F491168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1171 | 404 | 1165 | 66 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100958018|Ga0070707_1009580183 |
| Length | 80 |
| Sequence | MLAVCAAGDHKEMTMAQGTVKWFNDAKGYGFIKIENGEDVFVHYSAIQAQGFKSLAEGEQVEFEVTRGPKGLQAANVRKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 133 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 143 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 267 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 268 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 269 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 270 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 355 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 357 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 358 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 387 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.94 |
| Metatranscriptomes | 6.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.45 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 94.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001918 | 3300000546 | Bacteria | 2705 |
| 2 | JGI24736J21556_1028039 | 3300001904 | Bacteria | 871 |
| 3 | JGI24736J21556_1030037 | 3300001904 | Bacteria | 841 |
| 4 | JGI24737J22298_10123494 | 3300001990 | Bacteria | 765 |
| 5 | JGI24743J22301_10114563 | 3300001991 | Bacteria | 588 |
| 6 | rootH1_10182383 | 3300003316 | Bacteria | 1183 |
| 7 | Ga0058863_10059691 | 3300004799 | Bacteria | 1038 |
| 8 | Ga0058863_11915408 | 3300004799 | Bacteria | 667 |
| 9 | Ga0058861_11849805 | 3300004800 | Bacteria | 592 |
| 10 | Ga0058862_12494603 | 3300004803 | Bacteria | 536 |
| 11 | Ga0058862_12588482 | 3300004803 | Bacteria | 551 |
| 12 | Ga0058862_12631438 | 3300004803 | Bacteria | 677 |
| 13 | Ga0058862_12765549 | 3300004803 | Bacteria | 893 |
| 14 | Ga0065715_10398165 | 3300005293 | Bacteria | 885 |
| 15 | Ga0070658_10044029 | 3300005327 | Bacteria | 3606 |
| 16 | Ga0070658_10055014 | 3300005327 | Bacteria | 3232 |
| 17 | Ga0070658_10105049 | 3300005327 | Bacteria | 2337 |
| 18 | Ga0070658_10155085 | 3300005327 | Bacteria | 1919 |
| 19 | Ga0070658_10301321 | 3300005327 | Bacteria | 1367 |
| 20 | Ga0070658_10411026 | 3300005327 | Bacteria | 1163 |
| 21 | Ga0070658_10425153 | 3300005327 | Bacteria | 1143 |
| 22 | Ga0070658_10493093 | 3300005327 | Bacteria | 1058 |
| 23 | Ga0070658_11613765 | 3300005327 | Bacteria | 562 |
| 24 | Ga0070683_100013117 | 3300005329 | Bacteria | 7215 |
| 25 | Ga0070683_100025211 | 3300005329 | Bacteria | 5337 |
| 26 | Ga0070683_100042533 | 3300005329 | Bacteria | 4184 |
| 27 | Ga0070683_100082059 | 3300005329 | Bacteria | 3019 |
| 28 | Ga0070683_100320501 | 3300005329 | Bacteria | 1475 |
| 29 | Ga0070683_100392808 | 3300005329 | Bacteria | 1323 |
| 30 | Ga0070683_100484857 | 3300005329 | Bacteria | 1181 |
| 31 | Ga0070683_100849323 | 3300005329 | Bacteria | 875 |
| 32 | Ga0070683_100970720 | 3300005329 | Bacteria | 815 |
| 33 | Ga0070690_100386959 | 3300005330 | Bacteria | 1024 |
| 34 | Ga0070690_100881689 | 3300005330 | Bacteria | 699 |
| 35 | Ga0070690_101050582 | 3300005330 | Bacteria | 644 |
| 36 | Ga0070670_100000999 | 3300005331 | Bacteria | 22262 |
| 37 | Ga0070670_100004289 | 3300005331 | Bacteria | 11935 |
| 38 | Ga0070670_100012911 | 3300005331 | Bacteria | 7151 |
| 39 | Ga0070670_100828756 | 3300005331 | Bacteria | 836 |
| 40 | Ga0068869_100001465 | 3300005334 | Bacteria | 13968 |
| 41 | Ga0068869_100165197 | 3300005334 | Bacteria | 1726 |
| 42 | Ga0068869_100347333 | 3300005334 | Bacteria | 1208 |
| 43 | Ga0070666_10066988 | 3300005335 | Bacteria | 2438 |
| 44 | Ga0070666_10177794 | 3300005335 | Bacteria | 1492 |
| 45 | Ga0070666_10409718 | 3300005335 | Bacteria | 975 |
| 46 | Ga0070666_11020929 | 3300005335 | Bacteria | 614 |
| 47 | Ga0070680_100119720 | 3300005336 | Bacteria | 2197 |
| 48 | Ga0070680_100218497 | 3300005336 | Bacteria | 1608 |
| 49 | Ga0070680_100314598 | 3300005336 | Bacteria | 1329 |
| 50 | Ga0070680_101816758 | 3300005336 | Bacteria | 528 |
| 51 | Ga0070682_100316528 | 3300005337 | Bacteria | 1151 |
| 52 | Ga0070682_100464059 | 3300005337 | Bacteria | 973 |
| 53 | Ga0070682_100596215 | 3300005337 | Bacteria | 872 |
| 54 | Ga0070682_100634750 | 3300005337 | Bacteria | 848 |
| 55 | Ga0070682_100735844 | 3300005337 | Bacteria | 795 |
| 56 | Ga0070682_100959092 | 3300005337 | Bacteria | 707 |
| 57 | Ga0070682_101319662 | 3300005337 | Bacteria | 614 |
| 58 | Ga0068868_100000062 | 3300005338 | Bacteria | 61833 |
| 59 | Ga0070660_100075054 | 3300005339 | Bacteria | 2647 |
| 60 | Ga0070660_100390394 | 3300005339 | Bacteria | 1150 |
| 61 | Ga0070660_100756699 | 3300005339 | Bacteria | 816 |
| 62 | Ga0070689_100027354 | 3300005340 | Bacteria | 4299 |
| 63 | Ga0070689_101627254 | 3300005340 | Bacteria | 587 |
| 64 | Ga0070691_10007394 | 3300005341 | Bacteria | 5030 |
| 65 | Ga0070691_10063321 | 3300005341 | Bacteria | 1783 |
| 66 | Ga0070691_10850961 | 3300005341 | Bacteria | 559 |
| 67 | Ga0070661_100006060 | 3300005344 | Bacteria | 8319 |
| 68 | Ga0070661_100036188 | 3300005344 | Bacteria | 3589 |
| 69 | Ga0070661_100036965 | 3300005344 | Bacteria | 3551 |
| 70 | Ga0070661_100050157 | 3300005344 | Bacteria | 3054 |
| 71 | Ga0070661_100115431 | 3300005344 | Bacteria | 2008 |
| 72 | Ga0070661_100179525 | 3300005344 | Bacteria | 1610 |
| 73 | Ga0070661_101221537 | 3300005344 | Bacteria | 629 |
| 74 | Ga0070661_101827045 | 3300005344 | Bacteria | 516 |
| 75 | Ga0070692_10027487 | 3300005345 | Bacteria | 2820 |
| 76 | Ga0070669_100019209 | 3300005353 | Bacteria | 4882 |
| 77 | Ga0070675_100036857 | 3300005354 | Bacteria | 3982 |
| 78 | Ga0070671_100000449 | 3300005355 | Bacteria | 28636 |
| 79 | Ga0070671_100048626 | 3300005355 | Bacteria | 3527 |
| 80 | Ga0070671_100169593 | 3300005355 | Bacteria | 1846 |
| 81 | Ga0070671_100257519 | 3300005355 | Bacteria | 1483 |
| 82 | Ga0070671_100357250 | 3300005355 | Bacteria | 1247 |
| 83 | Ga0070671_100695442 | 3300005355 | Bacteria | 882 |
| 84 | Ga0070673_100021983 | 3300005364 | Bacteria | 4635 |
| 85 | Ga0070659_100281318 | 3300005366 | Bacteria | 1384 |
| 86 | Ga0070659_100455997 | 3300005366 | Bacteria | 1085 |
| 87 | Ga0070659_101271239 | 3300005366 | Bacteria | 652 |
| 88 | Ga0070667_100006315 | 3300005367 | Bacteria | 9848 |
| 89 | Ga0070667_100139922 | 3300005367 | Bacteria | 2119 |
| 90 | Ga0070667_100821901 | 3300005367 | Bacteria | 863 |
| 91 | Ga0070703_10040722 | 3300005406 | Bacteria | 1446 |
| 92 | Ga0070709_10395937 | 3300005434 | Bacteria | 1030 |
| 93 | Ga0070709_11128736 | 3300005434 | Bacteria | 628 |
| 94 | Ga0070714_100026455 | 3300005435 | Bacteria | 4795 |
| 95 | Ga0070714_100209394 | 3300005435 | Bacteria | 1787 |
| 96 | Ga0070714_100556983 | 3300005435 | Bacteria | 1098 |
| 97 | Ga0070714_101064370 | 3300005435 | Bacteria | 788 |
| 98 | Ga0070714_101144156 | 3300005435 | Bacteria | 759 |
| 99 | Ga0070714_101447180 | 3300005435 | Bacteria | 671 |
| 100 | Ga0070713_100085009 | 3300005436 | Bacteria | 2709 |
| 101 | Ga0070713_101109221 | 3300005436 | Bacteria | 765 |
| 102 | Ga0070713_102204929 | 3300005436 | Bacteria | 534 |
| 103 | Ga0070713_102330911 | 3300005436 | Bacteria | 518 |
| 104 | Ga0070710_10425345 | 3300005437 | Bacteria | 895 |
| 105 | Ga0070701_10015752 | 3300005438 | Bacteria | 3499 |
| 106 | Ga0070711_100848227 | 3300005439 | Bacteria | 777 |
| 107 | Ga0070711_100933639 | 3300005439 | Bacteria | 742 |
| 108 | Ga0070705_100052117 | 3300005440 | Bacteria | 2389 |
| 109 | Ga0070705_101061623 | 3300005440 | Bacteria | 661 |
| 110 | Ga0070694_100014714 | 3300005444 | Bacteria | 4901 |
| 111 | Ga0070694_100552417 | 3300005444 | Bacteria | 922 |
| 112 | Ga0070708_100011482 | 3300005445 | Bacteria | 7209 |
| 113 | Ga0070708_100011755 | 3300005445 | Bacteria | 7122 |
| 114 | Ga0070708_100033260 | 3300005445 | Bacteria | 4480 |
| 115 | Ga0070708_100760801 | 3300005445 | Bacteria | 911 |
| 116 | Ga0070663_100088079 | 3300005455 | Bacteria | 2295 |
| 117 | Ga0070663_100523255 | 3300005455 | Bacteria | 988 |
| 118 | Ga0070663_100934844 | 3300005455 | Bacteria | 751 |
| 119 | Ga0070678_100913243 | 3300005456 | Bacteria | 803 |
| 120 | Ga0070662_100197816 | 3300005457 | Bacteria | 1593 |
| 121 | Ga0070662_100745735 | 3300005457 | Bacteria | 830 |
| 122 | Ga0070662_101958812 | 3300005457 | Bacteria | 506 |
| 123 | Ga0070681_10014239 | 3300005458 | Bacteria | 7915 |
| 124 | Ga0070681_10046523 | 3300005458 | Bacteria | 4338 |
| 125 | Ga0070681_10073325 | 3300005458 | Bacteria | 3385 |
| 126 | Ga0070681_10129550 | 3300005458 | Bacteria | 2455 |
| 127 | Ga0070681_10536303 | 3300005458 | Bacteria | 1084 |
| 128 | Ga0070681_10862802 | 3300005458 | Bacteria | 823 |
| 129 | Ga0070681_10899288 | 3300005458 | Bacteria | 804 |
| 130 | Ga0068867_100066516 | 3300005459 | Bacteria | 2685 |
| 131 | Ga0070685_10039896 | 3300005466 | Bacteria | 2670 |
| 132 | Ga0070685_10231651 | 3300005466 | Bacteria | 1215 |
| 133 | Ga0070706_100014654 | 3300005467 | Bacteria | 7242 |
| 134 | Ga0070706_100020973 | 3300005467 | Bacteria | 6015 |
| 135 | Ga0070706_100885358 | 3300005467 | Bacteria | 825 |
| 136 | Ga0070707_100064848 | 3300005468 | Bacteria | 3508 |
| 137 | Ga0070707_100089460 | 3300005468 | Bacteria | 2979 |
| 138 | Ga0070707_100161513 | 3300005468 | Bacteria | 2183 |
| 139 | Ga0070707_100467975 | 3300005468 | Bacteria | 1222 |
| 140 | Ga0070707_100958018 | 3300005468 | Bacteria | 821 |
| 141 | Ga0070707_101321863 | 3300005468 | Bacteria | 687 |
| 142 | Ga0070698_100002346 | 3300005471 | Bacteria | 20934 |
| 143 | Ga0070698_100272359 | 3300005471 | Bacteria | 1624 |
| 144 | Ga0070698_100290461 | 3300005471 | Bacteria | 1566 |
| 145 | Ga0070698_102097484 | 3300005471 | Unclassified | 519 |
| 146 | Ga0070699_100005399 | 3300005518 | Bacteria | 11210 |
| 147 | Ga0070699_100055223 | 3300005518 | Bacteria | 3439 |
| 148 | Ga0070699_100113371 | 3300005518 | Bacteria | 2382 |
| 149 | Ga0070699_100400632 | 3300005518 | Bacteria | 1241 |
| 150 | Ga0070699_101159816 | 3300005518 | Bacteria | 709 |
| 151 | Ga0070679_100016264 | 3300005530 | Bacteria | 7168 |
| 152 | Ga0070679_100268992 | 3300005530 | Bacteria | 1659 |
| 153 | Ga0070679_100290012 | 3300005530 | Bacteria | 1588 |
| 154 | Ga0070679_102155034 | 3300005530 | Bacteria | 507 |
| 155 | Ga0070684_100002801 | 3300005535 | Bacteria | 12923 |
| 156 | Ga0070684_100023567 | 3300005535 | Bacteria | 5152 |
| 157 | Ga0070684_100028010 | 3300005535 | Bacteria | 4762 |
| 158 | Ga0070684_100032735 | 3300005535 | Bacteria | 4434 |
| 159 | Ga0070684_100057304 | 3300005535 | Bacteria | 3402 |
| 160 | Ga0070684_100063659 | 3300005535 | Bacteria | 3234 |
| 161 | Ga0070684_100150795 | 3300005535 | Bacteria | 2106 |
| 162 | Ga0070684_100367432 | 3300005535 | Bacteria | 1324 |
| 163 | Ga0070684_101189661 | 3300005535 | Bacteria | 717 |
| 164 | Ga0070697_100012687 | 3300005536 | Bacteria | 6600 |
| 165 | Ga0070697_100021509 | 3300005536 | Bacteria | 5111 |
| 166 | Ga0070697_100023655 | 3300005536 | Bacteria | 4887 |
| 167 | Ga0070697_100231193 | 3300005536 | Bacteria | 1577 |
| 168 | Ga0070697_100461554 | 3300005536 | Bacteria | 1107 |
| 169 | Ga0070697_101787216 | 3300005536 | Bacteria | 550 |
| 170 | Ga0068853_100000080 | 3300005539 | Bacteria | 66513 |
| 171 | Ga0068853_100024183 | 3300005539 | Bacteria | 5092 |
| 172 | Ga0068853_100070812 | 3300005539 | Bacteria | 3036 |
| 173 | Ga0068853_100087352 | 3300005539 | Bacteria | 2736 |
| 174 | Ga0068853_100253471 | 3300005539 | Bacteria | 1616 |
| 175 | Ga0068853_101237029 | 3300005539 | Bacteria | 721 |
| 176 | Ga0068853_101699466 | 3300005539 | Bacteria | 612 |
| 177 | Ga0068853_101936006 | 3300005539 | Bacteria | 572 |
| 178 | Ga0070672_100024224 | 3300005543 | Bacteria | 4482 |
| 179 | Ga0070672_100627845 | 3300005543 | Bacteria | 937 |
| 180 | Ga0070672_100678709 | 3300005543 | Bacteria | 901 |
| 181 | Ga0070686_101250524 | 3300005544 | Bacteria | 618 |
| 182 | Ga0070686_101460735 | 3300005544 | Bacteria | 575 |
| 183 | Ga0070695_100007587 | 3300005545 | Bacteria | 6427 |
| 184 | Ga0070695_100223253 | 3300005545 | Bacteria | 1358 |
| 185 | Ga0070696_100076522 | 3300005546 | Bacteria | 2363 |
| 186 | Ga0070696_100090784 | 3300005546 | Bacteria | 2174 |
| 187 | Ga0070696_100277990 | 3300005546 | Bacteria | 1275 |
| 188 | Ga0070696_100354728 | 3300005546 | Bacteria | 1137 |
| 189 | Ga0070696_101249051 | 3300005546 | Bacteria | 629 |
| 190 | Ga0070693_100337701 | 3300005547 | Bacteria | 1027 |
| 191 | Ga0070693_100454649 | 3300005547 | Bacteria | 899 |
| 192 | Ga0070693_100847890 | 3300005547 | Bacteria | 681 |
| 193 | Ga0070693_100973592 | 3300005547 | Bacteria | 640 |
| 194 | Ga0070665_100321539 | 3300005548 | Bacteria | 1551 |
| 195 | Ga0070665_100339679 | 3300005548 | Bacteria | 1506 |
| 196 | Ga0070665_100473829 | 3300005548 | Bacteria | 1263 |
| 197 | Ga0070665_100917769 | 3300005548 | Bacteria | 888 |
| 198 | Ga0070704_100128158 | 3300005549 | Bacteria | 1962 |
| 199 | Ga0070704_100187330 | 3300005549 | Bacteria | 1660 |
| 200 | Ga0070704_100344476 | 3300005549 | Bacteria | 1256 |
| 201 | Ga0068855_100001109 | 3300005563 | Bacteria | 33489 |
| 202 | Ga0068855_100003174 | 3300005563 | Bacteria | 20121 |
| 203 | Ga0068855_100041627 | 3300005563 | Bacteria | 5445 |
| 204 | Ga0068855_100102955 | 3300005563 | Bacteria | 3285 |
| 205 | Ga0068855_100103010 | 3300005563 | Bacteria | 3284 |
| 206 | Ga0068855_100120956 | 3300005563 | Bacteria | 2996 |
| 207 | Ga0068855_100137239 | 3300005563 | Bacteria | 2789 |
| 208 | Ga0068855_100179892 | 3300005563 | Bacteria | 2391 |
| 209 | Ga0068855_100447526 | 3300005563 | Bacteria | 1410 |
| 210 | Ga0068855_101043463 | 3300005563 | Bacteria | 857 |
| 211 | Ga0070664_100044728 | 3300005564 | Bacteria | 3738 |
| 212 | Ga0070664_100116334 | 3300005564 | Bacteria | 2338 |
| 213 | Ga0070664_100233379 | 3300005564 | Bacteria | 1650 |
| 214 | Ga0070664_100463432 | 3300005564 | Bacteria | 1165 |
| 215 | Ga0068857_100000969 | 3300005577 | Bacteria | 21932 |
| 216 | Ga0068857_100001491 | 3300005577 | Bacteria | 18629 |
| 217 | Ga0068857_100004470 | 3300005577 | Bacteria | 11819 |
| 218 | Ga0068857_100007098 | 3300005577 | Bacteria | 9647 |
| 219 | Ga0068857_100026640 | 3300005577 | Bacteria | 5095 |
| 220 | Ga0068857_100058309 | 3300005577 | Bacteria | 3428 |
| 221 | Ga0068857_100166944 | 3300005577 | Bacteria | 1999 |
| 222 | Ga0068857_100177536 | 3300005577 | Bacteria | 1937 |
| 223 | Ga0068857_100268748 | 3300005577 | Bacteria | 1567 |
| 224 | Ga0068857_101269541 | 3300005577 | Bacteria | 714 |
| 225 | Ga0068857_102267715 | 3300005577 | Bacteria | 533 |
| 226 | Ga0068854_100063256 | 3300005578 | Bacteria | 2685 |
| 227 | Ga0068854_100354129 | 3300005578 | Bacteria | 1202 |
| 228 | Ga0068854_100396266 | 3300005578 | Bacteria | 1141 |
| 229 | Ga0068856_100001717 | 3300005614 | Bacteria | 22914 |
| 230 | Ga0068856_100022866 | 3300005614 | Bacteria | 6080 |
| 231 | Ga0068856_100042723 | 3300005614 | Bacteria | 4460 |
| 232 | Ga0068856_100061299 | 3300005614 | Bacteria | 3715 |
| 233 | Ga0068856_100086253 | 3300005614 | Bacteria | 3119 |
| 234 | Ga0068856_100206324 | 3300005614 | Bacteria | 1980 |
| 235 | Ga0068856_100239317 | 3300005614 | Bacteria | 1830 |
| 236 | Ga0068856_100383861 | 3300005614 | Bacteria | 1424 |
| 237 | Ga0068856_100396687 | 3300005614 | Bacteria | 1399 |
| 238 | Ga0068856_100429245 | 3300005614 | Bacteria | 1342 |
| 239 | Ga0068856_100816416 | 3300005614 | Bacteria | 952 |
| 240 | Ga0068852_100000048 | 3300005616 | Bacteria | 87297 |
| 241 | Ga0068852_100000287 | 3300005616 | Bacteria | 33809 |
| 242 | Ga0068852_100000434 | 3300005616 | Bacteria | 27771 |
| 243 | Ga0068852_100049816 | 3300005616 | Bacteria | 3585 |
| 244 | Ga0068852_100194115 | 3300005616 | Bacteria | 1918 |
| 245 | Ga0068852_100256402 | 3300005616 | Bacteria | 1677 |
| 246 | Ga0068852_100324734 | 3300005616 | Bacteria | 1495 |
| 247 | Ga0068852_100464739 | 3300005616 | Bacteria | 1255 |
| 248 | Ga0068852_101462340 | 3300005616 | Bacteria | 706 |
| 249 | Ga0068852_102088059 | 3300005616 | Bacteria | 588 |
| 250 | Ga0068859_100010672 | 3300005617 | Bacteria | 9245 |
| 251 | Ga0068859_100012505 | 3300005617 | Bacteria | 8539 |
| 252 | Ga0068859_100024126 | 3300005617 | Bacteria | 6103 |
| 253 | Ga0068864_100001146 | 3300005618 | Bacteria | 22120 |
| 254 | Ga0068864_100001263 | 3300005618 | Bacteria | 21030 |
| 255 | Ga0068864_100013753 | 3300005618 | Bacteria | 6712 |
| 256 | Ga0068864_100020410 | 3300005618 | Bacteria | 5543 |
| 257 | Ga0068866_10150540 | 3300005718 | Bacteria | 1347 |
| 258 | Ga0068851_10006350 | 3300005834 | Bacteria | 5394 |
| 259 | Ga0068851_10006516 | 3300005834 | Bacteria | 5331 |
| 260 | Ga0068851_10029976 | 3300005834 | Bacteria | 2695 |
| 261 | Ga0068851_10084594 | 3300005834 | Bacteria | 1661 |
| 262 | Ga0068851_10106033 | 3300005834 | Bacteria | 1496 |
| 263 | Ga0068851_10110529 | 3300005834 | Bacteria | 1467 |
| 264 | Ga0068851_10253879 | 3300005834 | Bacteria | 998 |
| 265 | Ga0068851_10325847 | 3300005834 | Bacteria | 888 |
| 266 | Ga0068851_10709755 | 3300005834 | Bacteria | 619 |
| 267 | Ga0068870_10232748 | 3300005840 | Bacteria | 1133 |
| 268 | Ga0068863_100000893 | 3300005841 | Bacteria | 30063 |
| 269 | Ga0068863_100017111 | 3300005841 | Bacteria | 6955 |
| 270 | Ga0068863_101403674 | 3300005841 | Bacteria | 706 |
| 271 | Ga0068863_102228643 | 3300005841 | Bacteria | 558 |
| 272 | Ga0068858_100003222 | 3300005842 | Bacteria | 16289 |
| 273 | Ga0068858_100015396 | 3300005842 | Bacteria | 7193 |
| 274 | Ga0068858_100211044 | 3300005842 | Bacteria | 1837 |
| 275 | Ga0068858_100491666 | 3300005842 | Bacteria | 1185 |
| 276 | Ga0068858_100529515 | 3300005842 | Bacteria | 1140 |
| 277 | Ga0068860_100003815 | 3300005843 | Bacteria | 15503 |
| 278 | Ga0068860_100063187 | 3300005843 | Bacteria | 3517 |
| 279 | Ga0068860_100119698 | 3300005843 | Bacteria | 2521 |
| 280 | Ga0068860_101007921 | 3300005843 | Bacteria | 851 |
| 281 | Ga0068862_100022830 | 3300005844 | Bacteria | 5237 |
| 282 | Ga0068862_100089631 | 3300005844 | Bacteria | 2677 |
| 283 | Ga0068862_100168715 | 3300005844 | Bacteria | 1958 |
| 284 | Ga0068862_100231958 | 3300005844 | Bacteria | 1675 |
| 285 | Ga0070717_10405279 | 3300006028 | Bacteria | 1225 |
| 286 | Ga0070717_10674252 | 3300006028 | Bacteria | 939 |
| 287 | Ga0070717_10819360 | 3300006028 | Bacteria | 847 |
| 288 | Ga0070717_11508234 | 3300006028 | Bacteria | 610 |
| 289 | Ga0070717_11633752 | 3300006028 | Bacteria | 584 |
| 290 | Ga0075365_10672442 | 3300006038 | Bacteria | 732 |
| 291 | Ga0075368_10467820 | 3300006042 | Bacteria | 560 |
| 292 | Ga0075363_100507455 | 3300006048 | Bacteria | 717 |
| 293 | Ga0075364_10396621 | 3300006051 | Bacteria | 941 |
| 294 | Ga0070716_100000875 | 3300006173 | Bacteria | 12980 |
| 295 | Ga0070716_100290052 | 3300006173 | Bacteria | 1133 |
| 296 | Ga0070716_100440613 | 3300006173 | Bacteria | 947 |
| 297 | Ga0070716_100939741 | 3300006173 | Bacteria | 680 |
| 298 | Ga0070712_100108054 | 3300006175 | Bacteria | 2071 |
| 299 | Ga0070712_100528365 | 3300006175 | Bacteria | 992 |
| 300 | Ga0070712_101710314 | 3300006175 | Bacteria | 551 |
| 301 | Ga0097621_100006064 | 3300006237 | Bacteria | 8548 |
| 302 | Ga0097621_100007372 | 3300006237 | Bacteria | 7869 |
| 303 | Ga0097621_100065574 | 3300006237 | Bacteria | 2989 |
| 304 | Ga0097621_100317034 | 3300006237 | Bacteria | 1380 |
| 305 | Ga0097621_101899439 | 3300006237 | Bacteria | 568 |
| 306 | Ga0075370_10317233 | 3300006353 | Unclassified | 928 |
| 307 | Ga0068871_100033758 | 3300006358 | Bacteria | 4054 |
| 308 | Ga0068871_100076129 | 3300006358 | Bacteria | 2771 |
| 309 | Ga0075428_100509649 | 3300006844 | Unclassified | 1287 |
| 310 | Ga0075430_100153947 | 3300006846 | Bacteria | 1914 |
| 311 | Ga0075430_100168381 | 3300006846 | Bacteria | 1822 |
| 312 | Ga0075430_100327107 | 3300006846 | Unclassified | 1267 |
| 313 | Ga0075431_100100232 | 3300006847 | Unclassified | 2988 |
| 314 | Ga0075431_100477994 | 3300006847 | Bacteria | 1239 |
| 315 | Ga0075431_101650226 | 3300006847 | Bacteria | 598 |
| 316 | Ga0075431_101852621 | 3300006847 | Bacteria | 559 |
| 317 | Ga0075433_10045207 | 3300006852 | Bacteria | 3827 |
| 318 | Ga0075434_100014420 | 3300006871 | Bacteria | 7554 |
| 319 | Ga0075434_100600567 | 3300006871 | Bacteria | 1120 |
| 320 | Ga0075429_100003644 | 3300006880 | Bacteria | 13119 |
| 321 | Ga0075429_100144107 | 3300006880 | Bacteria | 2085 |
| 322 | Ga0075429_100249301 | 3300006880 | Bacteria | 1555 |
| 323 | Ga0075429_101842251 | 3300006880 | Bacteria | 525 |
| 324 | Ga0075436_100006247 | 3300006914 | Bacteria | 8162 |
| 325 | Ga0075436_100013593 | 3300006914 | Bacteria | 5576 |
| 326 | Ga0075436_100078134 | 3300006914 | Bacteria | 2293 |
| 327 | Ga0075436_100843507 | 3300006914 | Bacteria | 684 |
| 328 | Ga0075436_100848689 | 3300006914 | Bacteria | 682 |
| 329 | Ga0097620_100010672 | 3300006931 | Bacteria | 9245 |
| 330 | Ga0097620_100012505 | 3300006931 | Bacteria | 8539 |
| 331 | Ga0097620_100024125 | 3300006931 | Bacteria | 6103 |
| 332 | Ga0099794_10081387 | 3300007265 | Bacteria | 1598 |
| 333 | Ga0099794_10120220 | 3300007265 | Unclassified | 1321 |
| 334 | Ga0099794_10263097 | 3300007265 | Unclassified | 890 |
| 335 | Ga0099794_10275978 | 3300007265 | Bacteria | 869 |
| 336 | Ga0099794_10564609 | 3300007265 | Bacteria | 601 |
| 337 | Ga0099795_10011184 | 3300007788 | Bacteria | 2673 |
| 338 | Ga0099795_10132769 | 3300007788 | Bacteria | 1006 |
| 339 | Ga0105251_10254232 | 3300009011 | Bacteria | 792 |
| 340 | Ga0105240_10000171 | 3300009093 | Bacteria | 132604 |
| 341 | Ga0105240_10001982 | 3300009093 | Bacteria | 33815 |
| 342 | Ga0105240_10002781 | 3300009093 | Bacteria | 27658 |
| 343 | Ga0105240_10007773 | 3300009093 | Bacteria | 15499 |
| 344 | Ga0105240_10015305 | 3300009093 | Bacteria | 10436 |
| 345 | Ga0105240_10016664 | 3300009093 | Bacteria | 9940 |
| 346 | Ga0105240_10025954 | 3300009093 | Bacteria | 7695 |
| 347 | Ga0105240_10043806 | 3300009093 | Bacteria | 5691 |
| 348 | Ga0105240_10063462 | 3300009093 | Bacteria | 4595 |
| 349 | Ga0105240_10190101 | 3300009093 | Bacteria | 2415 |
| 350 | Ga0105240_10431344 | 3300009093 | Bacteria | 1479 |
| 351 | Ga0105240_10571313 | 3300009093 | Bacteria | 1248 |
| 352 | Ga0105240_11118129 | 3300009093 | Bacteria | 838 |
| 353 | Ga0105240_12794713 | 3300009093 | Bacteria | 502 |
| 354 | Ga0111539_10004706 | 3300009094 | Bacteria | 17835 |
| 355 | Ga0111539_10376644 | 3300009094 | Bacteria | 1652 |
| 356 | Ga0105245_10002006 | 3300009098 | Bacteria | 18471 |
| 357 | Ga0105247_10003806 | 3300009101 | Bacteria | 9771 |
| 358 | Ga0105247_10298439 | 3300009101 | Bacteria | 1117 |
| 359 | Ga0105247_11312183 | 3300009101 | Bacteria | 582 |
| 360 | Ga0114129_10011134 | 3300009147 | Bacteria | 12821 |
| 361 | Ga0114129_10036930 | 3300009147 | Bacteria | 6897 |
| 362 | Ga0114129_10344476 | 3300009147 | Bacteria | 1976 |
| 363 | Ga0114129_11160409 | 3300009147 | Unclassified | 964 |
| 364 | Ga0105243_10188046 | 3300009148 | Bacteria | 1801 |
| 365 | Ga0105243_11009074 | 3300009148 | Bacteria | 835 |
| 366 | Ga0105243_11531972 | 3300009148 | Bacteria | 691 |
| 367 | Ga0105241_10000839 | 3300009174 | Bacteria | 23314 |
| 368 | Ga0105241_10012928 | 3300009174 | Bacteria | 6122 |
| 369 | Ga0105241_10019234 | 3300009174 | Bacteria | 5035 |
| 370 | Ga0105241_10035824 | 3300009174 | Bacteria | 3733 |
| 371 | Ga0105241_10037495 | 3300009174 | Bacteria | 3652 |
| 372 | Ga0105241_10042761 | 3300009174 | Bacteria | 3430 |
| 373 | Ga0105241_10099036 | 3300009174 | Bacteria | 2314 |
| 374 | Ga0105241_10159953 | 3300009174 | Bacteria | 1850 |
| 375 | Ga0105241_10756905 | 3300009174 | Bacteria | 891 |
| 376 | Ga0105241_11419579 | 3300009174 | Bacteria | 665 |
| 377 | Ga0105242_10083613 | 3300009176 | Bacteria | 2674 |
| 378 | Ga0105242_10725101 | 3300009176 | Bacteria | 976 |
| 379 | Ga0105242_11158959 | 3300009176 | Bacteria | 790 |
| 380 | Ga0105242_12214656 | 3300009176 | Bacteria | 595 |
| 381 | Ga0105242_12504390 | 3300009176 | Bacteria | 564 |
| 382 | Ga0105248_10000596 | 3300009177 | Bacteria | 41138 |
| 383 | Ga0105248_10003599 | 3300009177 | Bacteria | 17176 |
| 384 | Ga0105248_10015061 | 3300009177 | Bacteria | 8515 |
| 385 | Ga0105248_10068520 | 3300009177 | Bacteria | 3983 |
| 386 | Ga0105248_10343810 | 3300009177 | Bacteria | 1679 |
| 387 | Ga0105248_10664090 | 3300009177 | Bacteria | 1176 |
| 388 | Ga0105248_12006431 | 3300009177 | Bacteria | 657 |
| 389 | Ga0105237_10055963 | 3300009545 | Bacteria | 3950 |
| 390 | Ga0105237_10150740 | 3300009545 | Bacteria | 2322 |
| 391 | Ga0105237_10252318 | 3300009545 | Bacteria | 1766 |
| 392 | Ga0105237_10573027 | 3300009545 | Bacteria | 1136 |
| 393 | Ga0105237_11260058 | 3300009545 | Bacteria | 746 |
| 394 | Ga0105237_11283793 | 3300009545 | Bacteria | 739 |
| 395 | Ga0105237_11353702 | 3300009545 | Bacteria | 718 |
| 396 | Ga0105237_11473978 | 3300009545 | Bacteria | 687 |
| 397 | Ga0105237_11585965 | 3300009545 | Bacteria | 661 |
| 398 | Ga0105237_12093664 | 3300009545 | Bacteria | 575 |
| 399 | Ga0105237_12176952 | 3300009545 | Bacteria | 564 |
| 400 | Ga0105238_10000307 | 3300009551 | Bacteria | 53404 |
| 401 | Ga0105238_10027293 | 3300009551 | Bacteria | 5816 |
| 402 | Ga0105238_10028178 | 3300009551 | Bacteria | 5722 |
| 403 | Ga0105238_10041389 | 3300009551 | Bacteria | 4666 |
| 404 | Ga0105238_10132405 | 3300009551 | Bacteria | 2472 |
| 405 | Ga0105238_10290797 | 3300009551 | Bacteria | 1616 |
| 406 | Ga0105238_10361141 | 3300009551 | Bacteria | 1442 |
| 407 | Ga0105238_10620429 | 3300009551 | Bacteria | 1090 |
| 408 | Ga0105238_10658902 | 3300009551 | Bacteria | 1057 |
| 409 | Ga0105238_10734731 | 3300009551 | Bacteria | 1000 |
| 410 | Ga0105238_10843112 | 3300009551 | Bacteria | 933 |
| 411 | Ga0105238_11952241 | 3300009551 | Bacteria | 620 |
| 412 | Ga0105249_10140115 | 3300009553 | Bacteria | 2318 |
| 413 | Ga0105249_10177926 | 3300009553 | Bacteria | 2067 |
| 414 | Ga0105249_10862565 | 3300009553 | Bacteria | 971 |
| 415 | Ga0105249_12359046 | 3300009553 | Bacteria | 605 |
| 416 | Ga0105239_10031350 | 3300010375 | Bacteria | 5847 |
| 417 | Ga0105239_10181295 | 3300010375 | Bacteria | 2356 |
| 418 | Ga0105239_10228383 | 3300010375 | Bacteria | 2088 |
| 419 | Ga0105239_10365880 | 3300010375 | Bacteria | 1629 |
| 420 | Ga0105239_10494873 | 3300010375 | Bacteria | 1390 |
| 421 | Ga0105239_10551755 | 3300010375 | Bacteria | 1312 |
| 422 | Ga0105239_10590261 | 3300010375 | Bacteria | 1267 |
| 423 | Ga0105239_10796409 | 3300010375 | Bacteria | 1083 |
| 424 | Ga0105239_10844089 | 3300010375 | Bacteria | 1050 |
| 425 | Ga0105239_10964983 | 3300010375 | Unclassified | 979 |
| 426 | Ga0105239_11328225 | 3300010375 | Bacteria | 830 |
| 427 | Ga0105239_11447103 | 3300010375 | Bacteria | 794 |
| 428 | Ga0105239_12275253 | 3300010375 | Bacteria | 631 |
| 429 | Ga0105239_12457728 | 3300010375 | Bacteria | 607 |
| 430 | Ga0105239_12599383 | 3300010375 | Bacteria | 590 |
| 431 | Ga0105239_13048090 | 3300010375 | Bacteria | 546 |
| 432 | Ga0105246_10003700 | 3300011119 | Bacteria | 9254 |
| 433 | Ga0105246_10714489 | 3300011119 | Bacteria | 880 |
| 434 | Ga0157323_1032888 | 3300012495 | Bacteria | 559 |
| 435 | Ga0157373_10058108 | 3300013100 | Bacteria | 2743 |
| 436 | Ga0157373_10165335 | 3300013100 | Bacteria | 1557 |
| 437 | Ga0157373_10214554 | 3300013100 | Bacteria | 1357 |
| 438 | Ga0157373_10223553 | 3300013100 | Bacteria | 1328 |
| 439 | Ga0157373_10386811 | 3300013100 | Bacteria | 1001 |
| 440 | Ga0157371_10123746 | 3300013102 | Bacteria | 1839 |
| 441 | Ga0157371_10246886 | 3300013102 | Bacteria | 1285 |
| 442 | Ga0157371_10863345 | 3300013102 | Bacteria | 685 |
| 443 | Ga0157371_11183759 | 3300013102 | Bacteria | 588 |
| 444 | Ga0157371_11432314 | 3300013102 | Bacteria | 537 |
| 445 | Ga0157370_10000019 | 3300013104 | Bacteria | 167473 |
| 446 | Ga0157370_10001105 | 3300013104 | Bacteria | 33807 |
| 447 | Ga0157370_10068416 | 3300013104 | Bacteria | 3356 |
| 448 | Ga0157370_10229185 | 3300013104 | Bacteria | 1720 |
| 449 | Ga0157370_10922186 | 3300013104 | Bacteria | 792 |
| 450 | Ga0157370_11475863 | 3300013104 | Bacteria | 611 |
| 451 | Ga0157369_10000081 | 3300013105 | Bacteria | 132630 |
| 452 | Ga0157369_10000707 | 3300013105 | Bacteria | 42987 |
| 453 | Ga0157369_10001102 | 3300013105 | Bacteria | 33815 |
| 454 | Ga0157369_10001710 | 3300013105 | Bacteria | 26709 |
| 455 | Ga0157369_10005051 | 3300013105 | Bacteria | 15449 |
| 456 | Ga0157369_10015409 | 3300013105 | Bacteria | 8617 |
| 457 | Ga0157369_10035363 | 3300013105 | Bacteria | 5478 |
| 458 | Ga0157369_10109048 | 3300013105 | Bacteria | 2944 |
| 459 | Ga0157369_10171732 | 3300013105 | Bacteria | 2284 |
| 460 | Ga0157369_10200435 | 3300013105 | Bacteria | 2095 |
| 461 | Ga0157369_10207146 | 3300013105 | Bacteria | 2056 |
| 462 | Ga0157369_10235339 | 3300013105 | Bacteria | 1914 |
| 463 | Ga0157369_10273410 | 3300013105 | Bacteria | 1760 |
| 464 | Ga0157369_10308414 | 3300013105 | Bacteria | 1646 |
| 465 | Ga0157369_10465537 | 3300013105 | Bacteria | 1309 |
| 466 | Ga0157369_11108996 | 3300013105 | Unclassified | 809 |
| 467 | Ga0157369_11201877 | 3300013105 | Bacteria | 774 |
| 468 | Ga0157369_11718652 | 3300013105 | Unclassified | 637 |
| 469 | Ga0157374_10009794 | 3300013296 | Bacteria | 8230 |
| 470 | Ga0157374_10015610 | 3300013296 | Bacteria | 6666 |
| 471 | Ga0157374_10114790 | 3300013296 | Bacteria | 2593 |
| 472 | Ga0157374_10171968 | 3300013296 | Bacteria | 2114 |
| 473 | Ga0157374_10194520 | 3300013296 | Bacteria | 1984 |
| 474 | Ga0157374_10288087 | 3300013296 | Bacteria | 1622 |
| 475 | Ga0157374_10359394 | 3300013296 | Bacteria | 1448 |
| 476 | Ga0157374_11192940 | 3300013296 | Bacteria | 782 |
| 477 | Ga0157374_11508860 | 3300013296 | Bacteria | 695 |
| 478 | Ga0157374_12251042 | 3300013296 | Bacteria | 572 |
| 479 | Ga0157378_10010577 | 3300013297 | Bacteria | 8063 |
| 480 | Ga0157378_10041010 | 3300013297 | Bacteria | 4107 |
| 481 | Ga0157378_10077857 | 3300013297 | Bacteria | 2990 |
| 482 | Ga0157378_10269610 | 3300013297 | Unclassified | 1637 |
| 483 | Ga0157378_10534356 | 3300013297 | Bacteria | 1176 |
| 484 | Ga0157378_10939253 | 3300013297 | Bacteria | 897 |
| 485 | Ga0157378_11938301 | 3300013297 | Bacteria | 638 |
| 486 | Ga0163162_10053860 | 3300013306 | Bacteria | 4045 |
| 487 | Ga0163162_10054763 | 3300013306 | Bacteria | 4013 |
| 488 | Ga0163162_10067634 | 3300013306 | Bacteria | 3623 |
| 489 | Ga0163162_10542947 | 3300013306 | Bacteria | 1291 |
| 490 | Ga0163162_11150717 | 3300013306 | Bacteria | 880 |
| 491 | Ga0163162_11391106 | 3300013306 | Bacteria | 798 |
| 492 | Ga0163162_11394282 | 3300013306 | Bacteria | 797 |
| 493 | Ga0163162_11540746 | 3300013306 | Bacteria | 758 |
| 494 | Ga0157372_10000058 | 3300013307 | Bacteria | 125647 |
| 495 | Ga0157372_10000816 | 3300013307 | Bacteria | 33749 |
| 496 | Ga0157372_10005348 | 3300013307 | Bacteria | 13643 |
| 497 | Ga0157372_10008671 | 3300013307 | Bacteria | 10800 |
| 498 | Ga0157372_10011989 | 3300013307 | Bacteria | 9232 |
| 499 | Ga0157372_10025712 | 3300013307 | Bacteria | 6404 |
| 500 | Ga0157372_10028222 | 3300013307 | Bacteria | 6124 |
| 501 | Ga0157372_10039761 | 3300013307 | Bacteria | 5192 |
| 502 | Ga0157372_10115154 | 3300013307 | Bacteria | 3082 |
| 503 | Ga0157372_10147772 | 3300013307 | Bacteria | 2711 |
| 504 | Ga0157372_10176183 | 3300013307 | Bacteria | 2475 |
| 505 | Ga0157372_10312382 | 3300013307 | Bacteria | 1829 |
| 506 | Ga0157372_10360199 | 3300013307 | Bacteria | 1695 |
| 507 | Ga0157372_10379563 | 3300013307 | Bacteria | 1647 |
| 508 | Ga0157372_10672920 | 3300013307 | Bacteria | 1205 |
| 509 | Ga0157372_10872702 | 3300013307 | Bacteria | 1044 |
| 510 | Ga0157372_11310889 | 3300013307 | Bacteria | 835 |
| 511 | Ga0157372_11394162 | 3300013307 | Bacteria | 808 |
| 512 | Ga0157372_11605953 | 3300013307 | Bacteria | 749 |
| 513 | Ga0157372_12076720 | 3300013307 | Bacteria | 653 |
| 514 | Ga0157372_12486033 | 3300013307 | Bacteria | 595 |
| 515 | Ga0157375_10019000 | 3300013308 | Bacteria | 6240 |
| 516 | Ga0157375_10550618 | 3300013308 | Bacteria | 1315 |
| 517 | Ga0157375_10817513 | 3300013308 | Bacteria | 1080 |
| 518 | Ga0157375_11828074 | 3300013308 | Bacteria | 720 |
| 519 | Ga0163163_10002835 | 3300014325 | Bacteria | 14651 |
| 520 | Ga0163163_10007035 | 3300014325 | Bacteria | 9884 |
| 521 | Ga0163163_10009352 | 3300014325 | Bacteria | 8750 |
| 522 | Ga0163163_10018944 | 3300014325 | Bacteria | 6457 |
| 523 | Ga0163163_10021461 | 3300014325 | Bacteria | 6095 |
| 524 | Ga0163163_10040007 | 3300014325 | Bacteria | 4577 |
| 525 | Ga0163163_10114203 | 3300014325 | Bacteria | 2731 |
| 526 | Ga0163163_11405551 | 3300014325 | Bacteria | 759 |
| 527 | Ga0157377_10148801 | 3300014745 | Bacteria | 1446 |
| 528 | Ga0157377_10353471 | 3300014745 | Bacteria | 987 |
| 529 | Ga0157379_10016500 | 3300014968 | Bacteria | 6496 |
| 530 | Ga0157379_10042808 | 3300014968 | Bacteria | 4044 |
| 531 | Ga0157379_10207680 | 3300014968 | Bacteria | 1772 |
| 532 | Ga0157379_11454251 | 3300014968 | Bacteria | 666 |
| 533 | Ga0157376_10004260 | 3300014969 | Bacteria | 9928 |
| 534 | Ga0157376_10021757 | 3300014969 | Bacteria | 4983 |
| 535 | Ga0157376_10060093 | 3300014969 | Bacteria | 3190 |
| 536 | Ga0157376_10096545 | 3300014969 | Bacteria | 2572 |
| 537 | Ga0157376_11031495 | 3300014969 | Bacteria | 846 |
| 538 | Ga0182007_10072624 | 3300015262 | Bacteria | 1127 |
| 539 | Ga0182007_10079996 | 3300015262 | Bacteria | 1072 |
| 540 | Ga0184598_103997 | 3300019182 | Bacteria | 523 |
| 541 | Ga0184601_144297 | 3300019183 | Bacteria | 502 |
| 542 | Ga0184600_105364 | 3300019190 | Bacteria | 676 |
| 543 | Ga0197907_10591539 | 3300020069 | Bacteria | 655 |
| 544 | Ga0197907_11373818 | 3300020069 | Bacteria | 1114 |
| 545 | Ga0206356_11755342 | 3300020070 | Bacteria | 1350 |
| 546 | Ga0206349_1982423 | 3300020075 | Bacteria | 582 |
| 547 | Ga0206355_1230271 | 3300020076 | Bacteria | 1105 |
| 548 | Ga0206355_1445323 | 3300020076 | Bacteria | 562 |
| 549 | Ga0206355_1641554 | 3300020076 | Bacteria | 522 |
| 550 | Ga0206351_10682782 | 3300020077 | Bacteria | 574 |
| 551 | Ga0206351_10823189 | 3300020077 | Bacteria | 792 |
| 552 | Ga0206352_10040263 | 3300020078 | Bacteria | 1004 |
| 553 | Ga0206352_10336565 | 3300020078 | Bacteria | 747 |
| 554 | Ga0206352_10462609 | 3300020078 | Bacteria | 834 |
| 555 | Ga0206350_11050674 | 3300020080 | Bacteria | 719 |
| 556 | Ga0206350_11481399 | 3300020080 | Bacteria | 841 |
| 557 | Ga0206354_11255018 | 3300020081 | Bacteria | 523 |
| 558 | Ga0206353_10188743 | 3300020082 | Bacteria | 525 |
| 559 | Ga0206353_10774232 | 3300020082 | Bacteria | 1102 |
| 560 | Ga0206353_11141441 | 3300020082 | Bacteria | 587 |
| 561 | Ga0206353_11692888 | 3300020082 | Bacteria | 524 |
| 562 | Ga0154015_1084318 | 3300020610 | Bacteria | 1013 |
| 563 | Ga0154015_1647532 | 3300020610 | Bacteria | 654 |
| 564 | Ga0213872_10007421 | 3300021361 | Bacteria | 5395 |
| 565 | Ga0213874_10011550 | 3300021377 | Bacteria | 2241 |
| 566 | Ga0224712_10242302 | 3300022467 | Bacteria | 831 |
| 567 | Ga0224712_10296094 | 3300022467 | Bacteria | 756 |
| 568 | Ga0224569_100005 | 3300022732 | Bacteria | 13434 |
| 569 | Ga0224571_100019 | 3300022734 | Bacteria | 4903 |
| 570 | Ga0224572_1002797 | 3300024225 | Bacteria | 2872 |
| 571 | Ga0228598_1000158 | 3300024227 | Bacteria | 11923 |
| 572 | Ga0209233_1076817 | 3300025261 | Bacteria | 604 |
| 573 | Ga0207656_10025114 | 3300025321 | Bacteria | 2417 |
| 574 | Ga0207656_10037417 | 3300025321 | Bacteria | 2042 |
| 575 | Ga0207656_10041702 | 3300025321 | Bacteria | 1951 |
| 576 | Ga0207656_10053773 | 3300025321 | Bacteria | 1748 |
| 577 | Ga0207656_10125465 | 3300025321 | Unclassified | 1199 |
| 578 | Ga0207656_10152199 | 3300025321 | Bacteria | 1096 |
| 579 | Ga0207656_10174028 | 3300025321 | Bacteria | 1030 |
| 580 | Ga0207653_10025536 | 3300025885 | Bacteria | 1890 |
| 581 | Ga0207692_10354659 | 3300025898 | Bacteria | 905 |
| 582 | Ga0207642_10611080 | 3300025899 | Bacteria | 679 |
| 583 | Ga0207710_10000588 | 3300025900 | Bacteria | 21466 |
| 584 | Ga0207710_10003146 | 3300025900 | Bacteria | 7396 |
| 585 | Ga0207680_10117960 | 3300025903 | Bacteria | 1732 |
| 586 | Ga0207680_10400440 | 3300025903 | Bacteria | 970 |
| 587 | Ga0207680_11160758 | 3300025903 | Bacteria | 551 |
| 588 | Ga0207680_11173883 | 3300025903 | Bacteria | 548 |
| 589 | Ga0207647_10002966 | 3300025904 | Bacteria | 12765 |
| 590 | Ga0207647_10004432 | 3300025904 | Bacteria | 10405 |
| 591 | Ga0207647_10077713 | 3300025904 | Bacteria | 1995 |
| 592 | Ga0207647_10200990 | 3300025904 | Bacteria | 1153 |
| 593 | Ga0207647_10304595 | 3300025904 | Bacteria | 907 |
| 594 | Ga0207685_10410651 | 3300025905 | Bacteria | 696 |
| 595 | Ga0207699_10218508 | 3300025906 | Bacteria | 1300 |
| 596 | Ga0207643_10108112 | 3300025908 | Bacteria | 1636 |
| 597 | Ga0207643_10166603 | 3300025908 | Bacteria | 1328 |
| 598 | Ga0207705_10038112 | 3300025909 | Bacteria | 3440 |
| 599 | Ga0207705_10043220 | 3300025909 | Bacteria | 3237 |
| 600 | Ga0207705_10067892 | 3300025909 | Bacteria | 2581 |
| 601 | Ga0207705_10079141 | 3300025909 | Bacteria | 2393 |
| 602 | Ga0207705_10091806 | 3300025909 | Bacteria | 2224 |
| 603 | Ga0207705_10290082 | 3300025909 | Bacteria | 1253 |
| 604 | Ga0207684_10002399 | 3300025910 | Bacteria | 18956 |
| 605 | Ga0207684_10008061 | 3300025910 | Bacteria | 9401 |
| 606 | Ga0207684_10369518 | 3300025910 | Bacteria | 1234 |
| 607 | Ga0207654_10000206 | 3300025911 | Bacteria | 36317 |
| 608 | Ga0207654_10000297 | 3300025911 | Bacteria | 30110 |
| 609 | Ga0207654_10000359 | 3300025911 | Bacteria | 26847 |
| 610 | Ga0207654_10022335 | 3300025911 | Bacteria | 3374 |
| 611 | Ga0207654_10025493 | 3300025911 | Bacteria | 3190 |
| 612 | Ga0207654_10206174 | 3300025911 | Bacteria | 1297 |
| 613 | Ga0207654_10816642 | 3300025911 | Bacteria | 674 |
| 614 | Ga0207654_11078515 | 3300025911 | Bacteria | 585 |
| 615 | Ga0207707_10022424 | 3300025912 | Bacteria | 5520 |
| 616 | Ga0207707_10081738 | 3300025912 | Bacteria | 2820 |
| 617 | Ga0207707_10718019 | 3300025912 | Bacteria | 838 |
| 618 | Ga0207707_10780112 | 3300025912 | Bacteria | 797 |
| 619 | Ga0207707_11128413 | 3300025912 | Bacteria | 638 |
| 620 | Ga0207707_11303555 | 3300025912 | Bacteria | 583 |
| 621 | Ga0207695_10000030 | 3300025913 | Bacteria | 533735 |
| 622 | Ga0207695_10000115 | 3300025913 | Bacteria | 240394 |
| 623 | Ga0207695_10000292 | 3300025913 | Bacteria | 123721 |
| 624 | Ga0207695_10001293 | 3300025913 | Bacteria | 42467 |
| 625 | Ga0207695_10001801 | 3300025913 | Bacteria | 33823 |
| 626 | Ga0207695_10024299 | 3300025913 | Bacteria | 6821 |
| 627 | Ga0207695_10039759 | 3300025913 | Bacteria | 5052 |
| 628 | Ga0207695_10059231 | 3300025913 | Bacteria | 3972 |
| 629 | Ga0207695_10080227 | 3300025913 | Bacteria | 3305 |
| 630 | Ga0207695_10338825 | 3300025913 | Bacteria | 1392 |
| 631 | Ga0207695_10731028 | 3300025913 | Bacteria | 870 |
| 632 | Ga0207695_10914230 | 3300025913 | Bacteria | 757 |
| 633 | Ga0207695_11213165 | 3300025913 | Bacteria | 635 |
| 634 | Ga0207695_11523391 | 3300025913 | Bacteria | 549 |
| 635 | Ga0207671_10000047 | 3300025914 | Bacteria | 196307 |
| 636 | Ga0207671_10000376 | 3300025914 | Bacteria | 63349 |
| 637 | Ga0207671_10000503 | 3300025914 | Bacteria | 53115 |
| 638 | Ga0207671_10355186 | 3300025914 | Bacteria | 1162 |
| 639 | Ga0207671_10578413 | 3300025914 | Bacteria | 895 |
| 640 | Ga0207671_10654782 | 3300025914 | Bacteria | 836 |
| 641 | Ga0207671_11078163 | 3300025914 | Bacteria | 631 |
| 642 | Ga0207671_11265664 | 3300025914 | Bacteria | 575 |
| 643 | Ga0207671_11529080 | 3300025914 | Bacteria | 515 |
| 644 | Ga0207693_10151955 | 3300025915 | Bacteria | 1821 |
| 645 | Ga0207663_10371000 | 3300025916 | Bacteria | 1088 |
| 646 | Ga0207663_11272941 | 3300025916 | Bacteria | 592 |
| 647 | Ga0207660_10036090 | 3300025917 | Bacteria | 3436 |
| 648 | Ga0207660_10179686 | 3300025917 | Bacteria | 1643 |
| 649 | Ga0207660_10359216 | 3300025917 | Bacteria | 1168 |
| 650 | Ga0207660_10649458 | 3300025917 | Bacteria | 860 |
| 651 | Ga0207660_10799138 | 3300025917 | Bacteria | 770 |
| 652 | Ga0207660_11708150 | 3300025917 | Bacteria | 506 |
| 653 | Ga0207660_11735733 | 3300025917 | Bacteria | 502 |
| 654 | Ga0207657_10055732 | 3300025919 | Bacteria | 3413 |
| 655 | Ga0207657_10454039 | 3300025919 | Bacteria | 1005 |
| 656 | Ga0207657_10458444 | 3300025919 | Bacteria | 1000 |
| 657 | Ga0207649_10003968 | 3300025920 | Bacteria | 8067 |
| 658 | Ga0207649_10033554 | 3300025920 | Bacteria | 3068 |
| 659 | Ga0207649_10039732 | 3300025920 | Bacteria | 2854 |
| 660 | Ga0207649_10043161 | 3300025920 | Bacteria | 2755 |
| 661 | Ga0207649_11278902 | 3300025920 | Bacteria | 580 |
| 662 | Ga0207649_11334758 | 3300025920 | Bacteria | 567 |
| 663 | Ga0207652_10027895 | 3300025921 | Bacteria | 4709 |
| 664 | Ga0207652_10322810 | 3300025921 | Bacteria | 1394 |
| 665 | Ga0207652_10481105 | 3300025921 | Bacteria | 1118 |
| 666 | Ga0207652_11026017 | 3300025921 | Bacteria | 724 |
| 667 | Ga0207652_11041720 | 3300025921 | Bacteria | 718 |
| 668 | Ga0207652_11814326 | 3300025921 | Bacteria | 515 |
| 669 | Ga0207646_10021267 | 3300025922 | Bacteria | 5996 |
| 670 | Ga0207646_10087235 | 3300025922 | Bacteria | 2793 |
| 671 | Ga0207646_10145937 | 3300025922 | Bacteria | 2132 |
| 672 | Ga0207646_10812829 | 3300025922 | Bacteria | 832 |
| 673 | Ga0207646_10994821 | 3300025922 | Bacteria | 741 |
| 674 | Ga0207681_10023444 | 3300025923 | Bacteria | 3948 |
| 675 | Ga0207681_10341882 | 3300025923 | Bacteria | 1196 |
| 676 | Ga0207694_10000167 | 3300025924 | Bacteria | 67706 |
| 677 | Ga0207694_10000497 | 3300025924 | Bacteria | 35591 |
| 678 | Ga0207694_10000697 | 3300025924 | Bacteria | 30202 |
| 679 | Ga0207694_10172613 | 3300025924 | Bacteria | 1751 |
| 680 | Ga0207694_10251409 | 3300025924 | Bacteria | 1446 |
| 681 | Ga0207694_10272387 | 3300025924 | Bacteria | 1389 |
| 682 | Ga0207694_10347444 | 3300025924 | Bacteria | 1227 |
| 683 | Ga0207694_10416483 | 3300025924 | Bacteria | 1119 |
| 684 | Ga0207694_10447894 | 3300025924 | Unclassified | 1077 |
| 685 | Ga0207694_10477081 | 3300025924 | Bacteria | 1043 |
| 686 | Ga0207694_11508536 | 3300025924 | Bacteria | 567 |
| 687 | Ga0207694_11551868 | 3300025924 | Bacteria | 558 |
| 688 | Ga0207650_10000090 | 3300025925 | Bacteria | 118973 |
| 689 | Ga0207650_10004940 | 3300025925 | Bacteria | 9108 |
| 690 | Ga0207650_10008028 | 3300025925 | Bacteria | 7193 |
| 691 | Ga0207650_11636668 | 3300025925 | Bacteria | 546 |
| 692 | Ga0207659_10111305 | 3300025926 | Bacteria | 2082 |
| 693 | Ga0207659_10573328 | 3300025926 | Bacteria | 961 |
| 694 | Ga0207687_10000707 | 3300025927 | Bacteria | 22619 |
| 695 | Ga0207687_10004473 | 3300025927 | Bacteria | 9303 |
| 696 | Ga0207700_10118702 | 3300025928 | Bacteria | 2141 |
| 697 | Ga0207700_10171687 | 3300025928 | Bacteria | 1809 |
| 698 | Ga0207700_10225396 | 3300025928 | Bacteria | 1591 |
| 699 | Ga0207700_10907348 | 3300025928 | Bacteria | 788 |
| 700 | Ga0207700_11118698 | 3300025928 | Bacteria | 704 |
| 701 | Ga0207700_11922991 | 3300025928 | Bacteria | 518 |
| 702 | Ga0207664_10068696 | 3300025929 | Bacteria | 2847 |
| 703 | Ga0207664_10172892 | 3300025929 | Bacteria | 1850 |
| 704 | Ga0207664_10414229 | 3300025929 | Bacteria | 1200 |
| 705 | Ga0207664_10626290 | 3300025929 | Bacteria | 966 |
| 706 | Ga0207664_11135485 | 3300025929 | Bacteria | 698 |
| 707 | Ga0207664_11182020 | 3300025929 | Bacteria | 682 |
| 708 | Ga0207644_10011067 | 3300025931 | Bacteria | 5959 |
| 709 | Ga0207644_10026155 | 3300025931 | Bacteria | 4019 |
| 710 | Ga0207644_11693084 | 3300025931 | Bacteria | 530 |
| 711 | Ga0207690_10438378 | 3300025932 | Bacteria | 1048 |
| 712 | Ga0207690_11448091 | 3300025932 | Bacteria | 574 |
| 713 | Ga0207706_10309935 | 3300025933 | Bacteria | 1375 |
| 714 | Ga0207706_10815393 | 3300025933 | Bacteria | 792 |
| 715 | Ga0207686_10620172 | 3300025934 | Bacteria | 853 |
| 716 | Ga0207709_10105625 | 3300025935 | Bacteria | 1872 |
| 717 | Ga0207709_10869581 | 3300025935 | Bacteria | 731 |
| 718 | Ga0207670_10119215 | 3300025936 | Bacteria | 1915 |
| 719 | Ga0207704_10191130 | 3300025938 | Bacteria | 1489 |
| 720 | Ga0207704_10665001 | 3300025938 | Bacteria | 859 |
| 721 | Ga0207665_10000111 | 3300025939 | Bacteria | 53549 |
| 722 | Ga0207665_10109296 | 3300025939 | Bacteria | 1941 |
| 723 | Ga0207665_10316082 | 3300025939 | Bacteria | 1171 |
| 724 | Ga0207665_10627105 | 3300025939 | Bacteria | 841 |
| 725 | Ga0207691_10037179 | 3300025940 | Bacteria | 4510 |
| 726 | Ga0207691_11658093 | 3300025940 | Bacteria | 518 |
| 727 | Ga0207711_10001551 | 3300025941 | Bacteria | 21254 |
| 728 | Ga0207711_10015108 | 3300025941 | Bacteria | 6412 |
| 729 | Ga0207711_10022270 | 3300025941 | Bacteria | 5298 |
| 730 | Ga0207711_10950798 | 3300025941 | Bacteria | 798 |
| 731 | Ga0207689_10001472 | 3300025942 | Bacteria | 22548 |
| 732 | Ga0207689_10058806 | 3300025942 | Bacteria | 3162 |
| 733 | Ga0207689_10065263 | 3300025942 | Bacteria | 2994 |
| 734 | Ga0207661_10008793 | 3300025944 | Bacteria | 7226 |
| 735 | Ga0207661_10013851 | 3300025944 | Bacteria | 5894 |
| 736 | Ga0207661_10020092 | 3300025944 | Bacteria | 4988 |
| 737 | Ga0207661_10127022 | 3300025944 | Bacteria | 2179 |
| 738 | Ga0207661_10260181 | 3300025944 | Bacteria | 1545 |
| 739 | Ga0207661_10354944 | 3300025944 | Bacteria | 1323 |
| 740 | Ga0207661_10638177 | 3300025944 | Bacteria | 978 |
| 741 | Ga0207679_10004118 | 3300025945 | Bacteria | 9029 |
| 742 | Ga0207679_10050322 | 3300025945 | Bacteria | 3044 |
| 743 | Ga0207679_10053711 | 3300025945 | Bacteria | 2962 |
| 744 | Ga0207679_11209541 | 3300025945 | Bacteria | 693 |
| 745 | Ga0207667_10001336 | 3300025949 | Bacteria | 30925 |
| 746 | Ga0207667_10002403 | 3300025949 | Bacteria | 23441 |
| 747 | Ga0207667_10002664 | 3300025949 | Bacteria | 22067 |
| 748 | Ga0207667_10024876 | 3300025949 | Bacteria | 6565 |
| 749 | Ga0207667_10040027 | 3300025949 | Bacteria | 4990 |
| 750 | Ga0207667_10158526 | 3300025949 | Bacteria | 2328 |
| 751 | Ga0207667_10427487 | 3300025949 | Bacteria | 1347 |
| 752 | Ga0207667_10615428 | 3300025949 | Bacteria | 1094 |
| 753 | Ga0207667_10990505 | 3300025949 | Bacteria | 828 |
| 754 | Ga0207667_11401431 | 3300025949 | Bacteria | 672 |
| 755 | Ga0207651_10044357 | 3300025960 | Bacteria | 2975 |
| 756 | Ga0207712_10112929 | 3300025961 | Bacteria | 2041 |
| 757 | Ga0207640_10007046 | 3300025981 | Bacteria | 6189 |
| 758 | Ga0207640_10096947 | 3300025981 | Bacteria | 2057 |
| 759 | Ga0207640_10135791 | 3300025981 | Bacteria | 1785 |
| 760 | Ga0207640_10959901 | 3300025981 | Bacteria | 750 |
| 761 | Ga0207640_11479469 | 3300025981 | Bacteria | 610 |
| 762 | Ga0207658_10000076 | 3300025986 | Bacteria | 108585 |
| 763 | Ga0207658_10001070 | 3300025986 | Bacteria | 22181 |
| 764 | Ga0207658_10505324 | 3300025986 | Bacteria | 1077 |
| 765 | Ga0207658_10612754 | 3300025986 | Bacteria | 979 |
| 766 | Ga0207658_11851351 | 3300025986 | Bacteria | 550 |
| 767 | Ga0207677_10000052 | 3300026023 | Bacteria | 99952 |
| 768 | Ga0207677_10000055 | 3300026023 | Bacteria | 98214 |
| 769 | Ga0207677_10384170 | 3300026023 | Bacteria | 1186 |
| 770 | Ga0207677_11712607 | 3300026023 | Bacteria | 583 |
| 771 | Ga0207677_12176730 | 3300026023 | Bacteria | 516 |
| 772 | Ga0207703_10007880 | 3300026035 | Bacteria | 8424 |
| 773 | Ga0207703_10009922 | 3300026035 | Bacteria | 7471 |
| 774 | Ga0207703_10591702 | 3300026035 | Bacteria | 1049 |
| 775 | Ga0207703_10600440 | 3300026035 | Bacteria | 1041 |
| 776 | Ga0207703_10823369 | 3300026035 | Bacteria | 887 |
| 777 | Ga0207703_11013236 | 3300026035 | Bacteria | 797 |
| 778 | Ga0207639_10000107 | 3300026041 | Bacteria | 67097 |
| 779 | Ga0207639_10059439 | 3300026041 | Bacteria | 2944 |
| 780 | Ga0207639_10241487 | 3300026041 | Unclassified | 1571 |
| 781 | Ga0207639_10264192 | 3300026041 | Bacteria | 1507 |
| 782 | Ga0207639_10357570 | 3300026041 | Bacteria | 1306 |
| 783 | Ga0207639_10829943 | 3300026041 | Bacteria | 862 |
| 784 | Ga0207678_10046048 | 3300026067 | Bacteria | 3772 |
| 785 | Ga0207678_10071390 | 3300026067 | Bacteria | 2977 |
| 786 | Ga0207678_10517196 | 3300026067 | Bacteria | 1041 |
| 787 | Ga0207678_10818184 | 3300026067 | Bacteria | 823 |
| 788 | Ga0207678_11387184 | 3300026067 | Bacteria | 621 |
| 789 | Ga0207678_11689686 | 3300026067 | Bacteria | 556 |
| 790 | Ga0207702_10002652 | 3300026078 | Bacteria | 16796 |
| 791 | Ga0207702_10004569 | 3300026078 | Bacteria | 12264 |
| 792 | Ga0207702_10015108 | 3300026078 | Bacteria | 6402 |
| 793 | Ga0207702_10021369 | 3300026078 | Bacteria | 5358 |
| 794 | Ga0207702_10130442 | 3300026078 | Bacteria | 2261 |
| 795 | Ga0207702_10160985 | 3300026078 | Bacteria | 2050 |
| 796 | Ga0207702_10215121 | 3300026078 | Bacteria | 1788 |
| 797 | Ga0207702_10628458 | 3300026078 | Bacteria | 1055 |
| 798 | Ga0207702_10855614 | 3300026078 | Bacteria | 900 |
| 799 | Ga0207702_11020102 | 3300026078 | Bacteria | 821 |
| 800 | Ga0207641_10000694 | 3300026088 | Bacteria | 36241 |
| 801 | Ga0207641_10001842 | 3300026088 | Bacteria | 20372 |
| 802 | Ga0207641_10031063 | 3300026088 | Bacteria | 4428 |
| 803 | Ga0207648_11888125 | 3300026089 | Bacteria | 559 |
| 804 | Ga0207676_10002573 | 3300026095 | Bacteria | 12942 |
| 805 | Ga0207676_10004619 | 3300026095 | Bacteria | 9750 |
| 806 | Ga0207676_11280727 | 3300026095 | Bacteria | 727 |
| 807 | Ga0207674_10000840 | 3300026116 | Bacteria | 40031 |
| 808 | Ga0207674_10002679 | 3300026116 | Bacteria | 22218 |
| 809 | Ga0207674_10003714 | 3300026116 | Bacteria | 18637 |
| 810 | Ga0207674_10004127 | 3300026116 | Bacteria | 17570 |
| 811 | Ga0207674_10018373 | 3300026116 | Bacteria | 7600 |
| 812 | Ga0207674_10022509 | 3300026116 | Bacteria | 6766 |
| 813 | Ga0207674_10024242 | 3300026116 | Bacteria | 6486 |
| 814 | Ga0207674_10036924 | 3300026116 | Bacteria | 5085 |
| 815 | Ga0207674_10198809 | 3300026116 | Bacteria | 1954 |
| 816 | Ga0207674_10217646 | 3300026116 | Bacteria | 1858 |
| 817 | Ga0207674_11430623 | 3300026116 | Bacteria | 661 |
| 818 | Ga0207698_10000011 | 3300026142 | Bacteria | 260352 |
| 819 | Ga0207698_10000059 | 3300026142 | Bacteria | 76632 |
| 820 | Ga0207698_10000239 | 3300026142 | Bacteria | 34266 |
| 821 | Ga0207698_10036972 | 3300026142 | Bacteria | 3591 |
| 822 | Ga0207698_10038724 | 3300026142 | Bacteria | 3525 |
| 823 | Ga0207698_10057267 | 3300026142 | Bacteria | 3014 |
| 824 | Ga0207698_10091253 | 3300026142 | Bacteria | 2493 |
| 825 | Ga0207698_10889964 | 3300026142 | Bacteria | 897 |
| 826 | Ga0207698_12020430 | 3300026142 | Bacteria | 591 |
| 827 | Ga0207698_12664499 | 3300026142 | Bacteria | 509 |
| 828 | Ga0207698_12718232 | 3300026142 | Bacteria | 503 |
| 829 | Ga0209588_1000776 | 3300027671 | Bacteria | 8125 |
| 830 | Ga0209588_1248218 | 3300027671 | Bacteria | 544 |
| 831 | Ga0209813_10114637 | 3300027866 | Bacteria | 932 |
| 832 | Ga0207428_10000299 | 3300027907 | Bacteria | 65352 |
| 833 | Ga0265356_1005931 | 3300028017 | Bacteria | 1441 |
| 834 | Ga0268266_10007211 | 3300028379 | Bacteria | 10055 |
| 835 | Ga0268266_10373157 | 3300028379 | Bacteria | 1344 |
| 836 | Ga0268266_10427715 | 3300028379 | Bacteria | 1256 |
| 837 | Ga0268266_10461543 | 3300028379 | Bacteria | 1208 |
| 838 | Ga0268266_10644192 | 3300028379 | Bacteria | 1019 |
| 839 | Ga0268266_10688369 | 3300028379 | Bacteria | 985 |
| 840 | Ga0268265_10028181 | 3300028380 | Bacteria | 4019 |
| 841 | Ga0268265_10053823 | 3300028380 | Bacteria | 3050 |
| 842 | Ga0268265_10147657 | 3300028380 | Bacteria | 1978 |
| 843 | Ga0268265_10414234 | 3300028380 | Bacteria | 1249 |
| 844 | Ga0268264_10001263 | 3300028381 | Bacteria | 24024 |
| 845 | Ga0268264_11149932 | 3300028381 | Bacteria | 785 |
| 846 | Ga0268264_11271649 | 3300028381 | Bacteria | 746 |
| 847 | Ga0268264_11526328 | 3300028381 | Bacteria | 679 |
| 848 | Ga0265323_10043562 | 3300028653 | Bacteria | 1620 |
| 849 | Ga0265323_10085533 | 3300028653 | Unclassified | 1060 |
| 850 | Ga0265338_10263239 | 3300028800 | Bacteria | 1267 |
| 851 | Ga0265762_1004180 | 3300030760 | Bacteria | 2588 |
| 852 | Ga0265775_105134 | 3300030762 | Bacteria | 749 |
| 853 | Ga0265766_1019194 | 3300030863 | Bacteria | 553 |
| 854 | Ga0265777_102106 | 3300030877 | Bacteria | 1124 |
| 855 | Ga0265764_103914 | 3300030882 | Bacteria | 793 |
| 856 | Ga0265764_114819 | 3300030882 | Bacteria | 530 |
| 857 | Ga0265769_116386 | 3300030888 | Bacteria | 559 |
| 858 | Ga0265761_102203 | 3300030889 | Bacteria | 900 |
| 859 | Ga0265771_1016502 | 3300031010 | Bacteria | 603 |
| 860 | Ga0265774_105592 | 3300031011 | Bacteria | 553 |
| 861 | Ga0265779_109831 | 3300031043 | Bacteria | 579 |
| 862 | Ga0265760_10113032 | 3300031090 | Bacteria | 866 |
| 863 | Ga0265760_10185526 | 3300031090 | Bacteria | 697 |
| 864 | Ga0265330_10385663 | 3300031235 | Bacteria | 592 |
| 865 | Ga0265339_10251993 | 3300031249 | Bacteria | 854 |
| 866 | Ga0265316_10088468 | 3300031344 | Bacteria | 2365 |
| 867 | Ga0265316_10312576 | 3300031344 | Bacteria | 1143 |
| 868 | Ga0265316_10496870 | 3300031344 | Bacteria | 872 |
| 869 | Ga0307408_100015742 | 3300031548 | Bacteria | 5039 |
| 870 | Ga0316575_10411201 | 3300031665 | Bacteria | 581 |
| 871 | Ga0307405_10042021 | 3300031731 | Bacteria | 2780 |
| 872 | Ga0307413_10751178 | 3300031824 | Bacteria | 815 |
| 873 | Ga0307410_10006891 | 3300031852 | Bacteria | 6173 |
| 874 | Ga0307406_10688427 | 3300031901 | Bacteria | 852 |
| 875 | Ga0307407_10464666 | 3300031903 | Bacteria | 921 |
| 876 | Ga0307407_11710558 | 3300031903 | Bacteria | 501 |
| 877 | Ga0307412_10366635 | 3300031911 | Bacteria | 1162 |
| 878 | Ga0307412_10435107 | 3300031911 | Bacteria | 1076 |
| 879 | Ga0307409_100091567 | 3300031995 | Bacteria | 2492 |
| 880 | Ga0307409_100833547 | 3300031995 | Bacteria | 932 |
| 881 | Ga0307416_100012293 | 3300032002 | Bacteria | 5760 |
| 882 | Ga0307416_100339700 | 3300032002 | Bacteria | 1514 |
| 883 | Ga0307411_10002046 | 3300032005 | Bacteria | 8658 |
| 884 | Ga0307411_10650537 | 3300032005 | Bacteria | 912 |
| 885 | Ga0316053_110382 | 3300032120 | Bacteria | 648 |
| 886 | Ga0307415_100001842 | 3300032126 | Bacteria | 10401 |
| 887 | Ga0307415_100034041 | 3300032126 | Bacteria | 3312 |
| 888 | Ga0316583_10029718 | 3300032133 | Bacteria | 1948 |
| 889 | Ga0307510_10142569 | 3300033180 | Bacteria | 2036 |
| 890 | Ga0307510_10396785 | 3300033180 | Bacteria | 823 |
| 891 | Ga0316592_1087192 | 3300033524 | Unclassified | 712 |
| 892 | Ga0316587_1065459 | 3300033529 | Unclassified | 677 |
| 893 | Ga0373948_0023108 | 3300034817 | Bacteria | 1204 |
| 894 | Ga0373958_0097486 | 3300034819 | Bacteria | 686 |
| 895 | Ga0373960_0374122 | 3300035121 | Bacteria | 545 |
| 896 | Ga0373943_0339941 | 3300035170 | Bacteria | 859 |
| 897 | Ga0373943_0542642 | 3300035170 | Bacteria | 682 |
| 898 | Ga0373955_0564235 | 3300035172 | Bacteria | 697 |
| 899 | Ga0316574_0186022 | 3300035398 | Bacteria | 1336 |
| 900 | Ga0316574_0748797 | 3300035398 | Bacteria | 597 |
| 901 | Ga0373931_1245041 | 3300035691 | Bacteria | 510 |
| 902 | Ga0373933_0922133 | 3300035724 | Bacteria | 575 |
| 903 | Ga0373937_0261190 | 3300036401 | Bacteria | 1633 |
| 904 | Ga0373937_0293875 | 3300036401 | Bacteria | 1535 |
| 905 | Ga0373937_1345160 | 3300036401 | Bacteria | 662 |
| 906 | Ga0373937_1626959 | 3300036401 | Bacteria | 593 |
| 907 | Ga0265778_059849 | 3300036457 | Bacteria | 531 |
| 908 | Ga0373925_1162772 | 3300037068 | Bacteria | 634 |
| 909 | Ga0395899_0012994 | 3300037312 | Bacteria | 6371 |
| 910 | Ga0395900_0007414 | 3300037418 | Bacteria | 11335 |
| 911 | Ga0395900_0349337 | 3300037418 | Bacteria | 1453 |
| 912 | Ga0395900_0836116 | 3300037418 | Bacteria | 847 |
| 913 | Ga0395900_1085642 | 3300037418 | Bacteria | 718 |
| 914 | Ga0395900_1186080 | 3300037418 | Bacteria | 679 |
| 915 | Ga0395900_1205976 | 3300037418 | Bacteria | 672 |
| 916 | Ga0395905_0008077 | 3300037471 | Bacteria | 10394 |
| 917 | Ga0395905_0025215 | 3300037471 | Bacteria | 5608 |
| 918 | Ga0395905_0027436 | 3300037471 | Bacteria | 5370 |
| 919 | Ga0395905_0040790 | 3300037471 | Bacteria | 4355 |
| 920 | Ga0395905_0102839 | 3300037471 | Bacteria | 2682 |
| 921 | Ga0395901_0629557 | 3300038443 | Bacteria | 1079 |
| 922 | Ga0436365_0395743 | 3300039437 | Bacteria | 818 |
| 923 | Ga0436365_1543233 | 3300039437 | Bacteria | 961 |
| 924 | Ga0436361_0510228 | 3300039447 | Bacteria | 6614 |
| 925 | Ga0436361_0520510 | 3300039447 | Bacteria | 1898 |
| 926 | Ga0436363_1107256 | 3300039450 | Bacteria | 633 |
| 927 | Ga0436363_1532784 | 3300039450 | Bacteria | 4313 |
| 928 | Ga0436362_1101430 | 3300039453 | Bacteria | 666 |
| 929 | Ga0436362_1298094 | 3300039453 | Bacteria | 609 |
| 930 | Ga0439436_0258594 | 3300041404 | Bacteria | 506 |
| 931 | Ga0451791_0865225 | 3300041451 | Bacteria | 687 |
| 932 | Ga0439433_0038011 | 3300041999 | Bacteria | 1115 |
| 933 | Ga0439441_025853 | 3300042001 | Bacteria | 1111 |
| 934 | Ga0439448_0137098 | 3300042005 | Bacteria | 846 |
| 935 | Ga0439448_0219088 | 3300042005 | Bacteria | 669 |
| 936 | Ga0439448_0283232 | 3300042005 | Bacteria | 587 |
| 937 | Ga0439449_0002082 | 3300042007 | Bacteria | 7864 |
| 938 | Ga0450923_053088 | 3300042125 | Bacteria | 874 |
| 939 | Ga0439446_0329524 | 3300042156 | Bacteria | 541 |
| 940 | Ga0451577_0000818 | 3300042876 | Bacteria | 46723 |
| 941 | Ga0451577_0006524 | 3300042876 | Bacteria | 11614 |
| 942 | Ga0451577_0024652 | 3300042876 | Bacteria | 5470 |
| 943 | Ga0451577_0255218 | 3300042876 | Bacteria | 1587 |
| 944 | Ga0451577_0737630 | 3300042876 | Bacteria | 891 |
| 945 | Ga0453683_0016561 | 3300044673 | Bacteria | 4756 |
| 946 | Ga0453683_0107458 | 3300044673 | Bacteria | 1754 |
| 947 | Ga0453683_0185002 | 3300044673 | Bacteria | 1322 |
| 948 | Ga0453683_0367380 | 3300044673 | Bacteria | 925 |
| 949 | Ga0453683_0410522 | 3300044673 | Bacteria | 873 |
| 950 | Ga0453683_0768716 | 3300044673 | Bacteria | 633 |
| 951 | Ga0466963_0025542 | 3300044694 | Bacteria | 3768 |
| 952 | Ga0466963_0036270 | 3300044694 | Bacteria | 3215 |
| 953 | Ga0466963_0038283 | 3300044694 | Bacteria | 3135 |
| 954 | Ga0453684_0000803 | 3300044712 | Bacteria | 107106 |
| 955 | Ga0453684_0036556 | 3300044712 | Bacteria | 6767 |
| 956 | Ga0453684_0055242 | 3300044712 | Bacteria | 5164 |
| 957 | Ga0453684_0408943 | 3300044712 | Bacteria | 1518 |
| 958 | Ga0453684_0831858 | 3300044712 | Bacteria | 993 |
| 959 | Ga0453684_2033838 | 3300044712 | Bacteria | 578 |
| 960 | Ga0453684_2066447 | 3300044712 | Bacteria | 572 |
| 961 | Ga0453684_2316097 | 3300044712 | Bacteria | 534 |
| 962 | Ga0466971_0322344 | 3300044719 | Bacteria | 745 |
| 963 | Ga0466959_0141489 | 3300045049 | Bacteria | 1700 |
| 964 | Ga0466959_0851990 | 3300045049 | Bacteria | 609 |
| 965 | Ga0451576_0006949 | 3300045051 | Bacteria | 13705 |
| 966 | Ga0451576_0014212 | 3300045051 | Bacteria | 8872 |
| 967 | Ga0451576_0453443 | 3300045051 | Bacteria | 1346 |
| 968 | Ga0451576_0523969 | 3300045051 | Bacteria | 1245 |
| 969 | Ga0451576_1872935 | 3300045051 | Bacteria | 619 |
| 970 | Ga0466958_0558685 | 3300045836 | Bacteria | 744 |
| 971 | Ga0466958_0584301 | 3300045836 | Bacteria | 726 |
| 972 | Ga0466958_0730860 | 3300045836 | Bacteria | 645 |
| 973 | Ga0466967_0001802 | 3300045976 | Bacteria | 12845 |
| 974 | Ga0466967_0575472 | 3300045976 | Bacteria | 1110 |
| 975 | Ga0466967_1239922 | 3300045976 | Bacteria | 743 |
| 976 | Ga0466967_1339251 | 3300045976 | Bacteria | 713 |
| 977 | Ga0466967_1992178 | 3300045976 | Bacteria | 577 |
| 978 | Ga0495590_0086527 | 3300046457 | Bacteria | 1107 |
| 979 | Ga0495651_0046854 | 3300046462 | Bacteria | 3345 |
| 980 | Ga0495651_0764995 | 3300046462 | Bacteria | 598 |
| 981 | Ga0495653_0389928 | 3300046463 | Bacteria | 888 |
| 982 | Ga0495580_0363815 | 3300046472 | Bacteria | 979 |
| 983 | Ga0495582_0328891 | 3300046473 | Bacteria | 880 |
| 984 | Ga0495639_0298439 | 3300046475 | Unclassified | 803 |
| 985 | Ga0495664_0279670 | 3300046477 | Bacteria | 1008 |
| 986 | Ga0495583_0344635 | 3300046506 | Bacteria | 588 |
| 987 | Ga0495608_0884909 | 3300046511 | Bacteria | 523 |
| 988 | Ga0495628_0915778 | 3300046516 | Bacteria | 608 |
| 989 | Ga0495643_0115001 | 3300046522 | Bacteria | 1364 |
| 990 | Ga0495652_0071133 | 3300046529 | Bacteria | 2905 |
| 991 | Ga0495652_0673866 | 3300046529 | Bacteria | 698 |
| 992 | Ga0495652_1009449 | 3300046529 | Bacteria | 544 |
| 993 | Ga0495586_0368822 | 3300046535 | Bacteria | 825 |
| 994 | Ga0495587_0113471 | 3300046536 | Bacteria | 1555 |
| 995 | Ga0495587_0709367 | 3300046536 | Bacteria | 551 |
| 996 | Ga0495645_0000781 | 3300046543 | Bacteria | 21806 |
| 997 | Ga0495645_0018179 | 3300046543 | Bacteria | 5047 |
| 998 | Ga0495645_0550023 | 3300046543 | Bacteria | 715 |
| 999 | Ga0495668_0585856 | 3300046616 | Bacteria | 616 |
| 1000 | Ga0495625_0063040 | 3300046660 | Bacteria | 2619 |
| 1001 | Ga0495625_0892497 | 3300046660 | Bacteria | 510 |
| 1002 | Ga0495635_0161273 | 3300046663 | Bacteria | 1526 |
| 1003 | Ga0495635_0202143 | 3300046663 | Bacteria | 1347 |
| 1004 | Ga0495599_0625446 | 3300046678 | Bacteria | 625 |
| 1005 | Ga0495623_0061112 | 3300046679 | Bacteria | 2363 |
| 1006 | Ga0495623_0074604 | 3300046679 | Bacteria | 2108 |
| 1007 | Ga0495646_0009843 | 3300046680 | Bacteria | 6075 |
| 1008 | Ga0495646_0696448 | 3300046680 | Bacteria | 511 |
| 1009 | Ga0495669_0080159 | 3300046684 | Bacteria | 1498 |
| 1010 | Ga0495669_0398375 | 3300046684 | Bacteria | 667 |
| 1011 | Ga0495669_0563686 | 3300046684 | Bacteria | 554 |
| 1012 | Ga0495613_0430824 | 3300046689 | Bacteria | 896 |
| 1013 | Ga0495671_0466328 | 3300046692 | Bacteria | 603 |
| 1014 | Ga0495649_0149118 | 3300046694 | Bacteria | 1229 |
| 1015 | Ga0495600_0094647 | 3300046809 | Bacteria | 1948 |
| 1016 | Ga0495604_0062399 | 3300047317 | Bacteria | 2847 |
| 1017 | Ga0495604_0565507 | 3300047317 | Bacteria | 732 |
| 1018 | Ga0495674_0693285 | 3300047319 | Bacteria | 800 |
| 1019 | Ga0495674_1198836 | 3300047319 | Bacteria | 574 |
| 1020 | Ga0495680_0922660 | 3300047322 | Bacteria | 563 |
| 1021 | Ga0495683_0181532 | 3300047323 | Bacteria | 961 |
| 1022 | Ga0495687_131774 | 3300047443 | Bacteria | 883 |
| 1023 | Ga0495675_0100151 | 3300047444 | Bacteria | 1814 |
| 1024 | Ga0495684_0345310 | 3300047471 | Bacteria | 1058 |
| 1025 | Ga0495686_0476126 | 3300047472 | Bacteria | 660 |
| 1026 | Ga0495602_0256746 | 3300048088 | Bacteria | 1299 |
| 1027 | Ga0495602_0884772 | 3300048088 | Bacteria | 595 |
| 1028 | Ga0496100_1315938 | 3300048903 | Bacteria | 570 |
| 1029 | Ga0496101_0241415 | 3300048904 | Bacteria | 1406 |
| 1030 | Ga0496101_0697124 | 3300048904 | Bacteria | 802 |
| 1031 | Ga0496103_0195603 | 3300048906 | Bacteria | 1300 |
| 1032 | Ga0496104_0040556 | 3300048907 | Bacteria | 4364 |
| 1033 | Ga0496104_0468253 | 3300048907 | Bacteria | 1172 |
| 1034 | Ga0496104_1148873 | 3300048907 | Bacteria | 680 |
| 1035 | Ga0496105_0166346 | 3300048908 | Bacteria | 1809 |
| 1036 | Ga0496105_0202716 | 3300048908 | Bacteria | 1619 |
| 1037 | Ga0496108_0026741 | 3300048911 | Bacteria | 4763 |
| 1038 | Ga0496108_0046396 | 3300048911 | Bacteria | 3630 |
| 1039 | Ga0496108_0096729 | 3300048911 | Bacteria | 2515 |
| 1040 | Ga0496109_0015917 | 3300048912 | Bacteria | 6568 |
| 1041 | Ga0496109_0078800 | 3300048912 | Bacteria | 3034 |
| 1042 | Ga0496109_0791849 | 3300048912 | Bacteria | 886 |
| 1043 | Ga0496110_0043752 | 3300048913 | Bacteria | 3910 |
| 1044 | Ga0496110_1404128 | 3300048913 | Bacteria | 608 |
| 1045 | Ga0496111_0074367 | 3300048914 | Bacteria | 2475 |
| 1046 | Ga0496112_0014309 | 3300048915 | Bacteria | 7351 |
| 1047 | Ga0496112_0046437 | 3300048915 | Bacteria | 4259 |
| 1048 | Ga0496112_0065430 | 3300048915 | Bacteria | 3587 |
| 1049 | Ga0496112_0173153 | 3300048915 | Bacteria | 2124 |
| 1050 | Ga0496112_0490605 | 3300048915 | Bacteria | 1164 |
| 1051 | Ga0496113_0016771 | 3300048916 | Bacteria | 5067 |
| 1052 | Ga0496113_0133902 | 3300048916 | Bacteria | 1946 |
| 1053 | Ga0496113_0824391 | 3300048916 | Bacteria | 736 |
| 1054 | Ga0496115_0434388 | 3300048918 | Bacteria | 1062 |
| 1055 | Ga0496115_0507457 | 3300048918 | Bacteria | 968 |
| 1056 | Ga0496115_0607701 | 3300048918 | Bacteria | 869 |
| 1057 | Ga0496119_0065543 | 3300048922 | Bacteria | 2151 |
| 1058 | Ga0496121_0828943 | 3300048924 | Bacteria | 540 |
| 1059 | Ga0496126_0016529 | 3300048929 | Bacteria | 7375 |
| 1060 | Ga0496126_0830221 | 3300048929 | Bacteria | 707 |
| 1061 | Ga0495682_0057786 | 3300049460 | Bacteria | 1404 |
| 1062 | Ga0495682_0060129 | 3300049460 | Bacteria | 1372 |
| 1063 | Ga0501299_115708 | 3300049522 | Bacteria | 640 |
| 1064 | Ga0501312_101970 | 3300049528 | Bacteria | 539 |
| 1065 | Ga0501031_0033208 | 3300049568 | Bacteria | 3365 |
| 1066 | Ga0501032_0178813 | 3300049569 | Bacteria | 1389 |
| 1067 | Ga0501033_0023595 | 3300049570 | Bacteria | 4639 |
| 1068 | Ga0501034_0008002 | 3300049571 | Bacteria | 11220 |
| 1069 | Ga0501034_0070152 | 3300049571 | Bacteria | 3516 |
| 1070 | Ga0501036_0003425 | 3300049572 | Bacteria | 12671 |
| 1071 | Ga0501037_0013264 | 3300049573 | Bacteria | 6072 |
| 1072 | Ga0501038_0002323 | 3300049574 | Bacteria | 17693 |
| 1073 | Ga0501039_0803183 | 3300049575 | Bacteria | 734 |
| 1074 | Ga0501040_0089120 | 3300049576 | Bacteria | 2143 |
| 1075 | Ga0501040_0123045 | 3300049576 | Bacteria | 1821 |
| 1076 | Ga0501043_0002319 | 3300049579 | Bacteria | 16114 |
| 1077 | Ga0501046_0000106 | 3300049580 | Bacteria | 89243 |
| 1078 | Ga0501046_0751997 | 3300049580 | Bacteria | 685 |
| 1079 | Ga0501047_0005612 | 3300049581 | Bacteria | 11819 |
| 1080 | Ga0501048_0318447 | 3300049582 | Bacteria | 1108 |
| 1081 | Ga0501048_0766391 | 3300049582 | Bacteria | 693 |
| 1082 | Ga0501068_0020211 | 3300049584 | Bacteria | 3877 |
| 1083 | Ga0501070_0078873 | 3300049586 | Bacteria | 2725 |
| 1084 | Ga0501072_0386191 | 3300049588 | Bacteria | 1111 |
| 1085 | Ga0501072_0907653 | 3300049588 | Bacteria | 688 |
| 1086 | Ga0501073_0054288 | 3300049589 | Bacteria | 2805 |
| 1087 | Ga0501073_0086276 | 3300049589 | Bacteria | 2183 |
| 1088 | Ga0501073_1202418 | 3300049589 | Bacteria | 520 |
| 1089 | Ga0501075_0102505 | 3300049591 | Bacteria | 2174 |
| 1090 | Ga0501076_0931127 | 3300049592 | Bacteria | 716 |
| 1091 | Ga0501077_0049431 | 3300049593 | Bacteria | 2673 |
| 1092 | Ga0501201_047589 | 3300049651 | Bacteria | 529 |
| 1093 | Ga0501250_086311 | 3300049680 | Bacteria | 541 |
| 1094 | Ga0501256_037217 | 3300049685 | Bacteria | 568 |
| 1095 | Ga0501221_112417 | 3300049704 | Bacteria | 688 |
| 1096 | Ga0501234_086055 | 3300049707 | Bacteria | 559 |
| 1097 | Ga0501245_125581 | 3300049708 | Bacteria | 545 |
| 1098 | Ga0501079_0617540 | 3300049741 | Bacteria | 853 |
| 1099 | Ga0501079_1165152 | 3300049741 | Bacteria | 607 |
| 1100 | Ga0501080_0210836 | 3300049742 | Bacteria | 1780 |
| 1101 | Ga0501274_012480 | 3300049771 | Bacteria | 805 |
| 1102 | Ga0501035_0202103 | 3300049822 | Bacteria | 1703 |
| 1103 | Ga0501035_0218211 | 3300049822 | Bacteria | 1629 |
| 1104 | Ga0501044_0080457 | 3300049823 | Bacteria | 3300 |
| 1105 | Ga0501044_0558274 | 3300049823 | Bacteria | 1041 |
| 1106 | Ga0501045_0073634 | 3300049824 | Bacteria | 2516 |
| 1107 | nmdc:mga03683_624164_c1 | 3300050489 | Unclassified | 529 |
| 1108 | nmdc:mga03n38_589969_c1 | 3300050490 | Archaea | 632 |
| 1109 | nmdc:mga00v17_1052193_c1 | 3300050491 | Bacteria | 511 |
| 1110 | nmdc:mga0yw44_861963_c1 | 3300050492 | Bacteria | 615 |
| 1111 | nmdc:mga06z11_611662_c1 | 3300050494 | Bacteria | 663 |
| 1112 | nmdc:mga04h51_112783_c1 | 3300050495 | Bacteria | 1004 |
| 1113 | nmdc:mga07m45_409555_c1 | 3300050496 | Bacteria | 787 |
| 1114 | nmdc:mga05p37_351502_c1 | 3300050507 | Bacteria | 1735 |
| 1115 | nmdc:mga05p37_625783_c1 | 3300050507 | Bacteria | 1210 |
| 1116 | nmdc:mga05p37_929_c1 | 3300050507 | Bacteria | 32527 |
| 1117 | nmdc:mga09592_1426664_c1 | 3300050508 | Bacteria | 565 |
| 1118 | nmdc:mga09592_1708180_c1 | 3300050508 | Bacteria | 507 |
| 1119 | nmdc:mga09592_779_c1 | 3300050508 | Bacteria | 24616 |
| 1120 | nmdc:mga0qj67_309711_c1 | 3300050509 | Unclassified | 1279 |
| 1121 | nmdc:mga06r32_1350870_c1 | 3300050510 | Bacteria | 655 |
| 1122 | nmdc:mga06r32_451439_c1 | 3300050510 | Bacteria | 1265 |
| 1123 | nmdc:mga06r32_570712_c1 | 3300050510 | Bacteria | 1104 |
| 1124 | nmdc:mga06r32_593560_c1 | 3300050510 | Bacteria | 1079 |
| 1125 | nmdc:mga08y16_19633_c1 | 3300050511 | Bacteria | 7127 |
| 1126 | nmdc:mga08y16_625177_c1 | 3300050511 | Bacteria | 1083 |
| 1127 | nmdc:mga0n895_2112276_c1 | 3300050512 | Bacteria | 520 |
| 1128 | nmdc:mga0n895_4165_c1 | 3300050512 | Bacteria | 11803 |
| 1129 | nmdc:mga0rr50_1757640_c1 | 3300050513 | Bacteria | 522 |
| 1130 | nmdc:mga0rr50_227413_c2 | 3300050513 | Bacteria | 1154 |
| 1131 | nmdc:mga0rr50_254447_c1 | 3300050513 | Bacteria | 1459 |
| 1132 | nmdc:mga08x19_1150071_c1 | 3300050514 | Bacteria | 551 |
| 1133 | nmdc:mga08x19_296333_c1 | 3300050514 | Bacteria | 1123 |
| 1134 | nmdc:mga08x19_532757_c1 | 3300050514 | Bacteria | 830 |
| 1135 | nmdc:mga08x19_77083_c1 | 3300050514 | Bacteria | 2183 |
| 1136 | nmdc:mga08x19_843806_c1 | 3300050514 | Bacteria | 651 |
| 1137 | nmdc:mga0a205_23561_c1 | 3300050515 | Bacteria | 5840 |
| 1138 | Ga0495601_0109528 | 3300053077 | Bacteria | 1788 |
| 1139 | Ga0495601_0337551 | 3300053077 | Bacteria | 980 |
| 1140 | Ga0500595_000032 | 3300053119 | Bacteria | 111447 |
| 1141 | Ga0500559_0555345 | 3300053136 | Bacteria | 523 |
| 1142 | Ga0501084_0141850 | 3300054114 | Bacteria | 2023 |
| 1143 | Ga0500661_001186 | 3300055283 | Bacteria | 4875 |
| 1144 | Ga0587066_055213 | 3300059490 | Bacteria | 795 |
| 1145 | Ga0587073_0156911 | 3300059492 | Bacteria | 649 |
| 1146 | Ga0587077_017890 | 3300059493 | Bacteria | 1213 |
| 1147 | Ga0587077_043834 | 3300059493 | Bacteria | 909 |
| 1148 | Ga0587077_256168 | 3300059493 | Bacteria | 508 |
| 1149 | Ga0587080_088305 | 3300059503 | Bacteria | 647 |
| 1150 | Ga0587082_087965 | 3300059504 | Bacteria | 658 |
| 1151 | Ga0587083_0139780 | 3300059505 | Bacteria | 644 |
| 1152 | Ga0587085_184512 | 3300059506 | Bacteria | 502 |
| 1153 | Ga0587088_079650 | 3300059508 | Bacteria | 699 |
| 1154 | Ga0587088_094395 | 3300059508 | Bacteria | 660 |
| 1155 | Ga0587089_079091 | 3300059509 | Bacteria | 570 |
| 1156 | Ga0587091_101168 | 3300059511 | Bacteria | 676 |
| 1157 | Ga0587109_187893 | 3300059624 | Bacteria | 532 |
| 1158 | Ga0587069_076152 | 3300059642 | Bacteria | 646 |
| 1159 | Ga0587079_134789 | 3300059647 | Unclassified | 624 |
| 1160 | Ga0587060_028550 | 3300060243 | Bacteria | 560 |
| 1161 | Ga0587071_195422 | 3300060344 | Bacteria | 527 |
| 1162 | Ga0587111_0000976 | 3300060346 | Bacteria | 3170 |
| 1163 | Ga0587111_0003253 | 3300060346 | Bacteria | 2287 |
| 1164 | Ga0466962_0718605 | 3300061719 | Bacteria | 513 |
| 1165 | Ga0530510_0002199 | 3300061734 | Bacteria | 13378 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_102097484 | Ga0070698_1020974841 | 65 |
| 2 | 3300006173 | Ga0070716_100000875 | Ga0070716_1000008752 | 65 |
| 3 | 3300006846 | Ga0075430_100168381 | Ga0075430_1001683813 | 65 |
| 4 | 3300006914 | Ga0075436_100013593 | Ga0075436_1000135934 | 65 |
| 5 | 3300007788 | Ga0099795_10011184 | Ga0099795_100111842 | 65 |
| 6 | 3300025939 | Ga0207665_10000111 | Ga0207665_1000011145 | 65 |
| 7 | 3300031665 | Ga0316575_10411201 | Ga0316575_104112011 | 65 |
| 8 | 3300032133 | Ga0316583_10029718 | Ga0316583_100297182 | 65 |
| 9 | 3300035398 | Ga0316574_0186022 | Ga0316574_0186022_680_877 | 65 |
| 10 | 3300035398 | Ga0316574_0748797 | Ga0316574_0748797_226_423 | 65 |
| 11 | 3300041404 | Ga0439436_0258594 | Ga0439436_0258594_39_236 | 65 |
| 12 | 3300041999 | Ga0439433_0038011 | Ga0439433_0038011_700_897 | 65 |
| 13 | 3300042007 | Ga0439449_0002082 | Ga0439449_0002082_2432_2629 | 65 |
| 14 | 3300050514 | nmdc:mga08x19_296333_c1 | nmdc:mga08x19_296333_c1_488_691 | 65 |
| 15 | 3300000546 | LJNas_1001918 | LJNas_10019182 | 66 |
| 16 | 3300001904 | JGI24736J21556_1028039 | JGI24736J21556_10280391 | 66 |
| 17 | 3300001904 | JGI24736J21556_1030037 | JGI24736J21556_10300372 | 66 |
| 18 | 3300001990 | JGI24737J22298_10123494 | JGI24737J22298_101234942 | 66 |
| 19 | 3300001991 | JGI24743J22301_10114563 | JGI24743J22301_101145632 | 66 |
| 20 | 3300003316 | rootH1_10182383 | rootH1_101823832 | 66 |
| 21 | 3300004799 | Ga0058863_10059691 | Ga0058863_100596911 | 66 |
| 22 | 3300004799 | Ga0058863_11915408 | Ga0058863_119154082 | 66 |
| 23 | 3300004800 | Ga0058861_11849805 | Ga0058861_118498051 | 66 |
| 24 | 3300004803 | Ga0058862_12494603 | Ga0058862_124946031 | 66 |
| 25 | 3300004803 | Ga0058862_12588482 | Ga0058862_125884821 | 66 |
| 26 | 3300004803 | Ga0058862_12631438 | Ga0058862_126314381 | 66 |
| 27 | 3300004803 | Ga0058862_12765549 | Ga0058862_127655491 | 66 |
| 28 | 3300005293 | Ga0065715_10398165 | Ga0065715_103981652 | 66 |
| 29 | 3300005327 | Ga0070658_10044029 | Ga0070658_100440292 | 66 |
| 30 | 3300005327 | Ga0070658_10055014 | Ga0070658_100550144 | 66 |
| 31 | 3300005327 | Ga0070658_10105049 | Ga0070658_101050492 | 66 |
| 32 | 3300005327 | Ga0070658_10155085 | Ga0070658_101550852 | 66 |
| 33 | 3300005327 | Ga0070658_10301321 | Ga0070658_103013212 | 66 |
| 34 | 3300005327 | Ga0070658_10411026 | Ga0070658_104110262 | 66 |
| 35 | 3300005327 | Ga0070658_10425153 | Ga0070658_104251531 | 66 |
| 36 | 3300005327 | Ga0070658_10493093 | Ga0070658_104930933 | 66 |
| 37 | 3300005327 | Ga0070658_11613765 | Ga0070658_116137651 | 66 |
| 38 | 3300005329 | Ga0070683_100013117 | Ga0070683_1000131173 | 66 |
| 39 | 3300005329 | Ga0070683_100025211 | Ga0070683_1000252118 | 66 |
| 40 | 3300005329 | Ga0070683_100042533 | Ga0070683_1000425334 | 66 |
| 41 | 3300005329 | Ga0070683_100082059 | Ga0070683_1000820591 | 66 |
| 42 | 3300005329 | Ga0070683_100320501 | Ga0070683_1003205012 | 66 |
| 43 | 3300005329 | Ga0070683_100392808 | Ga0070683_1003928082 | 66 |
| 44 | 3300005329 | Ga0070683_100484857 | Ga0070683_1004848573 | 66 |
| 45 | 3300005329 | Ga0070683_100849323 | Ga0070683_1008493232 | 66 |
| 46 | 3300005329 | Ga0070683_100970720 | Ga0070683_1009707201 | 66 |
| 47 | 3300005330 | Ga0070690_100386959 | Ga0070690_1003869591 | 66 |
| 48 | 3300005330 | Ga0070690_100881689 | Ga0070690_1008816892 | 66 |
| 49 | 3300005330 | Ga0070690_101050582 | Ga0070690_1010505821 | 66 |
| 50 | 3300005331 | Ga0070670_100000999 | Ga0070670_10000099912 | 66 |
| 51 | 3300005331 | Ga0070670_100004289 | Ga0070670_10000428913 | 66 |
| 52 | 3300005331 | Ga0070670_100012911 | Ga0070670_10001291111 | 66 |
| 53 | 3300005331 | Ga0070670_100828756 | Ga0070670_1008287562 | 66 |
| 54 | 3300005334 | Ga0068869_100001465 | Ga0068869_1000014653 | 66 |
| 55 | 3300005334 | Ga0068869_100165197 | Ga0068869_1001651972 | 66 |
| 56 | 3300005334 | Ga0068869_100347333 | Ga0068869_1003473332 | 66 |
| 57 | 3300005335 | Ga0070666_10066988 | Ga0070666_100669884 | 66 |
| 58 | 3300005335 | Ga0070666_10177794 | Ga0070666_101777942 | 66 |
| 59 | 3300005335 | Ga0070666_10409718 | Ga0070666_104097182 | 66 |
| 60 | 3300005335 | Ga0070666_11020929 | Ga0070666_110209291 | 66 |
| 61 | 3300005336 | Ga0070680_100119720 | Ga0070680_1001197203 | 66 |
| 62 | 3300005336 | Ga0070680_100218497 | Ga0070680_1002184972 | 66 |
| 63 | 3300005336 | Ga0070680_100314598 | Ga0070680_1003145982 | 66 |
| 64 | 3300005336 | Ga0070680_101816758 | Ga0070680_1018167581 | 66 |
| 65 | 3300005337 | Ga0070682_100316528 | Ga0070682_1003165282 | 66 |
| 66 | 3300005337 | Ga0070682_100464059 | Ga0070682_1004640592 | 66 |
| 67 | 3300005337 | Ga0070682_100596215 | Ga0070682_1005962151 | 66 |
| 68 | 3300005337 | Ga0070682_100634750 | Ga0070682_1006347502 | 66 |
| 69 | 3300005337 | Ga0070682_100735844 | Ga0070682_1007358441 | 66 |
| 70 | 3300005337 | Ga0070682_100959092 | Ga0070682_1009590922 | 66 |
| 71 | 3300005337 | Ga0070682_101319662 | Ga0070682_1013196621 | 66 |
| 72 | 3300005338 | Ga0068868_100000062 | Ga0068868_10000006213 | 66 |
| 73 | 3300005339 | Ga0070660_100075054 | Ga0070660_1000750543 | 66 |
| 74 | 3300005339 | Ga0070660_100390394 | Ga0070660_1003903942 | 66 |
| 75 | 3300005339 | Ga0070660_100756699 | Ga0070660_1007566992 | 66 |
| 76 | 3300005340 | Ga0070689_100027354 | Ga0070689_1000273544 | 66 |
| 77 | 3300005340 | Ga0070689_101627254 | Ga0070689_1016272541 | 66 |
| 78 | 3300005341 | Ga0070691_10007394 | Ga0070691_100073945 | 66 |
| 79 | 3300005341 | Ga0070691_10063321 | Ga0070691_100633213 | 66 |
| 80 | 3300005341 | Ga0070691_10850961 | Ga0070691_108509611 | 66 |
| 81 | 3300005344 | Ga0070661_100006060 | Ga0070661_1000060604 | 66 |
| 82 | 3300005344 | Ga0070661_100036188 | Ga0070661_1000361883 | 66 |
| 83 | 3300005344 | Ga0070661_100036965 | Ga0070661_1000369655 | 66 |
| 84 | 3300005344 | Ga0070661_100050157 | Ga0070661_1000501571 | 66 |
| 85 | 3300005344 | Ga0070661_100115431 | Ga0070661_1001154312 | 66 |
| 86 | 3300005344 | Ga0070661_100179525 | Ga0070661_1001795252 | 66 |
| 87 | 3300005344 | Ga0070661_101221537 | Ga0070661_1012215372 | 66 |
| 88 | 3300005344 | Ga0070661_101827045 | Ga0070661_1018270451 | 66 |
| 89 | 3300005345 | Ga0070692_10027487 | Ga0070692_100274873 | 66 |
| 90 | 3300005353 | Ga0070669_100019209 | Ga0070669_1000192097 | 66 |
| 91 | 3300005354 | Ga0070675_100036857 | Ga0070675_1000368575 | 66 |
| 92 | 3300005355 | Ga0070671_100000449 | Ga0070671_10000044920 | 66 |
| 93 | 3300005355 | Ga0070671_100048626 | Ga0070671_1000486264 | 66 |
| 94 | 3300005355 | Ga0070671_100169593 | Ga0070671_1001695932 | 66 |
| 95 | 3300005355 | Ga0070671_100257519 | Ga0070671_1002575193 | 66 |
| 96 | 3300005355 | Ga0070671_100357250 | Ga0070671_1003572501 | 66 |
| 97 | 3300005355 | Ga0070671_100695442 | Ga0070671_1006954421 | 66 |
| 98 | 3300005364 | Ga0070673_100021983 | Ga0070673_1000219836 | 66 |
| 99 | 3300005366 | Ga0070659_100281318 | Ga0070659_1002813181 | 66 |
| 100 | 3300005366 | Ga0070659_100455997 | Ga0070659_1004559972 | 66 |
| 101 | 3300005366 | Ga0070659_101271239 | Ga0070659_1012712391 | 66 |
| 102 | 3300005367 | Ga0070667_100006315 | Ga0070667_1000063155 | 66 |
| 103 | 3300005367 | Ga0070667_100139922 | Ga0070667_1001399224 | 66 |
| 104 | 3300005367 | Ga0070667_100821901 | Ga0070667_1008219011 | 66 |
| 105 | 3300005406 | Ga0070703_10040722 | Ga0070703_100407222 | 66 |
| 106 | 3300005434 | Ga0070709_10395937 | Ga0070709_103959371 | 66 |
| 107 | 3300005434 | Ga0070709_11128736 | Ga0070709_111287362 | 66 |
| 108 | 3300005435 | Ga0070714_100026455 | Ga0070714_1000264556 | 66 |
| 109 | 3300005435 | Ga0070714_100209394 | Ga0070714_1002093942 | 66 |
| 110 | 3300005435 | Ga0070714_100556983 | Ga0070714_1005569831 | 66 |
| 111 | 3300005435 | Ga0070714_101064370 | Ga0070714_1010643702 | 66 |
| 112 | 3300005435 | Ga0070714_101144156 | Ga0070714_1011441562 | 66 |
| 113 | 3300005435 | Ga0070714_101447180 | Ga0070714_1014471801 | 66 |
| 114 | 3300005436 | Ga0070713_100085009 | Ga0070713_1000850092 | 66 |
| 115 | 3300005436 | Ga0070713_101109221 | Ga0070713_1011092212 | 66 |
| 116 | 3300005436 | Ga0070713_102204929 | Ga0070713_1022049292 | 66 |
| 117 | 3300005436 | Ga0070713_102330911 | Ga0070713_1023309111 | 66 |
| 118 | 3300005437 | Ga0070710_10425345 | Ga0070710_104253452 | 66 |
| 119 | 3300005438 | Ga0070701_10015752 | Ga0070701_100157522 | 66 |
| 120 | 3300005439 | Ga0070711_100848227 | Ga0070711_1008482272 | 66 |
| 121 | 3300005439 | Ga0070711_100933639 | Ga0070711_1009336391 | 66 |
| 122 | 3300005440 | Ga0070705_100052117 | Ga0070705_1000521172 | 66 |
| 123 | 3300005440 | Ga0070705_101061623 | Ga0070705_1010616231 | 66 |
| 124 | 3300005444 | Ga0070694_100014714 | Ga0070694_1000147147 | 66 |
| 125 | 3300005444 | Ga0070694_100552417 | Ga0070694_1005524172 | 66 |
| 126 | 3300005445 | Ga0070708_100011482 | Ga0070708_1000114823 | 66 |
| 127 | 3300005445 | Ga0070708_100011755 | Ga0070708_1000117557 | 66 |
| 128 | 3300005445 | Ga0070708_100033260 | Ga0070708_1000332609 | 66 |
| 129 | 3300005445 | Ga0070708_100760801 | Ga0070708_1007608011 | 66 |
| 130 | 3300005455 | Ga0070663_100088079 | Ga0070663_1000880793 | 66 |
| 131 | 3300005455 | Ga0070663_100523255 | Ga0070663_1005232551 | 66 |
| 132 | 3300005455 | Ga0070663_100934844 | Ga0070663_1009348441 | 66 |
| 133 | 3300005456 | Ga0070678_100913243 | Ga0070678_1009132432 | 66 |
| 134 | 3300005457 | Ga0070662_100197816 | Ga0070662_1001978161 | 66 |
| 135 | 3300005457 | Ga0070662_100745735 | Ga0070662_1007457351 | 66 |
| 136 | 3300005457 | Ga0070662_101958812 | Ga0070662_1019588121 | 66 |
| 137 | 3300005458 | Ga0070681_10014239 | Ga0070681_100142396 | 66 |
| 138 | 3300005458 | Ga0070681_10046523 | Ga0070681_100465232 | 66 |
| 139 | 3300005458 | Ga0070681_10073325 | Ga0070681_100733253 | 66 |
| 140 | 3300005458 | Ga0070681_10129550 | Ga0070681_101295502 | 66 |
| 141 | 3300005458 | Ga0070681_10536303 | Ga0070681_105363032 | 66 |
| 142 | 3300005458 | Ga0070681_10862802 | Ga0070681_108628021 | 66 |
| 143 | 3300005458 | Ga0070681_10899288 | Ga0070681_108992881 | 66 |
| 144 | 3300005459 | Ga0068867_100066516 | Ga0068867_1000665163 | 66 |
| 145 | 3300005466 | Ga0070685_10039896 | Ga0070685_100398966 | 66 |
| 146 | 3300005466 | Ga0070685_10231651 | Ga0070685_102316512 | 66 |
| 147 | 3300005467 | Ga0070706_100014654 | Ga0070706_10001465410 | 66 |
| 148 | 3300005467 | Ga0070706_100014654 | Ga0070706_10001465411 | 66 |
| 149 | 3300005467 | Ga0070706_100020973 | Ga0070706_1000209732 | 66 |
| 150 | 3300005467 | Ga0070706_100885358 | Ga0070706_1008853582 | 66 |
| 151 | 3300005468 | Ga0070707_100064848 | Ga0070707_1000648483 | 66 |
| 152 | 3300005468 | Ga0070707_100089460 | Ga0070707_1000894604 | 66 |
| 153 | 3300005468 | Ga0070707_100161513 | Ga0070707_1001615132 | 66 |
| 154 | 3300005468 | Ga0070707_100161513 | Ga0070707_1001615133 | 66 |
| 155 | 3300005468 | Ga0070707_100467975 | Ga0070707_1004679753 | 66 |
| 156 | 3300005468 | Ga0070707_100958018 | Ga0070707_1009580183 | 66 |
| 157 | 3300005468 | Ga0070707_101321863 | Ga0070707_1013218631 | 66 |
| 158 | 3300005471 | Ga0070698_100002346 | Ga0070698_10000234623 | 66 |
| 159 | 3300005471 | Ga0070698_100272359 | Ga0070698_1002723591 | 66 |
| 160 | 3300005471 | Ga0070698_100272359 | Ga0070698_1002723592 | 66 |
| 161 | 3300005471 | Ga0070698_100290461 | Ga0070698_1002904613 | 66 |
| 162 | 3300005518 | Ga0070699_100005399 | Ga0070699_1000053992 | 66 |
| 163 | 3300005518 | Ga0070699_100055223 | Ga0070699_1000552232 | 66 |
| 164 | 3300005518 | Ga0070699_100113371 | Ga0070699_1001133714 | 66 |
| 165 | 3300005518 | Ga0070699_100400632 | Ga0070699_1004006323 | 66 |
| 166 | 3300005518 | Ga0070699_101159816 | Ga0070699_1011598162 | 66 |
| 167 | 3300005530 | Ga0070679_100016264 | Ga0070679_1000162648 | 66 |
| 168 | 3300005530 | Ga0070679_100268992 | Ga0070679_1002689921 | 66 |
| 169 | 3300005530 | Ga0070679_100290012 | Ga0070679_1002900123 | 66 |
| 170 | 3300005530 | Ga0070679_102155034 | Ga0070679_1021550341 | 66 |
| 171 | 3300005535 | Ga0070684_100002801 | Ga0070684_10000280110 | 66 |
| 172 | 3300005535 | Ga0070684_100023567 | Ga0070684_1000235677 | 66 |
| 173 | 3300005535 | Ga0070684_100028010 | Ga0070684_1000280105 | 66 |
| 174 | 3300005535 | Ga0070684_100032735 | Ga0070684_1000327352 | 66 |
| 175 | 3300005535 | Ga0070684_100057304 | Ga0070684_1000573042 | 66 |
| 176 | 3300005535 | Ga0070684_100063659 | Ga0070684_1000636594 | 66 |
| 177 | 3300005535 | Ga0070684_100150795 | Ga0070684_1001507954 | 66 |
| 178 | 3300005535 | Ga0070684_100367432 | Ga0070684_1003674322 | 66 |
| 179 | 3300005535 | Ga0070684_101189661 | Ga0070684_1011896611 | 66 |
| 180 | 3300005536 | Ga0070697_100012687 | Ga0070697_1000126875 | 66 |
| 181 | 3300005536 | Ga0070697_100021509 | Ga0070697_1000215093 | 66 |
| 182 | 3300005536 | Ga0070697_100023655 | Ga0070697_1000236556 | 66 |
| 183 | 3300005536 | Ga0070697_100231193 | Ga0070697_1002311932 | 66 |
| 184 | 3300005536 | Ga0070697_100461554 | Ga0070697_1004615543 | 66 |
| 185 | 3300005536 | Ga0070697_101787216 | Ga0070697_1017872161 | 66 |
| 186 | 3300005539 | Ga0068853_100000080 | Ga0068853_10000008040 | 66 |
| 187 | 3300005539 | Ga0068853_100024183 | Ga0068853_1000241834 | 66 |
| 188 | 3300005539 | Ga0068853_100070812 | Ga0068853_1000708122 | 66 |
| 189 | 3300005539 | Ga0068853_100087352 | Ga0068853_1000873524 | 66 |
| 190 | 3300005539 | Ga0068853_100253471 | Ga0068853_1002534712 | 66 |
| 191 | 3300005539 | Ga0068853_101237029 | Ga0068853_1012370291 | 66 |
| 192 | 3300005539 | Ga0068853_101699466 | Ga0068853_1016994661 | 66 |
| 193 | 3300005539 | Ga0068853_101936006 | Ga0068853_1019360061 | 66 |
| 194 | 3300005543 | Ga0070672_100024224 | Ga0070672_1000242246 | 66 |
| 195 | 3300005543 | Ga0070672_100627845 | Ga0070672_1006278452 | 66 |
| 196 | 3300005543 | Ga0070672_100678709 | Ga0070672_1006787092 | 66 |
| 197 | 3300005544 | Ga0070686_101250524 | Ga0070686_1012505241 | 66 |
| 198 | 3300005544 | Ga0070686_101460735 | Ga0070686_1014607353 | 66 |
| 199 | 3300005545 | Ga0070695_100007587 | Ga0070695_1000075875 | 66 |
| 200 | 3300005545 | Ga0070695_100223253 | Ga0070695_1002232531 | 66 |
| 201 | 3300005546 | Ga0070696_100076522 | Ga0070696_1000765223 | 66 |
| 202 | 3300005546 | Ga0070696_100090784 | Ga0070696_1000907843 | 66 |
| 203 | 3300005546 | Ga0070696_100277990 | Ga0070696_1002779901 | 66 |
| 204 | 3300005546 | Ga0070696_100354728 | Ga0070696_1003547282 | 66 |
| 205 | 3300005546 | Ga0070696_101249051 | Ga0070696_1012490511 | 66 |
| 206 | 3300005547 | Ga0070693_100337701 | Ga0070693_1003377012 | 66 |
| 207 | 3300005547 | Ga0070693_100454649 | Ga0070693_1004546491 | 66 |
| 208 | 3300005547 | Ga0070693_100847890 | Ga0070693_1008478901 | 66 |
| 209 | 3300005547 | Ga0070693_100973592 | Ga0070693_1009735922 | 66 |
| 210 | 3300005548 | Ga0070665_100321539 | Ga0070665_1003215393 | 66 |
| 211 | 3300005548 | Ga0070665_100339679 | Ga0070665_1003396792 | 66 |
| 212 | 3300005548 | Ga0070665_100473829 | Ga0070665_1004738292 | 66 |
| 213 | 3300005548 | Ga0070665_100917769 | Ga0070665_1009177691 | 66 |
| 214 | 3300005549 | Ga0070704_100128158 | Ga0070704_1001281581 | 66 |
| 215 | 3300005549 | Ga0070704_100187330 | Ga0070704_1001873301 | 66 |
| 216 | 3300005549 | Ga0070704_100344476 | Ga0070704_1003444761 | 66 |
| 217 | 3300005563 | Ga0068855_100001109 | Ga0068855_10000110910 | 66 |
| 218 | 3300005563 | Ga0068855_100003174 | Ga0068855_1000031742 | 66 |
| 219 | 3300005563 | Ga0068855_100041627 | Ga0068855_1000416276 | 66 |
| 220 | 3300005563 | Ga0068855_100102955 | Ga0068855_1001029552 | 66 |
| 221 | 3300005563 | Ga0068855_100103010 | Ga0068855_1001030103 | 66 |
| 222 | 3300005563 | Ga0068855_100120956 | Ga0068855_1001209562 | 66 |
| 223 | 3300005563 | Ga0068855_100137239 | Ga0068855_1001372394 | 66 |
| 224 | 3300005563 | Ga0068855_100179892 | Ga0068855_1001798921 | 66 |
| 225 | 3300005563 | Ga0068855_100447526 | Ga0068855_1004475263 | 66 |
| 226 | 3300005563 | Ga0068855_101043463 | Ga0068855_1010434631 | 66 |
| 227 | 3300005564 | Ga0070664_100044728 | Ga0070664_1000447282 | 66 |
| 228 | 3300005564 | Ga0070664_100116334 | Ga0070664_1001163342 | 66 |
| 229 | 3300005564 | Ga0070664_100233379 | Ga0070664_1002333793 | 66 |
| 230 | 3300005564 | Ga0070664_100463432 | Ga0070664_1004634322 | 66 |
| 231 | 3300005577 | Ga0068857_100000969 | Ga0068857_10000096915 | 66 |
| 232 | 3300005577 | Ga0068857_100001491 | Ga0068857_10000149111 | 66 |
| 233 | 3300005577 | Ga0068857_100004470 | Ga0068857_1000044709 | 66 |
| 234 | 3300005577 | Ga0068857_100007098 | Ga0068857_1000070985 | 66 |
| 235 | 3300005577 | Ga0068857_100026640 | Ga0068857_1000266402 | 66 |
| 236 | 3300005577 | Ga0068857_100058309 | Ga0068857_1000583092 | 66 |
| 237 | 3300005577 | Ga0068857_100166944 | Ga0068857_1001669441 | 66 |
| 238 | 3300005577 | Ga0068857_100177536 | Ga0068857_1001775362 | 66 |
| 239 | 3300005577 | Ga0068857_100268748 | Ga0068857_1002687482 | 66 |
| 240 | 3300005577 | Ga0068857_101269541 | Ga0068857_1012695411 | 66 |
| 241 | 3300005577 | Ga0068857_102267715 | Ga0068857_1022677151 | 66 |
| 242 | 3300005578 | Ga0068854_100063256 | Ga0068854_1000632564 | 66 |
| 243 | 3300005578 | Ga0068854_100354129 | Ga0068854_1003541292 | 66 |
| 244 | 3300005578 | Ga0068854_100396266 | Ga0068854_1003962662 | 66 |
| 245 | 3300005614 | Ga0068856_100001717 | Ga0068856_10000171721 | 66 |
| 246 | 3300005614 | Ga0068856_100022866 | Ga0068856_1000228664 | 66 |
| 247 | 3300005614 | Ga0068856_100042723 | Ga0068856_1000427234 | 66 |
| 248 | 3300005614 | Ga0068856_100061299 | Ga0068856_1000612993 | 66 |
| 249 | 3300005614 | Ga0068856_100086253 | Ga0068856_1000862534 | 66 |
| 250 | 3300005614 | Ga0068856_100206324 | Ga0068856_1002063243 | 66 |
| 251 | 3300005614 | Ga0068856_100239317 | Ga0068856_1002393172 | 66 |
| 252 | 3300005614 | Ga0068856_100383861 | Ga0068856_1003838611 | 66 |
| 253 | 3300005614 | Ga0068856_100396687 | Ga0068856_1003966872 | 66 |
| 254 | 3300005614 | Ga0068856_100429245 | Ga0068856_1004292452 | 66 |
| 255 | 3300005614 | Ga0068856_100816416 | Ga0068856_1008164163 | 66 |
| 256 | 3300005616 | Ga0068852_100000048 | Ga0068852_10000004848 | 66 |
| 257 | 3300005616 | Ga0068852_100000287 | Ga0068852_10000028722 | 66 |
| 258 | 3300005616 | Ga0068852_100000434 | Ga0068852_10000043420 | 66 |
| 259 | 3300005616 | Ga0068852_100049816 | Ga0068852_1000498165 | 66 |
| 260 | 3300005616 | Ga0068852_100194115 | Ga0068852_1001941153 | 66 |
| 261 | 3300005616 | Ga0068852_100256402 | Ga0068852_1002564022 | 66 |
| 262 | 3300005616 | Ga0068852_100324734 | Ga0068852_1003247342 | 66 |
| 263 | 3300005616 | Ga0068852_100464739 | Ga0068852_1004647392 | 66 |
| 264 | 3300005616 | Ga0068852_101462340 | Ga0068852_1014623401 | 66 |
| 265 | 3300005616 | Ga0068852_102088059 | Ga0068852_1020880591 | 66 |
| 266 | 3300005617 | Ga0068859_100010672 | Ga0068859_1000106722 | 66 |
| 267 | 3300005617 | Ga0068859_100012505 | Ga0068859_1000125054 | 66 |
| 268 | 3300005617 | Ga0068859_100024126 | Ga0068859_1000241265 | 66 |
| 269 | 3300005618 | Ga0068864_100001146 | Ga0068864_1000011468 | 66 |
| 270 | 3300005618 | Ga0068864_100001263 | Ga0068864_1000012634 | 66 |
| 271 | 3300005618 | Ga0068864_100013753 | Ga0068864_1000137537 | 66 |
| 272 | 3300005618 | Ga0068864_100020410 | Ga0068864_1000204104 | 66 |
| 273 | 3300005718 | Ga0068866_10150540 | Ga0068866_101505401 | 66 |
| 274 | 3300005834 | Ga0068851_10006350 | Ga0068851_100063504 | 66 |
| 275 | 3300005834 | Ga0068851_10006516 | Ga0068851_100065164 | 66 |
| 276 | 3300005834 | Ga0068851_10029976 | Ga0068851_100299761 | 66 |
| 277 | 3300005834 | Ga0068851_10084594 | Ga0068851_100845942 | 66 |
| 278 | 3300005834 | Ga0068851_10106033 | Ga0068851_101060333 | 66 |
| 279 | 3300005834 | Ga0068851_10110529 | Ga0068851_101105293 | 66 |
| 280 | 3300005834 | Ga0068851_10253879 | Ga0068851_102538791 | 66 |
| 281 | 3300005834 | Ga0068851_10325847 | Ga0068851_103258472 | 66 |
| 282 | 3300005834 | Ga0068851_10709755 | Ga0068851_107097552 | 66 |
| 283 | 3300005840 | Ga0068870_10232748 | Ga0068870_102327481 | 66 |
| 284 | 3300005841 | Ga0068863_100000893 | Ga0068863_1000008934 | 66 |
| 285 | 3300005841 | Ga0068863_100017111 | Ga0068863_1000171115 | 66 |
| 286 | 3300005841 | Ga0068863_101403674 | Ga0068863_1014036741 | 66 |
| 287 | 3300005841 | Ga0068863_102228643 | Ga0068863_1022286431 | 66 |
| 288 | 3300005842 | Ga0068858_100003222 | Ga0068858_10000322215 | 66 |
| 289 | 3300005842 | Ga0068858_100015396 | Ga0068858_1000153964 | 66 |
| 290 | 3300005842 | Ga0068858_100211044 | Ga0068858_1002110443 | 66 |
| 291 | 3300005842 | Ga0068858_100491666 | Ga0068858_1004916662 | 66 |
| 292 | 3300005842 | Ga0068858_100529515 | Ga0068858_1005295152 | 66 |
| 293 | 3300005843 | Ga0068860_100003815 | Ga0068860_1000038154 | 66 |
| 294 | 3300005843 | Ga0068860_100063187 | Ga0068860_1000631876 | 66 |
| 295 | 3300005843 | Ga0068860_100119698 | Ga0068860_1001196982 | 66 |
| 296 | 3300005843 | Ga0068860_101007921 | Ga0068860_1010079211 | 66 |
| 297 | 3300005844 | Ga0068862_100022830 | Ga0068862_1000228304 | 66 |
| 298 | 3300005844 | Ga0068862_100089631 | Ga0068862_1000896314 | 66 |
| 299 | 3300005844 | Ga0068862_100168715 | Ga0068862_1001687152 | 66 |
| 300 | 3300005844 | Ga0068862_100231958 | Ga0068862_1002319582 | 66 |
| 301 | 3300006028 | Ga0070717_10405279 | Ga0070717_104052792 | 66 |
| 302 | 3300006028 | Ga0070717_10674252 | Ga0070717_106742522 | 66 |
| 303 | 3300006028 | Ga0070717_10819360 | Ga0070717_108193603 | 66 |
| 304 | 3300006028 | Ga0070717_11508234 | Ga0070717_115082342 | 66 |
| 305 | 3300006028 | Ga0070717_11633752 | Ga0070717_116337521 | 66 |
| 306 | 3300006038 | Ga0075365_10672442 | Ga0075365_106724422 | 66 |
| 307 | 3300006042 | Ga0075368_10467820 | Ga0075368_104678202 | 66 |
| 308 | 3300006048 | Ga0075363_100507455 | Ga0075363_1005074551 | 66 |
| 309 | 3300006051 | Ga0075364_10396621 | Ga0075364_103966211 | 66 |
| 310 | 3300006173 | Ga0070716_100290052 | Ga0070716_1002900523 | 66 |
| 311 | 3300006173 | Ga0070716_100440613 | Ga0070716_1004406133 | 66 |
| 312 | 3300006173 | Ga0070716_100939741 | Ga0070716_1009397411 | 66 |
| 313 | 3300006175 | Ga0070712_100108054 | Ga0070712_1001080542 | 66 |
| 314 | 3300006175 | Ga0070712_100528365 | Ga0070712_1005283652 | 66 |
| 315 | 3300006175 | Ga0070712_101710314 | Ga0070712_1017103141 | 66 |
| 316 | 3300006237 | Ga0097621_100006064 | Ga0097621_1000060646 | 66 |
| 317 | 3300006237 | Ga0097621_100007372 | Ga0097621_1000073724 | 66 |
| 318 | 3300006237 | Ga0097621_100065574 | Ga0097621_1000655741 | 66 |
| 319 | 3300006237 | Ga0097621_100317034 | Ga0097621_1003170341 | 66 |
| 320 | 3300006237 | Ga0097621_101899439 | Ga0097621_1018994391 | 66 |
| 321 | 3300006353 | Ga0075370_10317233 | Ga0075370_103172331 | 66 |
| 322 | 3300006358 | Ga0068871_100033758 | Ga0068871_1000337583 | 66 |
| 323 | 3300006358 | Ga0068871_100076129 | Ga0068871_1000761293 | 66 |
| 324 | 3300006844 | Ga0075428_100509649 | Ga0075428_1005096492 | 66 |
| 325 | 3300006846 | Ga0075430_100153947 | Ga0075430_1001539472 | 66 |
| 326 | 3300006846 | Ga0075430_100327107 | Ga0075430_1003271072 | 66 |
| 327 | 3300006847 | Ga0075431_100100232 | Ga0075431_1001002321 | 66 |
| 328 | 3300006847 | Ga0075431_100477994 | Ga0075431_1004779942 | 66 |
| 329 | 3300006847 | Ga0075431_101650226 | Ga0075431_1016502261 | 66 |
| 330 | 3300006847 | Ga0075431_101852621 | Ga0075431_1018526211 | 66 |
| 331 | 3300006852 | Ga0075433_10045207 | Ga0075433_100452076 | 66 |
| 332 | 3300006871 | Ga0075434_100014420 | Ga0075434_10001442011 | 66 |
| 333 | 3300006871 | Ga0075434_100600567 | Ga0075434_1006005672 | 66 |
| 334 | 3300006880 | Ga0075429_100003644 | Ga0075429_1000036442 | 66 |
| 335 | 3300006880 | Ga0075429_100144107 | Ga0075429_1001441072 | 66 |
| 336 | 3300006880 | Ga0075429_100249301 | Ga0075429_1002493014 | 66 |
| 337 | 3300006880 | Ga0075429_101842251 | Ga0075429_1018422512 | 66 |
| 338 | 3300006914 | Ga0075436_100006247 | Ga0075436_1000062472 | 66 |
| 339 | 3300006914 | Ga0075436_100078134 | Ga0075436_1000781342 | 66 |
| 340 | 3300006914 | Ga0075436_100843507 | Ga0075436_1008435071 | 66 |
| 341 | 3300006914 | Ga0075436_100848689 | Ga0075436_1008486892 | 66 |
| 342 | 3300006931 | Ga0097620_100010672 | Ga0097620_1000106722 | 66 |
| 343 | 3300006931 | Ga0097620_100012505 | Ga0097620_1000125054 | 66 |
| 344 | 3300006931 | Ga0097620_100024125 | Ga0097620_1000241255 | 66 |
| 345 | 3300007265 | Ga0099794_10081387 | Ga0099794_100813871 | 66 |
| 346 | 3300007265 | Ga0099794_10120220 | Ga0099794_101202202 | 66 |
| 347 | 3300007265 | Ga0099794_10263097 | Ga0099794_102630972 | 66 |
| 348 | 3300007265 | Ga0099794_10275978 | Ga0099794_102759782 | 66 |
| 349 | 3300007265 | Ga0099794_10564609 | Ga0099794_105646091 | 66 |
| 350 | 3300007788 | Ga0099795_10132769 | Ga0099795_101327691 | 66 |
| 351 | 3300009011 | Ga0105251_10254232 | Ga0105251_102542321 | 66 |
| 352 | 3300009093 | Ga0105240_10000171 | Ga0105240_1000017120 | 66 |
| 353 | 3300009093 | Ga0105240_10001982 | Ga0105240_1000198210 | 66 |
| 354 | 3300009093 | Ga0105240_10002781 | Ga0105240_100027819 | 66 |
| 355 | 3300009093 | Ga0105240_10007773 | Ga0105240_100077733 | 66 |
| 356 | 3300009093 | Ga0105240_10015305 | Ga0105240_100153055 | 66 |
| 357 | 3300009093 | Ga0105240_10016664 | Ga0105240_1001666411 | 66 |
| 358 | 3300009093 | Ga0105240_10025954 | Ga0105240_100259548 | 66 |
| 359 | 3300009093 | Ga0105240_10043806 | Ga0105240_100438062 | 66 |
| 360 | 3300009093 | Ga0105240_10063462 | Ga0105240_100634623 | 66 |
| 361 | 3300009093 | Ga0105240_10190101 | Ga0105240_101901014 | 66 |
| 362 | 3300009093 | Ga0105240_10431344 | Ga0105240_104313443 | 66 |
| 363 | 3300009093 | Ga0105240_10571313 | Ga0105240_105713132 | 66 |
| 364 | 3300009093 | Ga0105240_11118129 | Ga0105240_111181291 | 66 |
| 365 | 3300009093 | Ga0105240_12794713 | Ga0105240_127947131 | 66 |
| 366 | 3300009094 | Ga0111539_10004706 | Ga0111539_1000470615 | 66 |
| 367 | 3300009094 | Ga0111539_10376644 | Ga0111539_103766443 | 66 |
| 368 | 3300009098 | Ga0105245_10002006 | Ga0105245_100020064 | 66 |
| 369 | 3300009101 | Ga0105247_10003806 | Ga0105247_100038065 | 66 |
| 370 | 3300009101 | Ga0105247_10298439 | Ga0105247_102984391 | 66 |
| 371 | 3300009101 | Ga0105247_11312183 | Ga0105247_113121831 | 66 |
| 372 | 3300009147 | Ga0114129_10011134 | Ga0114129_100111346 | 66 |
| 373 | 3300009147 | Ga0114129_10036930 | Ga0114129_100369306 | 66 |
| 374 | 3300009147 | Ga0114129_10344476 | Ga0114129_103444762 | 66 |
| 375 | 3300009147 | Ga0114129_11160409 | Ga0114129_111604092 | 66 |
| 376 | 3300009148 | Ga0105243_10188046 | Ga0105243_101880462 | 66 |
| 377 | 3300009148 | Ga0105243_11009074 | Ga0105243_110090742 | 66 |
| 378 | 3300009148 | Ga0105243_11531972 | Ga0105243_115319721 | 66 |
| 379 | 3300009174 | Ga0105241_10000839 | Ga0105241_1000083914 | 66 |
| 380 | 3300009174 | Ga0105241_10012928 | Ga0105241_100129285 | 66 |
| 381 | 3300009174 | Ga0105241_10019234 | Ga0105241_100192346 | 66 |
| 382 | 3300009174 | Ga0105241_10035824 | Ga0105241_100358244 | 66 |
| 383 | 3300009174 | Ga0105241_10037495 | Ga0105241_100374953 | 66 |
| 384 | 3300009174 | Ga0105241_10042761 | Ga0105241_100427617 | 66 |
| 385 | 3300009174 | Ga0105241_10099036 | Ga0105241_100990362 | 66 |
| 386 | 3300009174 | Ga0105241_10159953 | Ga0105241_101599531 | 66 |
| 387 | 3300009174 | Ga0105241_10756905 | Ga0105241_107569052 | 66 |
| 388 | 3300009174 | Ga0105241_11419579 | Ga0105241_114195791 | 66 |
| 389 | 3300009176 | Ga0105242_10083613 | Ga0105242_100836133 | 66 |
| 390 | 3300009176 | Ga0105242_10725101 | Ga0105242_107251011 | 66 |
| 391 | 3300009176 | Ga0105242_11158959 | Ga0105242_111589592 | 66 |
| 392 | 3300009176 | Ga0105242_12214656 | Ga0105242_122146562 | 66 |
| 393 | 3300009176 | Ga0105242_12504390 | Ga0105242_125043902 | 66 |
| 394 | 3300009177 | Ga0105248_10000596 | Ga0105248_1000059619 | 66 |
| 395 | 3300009177 | Ga0105248_10003599 | Ga0105248_1000359912 | 66 |
| 396 | 3300009177 | Ga0105248_10015061 | Ga0105248_100150614 | 66 |
| 397 | 3300009177 | Ga0105248_10068520 | Ga0105248_100685204 | 66 |
| 398 | 3300009177 | Ga0105248_10343810 | Ga0105248_103438102 | 66 |
| 399 | 3300009177 | Ga0105248_10664090 | Ga0105248_106640902 | 66 |
| 400 | 3300009177 | Ga0105248_12006431 | Ga0105248_120064311 | 66 |
| 401 | 3300009545 | Ga0105237_10055963 | Ga0105237_100559637 | 66 |
| 402 | 3300009545 | Ga0105237_10150740 | Ga0105237_101507403 | 66 |
| 403 | 3300009545 | Ga0105237_10252318 | Ga0105237_102523183 | 66 |
| 404 | 3300009545 | Ga0105237_10573027 | Ga0105237_105730272 | 66 |
| 405 | 3300009545 | Ga0105237_11260058 | Ga0105237_112600581 | 66 |
| 406 | 3300009545 | Ga0105237_11283793 | Ga0105237_112837932 | 66 |
| 407 | 3300009545 | Ga0105237_11353702 | Ga0105237_113537022 | 66 |
| 408 | 3300009545 | Ga0105237_11473978 | Ga0105237_114739781 | 66 |
| 409 | 3300009545 | Ga0105237_11585965 | Ga0105237_115859652 | 66 |
| 410 | 3300009545 | Ga0105237_12093664 | Ga0105237_120936641 | 66 |
| 411 | 3300009545 | Ga0105237_12176952 | Ga0105237_121769522 | 66 |
| 412 | 3300009551 | Ga0105238_10000307 | Ga0105238_1000030727 | 66 |
| 413 | 3300009551 | Ga0105238_10027293 | Ga0105238_100272933 | 66 |
| 414 | 3300009551 | Ga0105238_10028178 | Ga0105238_100281785 | 66 |
| 415 | 3300009551 | Ga0105238_10041389 | Ga0105238_100413894 | 66 |
| 416 | 3300009551 | Ga0105238_10132405 | Ga0105238_101324052 | 66 |
| 417 | 3300009551 | Ga0105238_10290797 | Ga0105238_102907972 | 66 |
| 418 | 3300009551 | Ga0105238_10361141 | Ga0105238_103611412 | 66 |
| 419 | 3300009551 | Ga0105238_10620429 | Ga0105238_106204292 | 66 |
| 420 | 3300009551 | Ga0105238_10658902 | Ga0105238_106589022 | 66 |
| 421 | 3300009551 | Ga0105238_10734731 | Ga0105238_107347312 | 66 |
| 422 | 3300009551 | Ga0105238_10843112 | Ga0105238_108431122 | 66 |
| 423 | 3300009551 | Ga0105238_11952241 | Ga0105238_119522412 | 66 |
| 424 | 3300009553 | Ga0105249_10140115 | Ga0105249_101401153 | 66 |
| 425 | 3300009553 | Ga0105249_10177926 | Ga0105249_101779263 | 66 |
| 426 | 3300009553 | Ga0105249_10862565 | Ga0105249_108625652 | 66 |
| 427 | 3300009553 | Ga0105249_12359046 | Ga0105249_123590462 | 66 |
| 428 | 3300010375 | Ga0105239_10031350 | Ga0105239_100313506 | 66 |
| 429 | 3300010375 | Ga0105239_10181295 | Ga0105239_101812951 | 66 |
| 430 | 3300010375 | Ga0105239_10228383 | Ga0105239_102283833 | 66 |
| 431 | 3300010375 | Ga0105239_10365880 | Ga0105239_103658802 | 66 |
| 432 | 3300010375 | Ga0105239_10494873 | Ga0105239_104948732 | 66 |
| 433 | 3300010375 | Ga0105239_10551755 | Ga0105239_105517552 | 66 |
| 434 | 3300010375 | Ga0105239_10590261 | Ga0105239_105902612 | 66 |
| 435 | 3300010375 | Ga0105239_10796409 | Ga0105239_107964092 | 66 |
| 436 | 3300010375 | Ga0105239_10844089 | Ga0105239_108440892 | 66 |
| 437 | 3300010375 | Ga0105239_10964983 | Ga0105239_109649831 | 66 |
| 438 | 3300010375 | Ga0105239_11328225 | Ga0105239_113282252 | 66 |
| 439 | 3300010375 | Ga0105239_11447103 | Ga0105239_114471032 | 66 |
| 440 | 3300010375 | Ga0105239_12275253 | Ga0105239_122752532 | 66 |
| 441 | 3300010375 | Ga0105239_12457728 | Ga0105239_124577281 | 66 |
| 442 | 3300010375 | Ga0105239_12599383 | Ga0105239_125993831 | 66 |
| 443 | 3300010375 | Ga0105239_13048090 | Ga0105239_130480902 | 66 |
| 444 | 3300011119 | Ga0105246_10003700 | Ga0105246_100037004 | 66 |
| 445 | 3300011119 | Ga0105246_10714489 | Ga0105246_107144892 | 66 |
| 446 | 3300012495 | Ga0157323_1032888 | Ga0157323_10328882 | 66 |
| 447 | 3300013100 | Ga0157373_10058108 | Ga0157373_100581084 | 66 |
| 448 | 3300013100 | Ga0157373_10165335 | Ga0157373_101653352 | 66 |
| 449 | 3300013100 | Ga0157373_10214554 | Ga0157373_102145542 | 66 |
| 450 | 3300013100 | Ga0157373_10223553 | Ga0157373_102235532 | 66 |
| 451 | 3300013100 | Ga0157373_10386811 | Ga0157373_103868112 | 66 |
| 452 | 3300013102 | Ga0157371_10123746 | Ga0157371_101237462 | 66 |
| 453 | 3300013102 | Ga0157371_10246886 | Ga0157371_102468862 | 66 |
| 454 | 3300013102 | Ga0157371_10863345 | Ga0157371_108633452 | 66 |
| 455 | 3300013102 | Ga0157371_11183759 | Ga0157371_111837591 | 66 |
| 456 | 3300013102 | Ga0157371_11432314 | Ga0157371_114323141 | 66 |
| 457 | 3300013104 | Ga0157370_10000019 | Ga0157370_10000019125 | 66 |
| 458 | 3300013104 | Ga0157370_10001105 | Ga0157370_1000110510 | 66 |
| 459 | 3300013104 | Ga0157370_10068416 | Ga0157370_100684164 | 66 |
| 460 | 3300013104 | Ga0157370_10229185 | Ga0157370_102291851 | 66 |
| 461 | 3300013104 | Ga0157370_10922186 | Ga0157370_109221861 | 66 |
| 462 | 3300013104 | Ga0157370_11475863 | Ga0157370_114758631 | 66 |
| 463 | 3300013105 | Ga0157369_10000081 | Ga0157369_1000008194 | 66 |
| 464 | 3300013105 | Ga0157369_10000707 | Ga0157369_1000070739 | 66 |
| 465 | 3300013105 | Ga0157369_10001102 | Ga0157369_1000110210 | 66 |
| 466 | 3300013105 | Ga0157369_10001710 | Ga0157369_100017103 | 66 |
| 467 | 3300013105 | Ga0157369_10005051 | Ga0157369_1000505110 | 66 |
| 468 | 3300013105 | Ga0157369_10015409 | Ga0157369_100154093 | 66 |
| 469 | 3300013105 | Ga0157369_10035363 | Ga0157369_100353634 | 66 |
| 470 | 3300013105 | Ga0157369_10109048 | Ga0157369_101090483 | 66 |
| 471 | 3300013105 | Ga0157369_10171732 | Ga0157369_101717323 | 66 |
| 472 | 3300013105 | Ga0157369_10200435 | Ga0157369_102004351 | 66 |
| 473 | 3300013105 | Ga0157369_10207146 | Ga0157369_102071462 | 66 |
| 474 | 3300013105 | Ga0157369_10235339 | Ga0157369_102353391 | 66 |
| 475 | 3300013105 | Ga0157369_10273410 | Ga0157369_102734101 | 66 |
| 476 | 3300013105 | Ga0157369_10308414 | Ga0157369_103084143 | 66 |
| 477 | 3300013105 | Ga0157369_10465537 | Ga0157369_104655373 | 66 |
| 478 | 3300013105 | Ga0157369_11108996 | Ga0157369_111089962 | 66 |
| 479 | 3300013105 | Ga0157369_11201877 | Ga0157369_112018772 | 66 |
| 480 | 3300013105 | Ga0157369_11718652 | Ga0157369_117186522 | 66 |
| 481 | 3300013296 | Ga0157374_10009794 | Ga0157374_100097944 | 66 |
| 482 | 3300013296 | Ga0157374_10015610 | Ga0157374_100156103 | 66 |
| 483 | 3300013296 | Ga0157374_10114790 | Ga0157374_101147904 | 66 |
| 484 | 3300013296 | Ga0157374_10171968 | Ga0157374_101719683 | 66 |
| 485 | 3300013296 | Ga0157374_10194520 | Ga0157374_101945202 | 66 |
| 486 | 3300013296 | Ga0157374_10288087 | Ga0157374_102880872 | 66 |
| 487 | 3300013296 | Ga0157374_10359394 | Ga0157374_103593942 | 66 |
| 488 | 3300013296 | Ga0157374_11192940 | Ga0157374_111929401 | 66 |
| 489 | 3300013296 | Ga0157374_11508860 | Ga0157374_115088602 | 66 |
| 490 | 3300013296 | Ga0157374_12251042 | Ga0157374_122510421 | 66 |
| 491 | 3300013297 | Ga0157378_10010577 | Ga0157378_100105774 | 66 |
| 492 | 3300013297 | Ga0157378_10041010 | Ga0157378_100410104 | 66 |
| 493 | 3300013297 | Ga0157378_10077857 | Ga0157378_100778572 | 66 |
| 494 | 3300013297 | Ga0157378_10269610 | Ga0157378_102696103 | 66 |
| 495 | 3300013297 | Ga0157378_10534356 | Ga0157378_105343562 | 66 |
| 496 | 3300013297 | Ga0157378_10939253 | Ga0157378_109392531 | 66 |
| 497 | 3300013297 | Ga0157378_11938301 | Ga0157378_119383011 | 66 |
| 498 | 3300013306 | Ga0163162_10053860 | Ga0163162_100538604 | 66 |
| 499 | 3300013306 | Ga0163162_10054763 | Ga0163162_100547633 | 66 |
| 500 | 3300013306 | Ga0163162_10067634 | Ga0163162_100676342 | 66 |
| 501 | 3300013306 | Ga0163162_10542947 | Ga0163162_105429472 | 66 |
| 502 | 3300013306 | Ga0163162_11150717 | Ga0163162_111507171 | 66 |
| 503 | 3300013306 | Ga0163162_11391106 | Ga0163162_113911061 | 66 |
| 504 | 3300013306 | Ga0163162_11394282 | Ga0163162_113942822 | 66 |
| 505 | 3300013306 | Ga0163162_11540746 | Ga0163162_115407462 | 66 |
| 506 | 3300013307 | Ga0157372_10000058 | Ga0157372_1000005814 | 66 |
| 507 | 3300013307 | Ga0157372_10000816 | Ga0157372_1000081610 | 66 |
| 508 | 3300013307 | Ga0157372_10005348 | Ga0157372_100053484 | 66 |
| 509 | 3300013307 | Ga0157372_10008671 | Ga0157372_100086715 | 66 |
| 510 | 3300013307 | Ga0157372_10011989 | Ga0157372_100119896 | 66 |
| 511 | 3300013307 | Ga0157372_10025712 | Ga0157372_100257124 | 66 |
| 512 | 3300013307 | Ga0157372_10028222 | Ga0157372_100282223 | 66 |
| 513 | 3300013307 | Ga0157372_10039761 | Ga0157372_100397615 | 66 |
| 514 | 3300013307 | Ga0157372_10115154 | Ga0157372_101151545 | 66 |
| 515 | 3300013307 | Ga0157372_10147772 | Ga0157372_101477725 | 66 |
| 516 | 3300013307 | Ga0157372_10176183 | Ga0157372_101761831 | 66 |
| 517 | 3300013307 | Ga0157372_10312382 | Ga0157372_103123823 | 66 |
| 518 | 3300013307 | Ga0157372_10360199 | Ga0157372_103601992 | 66 |
| 519 | 3300013307 | Ga0157372_10379563 | Ga0157372_103795631 | 66 |
| 520 | 3300013307 | Ga0157372_10672920 | Ga0157372_106729202 | 66 |
| 521 | 3300013307 | Ga0157372_10872702 | Ga0157372_108727021 | 66 |
| 522 | 3300013307 | Ga0157372_11310889 | Ga0157372_113108892 | 66 |
| 523 | 3300013307 | Ga0157372_11394162 | Ga0157372_113941621 | 66 |
| 524 | 3300013307 | Ga0157372_11605953 | Ga0157372_116059531 | 66 |
| 525 | 3300013307 | Ga0157372_12076720 | Ga0157372_120767202 | 66 |
| 526 | 3300013307 | Ga0157372_12486033 | Ga0157372_124860332 | 66 |
| 527 | 3300013308 | Ga0157375_10019000 | Ga0157375_100190002 | 66 |
| 528 | 3300013308 | Ga0157375_10550618 | Ga0157375_105506181 | 66 |
| 529 | 3300013308 | Ga0157375_10817513 | Ga0157375_108175132 | 66 |
| 530 | 3300013308 | Ga0157375_11828074 | Ga0157375_118280741 | 66 |
| 531 | 3300014325 | Ga0163163_10002835 | Ga0163163_100028359 | 66 |
| 532 | 3300014325 | Ga0163163_10007035 | Ga0163163_100070354 | 66 |
| 533 | 3300014325 | Ga0163163_10009352 | Ga0163163_100093524 | 66 |
| 534 | 3300014325 | Ga0163163_10018944 | Ga0163163_100189444 | 66 |
| 535 | 3300014325 | Ga0163163_10021461 | Ga0163163_1002146110 | 66 |
| 536 | 3300014325 | Ga0163163_10040007 | Ga0163163_100400072 | 66 |
| 537 | 3300014325 | Ga0163163_10114203 | Ga0163163_101142035 | 66 |
| 538 | 3300014325 | Ga0163163_11405551 | Ga0163163_114055512 | 66 |
| 539 | 3300014745 | Ga0157377_10148801 | Ga0157377_101488012 | 66 |
| 540 | 3300014745 | Ga0157377_10353471 | Ga0157377_103534711 | 66 |
| 541 | 3300014968 | Ga0157379_10016500 | Ga0157379_100165008 | 66 |
| 542 | 3300014968 | Ga0157379_10042808 | Ga0157379_100428082 | 66 |
| 543 | 3300014968 | Ga0157379_10207680 | Ga0157379_102076805 | 66 |
| 544 | 3300014968 | Ga0157379_11454251 | Ga0157379_114542511 | 66 |
| 545 | 3300014969 | Ga0157376_10004260 | Ga0157376_100042607 | 66 |
| 546 | 3300014969 | Ga0157376_10021757 | Ga0157376_100217574 | 66 |
| 547 | 3300014969 | Ga0157376_10060093 | Ga0157376_100600932 | 66 |
| 548 | 3300014969 | Ga0157376_10096545 | Ga0157376_100965453 | 66 |
| 549 | 3300014969 | Ga0157376_11031495 | Ga0157376_110314951 | 66 |
| 550 | 3300015262 | Ga0182007_10072624 | Ga0182007_100726242 | 66 |
| 551 | 3300015262 | Ga0182007_10079996 | Ga0182007_100799962 | 66 |
| 552 | 3300019182 | Ga0184598_103997 | Ga0184598_1039972 | 66 |
| 553 | 3300019183 | Ga0184601_144297 | Ga0184601_1442972 | 66 |
| 554 | 3300019190 | Ga0184600_105364 | Ga0184600_1053642 | 66 |
| 555 | 3300020069 | Ga0197907_10591539 | Ga0197907_105915392 | 66 |
| 556 | 3300020069 | Ga0197907_11373818 | Ga0197907_113738182 | 66 |
| 557 | 3300020070 | Ga0206356_11755342 | Ga0206356_117553421 | 66 |
| 558 | 3300020075 | Ga0206349_1982423 | Ga0206349_19824231 | 66 |
| 559 | 3300020076 | Ga0206355_1230271 | Ga0206355_12302712 | 66 |
| 560 | 3300020076 | Ga0206355_1445323 | Ga0206355_14453232 | 66 |
| 561 | 3300020076 | Ga0206355_1641554 | Ga0206355_16415542 | 66 |
| 562 | 3300020077 | Ga0206351_10682782 | Ga0206351_106827821 | 66 |
| 563 | 3300020077 | Ga0206351_10823189 | Ga0206351_108231892 | 66 |
| 564 | 3300020078 | Ga0206352_10040263 | Ga0206352_100402632 | 66 |
| 565 | 3300020078 | Ga0206352_10336565 | Ga0206352_103365651 | 66 |
| 566 | 3300020078 | Ga0206352_10462609 | Ga0206352_104626092 | 66 |
| 567 | 3300020080 | Ga0206350_11050674 | Ga0206350_110506742 | 66 |
| 568 | 3300020080 | Ga0206350_11481399 | Ga0206350_114813992 | 66 |
| 569 | 3300020081 | Ga0206354_11255018 | Ga0206354_112550182 | 66 |
| 570 | 3300020082 | Ga0206353_10188743 | Ga0206353_101887431 | 66 |
| 571 | 3300020082 | Ga0206353_10774232 | Ga0206353_107742324 | 66 |
| 572 | 3300020082 | Ga0206353_11141441 | Ga0206353_111414411 | 66 |
| 573 | 3300020082 | Ga0206353_11692888 | Ga0206353_116928881 | 66 |
| 574 | 3300020610 | Ga0154015_1084318 | Ga0154015_10843183 | 66 |
| 575 | 3300020610 | Ga0154015_1647532 | Ga0154015_16475322 | 66 |
| 576 | 3300021361 | Ga0213872_10007421 | Ga0213872_100074218 | 66 |
| 577 | 3300021377 | Ga0213874_10011550 | Ga0213874_100115502 | 66 |
| 578 | 3300022467 | Ga0224712_10242302 | Ga0224712_102423021 | 66 |
| 579 | 3300022467 | Ga0224712_10296094 | Ga0224712_102960942 | 66 |
| 580 | 3300022732 | Ga0224569_100005 | Ga0224569_1000053 | 66 |
| 581 | 3300022734 | Ga0224571_100019 | Ga0224571_1000194 | 66 |
| 582 | 3300024225 | Ga0224572_1002797 | Ga0224572_10027973 | 66 |
| 583 | 3300024227 | Ga0228598_1000158 | Ga0228598_100015810 | 66 |
| 584 | 3300025261 | Ga0209233_1076817 | Ga0209233_10768171 | 66 |
| 585 | 3300025321 | Ga0207656_10025114 | Ga0207656_100251143 | 66 |
| 586 | 3300025321 | Ga0207656_10037417 | Ga0207656_100374172 | 66 |
| 587 | 3300025321 | Ga0207656_10041702 | Ga0207656_100417022 | 66 |
| 588 | 3300025321 | Ga0207656_10053773 | Ga0207656_100537733 | 66 |
| 589 | 3300025321 | Ga0207656_10125465 | Ga0207656_101254652 | 66 |
| 590 | 3300025321 | Ga0207656_10152199 | Ga0207656_101521991 | 66 |
| 591 | 3300025321 | Ga0207656_10174028 | Ga0207656_101740281 | 66 |
| 592 | 3300025885 | Ga0207653_10025536 | Ga0207653_100255362 | 66 |
| 593 | 3300025898 | Ga0207692_10354659 | Ga0207692_103546592 | 66 |
| 594 | 3300025899 | Ga0207642_10611080 | Ga0207642_106110802 | 66 |
| 595 | 3300025900 | Ga0207710_10000588 | Ga0207710_1000058815 | 66 |
| 596 | 3300025900 | Ga0207710_10003146 | Ga0207710_100031465 | 66 |
| 597 | 3300025903 | Ga0207680_10117960 | Ga0207680_101179603 | 66 |
| 598 | 3300025903 | Ga0207680_10400440 | Ga0207680_104004402 | 66 |
| 599 | 3300025903 | Ga0207680_11160758 | Ga0207680_111607581 | 66 |
| 600 | 3300025903 | Ga0207680_11173883 | Ga0207680_111738831 | 66 |
| 601 | 3300025904 | Ga0207647_10002966 | Ga0207647_1000296616 | 66 |
| 602 | 3300025904 | Ga0207647_10004432 | Ga0207647_100044325 | 66 |
| 603 | 3300025904 | Ga0207647_10077713 | Ga0207647_100777134 | 66 |
| 604 | 3300025904 | Ga0207647_10200990 | Ga0207647_102009901 | 66 |
| 605 | 3300025904 | Ga0207647_10304595 | Ga0207647_103045951 | 66 |
| 606 | 3300025905 | Ga0207685_10410651 | Ga0207685_104106511 | 66 |
| 607 | 3300025906 | Ga0207699_10218508 | Ga0207699_102185082 | 66 |
| 608 | 3300025908 | Ga0207643_10108112 | Ga0207643_101081124 | 66 |
| 609 | 3300025908 | Ga0207643_10166603 | Ga0207643_101666032 | 66 |
| 610 | 3300025909 | Ga0207705_10038112 | Ga0207705_100381123 | 66 |
| 611 | 3300025909 | Ga0207705_10043220 | Ga0207705_100432204 | 66 |
| 612 | 3300025909 | Ga0207705_10067892 | Ga0207705_100678924 | 66 |
| 613 | 3300025909 | Ga0207705_10079141 | Ga0207705_100791412 | 66 |
| 614 | 3300025909 | Ga0207705_10091806 | Ga0207705_100918062 | 66 |
| 615 | 3300025909 | Ga0207705_10290082 | Ga0207705_102900822 | 66 |
| 616 | 3300025910 | Ga0207684_10002399 | Ga0207684_100023996 | 66 |
| 617 | 3300025910 | Ga0207684_10008061 | Ga0207684_100080616 | 66 |
| 618 | 3300025910 | Ga0207684_10008061 | Ga0207684_100080617 | 66 |
| 619 | 3300025910 | Ga0207684_10369518 | Ga0207684_103695182 | 66 |
| 620 | 3300025911 | Ga0207654_10000206 | Ga0207654_1000020620 | 66 |
| 621 | 3300025911 | Ga0207654_10000297 | Ga0207654_100002977 | 66 |
| 622 | 3300025911 | Ga0207654_10000359 | Ga0207654_1000035921 | 66 |
| 623 | 3300025911 | Ga0207654_10022335 | Ga0207654_100223352 | 66 |
| 624 | 3300025911 | Ga0207654_10025493 | Ga0207654_100254932 | 66 |
| 625 | 3300025911 | Ga0207654_10206174 | Ga0207654_102061742 | 66 |
| 626 | 3300025911 | Ga0207654_10816642 | Ga0207654_108166422 | 66 |
| 627 | 3300025911 | Ga0207654_11078515 | Ga0207654_110785152 | 66 |
| 628 | 3300025912 | Ga0207707_10022424 | Ga0207707_100224245 | 66 |
| 629 | 3300025912 | Ga0207707_10081738 | Ga0207707_100817385 | 66 |
| 630 | 3300025912 | Ga0207707_10718019 | Ga0207707_107180192 | 66 |
| 631 | 3300025912 | Ga0207707_10780112 | Ga0207707_107801122 | 66 |
| 632 | 3300025912 | Ga0207707_11128413 | Ga0207707_111284132 | 66 |
| 633 | 3300025912 | Ga0207707_11303555 | Ga0207707_113035552 | 66 |
| 634 | 3300025913 | Ga0207695_10000030 | Ga0207695_10000030364 | 66 |
| 635 | 3300025913 | Ga0207695_10000115 | Ga0207695_1000011576 | 66 |
| 636 | 3300025913 | Ga0207695_10000292 | Ga0207695_100002926 | 66 |
| 637 | 3300025913 | Ga0207695_10001293 | Ga0207695_1000129321 | 66 |
| 638 | 3300025913 | Ga0207695_10001801 | Ga0207695_1000180121 | 66 |
| 639 | 3300025913 | Ga0207695_10024299 | Ga0207695_100242993 | 66 |
| 640 | 3300025913 | Ga0207695_10039759 | Ga0207695_100397594 | 66 |
| 641 | 3300025913 | Ga0207695_10059231 | Ga0207695_100592315 | 66 |
| 642 | 3300025913 | Ga0207695_10080227 | Ga0207695_100802274 | 66 |
| 643 | 3300025913 | Ga0207695_10338825 | Ga0207695_103388252 | 66 |
| 644 | 3300025913 | Ga0207695_10731028 | Ga0207695_107310281 | 66 |
| 645 | 3300025913 | Ga0207695_10914230 | Ga0207695_109142303 | 66 |
| 646 | 3300025913 | Ga0207695_11213165 | Ga0207695_112131651 | 66 |
| 647 | 3300025913 | Ga0207695_11523391 | Ga0207695_115233911 | 66 |
| 648 | 3300025914 | Ga0207671_10000047 | Ga0207671_1000004721 | 66 |
| 649 | 3300025914 | Ga0207671_10000376 | Ga0207671_1000037614 | 66 |
| 650 | 3300025914 | Ga0207671_10000503 | Ga0207671_100005035 | 66 |
| 651 | 3300025914 | Ga0207671_10355186 | Ga0207671_103551861 | 66 |
| 652 | 3300025914 | Ga0207671_10578413 | Ga0207671_105784132 | 66 |
| 653 | 3300025914 | Ga0207671_10654782 | Ga0207671_106547822 | 66 |
| 654 | 3300025914 | Ga0207671_11078163 | Ga0207671_110781631 | 66 |
| 655 | 3300025914 | Ga0207671_11265664 | Ga0207671_112656642 | 66 |
| 656 | 3300025914 | Ga0207671_11529080 | Ga0207671_115290801 | 66 |
| 657 | 3300025915 | Ga0207693_10151955 | Ga0207693_101519552 | 66 |
| 658 | 3300025916 | Ga0207663_10371000 | Ga0207663_103710001 | 66 |
| 659 | 3300025916 | Ga0207663_11272941 | Ga0207663_112729412 | 66 |
| 660 | 3300025917 | Ga0207660_10036090 | Ga0207660_100360902 | 66 |
| 661 | 3300025917 | Ga0207660_10179686 | Ga0207660_101796862 | 66 |
| 662 | 3300025917 | Ga0207660_10359216 | Ga0207660_103592163 | 66 |
| 663 | 3300025917 | Ga0207660_10649458 | Ga0207660_106494582 | 66 |
| 664 | 3300025917 | Ga0207660_10799138 | Ga0207660_107991382 | 66 |
| 665 | 3300025917 | Ga0207660_11708150 | Ga0207660_117081501 | 66 |
| 666 | 3300025917 | Ga0207660_11735733 | Ga0207660_117357332 | 66 |
| 667 | 3300025919 | Ga0207657_10055732 | Ga0207657_100557325 | 66 |
| 668 | 3300025919 | Ga0207657_10454039 | Ga0207657_104540392 | 66 |
| 669 | 3300025919 | Ga0207657_10458444 | Ga0207657_104584442 | 66 |
| 670 | 3300025920 | Ga0207649_10003968 | Ga0207649_100039683 | 66 |
| 671 | 3300025920 | Ga0207649_10033554 | Ga0207649_100335543 | 66 |
| 672 | 3300025920 | Ga0207649_10039732 | Ga0207649_100397323 | 66 |
| 673 | 3300025920 | Ga0207649_10043161 | Ga0207649_100431612 | 66 |
| 674 | 3300025920 | Ga0207649_11278902 | Ga0207649_112789022 | 66 |
| 675 | 3300025920 | Ga0207649_11334758 | Ga0207649_113347581 | 66 |
| 676 | 3300025921 | Ga0207652_10027895 | Ga0207652_100278952 | 66 |
| 677 | 3300025921 | Ga0207652_10322810 | Ga0207652_103228101 | 66 |
| 678 | 3300025921 | Ga0207652_10481105 | Ga0207652_104811051 | 66 |
| 679 | 3300025921 | Ga0207652_11026017 | Ga0207652_110260171 | 66 |
| 680 | 3300025921 | Ga0207652_11041720 | Ga0207652_110417201 | 66 |
| 681 | 3300025921 | Ga0207652_11814326 | Ga0207652_118143261 | 66 |
| 682 | 3300025922 | Ga0207646_10021267 | Ga0207646_100212677 | 66 |
| 683 | 3300025922 | Ga0207646_10087235 | Ga0207646_100872352 | 66 |
| 684 | 3300025922 | Ga0207646_10087235 | Ga0207646_100872353 | 66 |
| 685 | 3300025922 | Ga0207646_10145937 | Ga0207646_101459372 | 66 |
| 686 | 3300025922 | Ga0207646_10812829 | Ga0207646_108128292 | 66 |
| 687 | 3300025922 | Ga0207646_10994821 | Ga0207646_109948212 | 66 |
| 688 | 3300025923 | Ga0207681_10023444 | Ga0207681_100234443 | 66 |
| 689 | 3300025923 | Ga0207681_10341882 | Ga0207681_103418822 | 66 |
| 690 | 3300025924 | Ga0207694_10000167 | Ga0207694_1000016740 | 66 |
| 691 | 3300025924 | Ga0207694_10000497 | Ga0207694_1000049710 | 66 |
| 692 | 3300025924 | Ga0207694_10000697 | Ga0207694_1000069712 | 66 |
| 693 | 3300025924 | Ga0207694_10172613 | Ga0207694_101726133 | 66 |
| 694 | 3300025924 | Ga0207694_10251409 | Ga0207694_102514094 | 66 |
| 695 | 3300025924 | Ga0207694_10272387 | Ga0207694_102723871 | 66 |
| 696 | 3300025924 | Ga0207694_10347444 | Ga0207694_103474442 | 66 |
| 697 | 3300025924 | Ga0207694_10416483 | Ga0207694_104164832 | 66 |
| 698 | 3300025924 | Ga0207694_10447894 | Ga0207694_104478941 | 66 |
| 699 | 3300025924 | Ga0207694_10477081 | Ga0207694_104770812 | 66 |
| 700 | 3300025924 | Ga0207694_11508536 | Ga0207694_115085362 | 66 |
| 701 | 3300025924 | Ga0207694_11551868 | Ga0207694_115518681 | 66 |
| 702 | 3300025925 | Ga0207650_10000090 | Ga0207650_1000009060 | 66 |
| 703 | 3300025925 | Ga0207650_10004940 | Ga0207650_100049407 | 66 |
| 704 | 3300025925 | Ga0207650_10008028 | Ga0207650_100080286 | 66 |
| 705 | 3300025925 | Ga0207650_11636668 | Ga0207650_116366682 | 66 |
| 706 | 3300025926 | Ga0207659_10111305 | Ga0207659_101113053 | 66 |
| 707 | 3300025926 | Ga0207659_10573328 | Ga0207659_105733282 | 66 |
| 708 | 3300025927 | Ga0207687_10000707 | Ga0207687_100007078 | 66 |
| 709 | 3300025927 | Ga0207687_10004473 | Ga0207687_100044735 | 66 |
| 710 | 3300025928 | Ga0207700_10118702 | Ga0207700_101187023 | 66 |
| 711 | 3300025928 | Ga0207700_10171687 | Ga0207700_101716872 | 66 |
| 712 | 3300025928 | Ga0207700_10225396 | Ga0207700_102253962 | 66 |
| 713 | 3300025928 | Ga0207700_10907348 | Ga0207700_109073482 | 66 |
| 714 | 3300025928 | Ga0207700_11118698 | Ga0207700_111186982 | 66 |
| 715 | 3300025928 | Ga0207700_11922991 | Ga0207700_119229912 | 66 |
| 716 | 3300025929 | Ga0207664_10068696 | Ga0207664_100686963 | 66 |
| 717 | 3300025929 | Ga0207664_10172892 | Ga0207664_101728922 | 66 |
| 718 | 3300025929 | Ga0207664_10414229 | Ga0207664_104142291 | 66 |
| 719 | 3300025929 | Ga0207664_10626290 | Ga0207664_106262901 | 66 |
| 720 | 3300025929 | Ga0207664_11135485 | Ga0207664_111354851 | 66 |
| 721 | 3300025929 | Ga0207664_11182020 | Ga0207664_111820202 | 66 |
| 722 | 3300025931 | Ga0207644_10011067 | Ga0207644_100110675 | 66 |
| 723 | 3300025931 | Ga0207644_10026155 | Ga0207644_100261552 | 66 |
| 724 | 3300025931 | Ga0207644_11693084 | Ga0207644_116930842 | 66 |
| 725 | 3300025932 | Ga0207690_10438378 | Ga0207690_104383781 | 66 |
| 726 | 3300025932 | Ga0207690_11448091 | Ga0207690_114480911 | 66 |
| 727 | 3300025933 | Ga0207706_10309935 | Ga0207706_103099351 | 66 |
| 728 | 3300025933 | Ga0207706_10815393 | Ga0207706_108153931 | 66 |
| 729 | 3300025934 | Ga0207686_10620172 | Ga0207686_106201722 | 66 |
| 730 | 3300025935 | Ga0207709_10105625 | Ga0207709_101056251 | 66 |
| 731 | 3300025935 | Ga0207709_10869581 | Ga0207709_108695811 | 66 |
| 732 | 3300025936 | Ga0207670_10119215 | Ga0207670_101192151 | 66 |
| 733 | 3300025938 | Ga0207704_10191130 | Ga0207704_101911301 | 66 |
| 734 | 3300025938 | Ga0207704_10665001 | Ga0207704_106650011 | 66 |
| 735 | 3300025939 | Ga0207665_10109296 | Ga0207665_101092962 | 66 |
| 736 | 3300025939 | Ga0207665_10316082 | Ga0207665_103160822 | 66 |
| 737 | 3300025939 | Ga0207665_10627105 | Ga0207665_106271052 | 66 |
| 738 | 3300025940 | Ga0207691_10037179 | Ga0207691_100371796 | 66 |
| 739 | 3300025940 | Ga0207691_11658093 | Ga0207691_116580932 | 66 |
| 740 | 3300025941 | Ga0207711_10001551 | Ga0207711_1000155114 | 66 |
| 741 | 3300025941 | Ga0207711_10015108 | Ga0207711_100151083 | 66 |
| 742 | 3300025941 | Ga0207711_10022270 | Ga0207711_100222703 | 66 |
| 743 | 3300025941 | Ga0207711_10950798 | Ga0207711_109507981 | 66 |
| 744 | 3300025942 | Ga0207689_10001472 | Ga0207689_100014723 | 66 |
| 745 | 3300025942 | Ga0207689_10058806 | Ga0207689_100588068 | 66 |
| 746 | 3300025942 | Ga0207689_10065263 | Ga0207689_100652633 | 66 |
| 747 | 3300025944 | Ga0207661_10008793 | Ga0207661_100087936 | 66 |
| 748 | 3300025944 | Ga0207661_10013851 | Ga0207661_100138519 | 66 |
| 749 | 3300025944 | Ga0207661_10020092 | Ga0207661_100200922 | 66 |
| 750 | 3300025944 | Ga0207661_10127022 | Ga0207661_101270224 | 66 |
| 751 | 3300025944 | Ga0207661_10260181 | Ga0207661_102601811 | 66 |
| 752 | 3300025944 | Ga0207661_10354944 | Ga0207661_103549443 | 66 |
| 753 | 3300025944 | Ga0207661_10638177 | Ga0207661_106381772 | 66 |
| 754 | 3300025945 | Ga0207679_10004118 | Ga0207679_1000411818 | 66 |
| 755 | 3300025945 | Ga0207679_10050322 | Ga0207679_100503223 | 66 |
| 756 | 3300025945 | Ga0207679_10053711 | Ga0207679_100537113 | 66 |
| 757 | 3300025945 | Ga0207679_11209541 | Ga0207679_112095411 | 66 |
| 758 | 3300025949 | Ga0207667_10001336 | Ga0207667_100013367 | 66 |
| 759 | 3300025949 | Ga0207667_10002403 | Ga0207667_100024032 | 66 |
| 760 | 3300025949 | Ga0207667_10002664 | Ga0207667_100026648 | 66 |
| 761 | 3300025949 | Ga0207667_10024876 | Ga0207667_100248766 | 66 |
| 762 | 3300025949 | Ga0207667_10040027 | Ga0207667_100400274 | 66 |
| 763 | 3300025949 | Ga0207667_10158526 | Ga0207667_101585262 | 66 |
| 764 | 3300025949 | Ga0207667_10427487 | Ga0207667_104274871 | 66 |
| 765 | 3300025949 | Ga0207667_10615428 | Ga0207667_106154283 | 66 |
| 766 | 3300025949 | Ga0207667_10990505 | Ga0207667_109905051 | 66 |
| 767 | 3300025949 | Ga0207667_11401431 | Ga0207667_114014311 | 66 |
| 768 | 3300025960 | Ga0207651_10044357 | Ga0207651_100443572 | 66 |
| 769 | 3300025961 | Ga0207712_10112929 | Ga0207712_101129292 | 66 |
| 770 | 3300025981 | Ga0207640_10007046 | Ga0207640_100070465 | 66 |
| 771 | 3300025981 | Ga0207640_10096947 | Ga0207640_100969473 | 66 |
| 772 | 3300025981 | Ga0207640_10135791 | Ga0207640_101357912 | 66 |
| 773 | 3300025981 | Ga0207640_10959901 | Ga0207640_109599012 | 66 |
| 774 | 3300025981 | Ga0207640_11479469 | Ga0207640_114794692 | 66 |
| 775 | 3300025986 | Ga0207658_10000076 | Ga0207658_1000007618 | 66 |
| 776 | 3300025986 | Ga0207658_10001070 | Ga0207658_100010704 | 66 |
| 777 | 3300025986 | Ga0207658_10505324 | Ga0207658_105053242 | 66 |
| 778 | 3300025986 | Ga0207658_10612754 | Ga0207658_106127541 | 66 |
| 779 | 3300025986 | Ga0207658_11851351 | Ga0207658_118513511 | 66 |
| 780 | 3300026023 | Ga0207677_10000052 | Ga0207677_1000005276 | 66 |
| 781 | 3300026023 | Ga0207677_10000055 | Ga0207677_100000556 | 66 |
| 782 | 3300026023 | Ga0207677_10384170 | Ga0207677_103841701 | 66 |
| 783 | 3300026023 | Ga0207677_11712607 | Ga0207677_117126071 | 66 |
| 784 | 3300026023 | Ga0207677_12176730 | Ga0207677_121767301 | 66 |
| 785 | 3300026035 | Ga0207703_10007880 | Ga0207703_100078804 | 66 |
| 786 | 3300026035 | Ga0207703_10009922 | Ga0207703_100099225 | 66 |
| 787 | 3300026035 | Ga0207703_10591702 | Ga0207703_105917021 | 66 |
| 788 | 3300026035 | Ga0207703_10600440 | Ga0207703_106004401 | 66 |
| 789 | 3300026035 | Ga0207703_10823369 | Ga0207703_108233692 | 66 |
| 790 | 3300026035 | Ga0207703_11013236 | Ga0207703_110132361 | 66 |
| 791 | 3300026041 | Ga0207639_10000107 | Ga0207639_1000010721 | 66 |
| 792 | 3300026041 | Ga0207639_10059439 | Ga0207639_100594393 | 66 |
| 793 | 3300026041 | Ga0207639_10241487 | Ga0207639_102414873 | 66 |
| 794 | 3300026041 | Ga0207639_10264192 | Ga0207639_102641921 | 66 |
| 795 | 3300026041 | Ga0207639_10357570 | Ga0207639_103575701 | 66 |
| 796 | 3300026041 | Ga0207639_10829943 | Ga0207639_108299432 | 66 |
| 797 | 3300026067 | Ga0207678_10046048 | Ga0207678_100460484 | 66 |
| 798 | 3300026067 | Ga0207678_10071390 | Ga0207678_100713903 | 66 |
| 799 | 3300026067 | Ga0207678_10517196 | Ga0207678_105171962 | 66 |
| 800 | 3300026067 | Ga0207678_10818184 | Ga0207678_108181842 | 66 |
| 801 | 3300026067 | Ga0207678_11387184 | Ga0207678_113871841 | 66 |
| 802 | 3300026067 | Ga0207678_11689686 | Ga0207678_116896861 | 66 |
| 803 | 3300026078 | Ga0207702_10002652 | Ga0207702_100026528 | 66 |
| 804 | 3300026078 | Ga0207702_10004569 | Ga0207702_100045696 | 66 |
| 805 | 3300026078 | Ga0207702_10015108 | Ga0207702_100151085 | 66 |
| 806 | 3300026078 | Ga0207702_10021369 | Ga0207702_100213693 | 66 |
| 807 | 3300026078 | Ga0207702_10130442 | Ga0207702_101304422 | 66 |
| 808 | 3300026078 | Ga0207702_10160985 | Ga0207702_101609852 | 66 |
| 809 | 3300026078 | Ga0207702_10215121 | Ga0207702_102151212 | 66 |
| 810 | 3300026078 | Ga0207702_10628458 | Ga0207702_106284582 | 66 |
| 811 | 3300026078 | Ga0207702_10855614 | Ga0207702_108556142 | 66 |
| 812 | 3300026078 | Ga0207702_11020102 | Ga0207702_110201021 | 66 |
| 813 | 3300026088 | Ga0207641_10000694 | Ga0207641_1000069412 | 66 |
| 814 | 3300026088 | Ga0207641_10001842 | Ga0207641_1000184219 | 66 |
| 815 | 3300026088 | Ga0207641_10031063 | Ga0207641_100310633 | 66 |
| 816 | 3300026089 | Ga0207648_11888125 | Ga0207648_118881251 | 66 |
| 817 | 3300026095 | Ga0207676_10002573 | Ga0207676_100025734 | 66 |
| 818 | 3300026095 | Ga0207676_10004619 | Ga0207676_1000461918 | 66 |
| 819 | 3300026095 | Ga0207676_11280727 | Ga0207676_112807272 | 66 |
| 820 | 3300026116 | Ga0207674_10000840 | Ga0207674_100008406 | 66 |
| 821 | 3300026116 | Ga0207674_10002679 | Ga0207674_100026797 | 66 |
| 822 | 3300026116 | Ga0207674_10003714 | Ga0207674_1000371411 | 66 |
| 823 | 3300026116 | Ga0207674_10004127 | Ga0207674_1000412714 | 66 |
| 824 | 3300026116 | Ga0207674_10018373 | Ga0207674_100183735 | 66 |
| 825 | 3300026116 | Ga0207674_10022509 | Ga0207674_100225096 | 66 |
| 826 | 3300026116 | Ga0207674_10024242 | Ga0207674_100242423 | 66 |
| 827 | 3300026116 | Ga0207674_10036924 | Ga0207674_100369244 | 66 |
| 828 | 3300026116 | Ga0207674_10198809 | Ga0207674_101988092 | 66 |
| 829 | 3300026116 | Ga0207674_10217646 | Ga0207674_102176463 | 66 |
| 830 | 3300026116 | Ga0207674_11430623 | Ga0207674_114306232 | 66 |
| 831 | 3300026142 | Ga0207698_10000011 | Ga0207698_1000001186 | 66 |
| 832 | 3300026142 | Ga0207698_10000059 | Ga0207698_1000005939 | 66 |
| 833 | 3300026142 | Ga0207698_10000239 | Ga0207698_1000023921 | 66 |
| 834 | 3300026142 | Ga0207698_10036972 | Ga0207698_100369723 | 66 |
| 835 | 3300026142 | Ga0207698_10038724 | Ga0207698_100387242 | 66 |
| 836 | 3300026142 | Ga0207698_10057267 | Ga0207698_100572673 | 66 |
| 837 | 3300026142 | Ga0207698_10091253 | Ga0207698_100912532 | 66 |
| 838 | 3300026142 | Ga0207698_10889964 | Ga0207698_108899642 | 66 |
| 839 | 3300026142 | Ga0207698_12020430 | Ga0207698_120204301 | 66 |
| 840 | 3300026142 | Ga0207698_12664499 | Ga0207698_126644991 | 66 |
| 841 | 3300026142 | Ga0207698_12718232 | Ga0207698_127182322 | 66 |
| 842 | 3300027671 | Ga0209588_1000776 | Ga0209588_10007761 | 66 |
| 843 | 3300027671 | Ga0209588_1248218 | Ga0209588_12482181 | 66 |
| 844 | 3300027866 | Ga0209813_10114637 | Ga0209813_101146372 | 66 |
| 845 | 3300027907 | Ga0207428_10000299 | Ga0207428_1000029915 | 66 |
| 846 | 3300028017 | Ga0265356_1005931 | Ga0265356_10059312 | 66 |
| 847 | 3300028379 | Ga0268266_10007211 | Ga0268266_100072115 | 66 |
| 848 | 3300028379 | Ga0268266_10373157 | Ga0268266_103731573 | 66 |
| 849 | 3300028379 | Ga0268266_10427715 | Ga0268266_104277151 | 66 |
| 850 | 3300028379 | Ga0268266_10461543 | Ga0268266_104615431 | 66 |
| 851 | 3300028379 | Ga0268266_10644192 | Ga0268266_106441922 | 66 |
| 852 | 3300028379 | Ga0268266_10688369 | Ga0268266_106883691 | 66 |
| 853 | 3300028380 | Ga0268265_10028181 | Ga0268265_100281814 | 66 |
| 854 | 3300028380 | Ga0268265_10053823 | Ga0268265_100538232 | 66 |
| 855 | 3300028380 | Ga0268265_10147657 | Ga0268265_101476572 | 66 |
| 856 | 3300028380 | Ga0268265_10414234 | Ga0268265_104142341 | 66 |
| 857 | 3300028381 | Ga0268264_10001263 | Ga0268264_1000126313 | 66 |
| 858 | 3300028381 | Ga0268264_11149932 | Ga0268264_111499321 | 66 |
| 859 | 3300028381 | Ga0268264_11271649 | Ga0268264_112716492 | 66 |
| 860 | 3300028381 | Ga0268264_11526328 | Ga0268264_115263281 | 66 |
| 861 | 3300028653 | Ga0265323_10043562 | Ga0265323_100435622 | 66 |
| 862 | 3300028653 | Ga0265323_10085533 | Ga0265323_100855331 | 66 |
| 863 | 3300028800 | Ga0265338_10263239 | Ga0265338_102632392 | 66 |
| 864 | 3300030760 | Ga0265762_1004180 | Ga0265762_10041804 | 66 |
| 865 | 3300030762 | Ga0265775_105134 | Ga0265775_1051341 | 66 |
| 866 | 3300030863 | Ga0265766_1019194 | Ga0265766_10191941 | 66 |
| 867 | 3300030877 | Ga0265777_102106 | Ga0265777_1021062 | 66 |
| 868 | 3300030882 | Ga0265764_103914 | Ga0265764_1039141 | 66 |
| 869 | 3300030882 | Ga0265764_114819 | Ga0265764_1148191 | 66 |
| 870 | 3300030888 | Ga0265769_116386 | Ga0265769_1163861 | 66 |
| 871 | 3300030889 | Ga0265761_102203 | Ga0265761_1022032 | 66 |
| 872 | 3300031010 | Ga0265771_1016502 | Ga0265771_10165021 | 66 |
| 873 | 3300031011 | Ga0265774_105592 | Ga0265774_1055922 | 66 |
| 874 | 3300031043 | Ga0265779_109831 | Ga0265779_1098312 | 66 |
| 875 | 3300031090 | Ga0265760_10113032 | Ga0265760_101130323 | 66 |
| 876 | 3300031090 | Ga0265760_10185526 | Ga0265760_101855262 | 66 |
| 877 | 3300031235 | Ga0265330_10385663 | Ga0265330_103856632 | 66 |
| 878 | 3300031249 | Ga0265339_10251993 | Ga0265339_102519932 | 66 |
| 879 | 3300031344 | Ga0265316_10088468 | Ga0265316_100884681 | 66 |
| 880 | 3300031344 | Ga0265316_10312576 | Ga0265316_103125761 | 66 |
| 881 | 3300031344 | Ga0265316_10496870 | Ga0265316_104968701 | 66 |
| 882 | 3300031548 | Ga0307408_100015742 | Ga0307408_1000157421 | 66 |
| 883 | 3300031731 | Ga0307405_10042021 | Ga0307405_100420212 | 66 |
| 884 | 3300031824 | Ga0307413_10751178 | Ga0307413_107511781 | 66 |
| 885 | 3300031852 | Ga0307410_10006891 | Ga0307410_100068912 | 66 |
| 886 | 3300031852 | Ga0307410_10006891 | Ga0307410_100068915 | 66 |
| 887 | 3300031901 | Ga0307406_10688427 | Ga0307406_106884271 | 66 |
| 888 | 3300031903 | Ga0307407_10464666 | Ga0307407_104646661 | 66 |
| 889 | 3300031903 | Ga0307407_11710558 | Ga0307407_117105581 | 66 |
| 890 | 3300031911 | Ga0307412_10366635 | Ga0307412_103666351 | 66 |
| 891 | 3300031911 | Ga0307412_10435107 | Ga0307412_104351071 | 66 |
| 892 | 3300031995 | Ga0307409_100091567 | Ga0307409_1000915672 | 66 |
| 893 | 3300031995 | Ga0307409_100833547 | Ga0307409_1008335471 | 66 |
| 894 | 3300032002 | Ga0307416_100012293 | Ga0307416_1000122933 | 66 |
| 895 | 3300032002 | Ga0307416_100339700 | Ga0307416_1003397002 | 66 |
| 896 | 3300032005 | Ga0307411_10002046 | Ga0307411_100020466 | 66 |
| 897 | 3300032005 | Ga0307411_10650537 | Ga0307411_106505372 | 66 |
| 898 | 3300032120 | Ga0316053_110382 | Ga0316053_1103822 | 66 |
| 899 | 3300032126 | Ga0307415_100001842 | Ga0307415_1000018428 | 66 |
| 900 | 3300032126 | Ga0307415_100034041 | Ga0307415_1000340413 | 66 |
| 901 | 3300033180 | Ga0307510_10142569 | Ga0307510_101425691 | 66 |
| 902 | 3300033180 | Ga0307510_10396785 | Ga0307510_103967852 | 66 |
| 903 | 3300033524 | Ga0316592_1087192 | Ga0316592_10871922 | 66 |
| 904 | 3300033529 | Ga0316587_1065459 | Ga0316587_10654591 | 66 |
| 905 | 3300034817 | Ga0373948_0023108 | Ga0373948_0023108_696_896 | 66 |
| 906 | 3300034819 | Ga0373958_0097486 | Ga0373958_0097486_77_277 | 66 |
| 907 | 3300035121 | Ga0373960_0374122 | Ga0373960_0374122_121_324 | 66 |
| 908 | 3300035170 | Ga0373943_0339941 | Ga0373943_0339941_41_241 | 66 |
| 909 | 3300035170 | Ga0373943_0542642 | Ga0373943_0542642_39_239 | 66 |
| 910 | 3300035172 | Ga0373955_0564235 | Ga0373955_0564235_388_588 | 66 |
| 911 | 3300035691 | Ga0373931_1245041 | Ga0373931_1245041_156_356 | 66 |
| 912 | 3300035724 | Ga0373933_0922133 | Ga0373933_0922133_146_346 | 66 |
| 913 | 3300036401 | Ga0373937_0261190 | Ga0373937_0261190_305_505 | 66 |
| 914 | 3300036401 | Ga0373937_0293875 | Ga0373937_0293875_691_891 | 66 |
| 915 | 3300036401 | Ga0373937_1345160 | Ga0373937_1345160_228_428 | 66 |
| 916 | 3300036401 | Ga0373937_1626959 | Ga0373937_1626959_245_445 | 66 |
| 917 | 3300036457 | Ga0265778_059849 | Ga0265778_059849_95_295 | 66 |
| 918 | 3300037068 | Ga0373925_1162772 | Ga0373925_1162772_108_308 | 66 |
| 919 | 3300037312 | Ga0395899_0012994 | Ga0395899_0012994_488_691 | 66 |
| 920 | 3300037418 | Ga0395900_0007414 | Ga0395900_0007414_6170_6373 | 66 |
| 921 | 3300037418 | Ga0395900_0349337 | Ga0395900_0349337_1142_1342 | 66 |
| 922 | 3300037418 | Ga0395900_0836116 | Ga0395900_0836116_173_373 | 66 |
| 923 | 3300037418 | Ga0395900_1085642 | Ga0395900_1085642_271_471 | 66 |
| 924 | 3300037418 | Ga0395900_1186080 | Ga0395900_1186080_89_289 | 66 |
| 925 | 3300037418 | Ga0395900_1205976 | Ga0395900_1205976_198_398 | 66 |
| 926 | 3300037471 | Ga0395905_0008077 | Ga0395905_0008077_2559_2759 | 66 |
| 927 | 3300037471 | Ga0395905_0025215 | Ga0395905_0025215_5216_5419 | 66 |
| 928 | 3300037471 | Ga0395905_0027436 | Ga0395905_0027436_4085_4285 | 66 |
| 929 | 3300037471 | Ga0395905_0040790 | Ga0395905_0040790_411_611 | 66 |
| 930 | 3300037471 | Ga0395905_0102839 | Ga0395905_0102839_1267_1467 | 66 |
| 931 | 3300038443 | Ga0395901_0629557 | Ga0395901_0629557_130_330 | 66 |
| 932 | 3300039437 | Ga0436365_0395743 | Ga0436365_0395743_481_681 | 66 |
| 933 | 3300039437 | Ga0436365_1543233 | Ga0436365_1543233_397_597 | 66 |
| 934 | 3300039447 | Ga0436361_0510228 | Ga0436361_0510228_3496_3696 | 66 |
| 935 | 3300039447 | Ga0436361_0520510 | Ga0436361_0520510_1396_1596 | 66 |
| 936 | 3300039450 | Ga0436363_1107256 | Ga0436363_1107256_409_609 | 66 |
| 937 | 3300039450 | Ga0436363_1532784 | Ga0436363_1532784_2072_2287 | 66 |
| 938 | 3300039453 | Ga0436362_1101430 | Ga0436362_1101430_66_281 | 66 |
| 939 | 3300039453 | Ga0436362_1298094 | Ga0436362_1298094_165_365 | 66 |
| 940 | 3300041451 | Ga0451791_0865225 | Ga0451791_0865225_198_398 | 66 |
| 941 | 3300042001 | Ga0439441_025853 | Ga0439441_025853_88_288 | 66 |
| 942 | 3300042005 | Ga0439448_0137098 | Ga0439448_0137098_228_428 | 66 |
| 943 | 3300042005 | Ga0439448_0219088 | Ga0439448_0219088_131_331 | 66 |
| 944 | 3300042005 | Ga0439448_0283232 | Ga0439448_0283232_285_485 | 66 |
| 945 | 3300042125 | Ga0450923_053088 | Ga0450923_053088_609_809 | 66 |
| 946 | 3300042156 | Ga0439446_0329524 | Ga0439446_0329524_86_286 | 66 |
| 947 | 3300042876 | Ga0451577_0000818 | Ga0451577_0000818_13355_13555 | 66 |
| 948 | 3300042876 | Ga0451577_0006524 | Ga0451577_0006524_7172_7372 | 66 |
| 949 | 3300042876 | Ga0451577_0024652 | Ga0451577_0024652_2935_3135 | 66 |
| 950 | 3300042876 | Ga0451577_0255218 | Ga0451577_0255218_673_873 | 66 |
| 951 | 3300042876 | Ga0451577_0737630 | Ga0451577_0737630_46_252 | 66 |
| 952 | 3300044673 | Ga0453683_0016561 | Ga0453683_0016561_475_675 | 66 |
| 953 | 3300044673 | Ga0453683_0107458 | Ga0453683_0107458_1370_1570 | 66 |
| 954 | 3300044673 | Ga0453683_0185002 | Ga0453683_0185002_167_367 | 66 |
| 955 | 3300044673 | Ga0453683_0367380 | Ga0453683_0367380_441_641 | 66 |
| 956 | 3300044673 | Ga0453683_0410522 | Ga0453683_0410522_235_435 | 66 |
| 957 | 3300044673 | Ga0453683_0768716 | Ga0453683_0768716_389_589 | 66 |
| 958 | 3300044694 | Ga0466963_0025542 | Ga0466963_0025542_3199_3399 | 66 |
| 959 | 3300044694 | Ga0466963_0036270 | Ga0466963_0036270_2829_3029 | 66 |
| 960 | 3300044694 | Ga0466963_0038283 | Ga0466963_0038283_2719_2919 | 66 |
| 961 | 3300044712 | Ga0453684_0000803 | Ga0453684_0000803_23044_23244 | 66 |
| 962 | 3300044712 | Ga0453684_0036556 | Ga0453684_0036556_265_465 | 66 |
| 963 | 3300044712 | Ga0453684_0055242 | Ga0453684_0055242_291_491 | 66 |
| 964 | 3300044712 | Ga0453684_0408943 | Ga0453684_0408943_615_815 | 66 |
| 965 | 3300044712 | Ga0453684_0831858 | Ga0453684_0831858_682_882 | 66 |
| 966 | 3300044712 | Ga0453684_2033838 | Ga0453684_2033838_333_533 | 66 |
| 967 | 3300044712 | Ga0453684_2066447 | Ga0453684_2066447_159_359 | 66 |
| 968 | 3300044712 | Ga0453684_2316097 | Ga0453684_2316097_131_337 | 66 |
| 969 | 3300044719 | Ga0466971_0322344 | Ga0466971_0322344_328_528 | 66 |
| 970 | 3300045049 | Ga0466959_0141489 | Ga0466959_0141489_954_1154 | 66 |
| 971 | 3300045049 | Ga0466959_0851990 | Ga0466959_0851990_27_227 | 66 |
| 972 | 3300045051 | Ga0451576_0006949 | Ga0451576_0006949_1786_1986 | 66 |
| 973 | 3300045051 | Ga0451576_0014212 | Ga0451576_0014212_5589_5789 | 66 |
| 974 | 3300045051 | Ga0451576_0453443 | Ga0451576_0453443_314_514 | 66 |
| 975 | 3300045051 | Ga0451576_0523969 | Ga0451576_0523969_218_418 | 66 |
| 976 | 3300045051 | Ga0451576_1872935 | Ga0451576_1872935_125_325 | 66 |
| 977 | 3300045836 | Ga0466958_0558685 | Ga0466958_0558685_34_234 | 66 |
| 978 | 3300045836 | Ga0466958_0584301 | Ga0466958_0584301_83_283 | 66 |
| 979 | 3300045836 | Ga0466958_0730860 | Ga0466958_0730860_246_446 | 66 |
| 980 | 3300045976 | Ga0466967_0001802 | Ga0466967_0001802_5123_5323 | 66 |
| 981 | 3300045976 | Ga0466967_0575472 | Ga0466967_0575472_782_982 | 66 |
| 982 | 3300045976 | Ga0466967_1239922 | Ga0466967_1239922_301_501 | 66 |
| 983 | 3300045976 | Ga0466967_1339251 | Ga0466967_1339251_171_371 | 66 |
| 984 | 3300045976 | Ga0466967_1992178 | Ga0466967_1992178_367_567 | 66 |
| 985 | 3300046457 | Ga0495590_0086527 | Ga0495590_0086527_685_885 | 66 |
| 986 | 3300046462 | Ga0495651_0046854 | Ga0495651_0046854_2984_3184 | 66 |
| 987 | 3300046462 | Ga0495651_0764995 | Ga0495651_0764995_118_318 | 66 |
| 988 | 3300046463 | Ga0495653_0389928 | Ga0495653_0389928_274_474 | 66 |
| 989 | 3300046472 | Ga0495580_0363815 | Ga0495580_0363815_356_556 | 66 |
| 990 | 3300046473 | Ga0495582_0328891 | Ga0495582_0328891_140_340 | 66 |
| 991 | 3300046475 | Ga0495639_0298439 | Ga0495639_0298439_567_773 | 66 |
| 992 | 3300046477 | Ga0495664_0279670 | Ga0495664_0279670_226_426 | 66 |
| 993 | 3300046506 | Ga0495583_0344635 | Ga0495583_0344635_250_450 | 66 |
| 994 | 3300046511 | Ga0495608_0884909 | Ga0495608_0884909_157_357 | 66 |
| 995 | 3300046516 | Ga0495628_0915778 | Ga0495628_0915778_371_571 | 66 |
| 996 | 3300046522 | Ga0495643_0115001 | Ga0495643_0115001_1091_1291 | 66 |
| 997 | 3300046529 | Ga0495652_0071133 | Ga0495652_0071133_895_1095 | 66 |
| 998 | 3300046529 | Ga0495652_0673866 | Ga0495652_0673866_300_500 | 66 |
| 999 | 3300046529 | Ga0495652_1009449 | Ga0495652_1009449_97_297 | 66 |
| 1000 | 3300046535 | Ga0495586_0368822 | Ga0495586_0368822_453_653 | 66 |
| 1001 | 3300046536 | Ga0495587_0113471 | Ga0495587_0113471_767_967 | 66 |
| 1002 | 3300046536 | Ga0495587_0709367 | Ga0495587_0709367_246_446 | 66 |
| 1003 | 3300046543 | Ga0495645_0000781 | Ga0495645_0000781_13165_13365 | 66 |
| 1004 | 3300046543 | Ga0495645_0018179 | Ga0495645_0018179_4819_5019 | 66 |
| 1005 | 3300046543 | Ga0495645_0550023 | Ga0495645_0550023_440_640 | 66 |
| 1006 | 3300046616 | Ga0495668_0585856 | Ga0495668_0585856_340_540 | 66 |
| 1007 | 3300046660 | Ga0495625_0063040 | Ga0495625_0063040_2187_2387 | 66 |
| 1008 | 3300046660 | Ga0495625_0892497 | Ga0495625_0892497_174_374 | 66 |
| 1009 | 3300046663 | Ga0495635_0161273 | Ga0495635_0161273_821_1021 | 66 |
| 1010 | 3300046663 | Ga0495635_0202143 | Ga0495635_0202143_557_757 | 66 |
| 1011 | 3300046678 | Ga0495599_0625446 | Ga0495599_0625446_371_571 | 66 |
| 1012 | 3300046679 | Ga0495623_0061112 | Ga0495623_0061112_864_1064 | 66 |
| 1013 | 3300046679 | Ga0495623_0074604 | Ga0495623_0074604_1639_1839 | 66 |
| 1014 | 3300046680 | Ga0495646_0009843 | Ga0495646_0009843_4099_4299 | 66 |
| 1015 | 3300046680 | Ga0495646_0696448 | Ga0495646_0696448_83_283 | 66 |
| 1016 | 3300046684 | Ga0495669_0080159 | Ga0495669_0080159_446_646 | 66 |
| 1017 | 3300046684 | Ga0495669_0398375 | Ga0495669_0398375_216_416 | 66 |
| 1018 | 3300046684 | Ga0495669_0563686 | Ga0495669_0563686_131_331 | 66 |
| 1019 | 3300046689 | Ga0495613_0430824 | Ga0495613_0430824_531_731 | 66 |
| 1020 | 3300046692 | Ga0495671_0466328 | Ga0495671_0466328_271_471 | 66 |
| 1021 | 3300046694 | Ga0495649_0149118 | Ga0495649_0149118_872_1072 | 66 |
| 1022 | 3300046809 | Ga0495600_0094647 | Ga0495600_0094647_1445_1645 | 66 |
| 1023 | 3300047317 | Ga0495604_0062399 | Ga0495604_0062399_951_1151 | 66 |
| 1024 | 3300047317 | Ga0495604_0565507 | Ga0495604_0565507_210_410 | 66 |
| 1025 | 3300047319 | Ga0495674_0693285 | Ga0495674_0693285_42_242 | 66 |
| 1026 | 3300047319 | Ga0495674_1198836 | Ga0495674_1198836_17_217 | 66 |
| 1027 | 3300047322 | Ga0495680_0922660 | Ga0495680_0922660_16_216 | 66 |
| 1028 | 3300047323 | Ga0495683_0181532 | Ga0495683_0181532_371_571 | 66 |
| 1029 | 3300047443 | Ga0495687_131774 | Ga0495687_131774_645_845 | 66 |
| 1030 | 3300047444 | Ga0495675_0100151 | Ga0495675_0100151_1499_1699 | 66 |
| 1031 | 3300047471 | Ga0495684_0345310 | Ga0495684_0345310_718_918 | 66 |
| 1032 | 3300047472 | Ga0495686_0476126 | Ga0495686_0476126_60_260 | 66 |
| 1033 | 3300048088 | Ga0495602_0256746 | Ga0495602_0256746_898_1098 | 66 |
| 1034 | 3300048088 | Ga0495602_0884772 | Ga0495602_0884772_171_371 | 66 |
| 1035 | 3300048903 | Ga0496100_1315938 | Ga0496100_1315938_221_421 | 66 |
| 1036 | 3300048904 | Ga0496101_0241415 | Ga0496101_0241415_619_819 | 66 |
| 1037 | 3300048904 | Ga0496101_0697124 | Ga0496101_0697124_290_490 | 66 |
| 1038 | 3300048906 | Ga0496103_0195603 | Ga0496103_0195603_1007_1207 | 66 |
| 1039 | 3300048907 | Ga0496104_0040556 | Ga0496104_0040556_3461_3661 | 66 |
| 1040 | 3300048907 | Ga0496104_0468253 | Ga0496104_0468253_861_1061 | 66 |
| 1041 | 3300048907 | Ga0496104_1148873 | Ga0496104_1148873_58_258 | 66 |
| 1042 | 3300048908 | Ga0496105_0166346 | Ga0496105_0166346_147_347 | 66 |
| 1043 | 3300048908 | Ga0496105_0202716 | Ga0496105_0202716_563_763 | 66 |
| 1044 | 3300048911 | Ga0496108_0026741 | Ga0496108_0026741_3810_4010 | 66 |
| 1045 | 3300048911 | Ga0496108_0046396 | Ga0496108_0046396_23_223 | 66 |
| 1046 | 3300048911 | Ga0496108_0096729 | Ga0496108_0096729_448_648 | 66 |
| 1047 | 3300048912 | Ga0496109_0015917 | Ga0496109_0015917_494_694 | 66 |
| 1048 | 3300048912 | Ga0496109_0078800 | Ga0496109_0078800_2164_2364 | 66 |
| 1049 | 3300048912 | Ga0496109_0791849 | Ga0496109_0791849_179_379 | 66 |
| 1050 | 3300048913 | Ga0496110_0043752 | Ga0496110_0043752_1774_1974 | 66 |
| 1051 | 3300048913 | Ga0496110_1404128 | Ga0496110_1404128_359_559 | 66 |
| 1052 | 3300048914 | Ga0496111_0074367 | Ga0496111_0074367_1986_2186 | 66 |
| 1053 | 3300048915 | Ga0496112_0014309 | Ga0496112_0014309_168_368 | 66 |
| 1054 | 3300048915 | Ga0496112_0046437 | Ga0496112_0046437_2659_2859 | 66 |
| 1055 | 3300048915 | Ga0496112_0065430 | Ga0496112_0065430_1691_1891 | 66 |
| 1056 | 3300048915 | Ga0496112_0173153 | Ga0496112_0173153_708_908 | 66 |
| 1057 | 3300048915 | Ga0496112_0490605 | Ga0496112_0490605_492_692 | 66 |
| 1058 | 3300048916 | Ga0496113_0016771 | Ga0496113_0016771_2041_2241 | 66 |
| 1059 | 3300048916 | Ga0496113_0133902 | Ga0496113_0133902_1064_1264 | 66 |
| 1060 | 3300048916 | Ga0496113_0824391 | Ga0496113_0824391_159_359 | 66 |
| 1061 | 3300048918 | Ga0496115_0434388 | Ga0496115_0434388_643_843 | 66 |
| 1062 | 3300048918 | Ga0496115_0507457 | Ga0496115_0507457_382_582 | 66 |
| 1063 | 3300048918 | Ga0496115_0607701 | Ga0496115_0607701_370_570 | 66 |
| 1064 | 3300048922 | Ga0496119_0065543 | Ga0496119_0065543_1120_1320 | 66 |
| 1065 | 3300048924 | Ga0496121_0828943 | Ga0496121_0828943_274_474 | 66 |
| 1066 | 3300048929 | Ga0496126_0016529 | Ga0496126_0016529_219_419 | 66 |
| 1067 | 3300048929 | Ga0496126_0830221 | Ga0496126_0830221_147_347 | 66 |
| 1068 | 3300049460 | Ga0495682_0057786 | Ga0495682_0057786_742_942 | 66 |
| 1069 | 3300049460 | Ga0495682_0060129 | Ga0495682_0060129_248_448 | 66 |
| 1070 | 3300049522 | Ga0501299_115708 | Ga0501299_115708_325_525 | 66 |
| 1071 | 3300049528 | Ga0501312_101970 | Ga0501312_101970_210_410 | 66 |
| 1072 | 3300049568 | Ga0501031_0033208 | Ga0501031_0033208_1747_1947 | 66 |
| 1073 | 3300049569 | Ga0501032_0178813 | Ga0501032_0178813_1026_1226 | 66 |
| 1074 | 3300049570 | Ga0501033_0023595 | Ga0501033_0023595_2070_2270 | 66 |
| 1075 | 3300049571 | Ga0501034_0008002 | Ga0501034_0008002_4279_4479 | 66 |
| 1076 | 3300049571 | Ga0501034_0070152 | Ga0501034_0070152_80_283 | 66 |
| 1077 | 3300049572 | Ga0501036_0003425 | Ga0501036_0003425_3552_3752 | 66 |
| 1078 | 3300049573 | Ga0501037_0013264 | Ga0501037_0013264_4895_5095 | 66 |
| 1079 | 3300049574 | Ga0501038_0002323 | Ga0501038_0002323_8972_9172 | 66 |
| 1080 | 3300049575 | Ga0501039_0803183 | Ga0501039_0803183_411_611 | 66 |
| 1081 | 3300049576 | Ga0501040_0089120 | Ga0501040_0089120_1078_1278 | 66 |
| 1082 | 3300049576 | Ga0501040_0123045 | Ga0501040_0123045_404_604 | 66 |
| 1083 | 3300049579 | Ga0501043_0002319 | Ga0501043_0002319_14053_14253 | 66 |
| 1084 | 3300049580 | Ga0501046_0000106 | Ga0501046_0000106_79080_79280 | 66 |
| 1085 | 3300049580 | Ga0501046_0751997 | Ga0501046_0751997_261_461 | 66 |
| 1086 | 3300049581 | Ga0501047_0005612 | Ga0501047_0005612_2964_3164 | 66 |
| 1087 | 3300049582 | Ga0501048_0318447 | Ga0501048_0318447_583_783 | 66 |
| 1088 | 3300049582 | Ga0501048_0766391 | Ga0501048_0766391_353_553 | 66 |
| 1089 | 3300049584 | Ga0501068_0020211 | Ga0501068_0020211_954_1154 | 66 |
| 1090 | 3300049586 | Ga0501070_0078873 | Ga0501070_0078873_1476_1676 | 66 |
| 1091 | 3300049588 | Ga0501072_0386191 | Ga0501072_0386191_859_1059 | 66 |
| 1092 | 3300049588 | Ga0501072_0907653 | Ga0501072_0907653_459_662 | 66 |
| 1093 | 3300049589 | Ga0501073_0054288 | Ga0501073_0054288_843_1043 | 66 |
| 1094 | 3300049589 | Ga0501073_0086276 | Ga0501073_0086276_157_357 | 66 |
| 1095 | 3300049589 | Ga0501073_1202418 | Ga0501073_1202418_227_427 | 66 |
| 1096 | 3300049591 | Ga0501075_0102505 | Ga0501075_0102505_489_692 | 66 |
| 1097 | 3300049592 | Ga0501076_0931127 | Ga0501076_0931127_89_292 | 66 |
| 1098 | 3300049593 | Ga0501077_0049431 | Ga0501077_0049431_198_398 | 66 |
| 1099 | 3300049651 | Ga0501201_047589 | Ga0501201_047589_144_344 | 66 |
| 1100 | 3300049680 | Ga0501250_086311 | Ga0501250_086311_308_508 | 66 |
| 1101 | 3300049685 | Ga0501256_037217 | Ga0501256_037217_311_511 | 66 |
| 1102 | 3300049704 | Ga0501221_112417 | Ga0501221_112417_64_264 | 66 |
| 1103 | 3300049707 | Ga0501234_086055 | Ga0501234_086055_234_434 | 66 |
| 1104 | 3300049708 | Ga0501245_125581 | Ga0501245_125581_145_345 | 66 |
| 1105 | 3300049741 | Ga0501079_0617540 | Ga0501079_0617540_95_295 | 66 |
| 1106 | 3300049741 | Ga0501079_1165152 | Ga0501079_1165152_381_584 | 66 |
| 1107 | 3300049742 | Ga0501080_0210836 | Ga0501080_0210836_721_921 | 66 |
| 1108 | 3300049771 | Ga0501274_012480 | Ga0501274_012480_560_760 | 66 |
| 1109 | 3300049822 | Ga0501035_0202103 | Ga0501035_0202103_1148_1348 | 66 |
| 1110 | 3300049822 | Ga0501035_0218211 | Ga0501035_0218211_991_1191 | 66 |
| 1111 | 3300049823 | Ga0501044_0080457 | Ga0501044_0080457_1541_1741 | 66 |
| 1112 | 3300049823 | Ga0501044_0558274 | Ga0501044_0558274_703_903 | 66 |
| 1113 | 3300049824 | Ga0501045_0073634 | Ga0501045_0073634_1871_2071 | 66 |
| 1114 | 3300050489 | nmdc:mga03683_624164_c1 | nmdc:mga03683_624164_c1_195_395 | 66 |
| 1115 | 3300050490 | nmdc:mga03n38_589969_c1 | nmdc:mga03n38_589969_c1_44_244 | 66 |
| 1116 | 3300050491 | nmdc:mga00v17_1052193_c1 | nmdc:mga00v17_1052193_c1_205_405 | 66 |
| 1117 | 3300050492 | nmdc:mga0yw44_861963_c1 | nmdc:mga0yw44_861963_c1_149_349 | 66 |
| 1118 | 3300050494 | nmdc:mga06z11_611662_c1 | nmdc:mga06z11_611662_c1_27_227 | 66 |
| 1119 | 3300050495 | nmdc:mga04h51_112783_c1 | nmdc:mga04h51_112783_c1_15_215 | 66 |
| 1120 | 3300050496 | nmdc:mga07m45_409555_c1 | nmdc:mga07m45_409555_c1_131_331 | 66 |
| 1121 | 3300050507 | nmdc:mga05p37_351502_c1 | nmdc:mga05p37_351502_c1_945_1145 | 66 |
| 1122 | 3300050507 | nmdc:mga05p37_625783_c1 | nmdc:mga05p37_625783_c1_679_879 | 66 |
| 1123 | 3300050507 | nmdc:mga05p37_929_c1 | nmdc:mga05p37_929_c1_7294_7494 | 66 |
| 1124 | 3300050508 | nmdc:mga09592_1426664_c1 | nmdc:mga09592_1426664_c1_280_480 | 66 |
| 1125 | 3300050508 | nmdc:mga09592_1708180_c1 | nmdc:mga09592_1708180_c1_134_334 | 66 |
| 1126 | 3300050508 | nmdc:mga09592_779_c1 | nmdc:mga09592_779_c1_21448_21648 | 66 |
| 1127 | 3300050509 | nmdc:mga0qj67_309711_c1 | nmdc:mga0qj67_309711_c1_118_318 | 66 |
| 1128 | 3300050510 | nmdc:mga06r32_1350870_c1 | nmdc:mga06r32_1350870_c1_275_475 | 66 |
| 1129 | 3300050510 | nmdc:mga06r32_451439_c1 | nmdc:mga06r32_451439_c1_603_803 | 66 |
| 1130 | 3300050510 | nmdc:mga06r32_570712_c1 | nmdc:mga06r32_570712_c1_821_1021 | 66 |
| 1131 | 3300050510 | nmdc:mga06r32_593560_c1 | nmdc:mga06r32_593560_c1_373_573 | 66 |
| 1132 | 3300050511 | nmdc:mga08y16_19633_c1 | nmdc:mga08y16_19633_c1_586_786 | 66 |
| 1133 | 3300050511 | nmdc:mga08y16_625177_c1 | nmdc:mga08y16_625177_c1_199_402 | 66 |
| 1134 | 3300050512 | nmdc:mga0n895_2112276_c1 | nmdc:mga0n895_2112276_c1_283_483 | 66 |
| 1135 | 3300050512 | nmdc:mga0n895_4165_c1 | nmdc:mga0n895_4165_c1_3238_3438 | 66 |
| 1136 | 3300050513 | nmdc:mga0rr50_1757640_c1 | nmdc:mga0rr50_1757640_c1_293_493 | 66 |
| 1137 | 3300050513 | nmdc:mga0rr50_227413_c2 | nmdc:mga0rr50_227413_c2_623_823 | 66 |
| 1138 | 3300050513 | nmdc:mga0rr50_254447_c1 | nmdc:mga0rr50_254447_c1_289_489 | 66 |
| 1139 | 3300050514 | nmdc:mga08x19_1150071_c1 | nmdc:mga08x19_1150071_c1_246_446 | 66 |
| 1140 | 3300050514 | nmdc:mga08x19_532757_c1 | nmdc:mga08x19_532757_c1_478_678 | 66 |
| 1141 | 3300050514 | nmdc:mga08x19_77083_c1 | nmdc:mga08x19_77083_c1_1650_1850 | 66 |
| 1142 | 3300050514 | nmdc:mga08x19_843806_c1 | nmdc:mga08x19_843806_c1_70_270 | 66 |
| 1143 | 3300050515 | nmdc:mga0a205_23561_c1 | nmdc:mga0a205_23561_c1_275_475 | 66 |
| 1144 | 3300053077 | Ga0495601_0109528 | Ga0495601_0109528_133_333 | 66 |
| 1145 | 3300053077 | Ga0495601_0337551 | Ga0495601_0337551_354_554 | 66 |
| 1146 | 3300053119 | Ga0500595_000032 | Ga0500595_000032_56859_57059 | 66 |
| 1147 | 3300053136 | Ga0500559_0555345 | Ga0500559_0555345_56_256 | 66 |
| 1148 | 3300054114 | Ga0501084_0141850 | Ga0501084_0141850_1751_1951 | 66 |
| 1149 | 3300055283 | Ga0500661_001186 | Ga0500661_001186_4547_4747 | 66 |
| 1150 | 3300059490 | Ga0587066_055213 | Ga0587066_055213_309_509 | 66 |
| 1151 | 3300059492 | Ga0587073_0156911 | Ga0587073_0156911_286_486 | 66 |
| 1152 | 3300059493 | Ga0587077_017890 | Ga0587077_017890_102_305 | 66 |
| 1153 | 3300059493 | Ga0587077_043834 | Ga0587077_043834_12_215 | 66 |
| 1154 | 3300059493 | Ga0587077_256168 | Ga0587077_256168_189_389 | 66 |
| 1155 | 3300059503 | Ga0587080_088305 | Ga0587080_088305_147_347 | 66 |
| 1156 | 3300059504 | Ga0587082_087965 | Ga0587082_087965_297_497 | 66 |
| 1157 | 3300059505 | Ga0587083_0139780 | Ga0587083_0139780_132_332 | 66 |
| 1158 | 3300059506 | Ga0587085_184512 | Ga0587085_184512_205_405 | 66 |
| 1159 | 3300059508 | Ga0587088_079650 | Ga0587088_079650_303_503 | 66 |
| 1160 | 3300059508 | Ga0587088_094395 | Ga0587088_094395_361_561 | 66 |
| 1161 | 3300059509 | Ga0587089_079091 | Ga0587089_079091_170_370 | 66 |
| 1162 | 3300059511 | Ga0587091_101168 | Ga0587091_101168_235_435 | 66 |
| 1163 | 3300059624 | Ga0587109_187893 | Ga0587109_187893_104_304 | 66 |
| 1164 | 3300059642 | Ga0587069_076152 | Ga0587069_076152_95_295 | 66 |
| 1165 | 3300059647 | Ga0587079_134789 | Ga0587079_134789_371_571 | 66 |
| 1166 | 3300060243 | Ga0587060_028550 | Ga0587060_028550_224_424 | 66 |
| 1167 | 3300060344 | Ga0587071_195422 | Ga0587071_195422_317_517 | 66 |
| 1168 | 3300060346 | Ga0587111_0000976 | Ga0587111_0000976_13_216 | 66 |
| 1169 | 3300060346 | Ga0587111_0003253 | Ga0587111_0003253_147_350 | 66 |
| 1170 | 3300061719 | Ga0466962_0718605 | Ga0466962_0718605_251_451 | 66 |
| 1171 | 3300061734 | Ga0530510_0002199 | Ga0530510_0002199_13047_13247 | 66 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9779 | 1 | 66 |
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.9768 | 2 | 66 |
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.9754 | 2 | 66 |
| 1hz9-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9722 | 1 | 66 |
| 1c9o-assembly1.cif.gz_B | crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp | 0.9715 | 1 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9731 | 2 | 63 | 2.40.50.140 |
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.973 | 2 | 63 | 2.40.50.140 |
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9708 | 2 | 63 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.959 | 2 | 63 | 2.40.50.140 |
| 2haxB02 | Special;Other non-globular;Rhinovirus 14, subunit 4; | 0.9577 | 40 | 66 | 6.20.370.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9PB08-F1-model_v4 | Cold-shock protein | 1.009 | 2 | 66 |
GO:0003676
GO:0005737 |
| AF-A0A2W0BM59-F1-model_v4 | Cold-shock protein | 1.008 | 1 | 66 |
GO:0003676
GO:0005737 |
| AF-A0A2N9MLP4-F1-model_v4 | Major cold shock protein | 1.008 | 2 | 66 |
GO:0003676
GO:0005737 |
| AF-A0A0C2HTJ5-F1-model_v4 | Cold-shock protein | 1.008 | 2 | 66 |
GO:0003676
GO:0005737 |
| AF-A0A2V9QND7-F1-model_v4 | Cold-shock protein | 1.007 | 1 | 66 |
GO:0003676
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar