F491168

General Info

Members Datasets Scaffolds Average Seq Length
1171 404 1165 66

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100958018|Ga0070707_1009580183
Length 80
Sequence MLAVCAAGDHKEMTMAQGTVKWFNDAKGYGFIKIENGEDVFVHYSAIQAQGFKSLAEGEQVEFEVTRGPKGLQAANVRKI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
133 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
143 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
266 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
267 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
268 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
355 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
356 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
357 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
358 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
359 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
387 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 6.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 2.56
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001918 3300000546 Bacteria 2705
2 JGI24736J21556_1028039 3300001904 Bacteria 871
3 JGI24736J21556_1030037 3300001904 Bacteria 841
4 JGI24737J22298_10123494 3300001990 Bacteria 765
5 JGI24743J22301_10114563 3300001991 Bacteria 588
6 rootH1_10182383 3300003316 Bacteria 1183
7 Ga0058863_10059691 3300004799 Bacteria 1038
8 Ga0058863_11915408 3300004799 Bacteria 667
9 Ga0058861_11849805 3300004800 Bacteria 592
10 Ga0058862_12494603 3300004803 Bacteria 536
11 Ga0058862_12588482 3300004803 Bacteria 551
12 Ga0058862_12631438 3300004803 Bacteria 677
13 Ga0058862_12765549 3300004803 Bacteria 893
14 Ga0065715_10398165 3300005293 Bacteria 885
15 Ga0070658_10044029 3300005327 Bacteria 3606
16 Ga0070658_10055014 3300005327 Bacteria 3232
17 Ga0070658_10105049 3300005327 Bacteria 2337
18 Ga0070658_10155085 3300005327 Bacteria 1919
19 Ga0070658_10301321 3300005327 Bacteria 1367
20 Ga0070658_10411026 3300005327 Bacteria 1163
21 Ga0070658_10425153 3300005327 Bacteria 1143
22 Ga0070658_10493093 3300005327 Bacteria 1058
23 Ga0070658_11613765 3300005327 Bacteria 562
24 Ga0070683_100013117 3300005329 Bacteria 7215
25 Ga0070683_100025211 3300005329 Bacteria 5337
26 Ga0070683_100042533 3300005329 Bacteria 4184
27 Ga0070683_100082059 3300005329 Bacteria 3019
28 Ga0070683_100320501 3300005329 Bacteria 1475
29 Ga0070683_100392808 3300005329 Bacteria 1323
30 Ga0070683_100484857 3300005329 Bacteria 1181
31 Ga0070683_100849323 3300005329 Bacteria 875
32 Ga0070683_100970720 3300005329 Bacteria 815
33 Ga0070690_100386959 3300005330 Bacteria 1024
34 Ga0070690_100881689 3300005330 Bacteria 699
35 Ga0070690_101050582 3300005330 Bacteria 644
36 Ga0070670_100000999 3300005331 Bacteria 22262
37 Ga0070670_100004289 3300005331 Bacteria 11935
38 Ga0070670_100012911 3300005331 Bacteria 7151
39 Ga0070670_100828756 3300005331 Bacteria 836
40 Ga0068869_100001465 3300005334 Bacteria 13968
41 Ga0068869_100165197 3300005334 Bacteria 1726
42 Ga0068869_100347333 3300005334 Bacteria 1208
43 Ga0070666_10066988 3300005335 Bacteria 2438
44 Ga0070666_10177794 3300005335 Bacteria 1492
45 Ga0070666_10409718 3300005335 Bacteria 975
46 Ga0070666_11020929 3300005335 Bacteria 614
47 Ga0070680_100119720 3300005336 Bacteria 2197
48 Ga0070680_100218497 3300005336 Bacteria 1608
49 Ga0070680_100314598 3300005336 Bacteria 1329
50 Ga0070680_101816758 3300005336 Bacteria 528
51 Ga0070682_100316528 3300005337 Bacteria 1151
52 Ga0070682_100464059 3300005337 Bacteria 973
53 Ga0070682_100596215 3300005337 Bacteria 872
54 Ga0070682_100634750 3300005337 Bacteria 848
55 Ga0070682_100735844 3300005337 Bacteria 795
56 Ga0070682_100959092 3300005337 Bacteria 707
57 Ga0070682_101319662 3300005337 Bacteria 614
58 Ga0068868_100000062 3300005338 Bacteria 61833
59 Ga0070660_100075054 3300005339 Bacteria 2647
60 Ga0070660_100390394 3300005339 Bacteria 1150
61 Ga0070660_100756699 3300005339 Bacteria 816
62 Ga0070689_100027354 3300005340 Bacteria 4299
63 Ga0070689_101627254 3300005340 Bacteria 587
64 Ga0070691_10007394 3300005341 Bacteria 5030
65 Ga0070691_10063321 3300005341 Bacteria 1783
66 Ga0070691_10850961 3300005341 Bacteria 559
67 Ga0070661_100006060 3300005344 Bacteria 8319
68 Ga0070661_100036188 3300005344 Bacteria 3589
69 Ga0070661_100036965 3300005344 Bacteria 3551
70 Ga0070661_100050157 3300005344 Bacteria 3054
71 Ga0070661_100115431 3300005344 Bacteria 2008
72 Ga0070661_100179525 3300005344 Bacteria 1610
73 Ga0070661_101221537 3300005344 Bacteria 629
74 Ga0070661_101827045 3300005344 Bacteria 516
75 Ga0070692_10027487 3300005345 Bacteria 2820
76 Ga0070669_100019209 3300005353 Bacteria 4882
77 Ga0070675_100036857 3300005354 Bacteria 3982
78 Ga0070671_100000449 3300005355 Bacteria 28636
79 Ga0070671_100048626 3300005355 Bacteria 3527
80 Ga0070671_100169593 3300005355 Bacteria 1846
81 Ga0070671_100257519 3300005355 Bacteria 1483
82 Ga0070671_100357250 3300005355 Bacteria 1247
83 Ga0070671_100695442 3300005355 Bacteria 882
84 Ga0070673_100021983 3300005364 Bacteria 4635
85 Ga0070659_100281318 3300005366 Bacteria 1384
86 Ga0070659_100455997 3300005366 Bacteria 1085
87 Ga0070659_101271239 3300005366 Bacteria 652
88 Ga0070667_100006315 3300005367 Bacteria 9848
89 Ga0070667_100139922 3300005367 Bacteria 2119
90 Ga0070667_100821901 3300005367 Bacteria 863
91 Ga0070703_10040722 3300005406 Bacteria 1446
92 Ga0070709_10395937 3300005434 Bacteria 1030
93 Ga0070709_11128736 3300005434 Bacteria 628
94 Ga0070714_100026455 3300005435 Bacteria 4795
95 Ga0070714_100209394 3300005435 Bacteria 1787
96 Ga0070714_100556983 3300005435 Bacteria 1098
97 Ga0070714_101064370 3300005435 Bacteria 788
98 Ga0070714_101144156 3300005435 Bacteria 759
99 Ga0070714_101447180 3300005435 Bacteria 671
100 Ga0070713_100085009 3300005436 Bacteria 2709
101 Ga0070713_101109221 3300005436 Bacteria 765
102 Ga0070713_102204929 3300005436 Bacteria 534
103 Ga0070713_102330911 3300005436 Bacteria 518
104 Ga0070710_10425345 3300005437 Bacteria 895
105 Ga0070701_10015752 3300005438 Bacteria 3499
106 Ga0070711_100848227 3300005439 Bacteria 777
107 Ga0070711_100933639 3300005439 Bacteria 742
108 Ga0070705_100052117 3300005440 Bacteria 2389
109 Ga0070705_101061623 3300005440 Bacteria 661
110 Ga0070694_100014714 3300005444 Bacteria 4901
111 Ga0070694_100552417 3300005444 Bacteria 922
112 Ga0070708_100011482 3300005445 Bacteria 7209
113 Ga0070708_100011755 3300005445 Bacteria 7122
114 Ga0070708_100033260 3300005445 Bacteria 4480
115 Ga0070708_100760801 3300005445 Bacteria 911
116 Ga0070663_100088079 3300005455 Bacteria 2295
117 Ga0070663_100523255 3300005455 Bacteria 988
118 Ga0070663_100934844 3300005455 Bacteria 751
119 Ga0070678_100913243 3300005456 Bacteria 803
120 Ga0070662_100197816 3300005457 Bacteria 1593
121 Ga0070662_100745735 3300005457 Bacteria 830
122 Ga0070662_101958812 3300005457 Bacteria 506
123 Ga0070681_10014239 3300005458 Bacteria 7915
124 Ga0070681_10046523 3300005458 Bacteria 4338
125 Ga0070681_10073325 3300005458 Bacteria 3385
126 Ga0070681_10129550 3300005458 Bacteria 2455
127 Ga0070681_10536303 3300005458 Bacteria 1084
128 Ga0070681_10862802 3300005458 Bacteria 823
129 Ga0070681_10899288 3300005458 Bacteria 804
130 Ga0068867_100066516 3300005459 Bacteria 2685
131 Ga0070685_10039896 3300005466 Bacteria 2670
132 Ga0070685_10231651 3300005466 Bacteria 1215
133 Ga0070706_100014654 3300005467 Bacteria 7242
134 Ga0070706_100020973 3300005467 Bacteria 6015
135 Ga0070706_100885358 3300005467 Bacteria 825
136 Ga0070707_100064848 3300005468 Bacteria 3508
137 Ga0070707_100089460 3300005468 Bacteria 2979
138 Ga0070707_100161513 3300005468 Bacteria 2183
139 Ga0070707_100467975 3300005468 Bacteria 1222
140 Ga0070707_100958018 3300005468 Bacteria 821
141 Ga0070707_101321863 3300005468 Bacteria 687
142 Ga0070698_100002346 3300005471 Bacteria 20934
143 Ga0070698_100272359 3300005471 Bacteria 1624
144 Ga0070698_100290461 3300005471 Bacteria 1566
145 Ga0070698_102097484 3300005471 Unclassified 519
146 Ga0070699_100005399 3300005518 Bacteria 11210
147 Ga0070699_100055223 3300005518 Bacteria 3439
148 Ga0070699_100113371 3300005518 Bacteria 2382
149 Ga0070699_100400632 3300005518 Bacteria 1241
150 Ga0070699_101159816 3300005518 Bacteria 709
151 Ga0070679_100016264 3300005530 Bacteria 7168
152 Ga0070679_100268992 3300005530 Bacteria 1659
153 Ga0070679_100290012 3300005530 Bacteria 1588
154 Ga0070679_102155034 3300005530 Bacteria 507
155 Ga0070684_100002801 3300005535 Bacteria 12923
156 Ga0070684_100023567 3300005535 Bacteria 5152
157 Ga0070684_100028010 3300005535 Bacteria 4762
158 Ga0070684_100032735 3300005535 Bacteria 4434
159 Ga0070684_100057304 3300005535 Bacteria 3402
160 Ga0070684_100063659 3300005535 Bacteria 3234
161 Ga0070684_100150795 3300005535 Bacteria 2106
162 Ga0070684_100367432 3300005535 Bacteria 1324
163 Ga0070684_101189661 3300005535 Bacteria 717
164 Ga0070697_100012687 3300005536 Bacteria 6600
165 Ga0070697_100021509 3300005536 Bacteria 5111
166 Ga0070697_100023655 3300005536 Bacteria 4887
167 Ga0070697_100231193 3300005536 Bacteria 1577
168 Ga0070697_100461554 3300005536 Bacteria 1107
169 Ga0070697_101787216 3300005536 Bacteria 550
170 Ga0068853_100000080 3300005539 Bacteria 66513
171 Ga0068853_100024183 3300005539 Bacteria 5092
172 Ga0068853_100070812 3300005539 Bacteria 3036
173 Ga0068853_100087352 3300005539 Bacteria 2736
174 Ga0068853_100253471 3300005539 Bacteria 1616
175 Ga0068853_101237029 3300005539 Bacteria 721
176 Ga0068853_101699466 3300005539 Bacteria 612
177 Ga0068853_101936006 3300005539 Bacteria 572
178 Ga0070672_100024224 3300005543 Bacteria 4482
179 Ga0070672_100627845 3300005543 Bacteria 937
180 Ga0070672_100678709 3300005543 Bacteria 901
181 Ga0070686_101250524 3300005544 Bacteria 618
182 Ga0070686_101460735 3300005544 Bacteria 575
183 Ga0070695_100007587 3300005545 Bacteria 6427
184 Ga0070695_100223253 3300005545 Bacteria 1358
185 Ga0070696_100076522 3300005546 Bacteria 2363
186 Ga0070696_100090784 3300005546 Bacteria 2174
187 Ga0070696_100277990 3300005546 Bacteria 1275
188 Ga0070696_100354728 3300005546 Bacteria 1137
189 Ga0070696_101249051 3300005546 Bacteria 629
190 Ga0070693_100337701 3300005547 Bacteria 1027
191 Ga0070693_100454649 3300005547 Bacteria 899
192 Ga0070693_100847890 3300005547 Bacteria 681
193 Ga0070693_100973592 3300005547 Bacteria 640
194 Ga0070665_100321539 3300005548 Bacteria 1551
195 Ga0070665_100339679 3300005548 Bacteria 1506
196 Ga0070665_100473829 3300005548 Bacteria 1263
197 Ga0070665_100917769 3300005548 Bacteria 888
198 Ga0070704_100128158 3300005549 Bacteria 1962
199 Ga0070704_100187330 3300005549 Bacteria 1660
200 Ga0070704_100344476 3300005549 Bacteria 1256
201 Ga0068855_100001109 3300005563 Bacteria 33489
202 Ga0068855_100003174 3300005563 Bacteria 20121
203 Ga0068855_100041627 3300005563 Bacteria 5445
204 Ga0068855_100102955 3300005563 Bacteria 3285
205 Ga0068855_100103010 3300005563 Bacteria 3284
206 Ga0068855_100120956 3300005563 Bacteria 2996
207 Ga0068855_100137239 3300005563 Bacteria 2789
208 Ga0068855_100179892 3300005563 Bacteria 2391
209 Ga0068855_100447526 3300005563 Bacteria 1410
210 Ga0068855_101043463 3300005563 Bacteria 857
211 Ga0070664_100044728 3300005564 Bacteria 3738
212 Ga0070664_100116334 3300005564 Bacteria 2338
213 Ga0070664_100233379 3300005564 Bacteria 1650
214 Ga0070664_100463432 3300005564 Bacteria 1165
215 Ga0068857_100000969 3300005577 Bacteria 21932
216 Ga0068857_100001491 3300005577 Bacteria 18629
217 Ga0068857_100004470 3300005577 Bacteria 11819
218 Ga0068857_100007098 3300005577 Bacteria 9647
219 Ga0068857_100026640 3300005577 Bacteria 5095
220 Ga0068857_100058309 3300005577 Bacteria 3428
221 Ga0068857_100166944 3300005577 Bacteria 1999
222 Ga0068857_100177536 3300005577 Bacteria 1937
223 Ga0068857_100268748 3300005577 Bacteria 1567
224 Ga0068857_101269541 3300005577 Bacteria 714
225 Ga0068857_102267715 3300005577 Bacteria 533
226 Ga0068854_100063256 3300005578 Bacteria 2685
227 Ga0068854_100354129 3300005578 Bacteria 1202
228 Ga0068854_100396266 3300005578 Bacteria 1141
229 Ga0068856_100001717 3300005614 Bacteria 22914
230 Ga0068856_100022866 3300005614 Bacteria 6080
231 Ga0068856_100042723 3300005614 Bacteria 4460
232 Ga0068856_100061299 3300005614 Bacteria 3715
233 Ga0068856_100086253 3300005614 Bacteria 3119
234 Ga0068856_100206324 3300005614 Bacteria 1980
235 Ga0068856_100239317 3300005614 Bacteria 1830
236 Ga0068856_100383861 3300005614 Bacteria 1424
237 Ga0068856_100396687 3300005614 Bacteria 1399
238 Ga0068856_100429245 3300005614 Bacteria 1342
239 Ga0068856_100816416 3300005614 Bacteria 952
240 Ga0068852_100000048 3300005616 Bacteria 87297
241 Ga0068852_100000287 3300005616 Bacteria 33809
242 Ga0068852_100000434 3300005616 Bacteria 27771
243 Ga0068852_100049816 3300005616 Bacteria 3585
244 Ga0068852_100194115 3300005616 Bacteria 1918
245 Ga0068852_100256402 3300005616 Bacteria 1677
246 Ga0068852_100324734 3300005616 Bacteria 1495
247 Ga0068852_100464739 3300005616 Bacteria 1255
248 Ga0068852_101462340 3300005616 Bacteria 706
249 Ga0068852_102088059 3300005616 Bacteria 588
250 Ga0068859_100010672 3300005617 Bacteria 9245
251 Ga0068859_100012505 3300005617 Bacteria 8539
252 Ga0068859_100024126 3300005617 Bacteria 6103
253 Ga0068864_100001146 3300005618 Bacteria 22120
254 Ga0068864_100001263 3300005618 Bacteria 21030
255 Ga0068864_100013753 3300005618 Bacteria 6712
256 Ga0068864_100020410 3300005618 Bacteria 5543
257 Ga0068866_10150540 3300005718 Bacteria 1347
258 Ga0068851_10006350 3300005834 Bacteria 5394
259 Ga0068851_10006516 3300005834 Bacteria 5331
260 Ga0068851_10029976 3300005834 Bacteria 2695
261 Ga0068851_10084594 3300005834 Bacteria 1661
262 Ga0068851_10106033 3300005834 Bacteria 1496
263 Ga0068851_10110529 3300005834 Bacteria 1467
264 Ga0068851_10253879 3300005834 Bacteria 998
265 Ga0068851_10325847 3300005834 Bacteria 888
266 Ga0068851_10709755 3300005834 Bacteria 619
267 Ga0068870_10232748 3300005840 Bacteria 1133
268 Ga0068863_100000893 3300005841 Bacteria 30063
269 Ga0068863_100017111 3300005841 Bacteria 6955
270 Ga0068863_101403674 3300005841 Bacteria 706
271 Ga0068863_102228643 3300005841 Bacteria 558
272 Ga0068858_100003222 3300005842 Bacteria 16289
273 Ga0068858_100015396 3300005842 Bacteria 7193
274 Ga0068858_100211044 3300005842 Bacteria 1837
275 Ga0068858_100491666 3300005842 Bacteria 1185
276 Ga0068858_100529515 3300005842 Bacteria 1140
277 Ga0068860_100003815 3300005843 Bacteria 15503
278 Ga0068860_100063187 3300005843 Bacteria 3517
279 Ga0068860_100119698 3300005843 Bacteria 2521
280 Ga0068860_101007921 3300005843 Bacteria 851
281 Ga0068862_100022830 3300005844 Bacteria 5237
282 Ga0068862_100089631 3300005844 Bacteria 2677
283 Ga0068862_100168715 3300005844 Bacteria 1958
284 Ga0068862_100231958 3300005844 Bacteria 1675
285 Ga0070717_10405279 3300006028 Bacteria 1225
286 Ga0070717_10674252 3300006028 Bacteria 939
287 Ga0070717_10819360 3300006028 Bacteria 847
288 Ga0070717_11508234 3300006028 Bacteria 610
289 Ga0070717_11633752 3300006028 Bacteria 584
290 Ga0075365_10672442 3300006038 Bacteria 732
291 Ga0075368_10467820 3300006042 Bacteria 560
292 Ga0075363_100507455 3300006048 Bacteria 717
293 Ga0075364_10396621 3300006051 Bacteria 941
294 Ga0070716_100000875 3300006173 Bacteria 12980
295 Ga0070716_100290052 3300006173 Bacteria 1133
296 Ga0070716_100440613 3300006173 Bacteria 947
297 Ga0070716_100939741 3300006173 Bacteria 680
298 Ga0070712_100108054 3300006175 Bacteria 2071
299 Ga0070712_100528365 3300006175 Bacteria 992
300 Ga0070712_101710314 3300006175 Bacteria 551
301 Ga0097621_100006064 3300006237 Bacteria 8548
302 Ga0097621_100007372 3300006237 Bacteria 7869
303 Ga0097621_100065574 3300006237 Bacteria 2989
304 Ga0097621_100317034 3300006237 Bacteria 1380
305 Ga0097621_101899439 3300006237 Bacteria 568
306 Ga0075370_10317233 3300006353 Unclassified 928
307 Ga0068871_100033758 3300006358 Bacteria 4054
308 Ga0068871_100076129 3300006358 Bacteria 2771
309 Ga0075428_100509649 3300006844 Unclassified 1287
310 Ga0075430_100153947 3300006846 Bacteria 1914
311 Ga0075430_100168381 3300006846 Bacteria 1822
312 Ga0075430_100327107 3300006846 Unclassified 1267
313 Ga0075431_100100232 3300006847 Unclassified 2988
314 Ga0075431_100477994 3300006847 Bacteria 1239
315 Ga0075431_101650226 3300006847 Bacteria 598
316 Ga0075431_101852621 3300006847 Bacteria 559
317 Ga0075433_10045207 3300006852 Bacteria 3827
318 Ga0075434_100014420 3300006871 Bacteria 7554
319 Ga0075434_100600567 3300006871 Bacteria 1120
320 Ga0075429_100003644 3300006880 Bacteria 13119
321 Ga0075429_100144107 3300006880 Bacteria 2085
322 Ga0075429_100249301 3300006880 Bacteria 1555
323 Ga0075429_101842251 3300006880 Bacteria 525
324 Ga0075436_100006247 3300006914 Bacteria 8162
325 Ga0075436_100013593 3300006914 Bacteria 5576
326 Ga0075436_100078134 3300006914 Bacteria 2293
327 Ga0075436_100843507 3300006914 Bacteria 684
328 Ga0075436_100848689 3300006914 Bacteria 682
329 Ga0097620_100010672 3300006931 Bacteria 9245
330 Ga0097620_100012505 3300006931 Bacteria 8539
331 Ga0097620_100024125 3300006931 Bacteria 6103
332 Ga0099794_10081387 3300007265 Bacteria 1598
333 Ga0099794_10120220 3300007265 Unclassified 1321
334 Ga0099794_10263097 3300007265 Unclassified 890
335 Ga0099794_10275978 3300007265 Bacteria 869
336 Ga0099794_10564609 3300007265 Bacteria 601
337 Ga0099795_10011184 3300007788 Bacteria 2673
338 Ga0099795_10132769 3300007788 Bacteria 1006
339 Ga0105251_10254232 3300009011 Bacteria 792
340 Ga0105240_10000171 3300009093 Bacteria 132604
341 Ga0105240_10001982 3300009093 Bacteria 33815
342 Ga0105240_10002781 3300009093 Bacteria 27658
343 Ga0105240_10007773 3300009093 Bacteria 15499
344 Ga0105240_10015305 3300009093 Bacteria 10436
345 Ga0105240_10016664 3300009093 Bacteria 9940
346 Ga0105240_10025954 3300009093 Bacteria 7695
347 Ga0105240_10043806 3300009093 Bacteria 5691
348 Ga0105240_10063462 3300009093 Bacteria 4595
349 Ga0105240_10190101 3300009093 Bacteria 2415
350 Ga0105240_10431344 3300009093 Bacteria 1479
351 Ga0105240_10571313 3300009093 Bacteria 1248
352 Ga0105240_11118129 3300009093 Bacteria 838
353 Ga0105240_12794713 3300009093 Bacteria 502
354 Ga0111539_10004706 3300009094 Bacteria 17835
355 Ga0111539_10376644 3300009094 Bacteria 1652
356 Ga0105245_10002006 3300009098 Bacteria 18471
357 Ga0105247_10003806 3300009101 Bacteria 9771
358 Ga0105247_10298439 3300009101 Bacteria 1117
359 Ga0105247_11312183 3300009101 Bacteria 582
360 Ga0114129_10011134 3300009147 Bacteria 12821
361 Ga0114129_10036930 3300009147 Bacteria 6897
362 Ga0114129_10344476 3300009147 Bacteria 1976
363 Ga0114129_11160409 3300009147 Unclassified 964
364 Ga0105243_10188046 3300009148 Bacteria 1801
365 Ga0105243_11009074 3300009148 Bacteria 835
366 Ga0105243_11531972 3300009148 Bacteria 691
367 Ga0105241_10000839 3300009174 Bacteria 23314
368 Ga0105241_10012928 3300009174 Bacteria 6122
369 Ga0105241_10019234 3300009174 Bacteria 5035
370 Ga0105241_10035824 3300009174 Bacteria 3733
371 Ga0105241_10037495 3300009174 Bacteria 3652
372 Ga0105241_10042761 3300009174 Bacteria 3430
373 Ga0105241_10099036 3300009174 Bacteria 2314
374 Ga0105241_10159953 3300009174 Bacteria 1850
375 Ga0105241_10756905 3300009174 Bacteria 891
376 Ga0105241_11419579 3300009174 Bacteria 665
377 Ga0105242_10083613 3300009176 Bacteria 2674
378 Ga0105242_10725101 3300009176 Bacteria 976
379 Ga0105242_11158959 3300009176 Bacteria 790
380 Ga0105242_12214656 3300009176 Bacteria 595
381 Ga0105242_12504390 3300009176 Bacteria 564
382 Ga0105248_10000596 3300009177 Bacteria 41138
383 Ga0105248_10003599 3300009177 Bacteria 17176
384 Ga0105248_10015061 3300009177 Bacteria 8515
385 Ga0105248_10068520 3300009177 Bacteria 3983
386 Ga0105248_10343810 3300009177 Bacteria 1679
387 Ga0105248_10664090 3300009177 Bacteria 1176
388 Ga0105248_12006431 3300009177 Bacteria 657
389 Ga0105237_10055963 3300009545 Bacteria 3950
390 Ga0105237_10150740 3300009545 Bacteria 2322
391 Ga0105237_10252318 3300009545 Bacteria 1766
392 Ga0105237_10573027 3300009545 Bacteria 1136
393 Ga0105237_11260058 3300009545 Bacteria 746
394 Ga0105237_11283793 3300009545 Bacteria 739
395 Ga0105237_11353702 3300009545 Bacteria 718
396 Ga0105237_11473978 3300009545 Bacteria 687
397 Ga0105237_11585965 3300009545 Bacteria 661
398 Ga0105237_12093664 3300009545 Bacteria 575
399 Ga0105237_12176952 3300009545 Bacteria 564
400 Ga0105238_10000307 3300009551 Bacteria 53404
401 Ga0105238_10027293 3300009551 Bacteria 5816
402 Ga0105238_10028178 3300009551 Bacteria 5722
403 Ga0105238_10041389 3300009551 Bacteria 4666
404 Ga0105238_10132405 3300009551 Bacteria 2472
405 Ga0105238_10290797 3300009551 Bacteria 1616
406 Ga0105238_10361141 3300009551 Bacteria 1442
407 Ga0105238_10620429 3300009551 Bacteria 1090
408 Ga0105238_10658902 3300009551 Bacteria 1057
409 Ga0105238_10734731 3300009551 Bacteria 1000
410 Ga0105238_10843112 3300009551 Bacteria 933
411 Ga0105238_11952241 3300009551 Bacteria 620
412 Ga0105249_10140115 3300009553 Bacteria 2318
413 Ga0105249_10177926 3300009553 Bacteria 2067
414 Ga0105249_10862565 3300009553 Bacteria 971
415 Ga0105249_12359046 3300009553 Bacteria 605
416 Ga0105239_10031350 3300010375 Bacteria 5847
417 Ga0105239_10181295 3300010375 Bacteria 2356
418 Ga0105239_10228383 3300010375 Bacteria 2088
419 Ga0105239_10365880 3300010375 Bacteria 1629
420 Ga0105239_10494873 3300010375 Bacteria 1390
421 Ga0105239_10551755 3300010375 Bacteria 1312
422 Ga0105239_10590261 3300010375 Bacteria 1267
423 Ga0105239_10796409 3300010375 Bacteria 1083
424 Ga0105239_10844089 3300010375 Bacteria 1050
425 Ga0105239_10964983 3300010375 Unclassified 979
426 Ga0105239_11328225 3300010375 Bacteria 830
427 Ga0105239_11447103 3300010375 Bacteria 794
428 Ga0105239_12275253 3300010375 Bacteria 631
429 Ga0105239_12457728 3300010375 Bacteria 607
430 Ga0105239_12599383 3300010375 Bacteria 590
431 Ga0105239_13048090 3300010375 Bacteria 546
432 Ga0105246_10003700 3300011119 Bacteria 9254
433 Ga0105246_10714489 3300011119 Bacteria 880
434 Ga0157323_1032888 3300012495 Bacteria 559
435 Ga0157373_10058108 3300013100 Bacteria 2743
436 Ga0157373_10165335 3300013100 Bacteria 1557
437 Ga0157373_10214554 3300013100 Bacteria 1357
438 Ga0157373_10223553 3300013100 Bacteria 1328
439 Ga0157373_10386811 3300013100 Bacteria 1001
440 Ga0157371_10123746 3300013102 Bacteria 1839
441 Ga0157371_10246886 3300013102 Bacteria 1285
442 Ga0157371_10863345 3300013102 Bacteria 685
443 Ga0157371_11183759 3300013102 Bacteria 588
444 Ga0157371_11432314 3300013102 Bacteria 537
445 Ga0157370_10000019 3300013104 Bacteria 167473
446 Ga0157370_10001105 3300013104 Bacteria 33807
447 Ga0157370_10068416 3300013104 Bacteria 3356
448 Ga0157370_10229185 3300013104 Bacteria 1720
449 Ga0157370_10922186 3300013104 Bacteria 792
450 Ga0157370_11475863 3300013104 Bacteria 611
451 Ga0157369_10000081 3300013105 Bacteria 132630
452 Ga0157369_10000707 3300013105 Bacteria 42987
453 Ga0157369_10001102 3300013105 Bacteria 33815
454 Ga0157369_10001710 3300013105 Bacteria 26709
455 Ga0157369_10005051 3300013105 Bacteria 15449
456 Ga0157369_10015409 3300013105 Bacteria 8617
457 Ga0157369_10035363 3300013105 Bacteria 5478
458 Ga0157369_10109048 3300013105 Bacteria 2944
459 Ga0157369_10171732 3300013105 Bacteria 2284
460 Ga0157369_10200435 3300013105 Bacteria 2095
461 Ga0157369_10207146 3300013105 Bacteria 2056
462 Ga0157369_10235339 3300013105 Bacteria 1914
463 Ga0157369_10273410 3300013105 Bacteria 1760
464 Ga0157369_10308414 3300013105 Bacteria 1646
465 Ga0157369_10465537 3300013105 Bacteria 1309
466 Ga0157369_11108996 3300013105 Unclassified 809
467 Ga0157369_11201877 3300013105 Bacteria 774
468 Ga0157369_11718652 3300013105 Unclassified 637
469 Ga0157374_10009794 3300013296 Bacteria 8230
470 Ga0157374_10015610 3300013296 Bacteria 6666
471 Ga0157374_10114790 3300013296 Bacteria 2593
472 Ga0157374_10171968 3300013296 Bacteria 2114
473 Ga0157374_10194520 3300013296 Bacteria 1984
474 Ga0157374_10288087 3300013296 Bacteria 1622
475 Ga0157374_10359394 3300013296 Bacteria 1448
476 Ga0157374_11192940 3300013296 Bacteria 782
477 Ga0157374_11508860 3300013296 Bacteria 695
478 Ga0157374_12251042 3300013296 Bacteria 572
479 Ga0157378_10010577 3300013297 Bacteria 8063
480 Ga0157378_10041010 3300013297 Bacteria 4107
481 Ga0157378_10077857 3300013297 Bacteria 2990
482 Ga0157378_10269610 3300013297 Unclassified 1637
483 Ga0157378_10534356 3300013297 Bacteria 1176
484 Ga0157378_10939253 3300013297 Bacteria 897
485 Ga0157378_11938301 3300013297 Bacteria 638
486 Ga0163162_10053860 3300013306 Bacteria 4045
487 Ga0163162_10054763 3300013306 Bacteria 4013
488 Ga0163162_10067634 3300013306 Bacteria 3623
489 Ga0163162_10542947 3300013306 Bacteria 1291
490 Ga0163162_11150717 3300013306 Bacteria 880
491 Ga0163162_11391106 3300013306 Bacteria 798
492 Ga0163162_11394282 3300013306 Bacteria 797
493 Ga0163162_11540746 3300013306 Bacteria 758
494 Ga0157372_10000058 3300013307 Bacteria 125647
495 Ga0157372_10000816 3300013307 Bacteria 33749
496 Ga0157372_10005348 3300013307 Bacteria 13643
497 Ga0157372_10008671 3300013307 Bacteria 10800
498 Ga0157372_10011989 3300013307 Bacteria 9232
499 Ga0157372_10025712 3300013307 Bacteria 6404
500 Ga0157372_10028222 3300013307 Bacteria 6124
501 Ga0157372_10039761 3300013307 Bacteria 5192
502 Ga0157372_10115154 3300013307 Bacteria 3082
503 Ga0157372_10147772 3300013307 Bacteria 2711
504 Ga0157372_10176183 3300013307 Bacteria 2475
505 Ga0157372_10312382 3300013307 Bacteria 1829
506 Ga0157372_10360199 3300013307 Bacteria 1695
507 Ga0157372_10379563 3300013307 Bacteria 1647
508 Ga0157372_10672920 3300013307 Bacteria 1205
509 Ga0157372_10872702 3300013307 Bacteria 1044
510 Ga0157372_11310889 3300013307 Bacteria 835
511 Ga0157372_11394162 3300013307 Bacteria 808
512 Ga0157372_11605953 3300013307 Bacteria 749
513 Ga0157372_12076720 3300013307 Bacteria 653
514 Ga0157372_12486033 3300013307 Bacteria 595
515 Ga0157375_10019000 3300013308 Bacteria 6240
516 Ga0157375_10550618 3300013308 Bacteria 1315
517 Ga0157375_10817513 3300013308 Bacteria 1080
518 Ga0157375_11828074 3300013308 Bacteria 720
519 Ga0163163_10002835 3300014325 Bacteria 14651
520 Ga0163163_10007035 3300014325 Bacteria 9884
521 Ga0163163_10009352 3300014325 Bacteria 8750
522 Ga0163163_10018944 3300014325 Bacteria 6457
523 Ga0163163_10021461 3300014325 Bacteria 6095
524 Ga0163163_10040007 3300014325 Bacteria 4577
525 Ga0163163_10114203 3300014325 Bacteria 2731
526 Ga0163163_11405551 3300014325 Bacteria 759
527 Ga0157377_10148801 3300014745 Bacteria 1446
528 Ga0157377_10353471 3300014745 Bacteria 987
529 Ga0157379_10016500 3300014968 Bacteria 6496
530 Ga0157379_10042808 3300014968 Bacteria 4044
531 Ga0157379_10207680 3300014968 Bacteria 1772
532 Ga0157379_11454251 3300014968 Bacteria 666
533 Ga0157376_10004260 3300014969 Bacteria 9928
534 Ga0157376_10021757 3300014969 Bacteria 4983
535 Ga0157376_10060093 3300014969 Bacteria 3190
536 Ga0157376_10096545 3300014969 Bacteria 2572
537 Ga0157376_11031495 3300014969 Bacteria 846
538 Ga0182007_10072624 3300015262 Bacteria 1127
539 Ga0182007_10079996 3300015262 Bacteria 1072
540 Ga0184598_103997 3300019182 Bacteria 523
541 Ga0184601_144297 3300019183 Bacteria 502
542 Ga0184600_105364 3300019190 Bacteria 676
543 Ga0197907_10591539 3300020069 Bacteria 655
544 Ga0197907_11373818 3300020069 Bacteria 1114
545 Ga0206356_11755342 3300020070 Bacteria 1350
546 Ga0206349_1982423 3300020075 Bacteria 582
547 Ga0206355_1230271 3300020076 Bacteria 1105
548 Ga0206355_1445323 3300020076 Bacteria 562
549 Ga0206355_1641554 3300020076 Bacteria 522
550 Ga0206351_10682782 3300020077 Bacteria 574
551 Ga0206351_10823189 3300020077 Bacteria 792
552 Ga0206352_10040263 3300020078 Bacteria 1004
553 Ga0206352_10336565 3300020078 Bacteria 747
554 Ga0206352_10462609 3300020078 Bacteria 834
555 Ga0206350_11050674 3300020080 Bacteria 719
556 Ga0206350_11481399 3300020080 Bacteria 841
557 Ga0206354_11255018 3300020081 Bacteria 523
558 Ga0206353_10188743 3300020082 Bacteria 525
559 Ga0206353_10774232 3300020082 Bacteria 1102
560 Ga0206353_11141441 3300020082 Bacteria 587
561 Ga0206353_11692888 3300020082 Bacteria 524
562 Ga0154015_1084318 3300020610 Bacteria 1013
563 Ga0154015_1647532 3300020610 Bacteria 654
564 Ga0213872_10007421 3300021361 Bacteria 5395
565 Ga0213874_10011550 3300021377 Bacteria 2241
566 Ga0224712_10242302 3300022467 Bacteria 831
567 Ga0224712_10296094 3300022467 Bacteria 756
568 Ga0224569_100005 3300022732 Bacteria 13434
569 Ga0224571_100019 3300022734 Bacteria 4903
570 Ga0224572_1002797 3300024225 Bacteria 2872
571 Ga0228598_1000158 3300024227 Bacteria 11923
572 Ga0209233_1076817 3300025261 Bacteria 604
573 Ga0207656_10025114 3300025321 Bacteria 2417
574 Ga0207656_10037417 3300025321 Bacteria 2042
575 Ga0207656_10041702 3300025321 Bacteria 1951
576 Ga0207656_10053773 3300025321 Bacteria 1748
577 Ga0207656_10125465 3300025321 Unclassified 1199
578 Ga0207656_10152199 3300025321 Bacteria 1096
579 Ga0207656_10174028 3300025321 Bacteria 1030
580 Ga0207653_10025536 3300025885 Bacteria 1890
581 Ga0207692_10354659 3300025898 Bacteria 905
582 Ga0207642_10611080 3300025899 Bacteria 679
583 Ga0207710_10000588 3300025900 Bacteria 21466
584 Ga0207710_10003146 3300025900 Bacteria 7396
585 Ga0207680_10117960 3300025903 Bacteria 1732
586 Ga0207680_10400440 3300025903 Bacteria 970
587 Ga0207680_11160758 3300025903 Bacteria 551
588 Ga0207680_11173883 3300025903 Bacteria 548
589 Ga0207647_10002966 3300025904 Bacteria 12765
590 Ga0207647_10004432 3300025904 Bacteria 10405
591 Ga0207647_10077713 3300025904 Bacteria 1995
592 Ga0207647_10200990 3300025904 Bacteria 1153
593 Ga0207647_10304595 3300025904 Bacteria 907
594 Ga0207685_10410651 3300025905 Bacteria 696
595 Ga0207699_10218508 3300025906 Bacteria 1300
596 Ga0207643_10108112 3300025908 Bacteria 1636
597 Ga0207643_10166603 3300025908 Bacteria 1328
598 Ga0207705_10038112 3300025909 Bacteria 3440
599 Ga0207705_10043220 3300025909 Bacteria 3237
600 Ga0207705_10067892 3300025909 Bacteria 2581
601 Ga0207705_10079141 3300025909 Bacteria 2393
602 Ga0207705_10091806 3300025909 Bacteria 2224
603 Ga0207705_10290082 3300025909 Bacteria 1253
604 Ga0207684_10002399 3300025910 Bacteria 18956
605 Ga0207684_10008061 3300025910 Bacteria 9401
606 Ga0207684_10369518 3300025910 Bacteria 1234
607 Ga0207654_10000206 3300025911 Bacteria 36317
608 Ga0207654_10000297 3300025911 Bacteria 30110
609 Ga0207654_10000359 3300025911 Bacteria 26847
610 Ga0207654_10022335 3300025911 Bacteria 3374
611 Ga0207654_10025493 3300025911 Bacteria 3190
612 Ga0207654_10206174 3300025911 Bacteria 1297
613 Ga0207654_10816642 3300025911 Bacteria 674
614 Ga0207654_11078515 3300025911 Bacteria 585
615 Ga0207707_10022424 3300025912 Bacteria 5520
616 Ga0207707_10081738 3300025912 Bacteria 2820
617 Ga0207707_10718019 3300025912 Bacteria 838
618 Ga0207707_10780112 3300025912 Bacteria 797
619 Ga0207707_11128413 3300025912 Bacteria 638
620 Ga0207707_11303555 3300025912 Bacteria 583
621 Ga0207695_10000030 3300025913 Bacteria 533735
622 Ga0207695_10000115 3300025913 Bacteria 240394
623 Ga0207695_10000292 3300025913 Bacteria 123721
624 Ga0207695_10001293 3300025913 Bacteria 42467
625 Ga0207695_10001801 3300025913 Bacteria 33823
626 Ga0207695_10024299 3300025913 Bacteria 6821
627 Ga0207695_10039759 3300025913 Bacteria 5052
628 Ga0207695_10059231 3300025913 Bacteria 3972
629 Ga0207695_10080227 3300025913 Bacteria 3305
630 Ga0207695_10338825 3300025913 Bacteria 1392
631 Ga0207695_10731028 3300025913 Bacteria 870
632 Ga0207695_10914230 3300025913 Bacteria 757
633 Ga0207695_11213165 3300025913 Bacteria 635
634 Ga0207695_11523391 3300025913 Bacteria 549
635 Ga0207671_10000047 3300025914 Bacteria 196307
636 Ga0207671_10000376 3300025914 Bacteria 63349
637 Ga0207671_10000503 3300025914 Bacteria 53115
638 Ga0207671_10355186 3300025914 Bacteria 1162
639 Ga0207671_10578413 3300025914 Bacteria 895
640 Ga0207671_10654782 3300025914 Bacteria 836
641 Ga0207671_11078163 3300025914 Bacteria 631
642 Ga0207671_11265664 3300025914 Bacteria 575
643 Ga0207671_11529080 3300025914 Bacteria 515
644 Ga0207693_10151955 3300025915 Bacteria 1821
645 Ga0207663_10371000 3300025916 Bacteria 1088
646 Ga0207663_11272941 3300025916 Bacteria 592
647 Ga0207660_10036090 3300025917 Bacteria 3436
648 Ga0207660_10179686 3300025917 Bacteria 1643
649 Ga0207660_10359216 3300025917 Bacteria 1168
650 Ga0207660_10649458 3300025917 Bacteria 860
651 Ga0207660_10799138 3300025917 Bacteria 770
652 Ga0207660_11708150 3300025917 Bacteria 506
653 Ga0207660_11735733 3300025917 Bacteria 502
654 Ga0207657_10055732 3300025919 Bacteria 3413
655 Ga0207657_10454039 3300025919 Bacteria 1005
656 Ga0207657_10458444 3300025919 Bacteria 1000
657 Ga0207649_10003968 3300025920 Bacteria 8067
658 Ga0207649_10033554 3300025920 Bacteria 3068
659 Ga0207649_10039732 3300025920 Bacteria 2854
660 Ga0207649_10043161 3300025920 Bacteria 2755
661 Ga0207649_11278902 3300025920 Bacteria 580
662 Ga0207649_11334758 3300025920 Bacteria 567
663 Ga0207652_10027895 3300025921 Bacteria 4709
664 Ga0207652_10322810 3300025921 Bacteria 1394
665 Ga0207652_10481105 3300025921 Bacteria 1118
666 Ga0207652_11026017 3300025921 Bacteria 724
667 Ga0207652_11041720 3300025921 Bacteria 718
668 Ga0207652_11814326 3300025921 Bacteria 515
669 Ga0207646_10021267 3300025922 Bacteria 5996
670 Ga0207646_10087235 3300025922 Bacteria 2793
671 Ga0207646_10145937 3300025922 Bacteria 2132
672 Ga0207646_10812829 3300025922 Bacteria 832
673 Ga0207646_10994821 3300025922 Bacteria 741
674 Ga0207681_10023444 3300025923 Bacteria 3948
675 Ga0207681_10341882 3300025923 Bacteria 1196
676 Ga0207694_10000167 3300025924 Bacteria 67706
677 Ga0207694_10000497 3300025924 Bacteria 35591
678 Ga0207694_10000697 3300025924 Bacteria 30202
679 Ga0207694_10172613 3300025924 Bacteria 1751
680 Ga0207694_10251409 3300025924 Bacteria 1446
681 Ga0207694_10272387 3300025924 Bacteria 1389
682 Ga0207694_10347444 3300025924 Bacteria 1227
683 Ga0207694_10416483 3300025924 Bacteria 1119
684 Ga0207694_10447894 3300025924 Unclassified 1077
685 Ga0207694_10477081 3300025924 Bacteria 1043
686 Ga0207694_11508536 3300025924 Bacteria 567
687 Ga0207694_11551868 3300025924 Bacteria 558
688 Ga0207650_10000090 3300025925 Bacteria 118973
689 Ga0207650_10004940 3300025925 Bacteria 9108
690 Ga0207650_10008028 3300025925 Bacteria 7193
691 Ga0207650_11636668 3300025925 Bacteria 546
692 Ga0207659_10111305 3300025926 Bacteria 2082
693 Ga0207659_10573328 3300025926 Bacteria 961
694 Ga0207687_10000707 3300025927 Bacteria 22619
695 Ga0207687_10004473 3300025927 Bacteria 9303
696 Ga0207700_10118702 3300025928 Bacteria 2141
697 Ga0207700_10171687 3300025928 Bacteria 1809
698 Ga0207700_10225396 3300025928 Bacteria 1591
699 Ga0207700_10907348 3300025928 Bacteria 788
700 Ga0207700_11118698 3300025928 Bacteria 704
701 Ga0207700_11922991 3300025928 Bacteria 518
702 Ga0207664_10068696 3300025929 Bacteria 2847
703 Ga0207664_10172892 3300025929 Bacteria 1850
704 Ga0207664_10414229 3300025929 Bacteria 1200
705 Ga0207664_10626290 3300025929 Bacteria 966
706 Ga0207664_11135485 3300025929 Bacteria 698
707 Ga0207664_11182020 3300025929 Bacteria 682
708 Ga0207644_10011067 3300025931 Bacteria 5959
709 Ga0207644_10026155 3300025931 Bacteria 4019
710 Ga0207644_11693084 3300025931 Bacteria 530
711 Ga0207690_10438378 3300025932 Bacteria 1048
712 Ga0207690_11448091 3300025932 Bacteria 574
713 Ga0207706_10309935 3300025933 Bacteria 1375
714 Ga0207706_10815393 3300025933 Bacteria 792
715 Ga0207686_10620172 3300025934 Bacteria 853
716 Ga0207709_10105625 3300025935 Bacteria 1872
717 Ga0207709_10869581 3300025935 Bacteria 731
718 Ga0207670_10119215 3300025936 Bacteria 1915
719 Ga0207704_10191130 3300025938 Bacteria 1489
720 Ga0207704_10665001 3300025938 Bacteria 859
721 Ga0207665_10000111 3300025939 Bacteria 53549
722 Ga0207665_10109296 3300025939 Bacteria 1941
723 Ga0207665_10316082 3300025939 Bacteria 1171
724 Ga0207665_10627105 3300025939 Bacteria 841
725 Ga0207691_10037179 3300025940 Bacteria 4510
726 Ga0207691_11658093 3300025940 Bacteria 518
727 Ga0207711_10001551 3300025941 Bacteria 21254
728 Ga0207711_10015108 3300025941 Bacteria 6412
729 Ga0207711_10022270 3300025941 Bacteria 5298
730 Ga0207711_10950798 3300025941 Bacteria 798
731 Ga0207689_10001472 3300025942 Bacteria 22548
732 Ga0207689_10058806 3300025942 Bacteria 3162
733 Ga0207689_10065263 3300025942 Bacteria 2994
734 Ga0207661_10008793 3300025944 Bacteria 7226
735 Ga0207661_10013851 3300025944 Bacteria 5894
736 Ga0207661_10020092 3300025944 Bacteria 4988
737 Ga0207661_10127022 3300025944 Bacteria 2179
738 Ga0207661_10260181 3300025944 Bacteria 1545
739 Ga0207661_10354944 3300025944 Bacteria 1323
740 Ga0207661_10638177 3300025944 Bacteria 978
741 Ga0207679_10004118 3300025945 Bacteria 9029
742 Ga0207679_10050322 3300025945 Bacteria 3044
743 Ga0207679_10053711 3300025945 Bacteria 2962
744 Ga0207679_11209541 3300025945 Bacteria 693
745 Ga0207667_10001336 3300025949 Bacteria 30925
746 Ga0207667_10002403 3300025949 Bacteria 23441
747 Ga0207667_10002664 3300025949 Bacteria 22067
748 Ga0207667_10024876 3300025949 Bacteria 6565
749 Ga0207667_10040027 3300025949 Bacteria 4990
750 Ga0207667_10158526 3300025949 Bacteria 2328
751 Ga0207667_10427487 3300025949 Bacteria 1347
752 Ga0207667_10615428 3300025949 Bacteria 1094
753 Ga0207667_10990505 3300025949 Bacteria 828
754 Ga0207667_11401431 3300025949 Bacteria 672
755 Ga0207651_10044357 3300025960 Bacteria 2975
756 Ga0207712_10112929 3300025961 Bacteria 2041
757 Ga0207640_10007046 3300025981 Bacteria 6189
758 Ga0207640_10096947 3300025981 Bacteria 2057
759 Ga0207640_10135791 3300025981 Bacteria 1785
760 Ga0207640_10959901 3300025981 Bacteria 750
761 Ga0207640_11479469 3300025981 Bacteria 610
762 Ga0207658_10000076 3300025986 Bacteria 108585
763 Ga0207658_10001070 3300025986 Bacteria 22181
764 Ga0207658_10505324 3300025986 Bacteria 1077
765 Ga0207658_10612754 3300025986 Bacteria 979
766 Ga0207658_11851351 3300025986 Bacteria 550
767 Ga0207677_10000052 3300026023 Bacteria 99952
768 Ga0207677_10000055 3300026023 Bacteria 98214
769 Ga0207677_10384170 3300026023 Bacteria 1186
770 Ga0207677_11712607 3300026023 Bacteria 583
771 Ga0207677_12176730 3300026023 Bacteria 516
772 Ga0207703_10007880 3300026035 Bacteria 8424
773 Ga0207703_10009922 3300026035 Bacteria 7471
774 Ga0207703_10591702 3300026035 Bacteria 1049
775 Ga0207703_10600440 3300026035 Bacteria 1041
776 Ga0207703_10823369 3300026035 Bacteria 887
777 Ga0207703_11013236 3300026035 Bacteria 797
778 Ga0207639_10000107 3300026041 Bacteria 67097
779 Ga0207639_10059439 3300026041 Bacteria 2944
780 Ga0207639_10241487 3300026041 Unclassified 1571
781 Ga0207639_10264192 3300026041 Bacteria 1507
782 Ga0207639_10357570 3300026041 Bacteria 1306
783 Ga0207639_10829943 3300026041 Bacteria 862
784 Ga0207678_10046048 3300026067 Bacteria 3772
785 Ga0207678_10071390 3300026067 Bacteria 2977
786 Ga0207678_10517196 3300026067 Bacteria 1041
787 Ga0207678_10818184 3300026067 Bacteria 823
788 Ga0207678_11387184 3300026067 Bacteria 621
789 Ga0207678_11689686 3300026067 Bacteria 556
790 Ga0207702_10002652 3300026078 Bacteria 16796
791 Ga0207702_10004569 3300026078 Bacteria 12264
792 Ga0207702_10015108 3300026078 Bacteria 6402
793 Ga0207702_10021369 3300026078 Bacteria 5358
794 Ga0207702_10130442 3300026078 Bacteria 2261
795 Ga0207702_10160985 3300026078 Bacteria 2050
796 Ga0207702_10215121 3300026078 Bacteria 1788
797 Ga0207702_10628458 3300026078 Bacteria 1055
798 Ga0207702_10855614 3300026078 Bacteria 900
799 Ga0207702_11020102 3300026078 Bacteria 821
800 Ga0207641_10000694 3300026088 Bacteria 36241
801 Ga0207641_10001842 3300026088 Bacteria 20372
802 Ga0207641_10031063 3300026088 Bacteria 4428
803 Ga0207648_11888125 3300026089 Bacteria 559
804 Ga0207676_10002573 3300026095 Bacteria 12942
805 Ga0207676_10004619 3300026095 Bacteria 9750
806 Ga0207676_11280727 3300026095 Bacteria 727
807 Ga0207674_10000840 3300026116 Bacteria 40031
808 Ga0207674_10002679 3300026116 Bacteria 22218
809 Ga0207674_10003714 3300026116 Bacteria 18637
810 Ga0207674_10004127 3300026116 Bacteria 17570
811 Ga0207674_10018373 3300026116 Bacteria 7600
812 Ga0207674_10022509 3300026116 Bacteria 6766
813 Ga0207674_10024242 3300026116 Bacteria 6486
814 Ga0207674_10036924 3300026116 Bacteria 5085
815 Ga0207674_10198809 3300026116 Bacteria 1954
816 Ga0207674_10217646 3300026116 Bacteria 1858
817 Ga0207674_11430623 3300026116 Bacteria 661
818 Ga0207698_10000011 3300026142 Bacteria 260352
819 Ga0207698_10000059 3300026142 Bacteria 76632
820 Ga0207698_10000239 3300026142 Bacteria 34266
821 Ga0207698_10036972 3300026142 Bacteria 3591
822 Ga0207698_10038724 3300026142 Bacteria 3525
823 Ga0207698_10057267 3300026142 Bacteria 3014
824 Ga0207698_10091253 3300026142 Bacteria 2493
825 Ga0207698_10889964 3300026142 Bacteria 897
826 Ga0207698_12020430 3300026142 Bacteria 591
827 Ga0207698_12664499 3300026142 Bacteria 509
828 Ga0207698_12718232 3300026142 Bacteria 503
829 Ga0209588_1000776 3300027671 Bacteria 8125
830 Ga0209588_1248218 3300027671 Bacteria 544
831 Ga0209813_10114637 3300027866 Bacteria 932
832 Ga0207428_10000299 3300027907 Bacteria 65352
833 Ga0265356_1005931 3300028017 Bacteria 1441
834 Ga0268266_10007211 3300028379 Bacteria 10055
835 Ga0268266_10373157 3300028379 Bacteria 1344
836 Ga0268266_10427715 3300028379 Bacteria 1256
837 Ga0268266_10461543 3300028379 Bacteria 1208
838 Ga0268266_10644192 3300028379 Bacteria 1019
839 Ga0268266_10688369 3300028379 Bacteria 985
840 Ga0268265_10028181 3300028380 Bacteria 4019
841 Ga0268265_10053823 3300028380 Bacteria 3050
842 Ga0268265_10147657 3300028380 Bacteria 1978
843 Ga0268265_10414234 3300028380 Bacteria 1249
844 Ga0268264_10001263 3300028381 Bacteria 24024
845 Ga0268264_11149932 3300028381 Bacteria 785
846 Ga0268264_11271649 3300028381 Bacteria 746
847 Ga0268264_11526328 3300028381 Bacteria 679
848 Ga0265323_10043562 3300028653 Bacteria 1620
849 Ga0265323_10085533 3300028653 Unclassified 1060
850 Ga0265338_10263239 3300028800 Bacteria 1267
851 Ga0265762_1004180 3300030760 Bacteria 2588
852 Ga0265775_105134 3300030762 Bacteria 749
853 Ga0265766_1019194 3300030863 Bacteria 553
854 Ga0265777_102106 3300030877 Bacteria 1124
855 Ga0265764_103914 3300030882 Bacteria 793
856 Ga0265764_114819 3300030882 Bacteria 530
857 Ga0265769_116386 3300030888 Bacteria 559
858 Ga0265761_102203 3300030889 Bacteria 900
859 Ga0265771_1016502 3300031010 Bacteria 603
860 Ga0265774_105592 3300031011 Bacteria 553
861 Ga0265779_109831 3300031043 Bacteria 579
862 Ga0265760_10113032 3300031090 Bacteria 866
863 Ga0265760_10185526 3300031090 Bacteria 697
864 Ga0265330_10385663 3300031235 Bacteria 592
865 Ga0265339_10251993 3300031249 Bacteria 854
866 Ga0265316_10088468 3300031344 Bacteria 2365
867 Ga0265316_10312576 3300031344 Bacteria 1143
868 Ga0265316_10496870 3300031344 Bacteria 872
869 Ga0307408_100015742 3300031548 Bacteria 5039
870 Ga0316575_10411201 3300031665 Bacteria 581
871 Ga0307405_10042021 3300031731 Bacteria 2780
872 Ga0307413_10751178 3300031824 Bacteria 815
873 Ga0307410_10006891 3300031852 Bacteria 6173
874 Ga0307406_10688427 3300031901 Bacteria 852
875 Ga0307407_10464666 3300031903 Bacteria 921
876 Ga0307407_11710558 3300031903 Bacteria 501
877 Ga0307412_10366635 3300031911 Bacteria 1162
878 Ga0307412_10435107 3300031911 Bacteria 1076
879 Ga0307409_100091567 3300031995 Bacteria 2492
880 Ga0307409_100833547 3300031995 Bacteria 932
881 Ga0307416_100012293 3300032002 Bacteria 5760
882 Ga0307416_100339700 3300032002 Bacteria 1514
883 Ga0307411_10002046 3300032005 Bacteria 8658
884 Ga0307411_10650537 3300032005 Bacteria 912
885 Ga0316053_110382 3300032120 Bacteria 648
886 Ga0307415_100001842 3300032126 Bacteria 10401
887 Ga0307415_100034041 3300032126 Bacteria 3312
888 Ga0316583_10029718 3300032133 Bacteria 1948
889 Ga0307510_10142569 3300033180 Bacteria 2036
890 Ga0307510_10396785 3300033180 Bacteria 823
891 Ga0316592_1087192 3300033524 Unclassified 712
892 Ga0316587_1065459 3300033529 Unclassified 677
893 Ga0373948_0023108 3300034817 Bacteria 1204
894 Ga0373958_0097486 3300034819 Bacteria 686
895 Ga0373960_0374122 3300035121 Bacteria 545
896 Ga0373943_0339941 3300035170 Bacteria 859
897 Ga0373943_0542642 3300035170 Bacteria 682
898 Ga0373955_0564235 3300035172 Bacteria 697
899 Ga0316574_0186022 3300035398 Bacteria 1336
900 Ga0316574_0748797 3300035398 Bacteria 597
901 Ga0373931_1245041 3300035691 Bacteria 510
902 Ga0373933_0922133 3300035724 Bacteria 575
903 Ga0373937_0261190 3300036401 Bacteria 1633
904 Ga0373937_0293875 3300036401 Bacteria 1535
905 Ga0373937_1345160 3300036401 Bacteria 662
906 Ga0373937_1626959 3300036401 Bacteria 593
907 Ga0265778_059849 3300036457 Bacteria 531
908 Ga0373925_1162772 3300037068 Bacteria 634
909 Ga0395899_0012994 3300037312 Bacteria 6371
910 Ga0395900_0007414 3300037418 Bacteria 11335
911 Ga0395900_0349337 3300037418 Bacteria 1453
912 Ga0395900_0836116 3300037418 Bacteria 847
913 Ga0395900_1085642 3300037418 Bacteria 718
914 Ga0395900_1186080 3300037418 Bacteria 679
915 Ga0395900_1205976 3300037418 Bacteria 672
916 Ga0395905_0008077 3300037471 Bacteria 10394
917 Ga0395905_0025215 3300037471 Bacteria 5608
918 Ga0395905_0027436 3300037471 Bacteria 5370
919 Ga0395905_0040790 3300037471 Bacteria 4355
920 Ga0395905_0102839 3300037471 Bacteria 2682
921 Ga0395901_0629557 3300038443 Bacteria 1079
922 Ga0436365_0395743 3300039437 Bacteria 818
923 Ga0436365_1543233 3300039437 Bacteria 961
924 Ga0436361_0510228 3300039447 Bacteria 6614
925 Ga0436361_0520510 3300039447 Bacteria 1898
926 Ga0436363_1107256 3300039450 Bacteria 633
927 Ga0436363_1532784 3300039450 Bacteria 4313
928 Ga0436362_1101430 3300039453 Bacteria 666
929 Ga0436362_1298094 3300039453 Bacteria 609
930 Ga0439436_0258594 3300041404 Bacteria 506
931 Ga0451791_0865225 3300041451 Bacteria 687
932 Ga0439433_0038011 3300041999 Bacteria 1115
933 Ga0439441_025853 3300042001 Bacteria 1111
934 Ga0439448_0137098 3300042005 Bacteria 846
935 Ga0439448_0219088 3300042005 Bacteria 669
936 Ga0439448_0283232 3300042005 Bacteria 587
937 Ga0439449_0002082 3300042007 Bacteria 7864
938 Ga0450923_053088 3300042125 Bacteria 874
939 Ga0439446_0329524 3300042156 Bacteria 541
940 Ga0451577_0000818 3300042876 Bacteria 46723
941 Ga0451577_0006524 3300042876 Bacteria 11614
942 Ga0451577_0024652 3300042876 Bacteria 5470
943 Ga0451577_0255218 3300042876 Bacteria 1587
944 Ga0451577_0737630 3300042876 Bacteria 891
945 Ga0453683_0016561 3300044673 Bacteria 4756
946 Ga0453683_0107458 3300044673 Bacteria 1754
947 Ga0453683_0185002 3300044673 Bacteria 1322
948 Ga0453683_0367380 3300044673 Bacteria 925
949 Ga0453683_0410522 3300044673 Bacteria 873
950 Ga0453683_0768716 3300044673 Bacteria 633
951 Ga0466963_0025542 3300044694 Bacteria 3768
952 Ga0466963_0036270 3300044694 Bacteria 3215
953 Ga0466963_0038283 3300044694 Bacteria 3135
954 Ga0453684_0000803 3300044712 Bacteria 107106
955 Ga0453684_0036556 3300044712 Bacteria 6767
956 Ga0453684_0055242 3300044712 Bacteria 5164
957 Ga0453684_0408943 3300044712 Bacteria 1518
958 Ga0453684_0831858 3300044712 Bacteria 993
959 Ga0453684_2033838 3300044712 Bacteria 578
960 Ga0453684_2066447 3300044712 Bacteria 572
961 Ga0453684_2316097 3300044712 Bacteria 534
962 Ga0466971_0322344 3300044719 Bacteria 745
963 Ga0466959_0141489 3300045049 Bacteria 1700
964 Ga0466959_0851990 3300045049 Bacteria 609
965 Ga0451576_0006949 3300045051 Bacteria 13705
966 Ga0451576_0014212 3300045051 Bacteria 8872
967 Ga0451576_0453443 3300045051 Bacteria 1346
968 Ga0451576_0523969 3300045051 Bacteria 1245
969 Ga0451576_1872935 3300045051 Bacteria 619
970 Ga0466958_0558685 3300045836 Bacteria 744
971 Ga0466958_0584301 3300045836 Bacteria 726
972 Ga0466958_0730860 3300045836 Bacteria 645
973 Ga0466967_0001802 3300045976 Bacteria 12845
974 Ga0466967_0575472 3300045976 Bacteria 1110
975 Ga0466967_1239922 3300045976 Bacteria 743
976 Ga0466967_1339251 3300045976 Bacteria 713
977 Ga0466967_1992178 3300045976 Bacteria 577
978 Ga0495590_0086527 3300046457 Bacteria 1107
979 Ga0495651_0046854 3300046462 Bacteria 3345
980 Ga0495651_0764995 3300046462 Bacteria 598
981 Ga0495653_0389928 3300046463 Bacteria 888
982 Ga0495580_0363815 3300046472 Bacteria 979
983 Ga0495582_0328891 3300046473 Bacteria 880
984 Ga0495639_0298439 3300046475 Unclassified 803
985 Ga0495664_0279670 3300046477 Bacteria 1008
986 Ga0495583_0344635 3300046506 Bacteria 588
987 Ga0495608_0884909 3300046511 Bacteria 523
988 Ga0495628_0915778 3300046516 Bacteria 608
989 Ga0495643_0115001 3300046522 Bacteria 1364
990 Ga0495652_0071133 3300046529 Bacteria 2905
991 Ga0495652_0673866 3300046529 Bacteria 698
992 Ga0495652_1009449 3300046529 Bacteria 544
993 Ga0495586_0368822 3300046535 Bacteria 825
994 Ga0495587_0113471 3300046536 Bacteria 1555
995 Ga0495587_0709367 3300046536 Bacteria 551
996 Ga0495645_0000781 3300046543 Bacteria 21806
997 Ga0495645_0018179 3300046543 Bacteria 5047
998 Ga0495645_0550023 3300046543 Bacteria 715
999 Ga0495668_0585856 3300046616 Bacteria 616
1000 Ga0495625_0063040 3300046660 Bacteria 2619
1001 Ga0495625_0892497 3300046660 Bacteria 510
1002 Ga0495635_0161273 3300046663 Bacteria 1526
1003 Ga0495635_0202143 3300046663 Bacteria 1347
1004 Ga0495599_0625446 3300046678 Bacteria 625
1005 Ga0495623_0061112 3300046679 Bacteria 2363
1006 Ga0495623_0074604 3300046679 Bacteria 2108
1007 Ga0495646_0009843 3300046680 Bacteria 6075
1008 Ga0495646_0696448 3300046680 Bacteria 511
1009 Ga0495669_0080159 3300046684 Bacteria 1498
1010 Ga0495669_0398375 3300046684 Bacteria 667
1011 Ga0495669_0563686 3300046684 Bacteria 554
1012 Ga0495613_0430824 3300046689 Bacteria 896
1013 Ga0495671_0466328 3300046692 Bacteria 603
1014 Ga0495649_0149118 3300046694 Bacteria 1229
1015 Ga0495600_0094647 3300046809 Bacteria 1948
1016 Ga0495604_0062399 3300047317 Bacteria 2847
1017 Ga0495604_0565507 3300047317 Bacteria 732
1018 Ga0495674_0693285 3300047319 Bacteria 800
1019 Ga0495674_1198836 3300047319 Bacteria 574
1020 Ga0495680_0922660 3300047322 Bacteria 563
1021 Ga0495683_0181532 3300047323 Bacteria 961
1022 Ga0495687_131774 3300047443 Bacteria 883
1023 Ga0495675_0100151 3300047444 Bacteria 1814
1024 Ga0495684_0345310 3300047471 Bacteria 1058
1025 Ga0495686_0476126 3300047472 Bacteria 660
1026 Ga0495602_0256746 3300048088 Bacteria 1299
1027 Ga0495602_0884772 3300048088 Bacteria 595
1028 Ga0496100_1315938 3300048903 Bacteria 570
1029 Ga0496101_0241415 3300048904 Bacteria 1406
1030 Ga0496101_0697124 3300048904 Bacteria 802
1031 Ga0496103_0195603 3300048906 Bacteria 1300
1032 Ga0496104_0040556 3300048907 Bacteria 4364
1033 Ga0496104_0468253 3300048907 Bacteria 1172
1034 Ga0496104_1148873 3300048907 Bacteria 680
1035 Ga0496105_0166346 3300048908 Bacteria 1809
1036 Ga0496105_0202716 3300048908 Bacteria 1619
1037 Ga0496108_0026741 3300048911 Bacteria 4763
1038 Ga0496108_0046396 3300048911 Bacteria 3630
1039 Ga0496108_0096729 3300048911 Bacteria 2515
1040 Ga0496109_0015917 3300048912 Bacteria 6568
1041 Ga0496109_0078800 3300048912 Bacteria 3034
1042 Ga0496109_0791849 3300048912 Bacteria 886
1043 Ga0496110_0043752 3300048913 Bacteria 3910
1044 Ga0496110_1404128 3300048913 Bacteria 608
1045 Ga0496111_0074367 3300048914 Bacteria 2475
1046 Ga0496112_0014309 3300048915 Bacteria 7351
1047 Ga0496112_0046437 3300048915 Bacteria 4259
1048 Ga0496112_0065430 3300048915 Bacteria 3587
1049 Ga0496112_0173153 3300048915 Bacteria 2124
1050 Ga0496112_0490605 3300048915 Bacteria 1164
1051 Ga0496113_0016771 3300048916 Bacteria 5067
1052 Ga0496113_0133902 3300048916 Bacteria 1946
1053 Ga0496113_0824391 3300048916 Bacteria 736
1054 Ga0496115_0434388 3300048918 Bacteria 1062
1055 Ga0496115_0507457 3300048918 Bacteria 968
1056 Ga0496115_0607701 3300048918 Bacteria 869
1057 Ga0496119_0065543 3300048922 Bacteria 2151
1058 Ga0496121_0828943 3300048924 Bacteria 540
1059 Ga0496126_0016529 3300048929 Bacteria 7375
1060 Ga0496126_0830221 3300048929 Bacteria 707
1061 Ga0495682_0057786 3300049460 Bacteria 1404
1062 Ga0495682_0060129 3300049460 Bacteria 1372
1063 Ga0501299_115708 3300049522 Bacteria 640
1064 Ga0501312_101970 3300049528 Bacteria 539
1065 Ga0501031_0033208 3300049568 Bacteria 3365
1066 Ga0501032_0178813 3300049569 Bacteria 1389
1067 Ga0501033_0023595 3300049570 Bacteria 4639
1068 Ga0501034_0008002 3300049571 Bacteria 11220
1069 Ga0501034_0070152 3300049571 Bacteria 3516
1070 Ga0501036_0003425 3300049572 Bacteria 12671
1071 Ga0501037_0013264 3300049573 Bacteria 6072
1072 Ga0501038_0002323 3300049574 Bacteria 17693
1073 Ga0501039_0803183 3300049575 Bacteria 734
1074 Ga0501040_0089120 3300049576 Bacteria 2143
1075 Ga0501040_0123045 3300049576 Bacteria 1821
1076 Ga0501043_0002319 3300049579 Bacteria 16114
1077 Ga0501046_0000106 3300049580 Bacteria 89243
1078 Ga0501046_0751997 3300049580 Bacteria 685
1079 Ga0501047_0005612 3300049581 Bacteria 11819
1080 Ga0501048_0318447 3300049582 Bacteria 1108
1081 Ga0501048_0766391 3300049582 Bacteria 693
1082 Ga0501068_0020211 3300049584 Bacteria 3877
1083 Ga0501070_0078873 3300049586 Bacteria 2725
1084 Ga0501072_0386191 3300049588 Bacteria 1111
1085 Ga0501072_0907653 3300049588 Bacteria 688
1086 Ga0501073_0054288 3300049589 Bacteria 2805
1087 Ga0501073_0086276 3300049589 Bacteria 2183
1088 Ga0501073_1202418 3300049589 Bacteria 520
1089 Ga0501075_0102505 3300049591 Bacteria 2174
1090 Ga0501076_0931127 3300049592 Bacteria 716
1091 Ga0501077_0049431 3300049593 Bacteria 2673
1092 Ga0501201_047589 3300049651 Bacteria 529
1093 Ga0501250_086311 3300049680 Bacteria 541
1094 Ga0501256_037217 3300049685 Bacteria 568
1095 Ga0501221_112417 3300049704 Bacteria 688
1096 Ga0501234_086055 3300049707 Bacteria 559
1097 Ga0501245_125581 3300049708 Bacteria 545
1098 Ga0501079_0617540 3300049741 Bacteria 853
1099 Ga0501079_1165152 3300049741 Bacteria 607
1100 Ga0501080_0210836 3300049742 Bacteria 1780
1101 Ga0501274_012480 3300049771 Bacteria 805
1102 Ga0501035_0202103 3300049822 Bacteria 1703
1103 Ga0501035_0218211 3300049822 Bacteria 1629
1104 Ga0501044_0080457 3300049823 Bacteria 3300
1105 Ga0501044_0558274 3300049823 Bacteria 1041
1106 Ga0501045_0073634 3300049824 Bacteria 2516
1107 nmdc:mga03683_624164_c1 3300050489 Unclassified 529
1108 nmdc:mga03n38_589969_c1 3300050490 Archaea 632
1109 nmdc:mga00v17_1052193_c1 3300050491 Bacteria 511
1110 nmdc:mga0yw44_861963_c1 3300050492 Bacteria 615
1111 nmdc:mga06z11_611662_c1 3300050494 Bacteria 663
1112 nmdc:mga04h51_112783_c1 3300050495 Bacteria 1004
1113 nmdc:mga07m45_409555_c1 3300050496 Bacteria 787
1114 nmdc:mga05p37_351502_c1 3300050507 Bacteria 1735
1115 nmdc:mga05p37_625783_c1 3300050507 Bacteria 1210
1116 nmdc:mga05p37_929_c1 3300050507 Bacteria 32527
1117 nmdc:mga09592_1426664_c1 3300050508 Bacteria 565
1118 nmdc:mga09592_1708180_c1 3300050508 Bacteria 507
1119 nmdc:mga09592_779_c1 3300050508 Bacteria 24616
1120 nmdc:mga0qj67_309711_c1 3300050509 Unclassified 1279
1121 nmdc:mga06r32_1350870_c1 3300050510 Bacteria 655
1122 nmdc:mga06r32_451439_c1 3300050510 Bacteria 1265
1123 nmdc:mga06r32_570712_c1 3300050510 Bacteria 1104
1124 nmdc:mga06r32_593560_c1 3300050510 Bacteria 1079
1125 nmdc:mga08y16_19633_c1 3300050511 Bacteria 7127
1126 nmdc:mga08y16_625177_c1 3300050511 Bacteria 1083
1127 nmdc:mga0n895_2112276_c1 3300050512 Bacteria 520
1128 nmdc:mga0n895_4165_c1 3300050512 Bacteria 11803
1129 nmdc:mga0rr50_1757640_c1 3300050513 Bacteria 522
1130 nmdc:mga0rr50_227413_c2 3300050513 Bacteria 1154
1131 nmdc:mga0rr50_254447_c1 3300050513 Bacteria 1459
1132 nmdc:mga08x19_1150071_c1 3300050514 Bacteria 551
1133 nmdc:mga08x19_296333_c1 3300050514 Bacteria 1123
1134 nmdc:mga08x19_532757_c1 3300050514 Bacteria 830
1135 nmdc:mga08x19_77083_c1 3300050514 Bacteria 2183
1136 nmdc:mga08x19_843806_c1 3300050514 Bacteria 651
1137 nmdc:mga0a205_23561_c1 3300050515 Bacteria 5840
1138 Ga0495601_0109528 3300053077 Bacteria 1788
1139 Ga0495601_0337551 3300053077 Bacteria 980
1140 Ga0500595_000032 3300053119 Bacteria 111447
1141 Ga0500559_0555345 3300053136 Bacteria 523
1142 Ga0501084_0141850 3300054114 Bacteria 2023
1143 Ga0500661_001186 3300055283 Bacteria 4875
1144 Ga0587066_055213 3300059490 Bacteria 795
1145 Ga0587073_0156911 3300059492 Bacteria 649
1146 Ga0587077_017890 3300059493 Bacteria 1213
1147 Ga0587077_043834 3300059493 Bacteria 909
1148 Ga0587077_256168 3300059493 Bacteria 508
1149 Ga0587080_088305 3300059503 Bacteria 647
1150 Ga0587082_087965 3300059504 Bacteria 658
1151 Ga0587083_0139780 3300059505 Bacteria 644
1152 Ga0587085_184512 3300059506 Bacteria 502
1153 Ga0587088_079650 3300059508 Bacteria 699
1154 Ga0587088_094395 3300059508 Bacteria 660
1155 Ga0587089_079091 3300059509 Bacteria 570
1156 Ga0587091_101168 3300059511 Bacteria 676
1157 Ga0587109_187893 3300059624 Bacteria 532
1158 Ga0587069_076152 3300059642 Bacteria 646
1159 Ga0587079_134789 3300059647 Unclassified 624
1160 Ga0587060_028550 3300060243 Bacteria 560
1161 Ga0587071_195422 3300060344 Bacteria 527
1162 Ga0587111_0000976 3300060346 Bacteria 3170
1163 Ga0587111_0003253 3300060346 Bacteria 2287
1164 Ga0466962_0718605 3300061719 Bacteria 513
1165 Ga0530510_0002199 3300061734 Bacteria 13378

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_102097484 Ga0070698_1020974841 65
2 3300006173 Ga0070716_100000875 Ga0070716_1000008752 65
3 3300006846 Ga0075430_100168381 Ga0075430_1001683813 65
4 3300006914 Ga0075436_100013593 Ga0075436_1000135934 65
5 3300007788 Ga0099795_10011184 Ga0099795_100111842 65
6 3300025939 Ga0207665_10000111 Ga0207665_1000011145 65
7 3300031665 Ga0316575_10411201 Ga0316575_104112011 65
8 3300032133 Ga0316583_10029718 Ga0316583_100297182 65
9 3300035398 Ga0316574_0186022 Ga0316574_0186022_680_877 65
10 3300035398 Ga0316574_0748797 Ga0316574_0748797_226_423 65
11 3300041404 Ga0439436_0258594 Ga0439436_0258594_39_236 65
12 3300041999 Ga0439433_0038011 Ga0439433_0038011_700_897 65
13 3300042007 Ga0439449_0002082 Ga0439449_0002082_2432_2629 65
14 3300050514 nmdc:mga08x19_296333_c1 nmdc:mga08x19_296333_c1_488_691 65
15 3300000546 LJNas_1001918 LJNas_10019182 66
16 3300001904 JGI24736J21556_1028039 JGI24736J21556_10280391 66
17 3300001904 JGI24736J21556_1030037 JGI24736J21556_10300372 66
18 3300001990 JGI24737J22298_10123494 JGI24737J22298_101234942 66
19 3300001991 JGI24743J22301_10114563 JGI24743J22301_101145632 66
20 3300003316 rootH1_10182383 rootH1_101823832 66
21 3300004799 Ga0058863_10059691 Ga0058863_100596911 66
22 3300004799 Ga0058863_11915408 Ga0058863_119154082 66
23 3300004800 Ga0058861_11849805 Ga0058861_118498051 66
24 3300004803 Ga0058862_12494603 Ga0058862_124946031 66
25 3300004803 Ga0058862_12588482 Ga0058862_125884821 66
26 3300004803 Ga0058862_12631438 Ga0058862_126314381 66
27 3300004803 Ga0058862_12765549 Ga0058862_127655491 66
28 3300005293 Ga0065715_10398165 Ga0065715_103981652 66
29 3300005327 Ga0070658_10044029 Ga0070658_100440292 66
30 3300005327 Ga0070658_10055014 Ga0070658_100550144 66
31 3300005327 Ga0070658_10105049 Ga0070658_101050492 66
32 3300005327 Ga0070658_10155085 Ga0070658_101550852 66
33 3300005327 Ga0070658_10301321 Ga0070658_103013212 66
34 3300005327 Ga0070658_10411026 Ga0070658_104110262 66
35 3300005327 Ga0070658_10425153 Ga0070658_104251531 66
36 3300005327 Ga0070658_10493093 Ga0070658_104930933 66
37 3300005327 Ga0070658_11613765 Ga0070658_116137651 66
38 3300005329 Ga0070683_100013117 Ga0070683_1000131173 66
39 3300005329 Ga0070683_100025211 Ga0070683_1000252118 66
40 3300005329 Ga0070683_100042533 Ga0070683_1000425334 66
41 3300005329 Ga0070683_100082059 Ga0070683_1000820591 66
42 3300005329 Ga0070683_100320501 Ga0070683_1003205012 66
43 3300005329 Ga0070683_100392808 Ga0070683_1003928082 66
44 3300005329 Ga0070683_100484857 Ga0070683_1004848573 66
45 3300005329 Ga0070683_100849323 Ga0070683_1008493232 66
46 3300005329 Ga0070683_100970720 Ga0070683_1009707201 66
47 3300005330 Ga0070690_100386959 Ga0070690_1003869591 66
48 3300005330 Ga0070690_100881689 Ga0070690_1008816892 66
49 3300005330 Ga0070690_101050582 Ga0070690_1010505821 66
50 3300005331 Ga0070670_100000999 Ga0070670_10000099912 66
51 3300005331 Ga0070670_100004289 Ga0070670_10000428913 66
52 3300005331 Ga0070670_100012911 Ga0070670_10001291111 66
53 3300005331 Ga0070670_100828756 Ga0070670_1008287562 66
54 3300005334 Ga0068869_100001465 Ga0068869_1000014653 66
55 3300005334 Ga0068869_100165197 Ga0068869_1001651972 66
56 3300005334 Ga0068869_100347333 Ga0068869_1003473332 66
57 3300005335 Ga0070666_10066988 Ga0070666_100669884 66
58 3300005335 Ga0070666_10177794 Ga0070666_101777942 66
59 3300005335 Ga0070666_10409718 Ga0070666_104097182 66
60 3300005335 Ga0070666_11020929 Ga0070666_110209291 66
61 3300005336 Ga0070680_100119720 Ga0070680_1001197203 66
62 3300005336 Ga0070680_100218497 Ga0070680_1002184972 66
63 3300005336 Ga0070680_100314598 Ga0070680_1003145982 66
64 3300005336 Ga0070680_101816758 Ga0070680_1018167581 66
65 3300005337 Ga0070682_100316528 Ga0070682_1003165282 66
66 3300005337 Ga0070682_100464059 Ga0070682_1004640592 66
67 3300005337 Ga0070682_100596215 Ga0070682_1005962151 66
68 3300005337 Ga0070682_100634750 Ga0070682_1006347502 66
69 3300005337 Ga0070682_100735844 Ga0070682_1007358441 66
70 3300005337 Ga0070682_100959092 Ga0070682_1009590922 66
71 3300005337 Ga0070682_101319662 Ga0070682_1013196621 66
72 3300005338 Ga0068868_100000062 Ga0068868_10000006213 66
73 3300005339 Ga0070660_100075054 Ga0070660_1000750543 66
74 3300005339 Ga0070660_100390394 Ga0070660_1003903942 66
75 3300005339 Ga0070660_100756699 Ga0070660_1007566992 66
76 3300005340 Ga0070689_100027354 Ga0070689_1000273544 66
77 3300005340 Ga0070689_101627254 Ga0070689_1016272541 66
78 3300005341 Ga0070691_10007394 Ga0070691_100073945 66
79 3300005341 Ga0070691_10063321 Ga0070691_100633213 66
80 3300005341 Ga0070691_10850961 Ga0070691_108509611 66
81 3300005344 Ga0070661_100006060 Ga0070661_1000060604 66
82 3300005344 Ga0070661_100036188 Ga0070661_1000361883 66
83 3300005344 Ga0070661_100036965 Ga0070661_1000369655 66
84 3300005344 Ga0070661_100050157 Ga0070661_1000501571 66
85 3300005344 Ga0070661_100115431 Ga0070661_1001154312 66
86 3300005344 Ga0070661_100179525 Ga0070661_1001795252 66
87 3300005344 Ga0070661_101221537 Ga0070661_1012215372 66
88 3300005344 Ga0070661_101827045 Ga0070661_1018270451 66
89 3300005345 Ga0070692_10027487 Ga0070692_100274873 66
90 3300005353 Ga0070669_100019209 Ga0070669_1000192097 66
91 3300005354 Ga0070675_100036857 Ga0070675_1000368575 66
92 3300005355 Ga0070671_100000449 Ga0070671_10000044920 66
93 3300005355 Ga0070671_100048626 Ga0070671_1000486264 66
94 3300005355 Ga0070671_100169593 Ga0070671_1001695932 66
95 3300005355 Ga0070671_100257519 Ga0070671_1002575193 66
96 3300005355 Ga0070671_100357250 Ga0070671_1003572501 66
97 3300005355 Ga0070671_100695442 Ga0070671_1006954421 66
98 3300005364 Ga0070673_100021983 Ga0070673_1000219836 66
99 3300005366 Ga0070659_100281318 Ga0070659_1002813181 66
100 3300005366 Ga0070659_100455997 Ga0070659_1004559972 66
101 3300005366 Ga0070659_101271239 Ga0070659_1012712391 66
102 3300005367 Ga0070667_100006315 Ga0070667_1000063155 66
103 3300005367 Ga0070667_100139922 Ga0070667_1001399224 66
104 3300005367 Ga0070667_100821901 Ga0070667_1008219011 66
105 3300005406 Ga0070703_10040722 Ga0070703_100407222 66
106 3300005434 Ga0070709_10395937 Ga0070709_103959371 66
107 3300005434 Ga0070709_11128736 Ga0070709_111287362 66
108 3300005435 Ga0070714_100026455 Ga0070714_1000264556 66
109 3300005435 Ga0070714_100209394 Ga0070714_1002093942 66
110 3300005435 Ga0070714_100556983 Ga0070714_1005569831 66
111 3300005435 Ga0070714_101064370 Ga0070714_1010643702 66
112 3300005435 Ga0070714_101144156 Ga0070714_1011441562 66
113 3300005435 Ga0070714_101447180 Ga0070714_1014471801 66
114 3300005436 Ga0070713_100085009 Ga0070713_1000850092 66
115 3300005436 Ga0070713_101109221 Ga0070713_1011092212 66
116 3300005436 Ga0070713_102204929 Ga0070713_1022049292 66
117 3300005436 Ga0070713_102330911 Ga0070713_1023309111 66
118 3300005437 Ga0070710_10425345 Ga0070710_104253452 66
119 3300005438 Ga0070701_10015752 Ga0070701_100157522 66
120 3300005439 Ga0070711_100848227 Ga0070711_1008482272 66
121 3300005439 Ga0070711_100933639 Ga0070711_1009336391 66
122 3300005440 Ga0070705_100052117 Ga0070705_1000521172 66
123 3300005440 Ga0070705_101061623 Ga0070705_1010616231 66
124 3300005444 Ga0070694_100014714 Ga0070694_1000147147 66
125 3300005444 Ga0070694_100552417 Ga0070694_1005524172 66
126 3300005445 Ga0070708_100011482 Ga0070708_1000114823 66
127 3300005445 Ga0070708_100011755 Ga0070708_1000117557 66
128 3300005445 Ga0070708_100033260 Ga0070708_1000332609 66
129 3300005445 Ga0070708_100760801 Ga0070708_1007608011 66
130 3300005455 Ga0070663_100088079 Ga0070663_1000880793 66
131 3300005455 Ga0070663_100523255 Ga0070663_1005232551 66
132 3300005455 Ga0070663_100934844 Ga0070663_1009348441 66
133 3300005456 Ga0070678_100913243 Ga0070678_1009132432 66
134 3300005457 Ga0070662_100197816 Ga0070662_1001978161 66
135 3300005457 Ga0070662_100745735 Ga0070662_1007457351 66
136 3300005457 Ga0070662_101958812 Ga0070662_1019588121 66
137 3300005458 Ga0070681_10014239 Ga0070681_100142396 66
138 3300005458 Ga0070681_10046523 Ga0070681_100465232 66
139 3300005458 Ga0070681_10073325 Ga0070681_100733253 66
140 3300005458 Ga0070681_10129550 Ga0070681_101295502 66
141 3300005458 Ga0070681_10536303 Ga0070681_105363032 66
142 3300005458 Ga0070681_10862802 Ga0070681_108628021 66
143 3300005458 Ga0070681_10899288 Ga0070681_108992881 66
144 3300005459 Ga0068867_100066516 Ga0068867_1000665163 66
145 3300005466 Ga0070685_10039896 Ga0070685_100398966 66
146 3300005466 Ga0070685_10231651 Ga0070685_102316512 66
147 3300005467 Ga0070706_100014654 Ga0070706_10001465410 66
148 3300005467 Ga0070706_100014654 Ga0070706_10001465411 66
149 3300005467 Ga0070706_100020973 Ga0070706_1000209732 66
150 3300005467 Ga0070706_100885358 Ga0070706_1008853582 66
151 3300005468 Ga0070707_100064848 Ga0070707_1000648483 66
152 3300005468 Ga0070707_100089460 Ga0070707_1000894604 66
153 3300005468 Ga0070707_100161513 Ga0070707_1001615132 66
154 3300005468 Ga0070707_100161513 Ga0070707_1001615133 66
155 3300005468 Ga0070707_100467975 Ga0070707_1004679753 66
156 3300005468 Ga0070707_100958018 Ga0070707_1009580183 66
157 3300005468 Ga0070707_101321863 Ga0070707_1013218631 66
158 3300005471 Ga0070698_100002346 Ga0070698_10000234623 66
159 3300005471 Ga0070698_100272359 Ga0070698_1002723591 66
160 3300005471 Ga0070698_100272359 Ga0070698_1002723592 66
161 3300005471 Ga0070698_100290461 Ga0070698_1002904613 66
162 3300005518 Ga0070699_100005399 Ga0070699_1000053992 66
163 3300005518 Ga0070699_100055223 Ga0070699_1000552232 66
164 3300005518 Ga0070699_100113371 Ga0070699_1001133714 66
165 3300005518 Ga0070699_100400632 Ga0070699_1004006323 66
166 3300005518 Ga0070699_101159816 Ga0070699_1011598162 66
167 3300005530 Ga0070679_100016264 Ga0070679_1000162648 66
168 3300005530 Ga0070679_100268992 Ga0070679_1002689921 66
169 3300005530 Ga0070679_100290012 Ga0070679_1002900123 66
170 3300005530 Ga0070679_102155034 Ga0070679_1021550341 66
171 3300005535 Ga0070684_100002801 Ga0070684_10000280110 66
172 3300005535 Ga0070684_100023567 Ga0070684_1000235677 66
173 3300005535 Ga0070684_100028010 Ga0070684_1000280105 66
174 3300005535 Ga0070684_100032735 Ga0070684_1000327352 66
175 3300005535 Ga0070684_100057304 Ga0070684_1000573042 66
176 3300005535 Ga0070684_100063659 Ga0070684_1000636594 66
177 3300005535 Ga0070684_100150795 Ga0070684_1001507954 66
178 3300005535 Ga0070684_100367432 Ga0070684_1003674322 66
179 3300005535 Ga0070684_101189661 Ga0070684_1011896611 66
180 3300005536 Ga0070697_100012687 Ga0070697_1000126875 66
181 3300005536 Ga0070697_100021509 Ga0070697_1000215093 66
182 3300005536 Ga0070697_100023655 Ga0070697_1000236556 66
183 3300005536 Ga0070697_100231193 Ga0070697_1002311932 66
184 3300005536 Ga0070697_100461554 Ga0070697_1004615543 66
185 3300005536 Ga0070697_101787216 Ga0070697_1017872161 66
186 3300005539 Ga0068853_100000080 Ga0068853_10000008040 66
187 3300005539 Ga0068853_100024183 Ga0068853_1000241834 66
188 3300005539 Ga0068853_100070812 Ga0068853_1000708122 66
189 3300005539 Ga0068853_100087352 Ga0068853_1000873524 66
190 3300005539 Ga0068853_100253471 Ga0068853_1002534712 66
191 3300005539 Ga0068853_101237029 Ga0068853_1012370291 66
192 3300005539 Ga0068853_101699466 Ga0068853_1016994661 66
193 3300005539 Ga0068853_101936006 Ga0068853_1019360061 66
194 3300005543 Ga0070672_100024224 Ga0070672_1000242246 66
195 3300005543 Ga0070672_100627845 Ga0070672_1006278452 66
196 3300005543 Ga0070672_100678709 Ga0070672_1006787092 66
197 3300005544 Ga0070686_101250524 Ga0070686_1012505241 66
198 3300005544 Ga0070686_101460735 Ga0070686_1014607353 66
199 3300005545 Ga0070695_100007587 Ga0070695_1000075875 66
200 3300005545 Ga0070695_100223253 Ga0070695_1002232531 66
201 3300005546 Ga0070696_100076522 Ga0070696_1000765223 66
202 3300005546 Ga0070696_100090784 Ga0070696_1000907843 66
203 3300005546 Ga0070696_100277990 Ga0070696_1002779901 66
204 3300005546 Ga0070696_100354728 Ga0070696_1003547282 66
205 3300005546 Ga0070696_101249051 Ga0070696_1012490511 66
206 3300005547 Ga0070693_100337701 Ga0070693_1003377012 66
207 3300005547 Ga0070693_100454649 Ga0070693_1004546491 66
208 3300005547 Ga0070693_100847890 Ga0070693_1008478901 66
209 3300005547 Ga0070693_100973592 Ga0070693_1009735922 66
210 3300005548 Ga0070665_100321539 Ga0070665_1003215393 66
211 3300005548 Ga0070665_100339679 Ga0070665_1003396792 66
212 3300005548 Ga0070665_100473829 Ga0070665_1004738292 66
213 3300005548 Ga0070665_100917769 Ga0070665_1009177691 66
214 3300005549 Ga0070704_100128158 Ga0070704_1001281581 66
215 3300005549 Ga0070704_100187330 Ga0070704_1001873301 66
216 3300005549 Ga0070704_100344476 Ga0070704_1003444761 66
217 3300005563 Ga0068855_100001109 Ga0068855_10000110910 66
218 3300005563 Ga0068855_100003174 Ga0068855_1000031742 66
219 3300005563 Ga0068855_100041627 Ga0068855_1000416276 66
220 3300005563 Ga0068855_100102955 Ga0068855_1001029552 66
221 3300005563 Ga0068855_100103010 Ga0068855_1001030103 66
222 3300005563 Ga0068855_100120956 Ga0068855_1001209562 66
223 3300005563 Ga0068855_100137239 Ga0068855_1001372394 66
224 3300005563 Ga0068855_100179892 Ga0068855_1001798921 66
225 3300005563 Ga0068855_100447526 Ga0068855_1004475263 66
226 3300005563 Ga0068855_101043463 Ga0068855_1010434631 66
227 3300005564 Ga0070664_100044728 Ga0070664_1000447282 66
228 3300005564 Ga0070664_100116334 Ga0070664_1001163342 66
229 3300005564 Ga0070664_100233379 Ga0070664_1002333793 66
230 3300005564 Ga0070664_100463432 Ga0070664_1004634322 66
231 3300005577 Ga0068857_100000969 Ga0068857_10000096915 66
232 3300005577 Ga0068857_100001491 Ga0068857_10000149111 66
233 3300005577 Ga0068857_100004470 Ga0068857_1000044709 66
234 3300005577 Ga0068857_100007098 Ga0068857_1000070985 66
235 3300005577 Ga0068857_100026640 Ga0068857_1000266402 66
236 3300005577 Ga0068857_100058309 Ga0068857_1000583092 66
237 3300005577 Ga0068857_100166944 Ga0068857_1001669441 66
238 3300005577 Ga0068857_100177536 Ga0068857_1001775362 66
239 3300005577 Ga0068857_100268748 Ga0068857_1002687482 66
240 3300005577 Ga0068857_101269541 Ga0068857_1012695411 66
241 3300005577 Ga0068857_102267715 Ga0068857_1022677151 66
242 3300005578 Ga0068854_100063256 Ga0068854_1000632564 66
243 3300005578 Ga0068854_100354129 Ga0068854_1003541292 66
244 3300005578 Ga0068854_100396266 Ga0068854_1003962662 66
245 3300005614 Ga0068856_100001717 Ga0068856_10000171721 66
246 3300005614 Ga0068856_100022866 Ga0068856_1000228664 66
247 3300005614 Ga0068856_100042723 Ga0068856_1000427234 66
248 3300005614 Ga0068856_100061299 Ga0068856_1000612993 66
249 3300005614 Ga0068856_100086253 Ga0068856_1000862534 66
250 3300005614 Ga0068856_100206324 Ga0068856_1002063243 66
251 3300005614 Ga0068856_100239317 Ga0068856_1002393172 66
252 3300005614 Ga0068856_100383861 Ga0068856_1003838611 66
253 3300005614 Ga0068856_100396687 Ga0068856_1003966872 66
254 3300005614 Ga0068856_100429245 Ga0068856_1004292452 66
255 3300005614 Ga0068856_100816416 Ga0068856_1008164163 66
256 3300005616 Ga0068852_100000048 Ga0068852_10000004848 66
257 3300005616 Ga0068852_100000287 Ga0068852_10000028722 66
258 3300005616 Ga0068852_100000434 Ga0068852_10000043420 66
259 3300005616 Ga0068852_100049816 Ga0068852_1000498165 66
260 3300005616 Ga0068852_100194115 Ga0068852_1001941153 66
261 3300005616 Ga0068852_100256402 Ga0068852_1002564022 66
262 3300005616 Ga0068852_100324734 Ga0068852_1003247342 66
263 3300005616 Ga0068852_100464739 Ga0068852_1004647392 66
264 3300005616 Ga0068852_101462340 Ga0068852_1014623401 66
265 3300005616 Ga0068852_102088059 Ga0068852_1020880591 66
266 3300005617 Ga0068859_100010672 Ga0068859_1000106722 66
267 3300005617 Ga0068859_100012505 Ga0068859_1000125054 66
268 3300005617 Ga0068859_100024126 Ga0068859_1000241265 66
269 3300005618 Ga0068864_100001146 Ga0068864_1000011468 66
270 3300005618 Ga0068864_100001263 Ga0068864_1000012634 66
271 3300005618 Ga0068864_100013753 Ga0068864_1000137537 66
272 3300005618 Ga0068864_100020410 Ga0068864_1000204104 66
273 3300005718 Ga0068866_10150540 Ga0068866_101505401 66
274 3300005834 Ga0068851_10006350 Ga0068851_100063504 66
275 3300005834 Ga0068851_10006516 Ga0068851_100065164 66
276 3300005834 Ga0068851_10029976 Ga0068851_100299761 66
277 3300005834 Ga0068851_10084594 Ga0068851_100845942 66
278 3300005834 Ga0068851_10106033 Ga0068851_101060333 66
279 3300005834 Ga0068851_10110529 Ga0068851_101105293 66
280 3300005834 Ga0068851_10253879 Ga0068851_102538791 66
281 3300005834 Ga0068851_10325847 Ga0068851_103258472 66
282 3300005834 Ga0068851_10709755 Ga0068851_107097552 66
283 3300005840 Ga0068870_10232748 Ga0068870_102327481 66
284 3300005841 Ga0068863_100000893 Ga0068863_1000008934 66
285 3300005841 Ga0068863_100017111 Ga0068863_1000171115 66
286 3300005841 Ga0068863_101403674 Ga0068863_1014036741 66
287 3300005841 Ga0068863_102228643 Ga0068863_1022286431 66
288 3300005842 Ga0068858_100003222 Ga0068858_10000322215 66
289 3300005842 Ga0068858_100015396 Ga0068858_1000153964 66
290 3300005842 Ga0068858_100211044 Ga0068858_1002110443 66
291 3300005842 Ga0068858_100491666 Ga0068858_1004916662 66
292 3300005842 Ga0068858_100529515 Ga0068858_1005295152 66
293 3300005843 Ga0068860_100003815 Ga0068860_1000038154 66
294 3300005843 Ga0068860_100063187 Ga0068860_1000631876 66
295 3300005843 Ga0068860_100119698 Ga0068860_1001196982 66
296 3300005843 Ga0068860_101007921 Ga0068860_1010079211 66
297 3300005844 Ga0068862_100022830 Ga0068862_1000228304 66
298 3300005844 Ga0068862_100089631 Ga0068862_1000896314 66
299 3300005844 Ga0068862_100168715 Ga0068862_1001687152 66
300 3300005844 Ga0068862_100231958 Ga0068862_1002319582 66
301 3300006028 Ga0070717_10405279 Ga0070717_104052792 66
302 3300006028 Ga0070717_10674252 Ga0070717_106742522 66
303 3300006028 Ga0070717_10819360 Ga0070717_108193603 66
304 3300006028 Ga0070717_11508234 Ga0070717_115082342 66
305 3300006028 Ga0070717_11633752 Ga0070717_116337521 66
306 3300006038 Ga0075365_10672442 Ga0075365_106724422 66
307 3300006042 Ga0075368_10467820 Ga0075368_104678202 66
308 3300006048 Ga0075363_100507455 Ga0075363_1005074551 66
309 3300006051 Ga0075364_10396621 Ga0075364_103966211 66
310 3300006173 Ga0070716_100290052 Ga0070716_1002900523 66
311 3300006173 Ga0070716_100440613 Ga0070716_1004406133 66
312 3300006173 Ga0070716_100939741 Ga0070716_1009397411 66
313 3300006175 Ga0070712_100108054 Ga0070712_1001080542 66
314 3300006175 Ga0070712_100528365 Ga0070712_1005283652 66
315 3300006175 Ga0070712_101710314 Ga0070712_1017103141 66
316 3300006237 Ga0097621_100006064 Ga0097621_1000060646 66
317 3300006237 Ga0097621_100007372 Ga0097621_1000073724 66
318 3300006237 Ga0097621_100065574 Ga0097621_1000655741 66
319 3300006237 Ga0097621_100317034 Ga0097621_1003170341 66
320 3300006237 Ga0097621_101899439 Ga0097621_1018994391 66
321 3300006353 Ga0075370_10317233 Ga0075370_103172331 66
322 3300006358 Ga0068871_100033758 Ga0068871_1000337583 66
323 3300006358 Ga0068871_100076129 Ga0068871_1000761293 66
324 3300006844 Ga0075428_100509649 Ga0075428_1005096492 66
325 3300006846 Ga0075430_100153947 Ga0075430_1001539472 66
326 3300006846 Ga0075430_100327107 Ga0075430_1003271072 66
327 3300006847 Ga0075431_100100232 Ga0075431_1001002321 66
328 3300006847 Ga0075431_100477994 Ga0075431_1004779942 66
329 3300006847 Ga0075431_101650226 Ga0075431_1016502261 66
330 3300006847 Ga0075431_101852621 Ga0075431_1018526211 66
331 3300006852 Ga0075433_10045207 Ga0075433_100452076 66
332 3300006871 Ga0075434_100014420 Ga0075434_10001442011 66
333 3300006871 Ga0075434_100600567 Ga0075434_1006005672 66
334 3300006880 Ga0075429_100003644 Ga0075429_1000036442 66
335 3300006880 Ga0075429_100144107 Ga0075429_1001441072 66
336 3300006880 Ga0075429_100249301 Ga0075429_1002493014 66
337 3300006880 Ga0075429_101842251 Ga0075429_1018422512 66
338 3300006914 Ga0075436_100006247 Ga0075436_1000062472 66
339 3300006914 Ga0075436_100078134 Ga0075436_1000781342 66
340 3300006914 Ga0075436_100843507 Ga0075436_1008435071 66
341 3300006914 Ga0075436_100848689 Ga0075436_1008486892 66
342 3300006931 Ga0097620_100010672 Ga0097620_1000106722 66
343 3300006931 Ga0097620_100012505 Ga0097620_1000125054 66
344 3300006931 Ga0097620_100024125 Ga0097620_1000241255 66
345 3300007265 Ga0099794_10081387 Ga0099794_100813871 66
346 3300007265 Ga0099794_10120220 Ga0099794_101202202 66
347 3300007265 Ga0099794_10263097 Ga0099794_102630972 66
348 3300007265 Ga0099794_10275978 Ga0099794_102759782 66
349 3300007265 Ga0099794_10564609 Ga0099794_105646091 66
350 3300007788 Ga0099795_10132769 Ga0099795_101327691 66
351 3300009011 Ga0105251_10254232 Ga0105251_102542321 66
352 3300009093 Ga0105240_10000171 Ga0105240_1000017120 66
353 3300009093 Ga0105240_10001982 Ga0105240_1000198210 66
354 3300009093 Ga0105240_10002781 Ga0105240_100027819 66
355 3300009093 Ga0105240_10007773 Ga0105240_100077733 66
356 3300009093 Ga0105240_10015305 Ga0105240_100153055 66
357 3300009093 Ga0105240_10016664 Ga0105240_1001666411 66
358 3300009093 Ga0105240_10025954 Ga0105240_100259548 66
359 3300009093 Ga0105240_10043806 Ga0105240_100438062 66
360 3300009093 Ga0105240_10063462 Ga0105240_100634623 66
361 3300009093 Ga0105240_10190101 Ga0105240_101901014 66
362 3300009093 Ga0105240_10431344 Ga0105240_104313443 66
363 3300009093 Ga0105240_10571313 Ga0105240_105713132 66
364 3300009093 Ga0105240_11118129 Ga0105240_111181291 66
365 3300009093 Ga0105240_12794713 Ga0105240_127947131 66
366 3300009094 Ga0111539_10004706 Ga0111539_1000470615 66
367 3300009094 Ga0111539_10376644 Ga0111539_103766443 66
368 3300009098 Ga0105245_10002006 Ga0105245_100020064 66
369 3300009101 Ga0105247_10003806 Ga0105247_100038065 66
370 3300009101 Ga0105247_10298439 Ga0105247_102984391 66
371 3300009101 Ga0105247_11312183 Ga0105247_113121831 66
372 3300009147 Ga0114129_10011134 Ga0114129_100111346 66
373 3300009147 Ga0114129_10036930 Ga0114129_100369306 66
374 3300009147 Ga0114129_10344476 Ga0114129_103444762 66
375 3300009147 Ga0114129_11160409 Ga0114129_111604092 66
376 3300009148 Ga0105243_10188046 Ga0105243_101880462 66
377 3300009148 Ga0105243_11009074 Ga0105243_110090742 66
378 3300009148 Ga0105243_11531972 Ga0105243_115319721 66
379 3300009174 Ga0105241_10000839 Ga0105241_1000083914 66
380 3300009174 Ga0105241_10012928 Ga0105241_100129285 66
381 3300009174 Ga0105241_10019234 Ga0105241_100192346 66
382 3300009174 Ga0105241_10035824 Ga0105241_100358244 66
383 3300009174 Ga0105241_10037495 Ga0105241_100374953 66
384 3300009174 Ga0105241_10042761 Ga0105241_100427617 66
385 3300009174 Ga0105241_10099036 Ga0105241_100990362 66
386 3300009174 Ga0105241_10159953 Ga0105241_101599531 66
387 3300009174 Ga0105241_10756905 Ga0105241_107569052 66
388 3300009174 Ga0105241_11419579 Ga0105241_114195791 66
389 3300009176 Ga0105242_10083613 Ga0105242_100836133 66
390 3300009176 Ga0105242_10725101 Ga0105242_107251011 66
391 3300009176 Ga0105242_11158959 Ga0105242_111589592 66
392 3300009176 Ga0105242_12214656 Ga0105242_122146562 66
393 3300009176 Ga0105242_12504390 Ga0105242_125043902 66
394 3300009177 Ga0105248_10000596 Ga0105248_1000059619 66
395 3300009177 Ga0105248_10003599 Ga0105248_1000359912 66
396 3300009177 Ga0105248_10015061 Ga0105248_100150614 66
397 3300009177 Ga0105248_10068520 Ga0105248_100685204 66
398 3300009177 Ga0105248_10343810 Ga0105248_103438102 66
399 3300009177 Ga0105248_10664090 Ga0105248_106640902 66
400 3300009177 Ga0105248_12006431 Ga0105248_120064311 66
401 3300009545 Ga0105237_10055963 Ga0105237_100559637 66
402 3300009545 Ga0105237_10150740 Ga0105237_101507403 66
403 3300009545 Ga0105237_10252318 Ga0105237_102523183 66
404 3300009545 Ga0105237_10573027 Ga0105237_105730272 66
405 3300009545 Ga0105237_11260058 Ga0105237_112600581 66
406 3300009545 Ga0105237_11283793 Ga0105237_112837932 66
407 3300009545 Ga0105237_11353702 Ga0105237_113537022 66
408 3300009545 Ga0105237_11473978 Ga0105237_114739781 66
409 3300009545 Ga0105237_11585965 Ga0105237_115859652 66
410 3300009545 Ga0105237_12093664 Ga0105237_120936641 66
411 3300009545 Ga0105237_12176952 Ga0105237_121769522 66
412 3300009551 Ga0105238_10000307 Ga0105238_1000030727 66
413 3300009551 Ga0105238_10027293 Ga0105238_100272933 66
414 3300009551 Ga0105238_10028178 Ga0105238_100281785 66
415 3300009551 Ga0105238_10041389 Ga0105238_100413894 66
416 3300009551 Ga0105238_10132405 Ga0105238_101324052 66
417 3300009551 Ga0105238_10290797 Ga0105238_102907972 66
418 3300009551 Ga0105238_10361141 Ga0105238_103611412 66
419 3300009551 Ga0105238_10620429 Ga0105238_106204292 66
420 3300009551 Ga0105238_10658902 Ga0105238_106589022 66
421 3300009551 Ga0105238_10734731 Ga0105238_107347312 66
422 3300009551 Ga0105238_10843112 Ga0105238_108431122 66
423 3300009551 Ga0105238_11952241 Ga0105238_119522412 66
424 3300009553 Ga0105249_10140115 Ga0105249_101401153 66
425 3300009553 Ga0105249_10177926 Ga0105249_101779263 66
426 3300009553 Ga0105249_10862565 Ga0105249_108625652 66
427 3300009553 Ga0105249_12359046 Ga0105249_123590462 66
428 3300010375 Ga0105239_10031350 Ga0105239_100313506 66
429 3300010375 Ga0105239_10181295 Ga0105239_101812951 66
430 3300010375 Ga0105239_10228383 Ga0105239_102283833 66
431 3300010375 Ga0105239_10365880 Ga0105239_103658802 66
432 3300010375 Ga0105239_10494873 Ga0105239_104948732 66
433 3300010375 Ga0105239_10551755 Ga0105239_105517552 66
434 3300010375 Ga0105239_10590261 Ga0105239_105902612 66
435 3300010375 Ga0105239_10796409 Ga0105239_107964092 66
436 3300010375 Ga0105239_10844089 Ga0105239_108440892 66
437 3300010375 Ga0105239_10964983 Ga0105239_109649831 66
438 3300010375 Ga0105239_11328225 Ga0105239_113282252 66
439 3300010375 Ga0105239_11447103 Ga0105239_114471032 66
440 3300010375 Ga0105239_12275253 Ga0105239_122752532 66
441 3300010375 Ga0105239_12457728 Ga0105239_124577281 66
442 3300010375 Ga0105239_12599383 Ga0105239_125993831 66
443 3300010375 Ga0105239_13048090 Ga0105239_130480902 66
444 3300011119 Ga0105246_10003700 Ga0105246_100037004 66
445 3300011119 Ga0105246_10714489 Ga0105246_107144892 66
446 3300012495 Ga0157323_1032888 Ga0157323_10328882 66
447 3300013100 Ga0157373_10058108 Ga0157373_100581084 66
448 3300013100 Ga0157373_10165335 Ga0157373_101653352 66
449 3300013100 Ga0157373_10214554 Ga0157373_102145542 66
450 3300013100 Ga0157373_10223553 Ga0157373_102235532 66
451 3300013100 Ga0157373_10386811 Ga0157373_103868112 66
452 3300013102 Ga0157371_10123746 Ga0157371_101237462 66
453 3300013102 Ga0157371_10246886 Ga0157371_102468862 66
454 3300013102 Ga0157371_10863345 Ga0157371_108633452 66
455 3300013102 Ga0157371_11183759 Ga0157371_111837591 66
456 3300013102 Ga0157371_11432314 Ga0157371_114323141 66
457 3300013104 Ga0157370_10000019 Ga0157370_10000019125 66
458 3300013104 Ga0157370_10001105 Ga0157370_1000110510 66
459 3300013104 Ga0157370_10068416 Ga0157370_100684164 66
460 3300013104 Ga0157370_10229185 Ga0157370_102291851 66
461 3300013104 Ga0157370_10922186 Ga0157370_109221861 66
462 3300013104 Ga0157370_11475863 Ga0157370_114758631 66
463 3300013105 Ga0157369_10000081 Ga0157369_1000008194 66
464 3300013105 Ga0157369_10000707 Ga0157369_1000070739 66
465 3300013105 Ga0157369_10001102 Ga0157369_1000110210 66
466 3300013105 Ga0157369_10001710 Ga0157369_100017103 66
467 3300013105 Ga0157369_10005051 Ga0157369_1000505110 66
468 3300013105 Ga0157369_10015409 Ga0157369_100154093 66
469 3300013105 Ga0157369_10035363 Ga0157369_100353634 66
470 3300013105 Ga0157369_10109048 Ga0157369_101090483 66
471 3300013105 Ga0157369_10171732 Ga0157369_101717323 66
472 3300013105 Ga0157369_10200435 Ga0157369_102004351 66
473 3300013105 Ga0157369_10207146 Ga0157369_102071462 66
474 3300013105 Ga0157369_10235339 Ga0157369_102353391 66
475 3300013105 Ga0157369_10273410 Ga0157369_102734101 66
476 3300013105 Ga0157369_10308414 Ga0157369_103084143 66
477 3300013105 Ga0157369_10465537 Ga0157369_104655373 66
478 3300013105 Ga0157369_11108996 Ga0157369_111089962 66
479 3300013105 Ga0157369_11201877 Ga0157369_112018772 66
480 3300013105 Ga0157369_11718652 Ga0157369_117186522 66
481 3300013296 Ga0157374_10009794 Ga0157374_100097944 66
482 3300013296 Ga0157374_10015610 Ga0157374_100156103 66
483 3300013296 Ga0157374_10114790 Ga0157374_101147904 66
484 3300013296 Ga0157374_10171968 Ga0157374_101719683 66
485 3300013296 Ga0157374_10194520 Ga0157374_101945202 66
486 3300013296 Ga0157374_10288087 Ga0157374_102880872 66
487 3300013296 Ga0157374_10359394 Ga0157374_103593942 66
488 3300013296 Ga0157374_11192940 Ga0157374_111929401 66
489 3300013296 Ga0157374_11508860 Ga0157374_115088602 66
490 3300013296 Ga0157374_12251042 Ga0157374_122510421 66
491 3300013297 Ga0157378_10010577 Ga0157378_100105774 66
492 3300013297 Ga0157378_10041010 Ga0157378_100410104 66
493 3300013297 Ga0157378_10077857 Ga0157378_100778572 66
494 3300013297 Ga0157378_10269610 Ga0157378_102696103 66
495 3300013297 Ga0157378_10534356 Ga0157378_105343562 66
496 3300013297 Ga0157378_10939253 Ga0157378_109392531 66
497 3300013297 Ga0157378_11938301 Ga0157378_119383011 66
498 3300013306 Ga0163162_10053860 Ga0163162_100538604 66
499 3300013306 Ga0163162_10054763 Ga0163162_100547633 66
500 3300013306 Ga0163162_10067634 Ga0163162_100676342 66
501 3300013306 Ga0163162_10542947 Ga0163162_105429472 66
502 3300013306 Ga0163162_11150717 Ga0163162_111507171 66
503 3300013306 Ga0163162_11391106 Ga0163162_113911061 66
504 3300013306 Ga0163162_11394282 Ga0163162_113942822 66
505 3300013306 Ga0163162_11540746 Ga0163162_115407462 66
506 3300013307 Ga0157372_10000058 Ga0157372_1000005814 66
507 3300013307 Ga0157372_10000816 Ga0157372_1000081610 66
508 3300013307 Ga0157372_10005348 Ga0157372_100053484 66
509 3300013307 Ga0157372_10008671 Ga0157372_100086715 66
510 3300013307 Ga0157372_10011989 Ga0157372_100119896 66
511 3300013307 Ga0157372_10025712 Ga0157372_100257124 66
512 3300013307 Ga0157372_10028222 Ga0157372_100282223 66
513 3300013307 Ga0157372_10039761 Ga0157372_100397615 66
514 3300013307 Ga0157372_10115154 Ga0157372_101151545 66
515 3300013307 Ga0157372_10147772 Ga0157372_101477725 66
516 3300013307 Ga0157372_10176183 Ga0157372_101761831 66
517 3300013307 Ga0157372_10312382 Ga0157372_103123823 66
518 3300013307 Ga0157372_10360199 Ga0157372_103601992 66
519 3300013307 Ga0157372_10379563 Ga0157372_103795631 66
520 3300013307 Ga0157372_10672920 Ga0157372_106729202 66
521 3300013307 Ga0157372_10872702 Ga0157372_108727021 66
522 3300013307 Ga0157372_11310889 Ga0157372_113108892 66
523 3300013307 Ga0157372_11394162 Ga0157372_113941621 66
524 3300013307 Ga0157372_11605953 Ga0157372_116059531 66
525 3300013307 Ga0157372_12076720 Ga0157372_120767202 66
526 3300013307 Ga0157372_12486033 Ga0157372_124860332 66
527 3300013308 Ga0157375_10019000 Ga0157375_100190002 66
528 3300013308 Ga0157375_10550618 Ga0157375_105506181 66
529 3300013308 Ga0157375_10817513 Ga0157375_108175132 66
530 3300013308 Ga0157375_11828074 Ga0157375_118280741 66
531 3300014325 Ga0163163_10002835 Ga0163163_100028359 66
532 3300014325 Ga0163163_10007035 Ga0163163_100070354 66
533 3300014325 Ga0163163_10009352 Ga0163163_100093524 66
534 3300014325 Ga0163163_10018944 Ga0163163_100189444 66
535 3300014325 Ga0163163_10021461 Ga0163163_1002146110 66
536 3300014325 Ga0163163_10040007 Ga0163163_100400072 66
537 3300014325 Ga0163163_10114203 Ga0163163_101142035 66
538 3300014325 Ga0163163_11405551 Ga0163163_114055512 66
539 3300014745 Ga0157377_10148801 Ga0157377_101488012 66
540 3300014745 Ga0157377_10353471 Ga0157377_103534711 66
541 3300014968 Ga0157379_10016500 Ga0157379_100165008 66
542 3300014968 Ga0157379_10042808 Ga0157379_100428082 66
543 3300014968 Ga0157379_10207680 Ga0157379_102076805 66
544 3300014968 Ga0157379_11454251 Ga0157379_114542511 66
545 3300014969 Ga0157376_10004260 Ga0157376_100042607 66
546 3300014969 Ga0157376_10021757 Ga0157376_100217574 66
547 3300014969 Ga0157376_10060093 Ga0157376_100600932 66
548 3300014969 Ga0157376_10096545 Ga0157376_100965453 66
549 3300014969 Ga0157376_11031495 Ga0157376_110314951 66
550 3300015262 Ga0182007_10072624 Ga0182007_100726242 66
551 3300015262 Ga0182007_10079996 Ga0182007_100799962 66
552 3300019182 Ga0184598_103997 Ga0184598_1039972 66
553 3300019183 Ga0184601_144297 Ga0184601_1442972 66
554 3300019190 Ga0184600_105364 Ga0184600_1053642 66
555 3300020069 Ga0197907_10591539 Ga0197907_105915392 66
556 3300020069 Ga0197907_11373818 Ga0197907_113738182 66
557 3300020070 Ga0206356_11755342 Ga0206356_117553421 66
558 3300020075 Ga0206349_1982423 Ga0206349_19824231 66
559 3300020076 Ga0206355_1230271 Ga0206355_12302712 66
560 3300020076 Ga0206355_1445323 Ga0206355_14453232 66
561 3300020076 Ga0206355_1641554 Ga0206355_16415542 66
562 3300020077 Ga0206351_10682782 Ga0206351_106827821 66
563 3300020077 Ga0206351_10823189 Ga0206351_108231892 66
564 3300020078 Ga0206352_10040263 Ga0206352_100402632 66
565 3300020078 Ga0206352_10336565 Ga0206352_103365651 66
566 3300020078 Ga0206352_10462609 Ga0206352_104626092 66
567 3300020080 Ga0206350_11050674 Ga0206350_110506742 66
568 3300020080 Ga0206350_11481399 Ga0206350_114813992 66
569 3300020081 Ga0206354_11255018 Ga0206354_112550182 66
570 3300020082 Ga0206353_10188743 Ga0206353_101887431 66
571 3300020082 Ga0206353_10774232 Ga0206353_107742324 66
572 3300020082 Ga0206353_11141441 Ga0206353_111414411 66
573 3300020082 Ga0206353_11692888 Ga0206353_116928881 66
574 3300020610 Ga0154015_1084318 Ga0154015_10843183 66
575 3300020610 Ga0154015_1647532 Ga0154015_16475322 66
576 3300021361 Ga0213872_10007421 Ga0213872_100074218 66
577 3300021377 Ga0213874_10011550 Ga0213874_100115502 66
578 3300022467 Ga0224712_10242302 Ga0224712_102423021 66
579 3300022467 Ga0224712_10296094 Ga0224712_102960942 66
580 3300022732 Ga0224569_100005 Ga0224569_1000053 66
581 3300022734 Ga0224571_100019 Ga0224571_1000194 66
582 3300024225 Ga0224572_1002797 Ga0224572_10027973 66
583 3300024227 Ga0228598_1000158 Ga0228598_100015810 66
584 3300025261 Ga0209233_1076817 Ga0209233_10768171 66
585 3300025321 Ga0207656_10025114 Ga0207656_100251143 66
586 3300025321 Ga0207656_10037417 Ga0207656_100374172 66
587 3300025321 Ga0207656_10041702 Ga0207656_100417022 66
588 3300025321 Ga0207656_10053773 Ga0207656_100537733 66
589 3300025321 Ga0207656_10125465 Ga0207656_101254652 66
590 3300025321 Ga0207656_10152199 Ga0207656_101521991 66
591 3300025321 Ga0207656_10174028 Ga0207656_101740281 66
592 3300025885 Ga0207653_10025536 Ga0207653_100255362 66
593 3300025898 Ga0207692_10354659 Ga0207692_103546592 66
594 3300025899 Ga0207642_10611080 Ga0207642_106110802 66
595 3300025900 Ga0207710_10000588 Ga0207710_1000058815 66
596 3300025900 Ga0207710_10003146 Ga0207710_100031465 66
597 3300025903 Ga0207680_10117960 Ga0207680_101179603 66
598 3300025903 Ga0207680_10400440 Ga0207680_104004402 66
599 3300025903 Ga0207680_11160758 Ga0207680_111607581 66
600 3300025903 Ga0207680_11173883 Ga0207680_111738831 66
601 3300025904 Ga0207647_10002966 Ga0207647_1000296616 66
602 3300025904 Ga0207647_10004432 Ga0207647_100044325 66
603 3300025904 Ga0207647_10077713 Ga0207647_100777134 66
604 3300025904 Ga0207647_10200990 Ga0207647_102009901 66
605 3300025904 Ga0207647_10304595 Ga0207647_103045951 66
606 3300025905 Ga0207685_10410651 Ga0207685_104106511 66
607 3300025906 Ga0207699_10218508 Ga0207699_102185082 66
608 3300025908 Ga0207643_10108112 Ga0207643_101081124 66
609 3300025908 Ga0207643_10166603 Ga0207643_101666032 66
610 3300025909 Ga0207705_10038112 Ga0207705_100381123 66
611 3300025909 Ga0207705_10043220 Ga0207705_100432204 66
612 3300025909 Ga0207705_10067892 Ga0207705_100678924 66
613 3300025909 Ga0207705_10079141 Ga0207705_100791412 66
614 3300025909 Ga0207705_10091806 Ga0207705_100918062 66
615 3300025909 Ga0207705_10290082 Ga0207705_102900822 66
616 3300025910 Ga0207684_10002399 Ga0207684_100023996 66
617 3300025910 Ga0207684_10008061 Ga0207684_100080616 66
618 3300025910 Ga0207684_10008061 Ga0207684_100080617 66
619 3300025910 Ga0207684_10369518 Ga0207684_103695182 66
620 3300025911 Ga0207654_10000206 Ga0207654_1000020620 66
621 3300025911 Ga0207654_10000297 Ga0207654_100002977 66
622 3300025911 Ga0207654_10000359 Ga0207654_1000035921 66
623 3300025911 Ga0207654_10022335 Ga0207654_100223352 66
624 3300025911 Ga0207654_10025493 Ga0207654_100254932 66
625 3300025911 Ga0207654_10206174 Ga0207654_102061742 66
626 3300025911 Ga0207654_10816642 Ga0207654_108166422 66
627 3300025911 Ga0207654_11078515 Ga0207654_110785152 66
628 3300025912 Ga0207707_10022424 Ga0207707_100224245 66
629 3300025912 Ga0207707_10081738 Ga0207707_100817385 66
630 3300025912 Ga0207707_10718019 Ga0207707_107180192 66
631 3300025912 Ga0207707_10780112 Ga0207707_107801122 66
632 3300025912 Ga0207707_11128413 Ga0207707_111284132 66
633 3300025912 Ga0207707_11303555 Ga0207707_113035552 66
634 3300025913 Ga0207695_10000030 Ga0207695_10000030364 66
635 3300025913 Ga0207695_10000115 Ga0207695_1000011576 66
636 3300025913 Ga0207695_10000292 Ga0207695_100002926 66
637 3300025913 Ga0207695_10001293 Ga0207695_1000129321 66
638 3300025913 Ga0207695_10001801 Ga0207695_1000180121 66
639 3300025913 Ga0207695_10024299 Ga0207695_100242993 66
640 3300025913 Ga0207695_10039759 Ga0207695_100397594 66
641 3300025913 Ga0207695_10059231 Ga0207695_100592315 66
642 3300025913 Ga0207695_10080227 Ga0207695_100802274 66
643 3300025913 Ga0207695_10338825 Ga0207695_103388252 66
644 3300025913 Ga0207695_10731028 Ga0207695_107310281 66
645 3300025913 Ga0207695_10914230 Ga0207695_109142303 66
646 3300025913 Ga0207695_11213165 Ga0207695_112131651 66
647 3300025913 Ga0207695_11523391 Ga0207695_115233911 66
648 3300025914 Ga0207671_10000047 Ga0207671_1000004721 66
649 3300025914 Ga0207671_10000376 Ga0207671_1000037614 66
650 3300025914 Ga0207671_10000503 Ga0207671_100005035 66
651 3300025914 Ga0207671_10355186 Ga0207671_103551861 66
652 3300025914 Ga0207671_10578413 Ga0207671_105784132 66
653 3300025914 Ga0207671_10654782 Ga0207671_106547822 66
654 3300025914 Ga0207671_11078163 Ga0207671_110781631 66
655 3300025914 Ga0207671_11265664 Ga0207671_112656642 66
656 3300025914 Ga0207671_11529080 Ga0207671_115290801 66
657 3300025915 Ga0207693_10151955 Ga0207693_101519552 66
658 3300025916 Ga0207663_10371000 Ga0207663_103710001 66
659 3300025916 Ga0207663_11272941 Ga0207663_112729412 66
660 3300025917 Ga0207660_10036090 Ga0207660_100360902 66
661 3300025917 Ga0207660_10179686 Ga0207660_101796862 66
662 3300025917 Ga0207660_10359216 Ga0207660_103592163 66
663 3300025917 Ga0207660_10649458 Ga0207660_106494582 66
664 3300025917 Ga0207660_10799138 Ga0207660_107991382 66
665 3300025917 Ga0207660_11708150 Ga0207660_117081501 66
666 3300025917 Ga0207660_11735733 Ga0207660_117357332 66
667 3300025919 Ga0207657_10055732 Ga0207657_100557325 66
668 3300025919 Ga0207657_10454039 Ga0207657_104540392 66
669 3300025919 Ga0207657_10458444 Ga0207657_104584442 66
670 3300025920 Ga0207649_10003968 Ga0207649_100039683 66
671 3300025920 Ga0207649_10033554 Ga0207649_100335543 66
672 3300025920 Ga0207649_10039732 Ga0207649_100397323 66
673 3300025920 Ga0207649_10043161 Ga0207649_100431612 66
674 3300025920 Ga0207649_11278902 Ga0207649_112789022 66
675 3300025920 Ga0207649_11334758 Ga0207649_113347581 66
676 3300025921 Ga0207652_10027895 Ga0207652_100278952 66
677 3300025921 Ga0207652_10322810 Ga0207652_103228101 66
678 3300025921 Ga0207652_10481105 Ga0207652_104811051 66
679 3300025921 Ga0207652_11026017 Ga0207652_110260171 66
680 3300025921 Ga0207652_11041720 Ga0207652_110417201 66
681 3300025921 Ga0207652_11814326 Ga0207652_118143261 66
682 3300025922 Ga0207646_10021267 Ga0207646_100212677 66
683 3300025922 Ga0207646_10087235 Ga0207646_100872352 66
684 3300025922 Ga0207646_10087235 Ga0207646_100872353 66
685 3300025922 Ga0207646_10145937 Ga0207646_101459372 66
686 3300025922 Ga0207646_10812829 Ga0207646_108128292 66
687 3300025922 Ga0207646_10994821 Ga0207646_109948212 66
688 3300025923 Ga0207681_10023444 Ga0207681_100234443 66
689 3300025923 Ga0207681_10341882 Ga0207681_103418822 66
690 3300025924 Ga0207694_10000167 Ga0207694_1000016740 66
691 3300025924 Ga0207694_10000497 Ga0207694_1000049710 66
692 3300025924 Ga0207694_10000697 Ga0207694_1000069712 66
693 3300025924 Ga0207694_10172613 Ga0207694_101726133 66
694 3300025924 Ga0207694_10251409 Ga0207694_102514094 66
695 3300025924 Ga0207694_10272387 Ga0207694_102723871 66
696 3300025924 Ga0207694_10347444 Ga0207694_103474442 66
697 3300025924 Ga0207694_10416483 Ga0207694_104164832 66
698 3300025924 Ga0207694_10447894 Ga0207694_104478941 66
699 3300025924 Ga0207694_10477081 Ga0207694_104770812 66
700 3300025924 Ga0207694_11508536 Ga0207694_115085362 66
701 3300025924 Ga0207694_11551868 Ga0207694_115518681 66
702 3300025925 Ga0207650_10000090 Ga0207650_1000009060 66
703 3300025925 Ga0207650_10004940 Ga0207650_100049407 66
704 3300025925 Ga0207650_10008028 Ga0207650_100080286 66
705 3300025925 Ga0207650_11636668 Ga0207650_116366682 66
706 3300025926 Ga0207659_10111305 Ga0207659_101113053 66
707 3300025926 Ga0207659_10573328 Ga0207659_105733282 66
708 3300025927 Ga0207687_10000707 Ga0207687_100007078 66
709 3300025927 Ga0207687_10004473 Ga0207687_100044735 66
710 3300025928 Ga0207700_10118702 Ga0207700_101187023 66
711 3300025928 Ga0207700_10171687 Ga0207700_101716872 66
712 3300025928 Ga0207700_10225396 Ga0207700_102253962 66
713 3300025928 Ga0207700_10907348 Ga0207700_109073482 66
714 3300025928 Ga0207700_11118698 Ga0207700_111186982 66
715 3300025928 Ga0207700_11922991 Ga0207700_119229912 66
716 3300025929 Ga0207664_10068696 Ga0207664_100686963 66
717 3300025929 Ga0207664_10172892 Ga0207664_101728922 66
718 3300025929 Ga0207664_10414229 Ga0207664_104142291 66
719 3300025929 Ga0207664_10626290 Ga0207664_106262901 66
720 3300025929 Ga0207664_11135485 Ga0207664_111354851 66
721 3300025929 Ga0207664_11182020 Ga0207664_111820202 66
722 3300025931 Ga0207644_10011067 Ga0207644_100110675 66
723 3300025931 Ga0207644_10026155 Ga0207644_100261552 66
724 3300025931 Ga0207644_11693084 Ga0207644_116930842 66
725 3300025932 Ga0207690_10438378 Ga0207690_104383781 66
726 3300025932 Ga0207690_11448091 Ga0207690_114480911 66
727 3300025933 Ga0207706_10309935 Ga0207706_103099351 66
728 3300025933 Ga0207706_10815393 Ga0207706_108153931 66
729 3300025934 Ga0207686_10620172 Ga0207686_106201722 66
730 3300025935 Ga0207709_10105625 Ga0207709_101056251 66
731 3300025935 Ga0207709_10869581 Ga0207709_108695811 66
732 3300025936 Ga0207670_10119215 Ga0207670_101192151 66
733 3300025938 Ga0207704_10191130 Ga0207704_101911301 66
734 3300025938 Ga0207704_10665001 Ga0207704_106650011 66
735 3300025939 Ga0207665_10109296 Ga0207665_101092962 66
736 3300025939 Ga0207665_10316082 Ga0207665_103160822 66
737 3300025939 Ga0207665_10627105 Ga0207665_106271052 66
738 3300025940 Ga0207691_10037179 Ga0207691_100371796 66
739 3300025940 Ga0207691_11658093 Ga0207691_116580932 66
740 3300025941 Ga0207711_10001551 Ga0207711_1000155114 66
741 3300025941 Ga0207711_10015108 Ga0207711_100151083 66
742 3300025941 Ga0207711_10022270 Ga0207711_100222703 66
743 3300025941 Ga0207711_10950798 Ga0207711_109507981 66
744 3300025942 Ga0207689_10001472 Ga0207689_100014723 66
745 3300025942 Ga0207689_10058806 Ga0207689_100588068 66
746 3300025942 Ga0207689_10065263 Ga0207689_100652633 66
747 3300025944 Ga0207661_10008793 Ga0207661_100087936 66
748 3300025944 Ga0207661_10013851 Ga0207661_100138519 66
749 3300025944 Ga0207661_10020092 Ga0207661_100200922 66
750 3300025944 Ga0207661_10127022 Ga0207661_101270224 66
751 3300025944 Ga0207661_10260181 Ga0207661_102601811 66
752 3300025944 Ga0207661_10354944 Ga0207661_103549443 66
753 3300025944 Ga0207661_10638177 Ga0207661_106381772 66
754 3300025945 Ga0207679_10004118 Ga0207679_1000411818 66
755 3300025945 Ga0207679_10050322 Ga0207679_100503223 66
756 3300025945 Ga0207679_10053711 Ga0207679_100537113 66
757 3300025945 Ga0207679_11209541 Ga0207679_112095411 66
758 3300025949 Ga0207667_10001336 Ga0207667_100013367 66
759 3300025949 Ga0207667_10002403 Ga0207667_100024032 66
760 3300025949 Ga0207667_10002664 Ga0207667_100026648 66
761 3300025949 Ga0207667_10024876 Ga0207667_100248766 66
762 3300025949 Ga0207667_10040027 Ga0207667_100400274 66
763 3300025949 Ga0207667_10158526 Ga0207667_101585262 66
764 3300025949 Ga0207667_10427487 Ga0207667_104274871 66
765 3300025949 Ga0207667_10615428 Ga0207667_106154283 66
766 3300025949 Ga0207667_10990505 Ga0207667_109905051 66
767 3300025949 Ga0207667_11401431 Ga0207667_114014311 66
768 3300025960 Ga0207651_10044357 Ga0207651_100443572 66
769 3300025961 Ga0207712_10112929 Ga0207712_101129292 66
770 3300025981 Ga0207640_10007046 Ga0207640_100070465 66
771 3300025981 Ga0207640_10096947 Ga0207640_100969473 66
772 3300025981 Ga0207640_10135791 Ga0207640_101357912 66
773 3300025981 Ga0207640_10959901 Ga0207640_109599012 66
774 3300025981 Ga0207640_11479469 Ga0207640_114794692 66
775 3300025986 Ga0207658_10000076 Ga0207658_1000007618 66
776 3300025986 Ga0207658_10001070 Ga0207658_100010704 66
777 3300025986 Ga0207658_10505324 Ga0207658_105053242 66
778 3300025986 Ga0207658_10612754 Ga0207658_106127541 66
779 3300025986 Ga0207658_11851351 Ga0207658_118513511 66
780 3300026023 Ga0207677_10000052 Ga0207677_1000005276 66
781 3300026023 Ga0207677_10000055 Ga0207677_100000556 66
782 3300026023 Ga0207677_10384170 Ga0207677_103841701 66
783 3300026023 Ga0207677_11712607 Ga0207677_117126071 66
784 3300026023 Ga0207677_12176730 Ga0207677_121767301 66
785 3300026035 Ga0207703_10007880 Ga0207703_100078804 66
786 3300026035 Ga0207703_10009922 Ga0207703_100099225 66
787 3300026035 Ga0207703_10591702 Ga0207703_105917021 66
788 3300026035 Ga0207703_10600440 Ga0207703_106004401 66
789 3300026035 Ga0207703_10823369 Ga0207703_108233692 66
790 3300026035 Ga0207703_11013236 Ga0207703_110132361 66
791 3300026041 Ga0207639_10000107 Ga0207639_1000010721 66
792 3300026041 Ga0207639_10059439 Ga0207639_100594393 66
793 3300026041 Ga0207639_10241487 Ga0207639_102414873 66
794 3300026041 Ga0207639_10264192 Ga0207639_102641921 66
795 3300026041 Ga0207639_10357570 Ga0207639_103575701 66
796 3300026041 Ga0207639_10829943 Ga0207639_108299432 66
797 3300026067 Ga0207678_10046048 Ga0207678_100460484 66
798 3300026067 Ga0207678_10071390 Ga0207678_100713903 66
799 3300026067 Ga0207678_10517196 Ga0207678_105171962 66
800 3300026067 Ga0207678_10818184 Ga0207678_108181842 66
801 3300026067 Ga0207678_11387184 Ga0207678_113871841 66
802 3300026067 Ga0207678_11689686 Ga0207678_116896861 66
803 3300026078 Ga0207702_10002652 Ga0207702_100026528 66
804 3300026078 Ga0207702_10004569 Ga0207702_100045696 66
805 3300026078 Ga0207702_10015108 Ga0207702_100151085 66
806 3300026078 Ga0207702_10021369 Ga0207702_100213693 66
807 3300026078 Ga0207702_10130442 Ga0207702_101304422 66
808 3300026078 Ga0207702_10160985 Ga0207702_101609852 66
809 3300026078 Ga0207702_10215121 Ga0207702_102151212 66
810 3300026078 Ga0207702_10628458 Ga0207702_106284582 66
811 3300026078 Ga0207702_10855614 Ga0207702_108556142 66
812 3300026078 Ga0207702_11020102 Ga0207702_110201021 66
813 3300026088 Ga0207641_10000694 Ga0207641_1000069412 66
814 3300026088 Ga0207641_10001842 Ga0207641_1000184219 66
815 3300026088 Ga0207641_10031063 Ga0207641_100310633 66
816 3300026089 Ga0207648_11888125 Ga0207648_118881251 66
817 3300026095 Ga0207676_10002573 Ga0207676_100025734 66
818 3300026095 Ga0207676_10004619 Ga0207676_1000461918 66
819 3300026095 Ga0207676_11280727 Ga0207676_112807272 66
820 3300026116 Ga0207674_10000840 Ga0207674_100008406 66
821 3300026116 Ga0207674_10002679 Ga0207674_100026797 66
822 3300026116 Ga0207674_10003714 Ga0207674_1000371411 66
823 3300026116 Ga0207674_10004127 Ga0207674_1000412714 66
824 3300026116 Ga0207674_10018373 Ga0207674_100183735 66
825 3300026116 Ga0207674_10022509 Ga0207674_100225096 66
826 3300026116 Ga0207674_10024242 Ga0207674_100242423 66
827 3300026116 Ga0207674_10036924 Ga0207674_100369244 66
828 3300026116 Ga0207674_10198809 Ga0207674_101988092 66
829 3300026116 Ga0207674_10217646 Ga0207674_102176463 66
830 3300026116 Ga0207674_11430623 Ga0207674_114306232 66
831 3300026142 Ga0207698_10000011 Ga0207698_1000001186 66
832 3300026142 Ga0207698_10000059 Ga0207698_1000005939 66
833 3300026142 Ga0207698_10000239 Ga0207698_1000023921 66
834 3300026142 Ga0207698_10036972 Ga0207698_100369723 66
835 3300026142 Ga0207698_10038724 Ga0207698_100387242 66
836 3300026142 Ga0207698_10057267 Ga0207698_100572673 66
837 3300026142 Ga0207698_10091253 Ga0207698_100912532 66
838 3300026142 Ga0207698_10889964 Ga0207698_108899642 66
839 3300026142 Ga0207698_12020430 Ga0207698_120204301 66
840 3300026142 Ga0207698_12664499 Ga0207698_126644991 66
841 3300026142 Ga0207698_12718232 Ga0207698_127182322 66
842 3300027671 Ga0209588_1000776 Ga0209588_10007761 66
843 3300027671 Ga0209588_1248218 Ga0209588_12482181 66
844 3300027866 Ga0209813_10114637 Ga0209813_101146372 66
845 3300027907 Ga0207428_10000299 Ga0207428_1000029915 66
846 3300028017 Ga0265356_1005931 Ga0265356_10059312 66
847 3300028379 Ga0268266_10007211 Ga0268266_100072115 66
848 3300028379 Ga0268266_10373157 Ga0268266_103731573 66
849 3300028379 Ga0268266_10427715 Ga0268266_104277151 66
850 3300028379 Ga0268266_10461543 Ga0268266_104615431 66
851 3300028379 Ga0268266_10644192 Ga0268266_106441922 66
852 3300028379 Ga0268266_10688369 Ga0268266_106883691 66
853 3300028380 Ga0268265_10028181 Ga0268265_100281814 66
854 3300028380 Ga0268265_10053823 Ga0268265_100538232 66
855 3300028380 Ga0268265_10147657 Ga0268265_101476572 66
856 3300028380 Ga0268265_10414234 Ga0268265_104142341 66
857 3300028381 Ga0268264_10001263 Ga0268264_1000126313 66
858 3300028381 Ga0268264_11149932 Ga0268264_111499321 66
859 3300028381 Ga0268264_11271649 Ga0268264_112716492 66
860 3300028381 Ga0268264_11526328 Ga0268264_115263281 66
861 3300028653 Ga0265323_10043562 Ga0265323_100435622 66
862 3300028653 Ga0265323_10085533 Ga0265323_100855331 66
863 3300028800 Ga0265338_10263239 Ga0265338_102632392 66
864 3300030760 Ga0265762_1004180 Ga0265762_10041804 66
865 3300030762 Ga0265775_105134 Ga0265775_1051341 66
866 3300030863 Ga0265766_1019194 Ga0265766_10191941 66
867 3300030877 Ga0265777_102106 Ga0265777_1021062 66
868 3300030882 Ga0265764_103914 Ga0265764_1039141 66
869 3300030882 Ga0265764_114819 Ga0265764_1148191 66
870 3300030888 Ga0265769_116386 Ga0265769_1163861 66
871 3300030889 Ga0265761_102203 Ga0265761_1022032 66
872 3300031010 Ga0265771_1016502 Ga0265771_10165021 66
873 3300031011 Ga0265774_105592 Ga0265774_1055922 66
874 3300031043 Ga0265779_109831 Ga0265779_1098312 66
875 3300031090 Ga0265760_10113032 Ga0265760_101130323 66
876 3300031090 Ga0265760_10185526 Ga0265760_101855262 66
877 3300031235 Ga0265330_10385663 Ga0265330_103856632 66
878 3300031249 Ga0265339_10251993 Ga0265339_102519932 66
879 3300031344 Ga0265316_10088468 Ga0265316_100884681 66
880 3300031344 Ga0265316_10312576 Ga0265316_103125761 66
881 3300031344 Ga0265316_10496870 Ga0265316_104968701 66
882 3300031548 Ga0307408_100015742 Ga0307408_1000157421 66
883 3300031731 Ga0307405_10042021 Ga0307405_100420212 66
884 3300031824 Ga0307413_10751178 Ga0307413_107511781 66
885 3300031852 Ga0307410_10006891 Ga0307410_100068912 66
886 3300031852 Ga0307410_10006891 Ga0307410_100068915 66
887 3300031901 Ga0307406_10688427 Ga0307406_106884271 66
888 3300031903 Ga0307407_10464666 Ga0307407_104646661 66
889 3300031903 Ga0307407_11710558 Ga0307407_117105581 66
890 3300031911 Ga0307412_10366635 Ga0307412_103666351 66
891 3300031911 Ga0307412_10435107 Ga0307412_104351071 66
892 3300031995 Ga0307409_100091567 Ga0307409_1000915672 66
893 3300031995 Ga0307409_100833547 Ga0307409_1008335471 66
894 3300032002 Ga0307416_100012293 Ga0307416_1000122933 66
895 3300032002 Ga0307416_100339700 Ga0307416_1003397002 66
896 3300032005 Ga0307411_10002046 Ga0307411_100020466 66
897 3300032005 Ga0307411_10650537 Ga0307411_106505372 66
898 3300032120 Ga0316053_110382 Ga0316053_1103822 66
899 3300032126 Ga0307415_100001842 Ga0307415_1000018428 66
900 3300032126 Ga0307415_100034041 Ga0307415_1000340413 66
901 3300033180 Ga0307510_10142569 Ga0307510_101425691 66
902 3300033180 Ga0307510_10396785 Ga0307510_103967852 66
903 3300033524 Ga0316592_1087192 Ga0316592_10871922 66
904 3300033529 Ga0316587_1065459 Ga0316587_10654591 66
905 3300034817 Ga0373948_0023108 Ga0373948_0023108_696_896 66
906 3300034819 Ga0373958_0097486 Ga0373958_0097486_77_277 66
907 3300035121 Ga0373960_0374122 Ga0373960_0374122_121_324 66
908 3300035170 Ga0373943_0339941 Ga0373943_0339941_41_241 66
909 3300035170 Ga0373943_0542642 Ga0373943_0542642_39_239 66
910 3300035172 Ga0373955_0564235 Ga0373955_0564235_388_588 66
911 3300035691 Ga0373931_1245041 Ga0373931_1245041_156_356 66
912 3300035724 Ga0373933_0922133 Ga0373933_0922133_146_346 66
913 3300036401 Ga0373937_0261190 Ga0373937_0261190_305_505 66
914 3300036401 Ga0373937_0293875 Ga0373937_0293875_691_891 66
915 3300036401 Ga0373937_1345160 Ga0373937_1345160_228_428 66
916 3300036401 Ga0373937_1626959 Ga0373937_1626959_245_445 66
917 3300036457 Ga0265778_059849 Ga0265778_059849_95_295 66
918 3300037068 Ga0373925_1162772 Ga0373925_1162772_108_308 66
919 3300037312 Ga0395899_0012994 Ga0395899_0012994_488_691 66
920 3300037418 Ga0395900_0007414 Ga0395900_0007414_6170_6373 66
921 3300037418 Ga0395900_0349337 Ga0395900_0349337_1142_1342 66
922 3300037418 Ga0395900_0836116 Ga0395900_0836116_173_373 66
923 3300037418 Ga0395900_1085642 Ga0395900_1085642_271_471 66
924 3300037418 Ga0395900_1186080 Ga0395900_1186080_89_289 66
925 3300037418 Ga0395900_1205976 Ga0395900_1205976_198_398 66
926 3300037471 Ga0395905_0008077 Ga0395905_0008077_2559_2759 66
927 3300037471 Ga0395905_0025215 Ga0395905_0025215_5216_5419 66
928 3300037471 Ga0395905_0027436 Ga0395905_0027436_4085_4285 66
929 3300037471 Ga0395905_0040790 Ga0395905_0040790_411_611 66
930 3300037471 Ga0395905_0102839 Ga0395905_0102839_1267_1467 66
931 3300038443 Ga0395901_0629557 Ga0395901_0629557_130_330 66
932 3300039437 Ga0436365_0395743 Ga0436365_0395743_481_681 66
933 3300039437 Ga0436365_1543233 Ga0436365_1543233_397_597 66
934 3300039447 Ga0436361_0510228 Ga0436361_0510228_3496_3696 66
935 3300039447 Ga0436361_0520510 Ga0436361_0520510_1396_1596 66
936 3300039450 Ga0436363_1107256 Ga0436363_1107256_409_609 66
937 3300039450 Ga0436363_1532784 Ga0436363_1532784_2072_2287 66
938 3300039453 Ga0436362_1101430 Ga0436362_1101430_66_281 66
939 3300039453 Ga0436362_1298094 Ga0436362_1298094_165_365 66
940 3300041451 Ga0451791_0865225 Ga0451791_0865225_198_398 66
941 3300042001 Ga0439441_025853 Ga0439441_025853_88_288 66
942 3300042005 Ga0439448_0137098 Ga0439448_0137098_228_428 66
943 3300042005 Ga0439448_0219088 Ga0439448_0219088_131_331 66
944 3300042005 Ga0439448_0283232 Ga0439448_0283232_285_485 66
945 3300042125 Ga0450923_053088 Ga0450923_053088_609_809 66
946 3300042156 Ga0439446_0329524 Ga0439446_0329524_86_286 66
947 3300042876 Ga0451577_0000818 Ga0451577_0000818_13355_13555 66
948 3300042876 Ga0451577_0006524 Ga0451577_0006524_7172_7372 66
949 3300042876 Ga0451577_0024652 Ga0451577_0024652_2935_3135 66
950 3300042876 Ga0451577_0255218 Ga0451577_0255218_673_873 66
951 3300042876 Ga0451577_0737630 Ga0451577_0737630_46_252 66
952 3300044673 Ga0453683_0016561 Ga0453683_0016561_475_675 66
953 3300044673 Ga0453683_0107458 Ga0453683_0107458_1370_1570 66
954 3300044673 Ga0453683_0185002 Ga0453683_0185002_167_367 66
955 3300044673 Ga0453683_0367380 Ga0453683_0367380_441_641 66
956 3300044673 Ga0453683_0410522 Ga0453683_0410522_235_435 66
957 3300044673 Ga0453683_0768716 Ga0453683_0768716_389_589 66
958 3300044694 Ga0466963_0025542 Ga0466963_0025542_3199_3399 66
959 3300044694 Ga0466963_0036270 Ga0466963_0036270_2829_3029 66
960 3300044694 Ga0466963_0038283 Ga0466963_0038283_2719_2919 66
961 3300044712 Ga0453684_0000803 Ga0453684_0000803_23044_23244 66
962 3300044712 Ga0453684_0036556 Ga0453684_0036556_265_465 66
963 3300044712 Ga0453684_0055242 Ga0453684_0055242_291_491 66
964 3300044712 Ga0453684_0408943 Ga0453684_0408943_615_815 66
965 3300044712 Ga0453684_0831858 Ga0453684_0831858_682_882 66
966 3300044712 Ga0453684_2033838 Ga0453684_2033838_333_533 66
967 3300044712 Ga0453684_2066447 Ga0453684_2066447_159_359 66
968 3300044712 Ga0453684_2316097 Ga0453684_2316097_131_337 66
969 3300044719 Ga0466971_0322344 Ga0466971_0322344_328_528 66
970 3300045049 Ga0466959_0141489 Ga0466959_0141489_954_1154 66
971 3300045049 Ga0466959_0851990 Ga0466959_0851990_27_227 66
972 3300045051 Ga0451576_0006949 Ga0451576_0006949_1786_1986 66
973 3300045051 Ga0451576_0014212 Ga0451576_0014212_5589_5789 66
974 3300045051 Ga0451576_0453443 Ga0451576_0453443_314_514 66
975 3300045051 Ga0451576_0523969 Ga0451576_0523969_218_418 66
976 3300045051 Ga0451576_1872935 Ga0451576_1872935_125_325 66
977 3300045836 Ga0466958_0558685 Ga0466958_0558685_34_234 66
978 3300045836 Ga0466958_0584301 Ga0466958_0584301_83_283 66
979 3300045836 Ga0466958_0730860 Ga0466958_0730860_246_446 66
980 3300045976 Ga0466967_0001802 Ga0466967_0001802_5123_5323 66
981 3300045976 Ga0466967_0575472 Ga0466967_0575472_782_982 66
982 3300045976 Ga0466967_1239922 Ga0466967_1239922_301_501 66
983 3300045976 Ga0466967_1339251 Ga0466967_1339251_171_371 66
984 3300045976 Ga0466967_1992178 Ga0466967_1992178_367_567 66
985 3300046457 Ga0495590_0086527 Ga0495590_0086527_685_885 66
986 3300046462 Ga0495651_0046854 Ga0495651_0046854_2984_3184 66
987 3300046462 Ga0495651_0764995 Ga0495651_0764995_118_318 66
988 3300046463 Ga0495653_0389928 Ga0495653_0389928_274_474 66
989 3300046472 Ga0495580_0363815 Ga0495580_0363815_356_556 66
990 3300046473 Ga0495582_0328891 Ga0495582_0328891_140_340 66
991 3300046475 Ga0495639_0298439 Ga0495639_0298439_567_773 66
992 3300046477 Ga0495664_0279670 Ga0495664_0279670_226_426 66
993 3300046506 Ga0495583_0344635 Ga0495583_0344635_250_450 66
994 3300046511 Ga0495608_0884909 Ga0495608_0884909_157_357 66
995 3300046516 Ga0495628_0915778 Ga0495628_0915778_371_571 66
996 3300046522 Ga0495643_0115001 Ga0495643_0115001_1091_1291 66
997 3300046529 Ga0495652_0071133 Ga0495652_0071133_895_1095 66
998 3300046529 Ga0495652_0673866 Ga0495652_0673866_300_500 66
999 3300046529 Ga0495652_1009449 Ga0495652_1009449_97_297 66
1000 3300046535 Ga0495586_0368822 Ga0495586_0368822_453_653 66
1001 3300046536 Ga0495587_0113471 Ga0495587_0113471_767_967 66
1002 3300046536 Ga0495587_0709367 Ga0495587_0709367_246_446 66
1003 3300046543 Ga0495645_0000781 Ga0495645_0000781_13165_13365 66
1004 3300046543 Ga0495645_0018179 Ga0495645_0018179_4819_5019 66
1005 3300046543 Ga0495645_0550023 Ga0495645_0550023_440_640 66
1006 3300046616 Ga0495668_0585856 Ga0495668_0585856_340_540 66
1007 3300046660 Ga0495625_0063040 Ga0495625_0063040_2187_2387 66
1008 3300046660 Ga0495625_0892497 Ga0495625_0892497_174_374 66
1009 3300046663 Ga0495635_0161273 Ga0495635_0161273_821_1021 66
1010 3300046663 Ga0495635_0202143 Ga0495635_0202143_557_757 66
1011 3300046678 Ga0495599_0625446 Ga0495599_0625446_371_571 66
1012 3300046679 Ga0495623_0061112 Ga0495623_0061112_864_1064 66
1013 3300046679 Ga0495623_0074604 Ga0495623_0074604_1639_1839 66
1014 3300046680 Ga0495646_0009843 Ga0495646_0009843_4099_4299 66
1015 3300046680 Ga0495646_0696448 Ga0495646_0696448_83_283 66
1016 3300046684 Ga0495669_0080159 Ga0495669_0080159_446_646 66
1017 3300046684 Ga0495669_0398375 Ga0495669_0398375_216_416 66
1018 3300046684 Ga0495669_0563686 Ga0495669_0563686_131_331 66
1019 3300046689 Ga0495613_0430824 Ga0495613_0430824_531_731 66
1020 3300046692 Ga0495671_0466328 Ga0495671_0466328_271_471 66
1021 3300046694 Ga0495649_0149118 Ga0495649_0149118_872_1072 66
1022 3300046809 Ga0495600_0094647 Ga0495600_0094647_1445_1645 66
1023 3300047317 Ga0495604_0062399 Ga0495604_0062399_951_1151 66
1024 3300047317 Ga0495604_0565507 Ga0495604_0565507_210_410 66
1025 3300047319 Ga0495674_0693285 Ga0495674_0693285_42_242 66
1026 3300047319 Ga0495674_1198836 Ga0495674_1198836_17_217 66
1027 3300047322 Ga0495680_0922660 Ga0495680_0922660_16_216 66
1028 3300047323 Ga0495683_0181532 Ga0495683_0181532_371_571 66
1029 3300047443 Ga0495687_131774 Ga0495687_131774_645_845 66
1030 3300047444 Ga0495675_0100151 Ga0495675_0100151_1499_1699 66
1031 3300047471 Ga0495684_0345310 Ga0495684_0345310_718_918 66
1032 3300047472 Ga0495686_0476126 Ga0495686_0476126_60_260 66
1033 3300048088 Ga0495602_0256746 Ga0495602_0256746_898_1098 66
1034 3300048088 Ga0495602_0884772 Ga0495602_0884772_171_371 66
1035 3300048903 Ga0496100_1315938 Ga0496100_1315938_221_421 66
1036 3300048904 Ga0496101_0241415 Ga0496101_0241415_619_819 66
1037 3300048904 Ga0496101_0697124 Ga0496101_0697124_290_490 66
1038 3300048906 Ga0496103_0195603 Ga0496103_0195603_1007_1207 66
1039 3300048907 Ga0496104_0040556 Ga0496104_0040556_3461_3661 66
1040 3300048907 Ga0496104_0468253 Ga0496104_0468253_861_1061 66
1041 3300048907 Ga0496104_1148873 Ga0496104_1148873_58_258 66
1042 3300048908 Ga0496105_0166346 Ga0496105_0166346_147_347 66
1043 3300048908 Ga0496105_0202716 Ga0496105_0202716_563_763 66
1044 3300048911 Ga0496108_0026741 Ga0496108_0026741_3810_4010 66
1045 3300048911 Ga0496108_0046396 Ga0496108_0046396_23_223 66
1046 3300048911 Ga0496108_0096729 Ga0496108_0096729_448_648 66
1047 3300048912 Ga0496109_0015917 Ga0496109_0015917_494_694 66
1048 3300048912 Ga0496109_0078800 Ga0496109_0078800_2164_2364 66
1049 3300048912 Ga0496109_0791849 Ga0496109_0791849_179_379 66
1050 3300048913 Ga0496110_0043752 Ga0496110_0043752_1774_1974 66
1051 3300048913 Ga0496110_1404128 Ga0496110_1404128_359_559 66
1052 3300048914 Ga0496111_0074367 Ga0496111_0074367_1986_2186 66
1053 3300048915 Ga0496112_0014309 Ga0496112_0014309_168_368 66
1054 3300048915 Ga0496112_0046437 Ga0496112_0046437_2659_2859 66
1055 3300048915 Ga0496112_0065430 Ga0496112_0065430_1691_1891 66
1056 3300048915 Ga0496112_0173153 Ga0496112_0173153_708_908 66
1057 3300048915 Ga0496112_0490605 Ga0496112_0490605_492_692 66
1058 3300048916 Ga0496113_0016771 Ga0496113_0016771_2041_2241 66
1059 3300048916 Ga0496113_0133902 Ga0496113_0133902_1064_1264 66
1060 3300048916 Ga0496113_0824391 Ga0496113_0824391_159_359 66
1061 3300048918 Ga0496115_0434388 Ga0496115_0434388_643_843 66
1062 3300048918 Ga0496115_0507457 Ga0496115_0507457_382_582 66
1063 3300048918 Ga0496115_0607701 Ga0496115_0607701_370_570 66
1064 3300048922 Ga0496119_0065543 Ga0496119_0065543_1120_1320 66
1065 3300048924 Ga0496121_0828943 Ga0496121_0828943_274_474 66
1066 3300048929 Ga0496126_0016529 Ga0496126_0016529_219_419 66
1067 3300048929 Ga0496126_0830221 Ga0496126_0830221_147_347 66
1068 3300049460 Ga0495682_0057786 Ga0495682_0057786_742_942 66
1069 3300049460 Ga0495682_0060129 Ga0495682_0060129_248_448 66
1070 3300049522 Ga0501299_115708 Ga0501299_115708_325_525 66
1071 3300049528 Ga0501312_101970 Ga0501312_101970_210_410 66
1072 3300049568 Ga0501031_0033208 Ga0501031_0033208_1747_1947 66
1073 3300049569 Ga0501032_0178813 Ga0501032_0178813_1026_1226 66
1074 3300049570 Ga0501033_0023595 Ga0501033_0023595_2070_2270 66
1075 3300049571 Ga0501034_0008002 Ga0501034_0008002_4279_4479 66
1076 3300049571 Ga0501034_0070152 Ga0501034_0070152_80_283 66
1077 3300049572 Ga0501036_0003425 Ga0501036_0003425_3552_3752 66
1078 3300049573 Ga0501037_0013264 Ga0501037_0013264_4895_5095 66
1079 3300049574 Ga0501038_0002323 Ga0501038_0002323_8972_9172 66
1080 3300049575 Ga0501039_0803183 Ga0501039_0803183_411_611 66
1081 3300049576 Ga0501040_0089120 Ga0501040_0089120_1078_1278 66
1082 3300049576 Ga0501040_0123045 Ga0501040_0123045_404_604 66
1083 3300049579 Ga0501043_0002319 Ga0501043_0002319_14053_14253 66
1084 3300049580 Ga0501046_0000106 Ga0501046_0000106_79080_79280 66
1085 3300049580 Ga0501046_0751997 Ga0501046_0751997_261_461 66
1086 3300049581 Ga0501047_0005612 Ga0501047_0005612_2964_3164 66
1087 3300049582 Ga0501048_0318447 Ga0501048_0318447_583_783 66
1088 3300049582 Ga0501048_0766391 Ga0501048_0766391_353_553 66
1089 3300049584 Ga0501068_0020211 Ga0501068_0020211_954_1154 66
1090 3300049586 Ga0501070_0078873 Ga0501070_0078873_1476_1676 66
1091 3300049588 Ga0501072_0386191 Ga0501072_0386191_859_1059 66
1092 3300049588 Ga0501072_0907653 Ga0501072_0907653_459_662 66
1093 3300049589 Ga0501073_0054288 Ga0501073_0054288_843_1043 66
1094 3300049589 Ga0501073_0086276 Ga0501073_0086276_157_357 66
1095 3300049589 Ga0501073_1202418 Ga0501073_1202418_227_427 66
1096 3300049591 Ga0501075_0102505 Ga0501075_0102505_489_692 66
1097 3300049592 Ga0501076_0931127 Ga0501076_0931127_89_292 66
1098 3300049593 Ga0501077_0049431 Ga0501077_0049431_198_398 66
1099 3300049651 Ga0501201_047589 Ga0501201_047589_144_344 66
1100 3300049680 Ga0501250_086311 Ga0501250_086311_308_508 66
1101 3300049685 Ga0501256_037217 Ga0501256_037217_311_511 66
1102 3300049704 Ga0501221_112417 Ga0501221_112417_64_264 66
1103 3300049707 Ga0501234_086055 Ga0501234_086055_234_434 66
1104 3300049708 Ga0501245_125581 Ga0501245_125581_145_345 66
1105 3300049741 Ga0501079_0617540 Ga0501079_0617540_95_295 66
1106 3300049741 Ga0501079_1165152 Ga0501079_1165152_381_584 66
1107 3300049742 Ga0501080_0210836 Ga0501080_0210836_721_921 66
1108 3300049771 Ga0501274_012480 Ga0501274_012480_560_760 66
1109 3300049822 Ga0501035_0202103 Ga0501035_0202103_1148_1348 66
1110 3300049822 Ga0501035_0218211 Ga0501035_0218211_991_1191 66
1111 3300049823 Ga0501044_0080457 Ga0501044_0080457_1541_1741 66
1112 3300049823 Ga0501044_0558274 Ga0501044_0558274_703_903 66
1113 3300049824 Ga0501045_0073634 Ga0501045_0073634_1871_2071 66
1114 3300050489 nmdc:mga03683_624164_c1 nmdc:mga03683_624164_c1_195_395 66
1115 3300050490 nmdc:mga03n38_589969_c1 nmdc:mga03n38_589969_c1_44_244 66
1116 3300050491 nmdc:mga00v17_1052193_c1 nmdc:mga00v17_1052193_c1_205_405 66
1117 3300050492 nmdc:mga0yw44_861963_c1 nmdc:mga0yw44_861963_c1_149_349 66
1118 3300050494 nmdc:mga06z11_611662_c1 nmdc:mga06z11_611662_c1_27_227 66
1119 3300050495 nmdc:mga04h51_112783_c1 nmdc:mga04h51_112783_c1_15_215 66
1120 3300050496 nmdc:mga07m45_409555_c1 nmdc:mga07m45_409555_c1_131_331 66
1121 3300050507 nmdc:mga05p37_351502_c1 nmdc:mga05p37_351502_c1_945_1145 66
1122 3300050507 nmdc:mga05p37_625783_c1 nmdc:mga05p37_625783_c1_679_879 66
1123 3300050507 nmdc:mga05p37_929_c1 nmdc:mga05p37_929_c1_7294_7494 66
1124 3300050508 nmdc:mga09592_1426664_c1 nmdc:mga09592_1426664_c1_280_480 66
1125 3300050508 nmdc:mga09592_1708180_c1 nmdc:mga09592_1708180_c1_134_334 66
1126 3300050508 nmdc:mga09592_779_c1 nmdc:mga09592_779_c1_21448_21648 66
1127 3300050509 nmdc:mga0qj67_309711_c1 nmdc:mga0qj67_309711_c1_118_318 66
1128 3300050510 nmdc:mga06r32_1350870_c1 nmdc:mga06r32_1350870_c1_275_475 66
1129 3300050510 nmdc:mga06r32_451439_c1 nmdc:mga06r32_451439_c1_603_803 66
1130 3300050510 nmdc:mga06r32_570712_c1 nmdc:mga06r32_570712_c1_821_1021 66
1131 3300050510 nmdc:mga06r32_593560_c1 nmdc:mga06r32_593560_c1_373_573 66
1132 3300050511 nmdc:mga08y16_19633_c1 nmdc:mga08y16_19633_c1_586_786 66
1133 3300050511 nmdc:mga08y16_625177_c1 nmdc:mga08y16_625177_c1_199_402 66
1134 3300050512 nmdc:mga0n895_2112276_c1 nmdc:mga0n895_2112276_c1_283_483 66
1135 3300050512 nmdc:mga0n895_4165_c1 nmdc:mga0n895_4165_c1_3238_3438 66
1136 3300050513 nmdc:mga0rr50_1757640_c1 nmdc:mga0rr50_1757640_c1_293_493 66
1137 3300050513 nmdc:mga0rr50_227413_c2 nmdc:mga0rr50_227413_c2_623_823 66
1138 3300050513 nmdc:mga0rr50_254447_c1 nmdc:mga0rr50_254447_c1_289_489 66
1139 3300050514 nmdc:mga08x19_1150071_c1 nmdc:mga08x19_1150071_c1_246_446 66
1140 3300050514 nmdc:mga08x19_532757_c1 nmdc:mga08x19_532757_c1_478_678 66
1141 3300050514 nmdc:mga08x19_77083_c1 nmdc:mga08x19_77083_c1_1650_1850 66
1142 3300050514 nmdc:mga08x19_843806_c1 nmdc:mga08x19_843806_c1_70_270 66
1143 3300050515 nmdc:mga0a205_23561_c1 nmdc:mga0a205_23561_c1_275_475 66
1144 3300053077 Ga0495601_0109528 Ga0495601_0109528_133_333 66
1145 3300053077 Ga0495601_0337551 Ga0495601_0337551_354_554 66
1146 3300053119 Ga0500595_000032 Ga0500595_000032_56859_57059 66
1147 3300053136 Ga0500559_0555345 Ga0500559_0555345_56_256 66
1148 3300054114 Ga0501084_0141850 Ga0501084_0141850_1751_1951 66
1149 3300055283 Ga0500661_001186 Ga0500661_001186_4547_4747 66
1150 3300059490 Ga0587066_055213 Ga0587066_055213_309_509 66
1151 3300059492 Ga0587073_0156911 Ga0587073_0156911_286_486 66
1152 3300059493 Ga0587077_017890 Ga0587077_017890_102_305 66
1153 3300059493 Ga0587077_043834 Ga0587077_043834_12_215 66
1154 3300059493 Ga0587077_256168 Ga0587077_256168_189_389 66
1155 3300059503 Ga0587080_088305 Ga0587080_088305_147_347 66
1156 3300059504 Ga0587082_087965 Ga0587082_087965_297_497 66
1157 3300059505 Ga0587083_0139780 Ga0587083_0139780_132_332 66
1158 3300059506 Ga0587085_184512 Ga0587085_184512_205_405 66
1159 3300059508 Ga0587088_079650 Ga0587088_079650_303_503 66
1160 3300059508 Ga0587088_094395 Ga0587088_094395_361_561 66
1161 3300059509 Ga0587089_079091 Ga0587089_079091_170_370 66
1162 3300059511 Ga0587091_101168 Ga0587091_101168_235_435 66
1163 3300059624 Ga0587109_187893 Ga0587109_187893_104_304 66
1164 3300059642 Ga0587069_076152 Ga0587069_076152_95_295 66
1165 3300059647 Ga0587079_134789 Ga0587079_134789_371_571 66
1166 3300060243 Ga0587060_028550 Ga0587060_028550_224_424 66
1167 3300060344 Ga0587071_195422 Ga0587071_195422_317_517 66
1168 3300060346 Ga0587111_0000976 Ga0587111_0000976_13_216 66
1169 3300060346 Ga0587111_0003253 Ga0587111_0003253_147_350 66
1170 3300061719 Ga0466962_0718605 Ga0466962_0718605_251_451 66
1171 3300061734 Ga0530510_0002199 Ga0530510_0002199_13047_13247 66

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

16

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9779 1 66
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9768 2 66
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9754 2 66
1hz9-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9722 1 66
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9715 1 66
ID Description Score Start End Superfamily
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9731 2 63 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.973 2 63 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9708 2 63 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.959 2 63 2.40.50.140
2haxB02 Special;Other non-globular;Rhinovirus 14, subunit 4; 0.9577 40 66 6.20.370.130
ID Description Score Start End GO Terms
AF-A0A2V9PB08-F1-model_v4 Cold-shock protein 1.009 2 66 GO:0003676
GO:0005737
AF-A0A2W0BM59-F1-model_v4 Cold-shock protein 1.008 1 66 GO:0003676
GO:0005737
AF-A0A2N9MLP4-F1-model_v4 Major cold shock protein 1.008 2 66 GO:0003676
GO:0005737
AF-A0A0C2HTJ5-F1-model_v4 Cold-shock protein 1.008 2 66 GO:0003676
GO:0005737
AF-A0A2V9QND7-F1-model_v4 Cold-shock protein 1.007 1 66 GO:0003676
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.02 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map