F491066

General Info

Members Datasets Scaffolds Average Seq Length
1165 446 1165 131

Family's Representative Sequence

Representative Sequence 3300020080|Ga0206350_10920527|Ga0206350_109205273
Length 150
Sequence MAKPKPGGRRPRRRERKNIAYGVAHIKSSFNNTIISISDPQGNVLAWASAGNVGFKGSRKSTPFAAQLAAEACARRAMEHGVRKVDVLVKGPGSGRETAIRSLQNSGIEVSGIKDVTPSRTTAAAPRSVGGSDRWPATPDPSAGSVGARR

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
104 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
197 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
198 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
199 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
260 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
266 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
267 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
270 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
271 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
428 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
431 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
432 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
433 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
434 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
435 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
438 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 4.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 9.1
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1001877 3300002073 Bacteria 2086
2 Ga0058863_11918246 3300004799 Bacteria 585
3 Ga0058863_11957316 3300004799 Bacteria 1932
4 Ga0065712_10113701 3300005290 Bacteria 1778
5 Ga0065715_10063152 3300005293 Bacteria 809
6 Ga0065707_10485627 3300005295 Bacteria 770
7 Ga0070683_100363808 3300005329 Bacteria 1378
8 Ga0070683_101340454 3300005329 Bacteria 688
9 Ga0070690_100048896 3300005330 Bacteria 2695
10 Ga0070690_100334046 3300005330 Bacteria 1096
11 Ga0070690_101584607 3300005330 Bacteria 530
12 Ga0070670_100751242 3300005331 Bacteria 879
13 Ga0070670_101121483 3300005331 Bacteria 718
14 Ga0068869_102125525 3300005334 Bacteria 505
15 Ga0070666_10781288 3300005335 Bacteria 703
16 Ga0070680_100373398 3300005336 Bacteria 1214
17 Ga0070680_101020262 3300005336 Bacteria 715
18 Ga0068868_100151741 3300005338 Bacteria 1908
19 Ga0068868_100403634 3300005338 Bacteria 1180
20 Ga0070660_100123948 3300005339 Bacteria 2064
21 Ga0070660_100261615 3300005339 Bacteria 1413
22 Ga0070660_100593135 3300005339 Bacteria 926
23 Ga0070660_101068235 3300005339 Bacteria 683
24 Ga0070689_100804299 3300005340 Bacteria 827
25 Ga0070691_10023408 3300005341 Bacteria 2868
26 Ga0070691_10189233 3300005341 Bacteria 1075
27 Ga0070691_10717507 3300005341 Bacteria 602
28 Ga0070687_100356924 3300005343 Bacteria 945
29 Ga0070661_100778634 3300005344 Bacteria 784
30 Ga0070661_101452217 3300005344 Bacteria 578
31 Ga0070692_10225988 3300005345 Bacteria 1109
32 Ga0070692_10527502 3300005345 Bacteria 770
33 Ga0070668_100254737 3300005347 Bacteria 1458
34 Ga0070668_100793922 3300005347 Bacteria 841
35 Ga0070669_100078134 3300005353 Bacteria 2459
36 Ga0070669_101298822 3300005353 Bacteria 630
37 Ga0070669_101456492 3300005353 Bacteria 595
38 Ga0070675_100041662 3300005354 Bacteria 3750
39 Ga0070675_100418939 3300005354 Bacteria 1197
40 Ga0070675_101189689 3300005354 Bacteria 702
41 Ga0070675_101392756 3300005354 Bacteria 646
42 Ga0070671_101524059 3300005355 Bacteria 592
43 Ga0070674_100026741 3300005356 Bacteria 3772
44 Ga0070674_100064122 3300005356 Bacteria 2573
45 Ga0070674_100125926 3300005356 Bacteria 1903
46 Ga0070674_100160059 3300005356 Bacteria 1707
47 Ga0070673_100177821 3300005364 Bacteria 1820
48 Ga0070673_100439083 3300005364 Bacteria 1173
49 Ga0070673_100664790 3300005364 Bacteria 954
50 Ga0070688_100946637 3300005365 Bacteria 682
51 Ga0070688_101109780 3300005365 Bacteria 633
52 Ga0070659_100345404 3300005366 Bacteria 1248
53 Ga0070659_100560527 3300005366 Bacteria 979
54 Ga0070667_100349742 3300005367 Bacteria 1338
55 Ga0070667_100656317 3300005367 Bacteria 969
56 Ga0070703_10006895 3300005406 Bacteria 3187
57 Ga0070714_100542434 3300005435 Bacteria 1113
58 Ga0070713_100234062 3300005436 Bacteria 1671
59 Ga0070713_101081728 3300005436 Bacteria 775
60 Ga0070713_101976119 3300005436 Bacteria 566
61 Ga0070713_102267855 3300005436 Bacteria 526
62 Ga0070710_11149834 3300005437 Bacteria 572
63 Ga0070701_10004277 3300005438 Bacteria 5761
64 Ga0070701_10284544 3300005438 Bacteria 1011
65 Ga0070701_10576572 3300005438 Bacteria 742
66 Ga0070711_100048282 3300005439 Bacteria 2909
67 Ga0070705_100008111 3300005440 Bacteria 5195
68 Ga0070705_100045233 3300005440 Bacteria 2532
69 Ga0070705_100061337 3300005440 Bacteria 2234
70 Ga0070705_100114960 3300005440 Bacteria 1727
71 Ga0070705_101007065 3300005440 Bacteria 677
72 Ga0070705_101662880 3300005440 Bacteria 539
73 Ga0070700_100013216 3300005441 Bacteria 4633
74 Ga0070700_100622564 3300005441 Bacteria 849
75 Ga0070694_100285083 3300005444 Bacteria 1260
76 Ga0070694_100317209 3300005444 Bacteria 1199
77 Ga0070708_100002882 3300005445 Bacteria 13353
78 Ga0070708_100014721 3300005445 Bacteria 6444
79 Ga0070708_100051650 3300005445 Bacteria 3643
80 Ga0070708_100114650 3300005445 Bacteria 2480
81 Ga0070708_100175853 3300005445 Bacteria 2000
82 Ga0070708_101667802 3300005445 Bacteria 593
83 Ga0070678_100055745 3300005456 Bacteria 2887
84 Ga0070678_100070399 3300005456 Bacteria 2614
85 Ga0070678_100484892 3300005456 Bacteria 1088
86 Ga0070678_100667602 3300005456 Bacteria 934
87 Ga0070678_100738527 3300005456 Bacteria 889
88 Ga0070678_101498867 3300005456 Bacteria 631
89 Ga0070662_101119680 3300005457 Bacteria 676
90 Ga0070681_10162793 3300005458 Bacteria 2155
91 Ga0070681_10302860 3300005458 Bacteria 1508
92 Ga0070681_10551492 3300005458 Bacteria 1066
93 Ga0070681_10622920 3300005458 Bacteria 994
94 Ga0070681_11597320 3300005458 Bacteria 577
95 Ga0068867_100034170 3300005459 Bacteria 3685
96 Ga0068867_100043147 3300005459 Bacteria 3301
97 Ga0068867_100065006 3300005459 Bacteria 2713
98 Ga0068867_100316760 3300005459 Bacteria 1291
99 Ga0068867_100491185 3300005459 Bacteria 1053
100 Ga0070706_100012452 3300005467 Bacteria 7880
101 Ga0070706_100229885 3300005467 Bacteria 1731
102 Ga0070706_100830639 3300005467 Bacteria 855
103 Ga0070707_100086130 3300005468 Bacteria 3038
104 Ga0070698_100007643 3300005471 Bacteria 11696
105 Ga0070698_101171535 3300005471 Bacteria 718
106 Ga0070699_100715826 3300005518 Bacteria 915
107 Ga0070699_100864895 3300005518 Bacteria 828
108 Ga0070684_101005174 3300005535 Bacteria 783
109 Ga0070697_100586951 3300005536 Bacteria 979
110 Ga0070697_100686513 3300005536 Bacteria 903
111 Ga0070672_100285086 3300005543 Bacteria 1397
112 Ga0070672_100362166 3300005543 Bacteria 1238
113 Ga0070686_100043668 3300005544 Bacteria 2813
114 Ga0070686_100638962 3300005544 Bacteria 843
115 Ga0070686_101293685 3300005544 Bacteria 609
116 Ga0070695_100004664 3300005545 Bacteria 8058
117 Ga0070695_100384825 3300005545 Bacteria 1059
118 Ga0070695_100915954 3300005545 Bacteria 709
119 Ga0070696_100005392 3300005546 Bacteria 8530
120 Ga0070696_100034118 3300005546 Bacteria 3500
121 Ga0070696_100072784 3300005546 Bacteria 2421
122 Ga0070696_101507314 3300005546 Bacteria 576
123 Ga0070693_100136617 3300005547 Bacteria 1539
124 Ga0070693_100726481 3300005547 Bacteria 729
125 Ga0070665_100494877 3300005548 Bacteria 1234
126 Ga0070665_100898040 3300005548 Bacteria 899
127 Ga0070665_101499362 3300005548 Bacteria 683
128 Ga0070704_100190204 3300005549 Bacteria 1649
129 Ga0070704_100199142 3300005549 Bacteria 1615
130 Ga0070704_100272886 3300005549 Bacteria 1398
131 Ga0070704_100287871 3300005549 Bacteria 1364
132 Ga0070704_100312409 3300005549 Bacteria 1314
133 Ga0070704_100466094 3300005549 Bacteria 1091
134 Ga0070704_101696730 3300005549 Bacteria 583
135 Ga0068855_100535872 3300005563 Bacteria 1269
136 Ga0070664_100178694 3300005564 Bacteria 1886
137 Ga0070664_100411456 3300005564 Bacteria 1238
138 Ga0070664_100625012 3300005564 Bacteria 1000
139 Ga0070664_100936687 3300005564 Bacteria 813
140 Ga0068854_100914679 3300005578 Bacteria 772
141 Ga0068854_100938550 3300005578 Bacteria 762
142 Ga0068856_100316577 3300005614 Bacteria 1578
143 Ga0068856_101090923 3300005614 Bacteria 816
144 Ga0068856_102303174 3300005614 Bacteria 547
145 Ga0070702_100070055 3300005615 Bacteria 2068
146 Ga0070702_100203069 3300005615 Bacteria 1313
147 Ga0070702_100267871 3300005615 Bacteria 1166
148 Ga0070702_100273695 3300005615 Bacteria 1156
149 Ga0068852_100063116 3300005616 Bacteria 3225
150 Ga0068852_102255945 3300005616 Bacteria 566
151 Ga0068859_100265412 3300005617 Bacteria 1809
152 Ga0068859_102896517 3300005617 Bacteria 526
153 Ga0068864_100024465 3300005618 Bacteria 5081
154 Ga0068864_100551791 3300005618 Bacteria 1114
155 Ga0068866_10165170 3300005718 Bacteria 1294
156 Ga0068861_100269045 3300005719 Bacteria 1463
157 Ga0068861_100383439 3300005719 Bacteria 1242
158 Ga0068861_101190162 3300005719 Bacteria 736
159 Ga0068861_101196440 3300005719 Bacteria 735
160 Ga0068861_101233368 3300005719 Bacteria 724
161 Ga0068851_10768583 3300005834 Bacteria 597
162 Ga0068870_10169134 3300005840 Bacteria 1303
163 Ga0068863_100163339 3300005841 Bacteria 2135
164 Ga0068863_100425701 3300005841 Bacteria 1301
165 Ga0068858_100230507 3300005842 Bacteria 1756
166 Ga0068858_100660742 3300005842 Bacteria 1016
167 Ga0068860_100190707 3300005843 Bacteria 1984
168 Ga0068860_100354464 3300005843 Bacteria 1444
169 Ga0068860_100451668 3300005843 Bacteria 1278
170 Ga0068860_100527037 3300005843 Bacteria 1182
171 Ga0068862_101266403 3300005844 Bacteria 738
172 Ga0068862_102533836 3300005844 Bacteria 525
173 Ga0081455_10166672 3300005937 Bacteria 1682
174 Ga0081539_10008891 3300005985 Bacteria 8576
175 Ga0081539_10011391 3300005985 Bacteria 7035
176 Ga0075365_10128755 3300006038 Bacteria 1751
177 Ga0075365_10436419 3300006038 Bacteria 925
178 Ga0075365_10438268 3300006038 Bacteria 923
179 Ga0075365_10782487 3300006038 Bacteria 673
180 Ga0075363_100037884 3300006048 Bacteria 2533
181 Ga0075364_10123739 3300006051 Bacteria 1732
182 Ga0075364_10421099 3300006051 Bacteria 912
183 Ga0070712_100332471 3300006175 Bacteria 1238
184 Ga0070712_100589458 3300006175 Bacteria 940
185 Ga0070712_100837696 3300006175 Bacteria 791
186 Ga0075367_10044620 3300006178 Bacteria 2600
187 Ga0075367_10220586 3300006178 Bacteria 1187
188 Ga0097621_100214381 3300006237 Bacteria 1676
189 Ga0075370_10352225 3300006353 Bacteria 880
190 Ga0068871_100450337 3300006358 Bacteria 1154
191 Ga0068871_102431149 3300006358 Bacteria 500
192 Ga0075428_100000238 3300006844 Bacteria 53672
193 Ga0075428_102135036 3300006844 Bacteria 579
194 Ga0075430_100029304 3300006846 Bacteria 4671
195 Ga0075430_100368645 3300006846 Bacteria 1186
196 Ga0075430_100691089 3300006846 Bacteria 841
197 Ga0075433_10433733 3300006852 Bacteria 1158
198 Ga0075433_11892593 3300006852 Bacteria 512
199 Ga0075434_100004540 3300006871 Bacteria 12533
200 Ga0075434_100283026 3300006871 Bacteria 1677
201 Ga0075434_100534892 3300006871 Bacteria 1192
202 Ga0075434_101926987 3300006871 Bacteria 597
203 Ga0068865_100170866 3300006881 Bacteria 1666
204 Ga0068865_100292548 3300006881 Bacteria 1301
205 Ga0068865_101007708 3300006881 Bacteria 729
206 Ga0075436_100441394 3300006914 Bacteria 947
207 Ga0097620_100265432 3300006931 Bacteria 1809
208 Ga0097620_102896492 3300006931 Bacteria 526
209 Ga0075435_100304394 3300007076 Bacteria 1363
210 Ga0075435_100436464 3300007076 Bacteria 1129
211 Ga0075435_100735764 3300007076 Bacteria 858
212 Ga0075435_101449258 3300007076 Bacteria 602
213 Ga0105251_10150715 3300009011 Bacteria 1050
214 Ga0105251_10156309 3300009011 Bacteria 1029
215 Ga0105240_11571517 3300009093 Bacteria 689
216 Ga0105240_11595821 3300009093 Bacteria 683
217 Ga0105240_12017406 3300009093 Bacteria 599
218 Ga0111539_11173410 3300009094 Bacteria 892
219 Ga0105245_10010831 3300009098 Bacteria 7934
220 Ga0105245_10107113 3300009098 Bacteria 2595
221 Ga0105245_10182636 3300009098 Bacteria 2005
222 Ga0105245_10395950 3300009098 Bacteria 1379
223 Ga0105245_10614923 3300009098 Bacteria 1114
224 Ga0105245_10711509 3300009098 Bacteria 1038
225 Ga0105245_12587692 3300009098 Bacteria 561
226 Ga0105247_10048269 3300009101 Bacteria 2615
227 Ga0105247_10157730 3300009101 Bacteria 1500
228 Ga0105247_10787307 3300009101 Bacteria 724
229 Ga0105247_11124999 3300009101 Bacteria 621
230 Ga0114129_10013928 3300009147 Bacteria 11456
231 Ga0114129_10095509 3300009147 Bacteria 4117
232 Ga0114129_10306806 3300009147 Bacteria 2114
233 Ga0114129_11533637 3300009147 Bacteria 818
234 Ga0114129_12077752 3300009147 Bacteria 686
235 Ga0105243_10010219 3300009148 Bacteria 7133
236 Ga0105243_10117905 3300009148 Bacteria 2233
237 Ga0105243_10184492 3300009148 Bacteria 1817
238 Ga0105243_10381517 3300009148 Bacteria 1304
239 Ga0105243_10517779 3300009148 Bacteria 1134
240 Ga0105243_11100438 3300009148 Bacteria 803
241 Ga0105243_11136870 3300009148 Bacteria 791
242 Ga0105241_11183774 3300009174 Bacteria 723
243 Ga0105242_10014288 3300009176 Bacteria 6150
244 Ga0105242_10048621 3300009176 Bacteria 3448
245 Ga0105242_10141150 3300009176 Bacteria 2090
246 Ga0105242_10162792 3300009176 Bacteria 1954
247 Ga0105242_11035059 3300009176 Bacteria 831
248 Ga0105242_11425123 3300009176 Bacteria 721
249 Ga0105242_12932557 3300009176 Bacteria 527
250 Ga0105248_10029357 3300009177 Bacteria 6135
251 Ga0105248_11251043 3300009177 Bacteria 839
252 Ga0105248_11410131 3300009177 Bacteria 788
253 Ga0105248_11961100 3300009177 Bacteria 665
254 Ga0105238_10151244 3300009551 Bacteria 2296
255 Ga0105238_10189405 3300009551 Bacteria 2033
256 Ga0105238_10252118 3300009551 Bacteria 1744
257 Ga0105238_10766213 3300009551 Bacteria 979
258 Ga0105238_11066666 3300009551 Bacteria 830
259 Ga0105238_11231728 3300009551 Bacteria 773
260 Ga0105238_11302686 3300009551 Bacteria 752
261 Ga0105249_10180331 3300009553 Bacteria 2054
262 Ga0105249_10474493 3300009553 Bacteria 1293
263 Ga0105249_10839747 3300009553 Bacteria 984
264 Ga0105249_11076305 3300009553 Bacteria 874
265 Ga0105239_10102797 3300010375 Bacteria 3162
266 Ga0105239_10109180 3300010375 Bacteria 3066
267 Ga0105239_10882087 3300010375 Bacteria 1026
268 Ga0105239_13580572 3300010375 Bacteria 505
269 Ga0105246_10460966 3300011119 Bacteria 1070
270 Ga0157341_1010957 3300012494 Bacteria 778
271 Ga0157341_1014538 3300012494 Bacteria 715
272 Ga0154019_138530 3300013044 Bacteria 543
273 Ga0157371_10413641 3300013102 Bacteria 988
274 Ga0157370_10993703 3300013104 Bacteria 760
275 Ga0157369_10404394 3300013105 Bacteria 1416
276 Ga0157374_10128946 3300013296 Bacteria 2446
277 Ga0157374_11419756 3300013296 Bacteria 717
278 Ga0157374_12567545 3300013296 Bacteria 537
279 Ga0157378_10011509 3300013297 Bacteria 7745
280 Ga0157378_10114709 3300013297 Bacteria 2475
281 Ga0157378_10200215 3300013297 Bacteria 1888
282 Ga0157378_10245590 3300013297 Bacteria 1712
283 Ga0157378_10291057 3300013297 Bacteria 1577
284 Ga0157378_10474056 3300013297 Bacteria 1246
285 Ga0157378_10490338 3300013297 Bacteria 1226
286 Ga0157378_11859649 3300013297 Bacteria 651
287 Ga0157378_13176213 3300013297 Bacteria 510
288 Ga0163162_10157494 3300013306 Bacteria 2392
289 Ga0163162_10317375 3300013306 Bacteria 1691
290 Ga0163162_10912293 3300013306 Bacteria 991
291 Ga0157372_11397127 3300013307 Bacteria 807
292 Ga0157372_11728799 3300013307 Bacteria 720
293 Ga0157372_12194534 3300013307 Bacteria 634
294 Ga0157372_12695434 3300013307 Bacteria 570
295 Ga0157372_13364805 3300013307 Bacteria 509
296 Ga0157375_11141309 3300013308 Bacteria 913
297 Ga0157375_11405038 3300013308 Bacteria 822
298 Ga0157375_11779705 3300013308 Bacteria 730
299 Ga0163163_10050944 3300014325 Bacteria 4080
300 Ga0163163_10110359 3300014325 Bacteria 2779
301 Ga0163163_10709971 3300014325 Bacteria 1069
302 Ga0163163_11132635 3300014325 Bacteria 845
303 Ga0163163_11479394 3300014325 Bacteria 740
304 Ga0157380_10304111 3300014326 Bacteria 1471
305 Ga0157380_10341821 3300014326 Bacteria 1396
306 Ga0157380_10900440 3300014326 Bacteria 911
307 Ga0157380_11071261 3300014326 Bacteria 844
308 Ga0182008_10015863 3300014497 Bacteria 3923
309 Ga0157377_10978391 3300014745 Bacteria 639
310 Ga0157379_10294062 3300014968 Bacteria 1479
311 Ga0157379_10378122 3300014968 Bacteria 1299
312 Ga0157379_10524474 3300014968 Bacteria 1100
313 Ga0157379_11222197 3300014968 Bacteria 723
314 Ga0157379_11447265 3300014968 Bacteria 667
315 Ga0157379_11859297 3300014968 Bacteria 593
316 Ga0157376_10562994 3300014969 Bacteria 1129
317 Ga0157376_11402738 3300014969 Bacteria 730
318 Ga0163161_10224975 3300017792 Bacteria 1454
319 Ga0163161_10635450 3300017792 Bacteria 883
320 Ga0163161_10988827 3300017792 Bacteria 718
321 Ga0197907_10066917 3300020069 Bacteria 745
322 Ga0197907_10138522 3300020069 Bacteria 1308
323 Ga0197907_10234640 3300020069 Bacteria 1077
324 Ga0197907_10258355 3300020069 Bacteria 3502
325 Ga0197907_10620110 3300020069 Bacteria 1696
326 Ga0197907_10658576 3300020069 Bacteria 898
327 Ga0206356_11448412 3300020070 Bacteria 1484
328 Ga0206356_11662501 3300020070 Bacteria 887
329 Ga0206356_11884025 3300020070 Bacteria 1684
330 Ga0206349_1416863 3300020075 Bacteria 1123
331 Ga0206349_1666946 3300020075 Bacteria 1584
332 Ga0206351_10988002 3300020077 Bacteria 775
333 Ga0206352_10352027 3300020078 Bacteria 790
334 Ga0206352_10877631 3300020078 Bacteria 544
335 Ga0206350_10761397 3300020080 Bacteria 1427
336 Ga0206350_10920527 3300020080 Bacteria 1625
337 Ga0206354_11473189 3300020081 Bacteria 655
338 Ga0206354_11626811 3300020081 Bacteria 3146
339 Ga0206353_11486044 3300020082 Bacteria 610
340 Ga0206353_11522619 3300020082 Bacteria 851
341 Ga0206353_11601702 3300020082 Bacteria 811
342 Ga0206353_11684874 3300020082 Bacteria 692
343 Ga0206353_11971528 3300020082 Bacteria 1011
344 Ga0154015_1336961 3300020610 Bacteria 1380
345 Ga0213873_10004180 3300021358 Bacteria 2672
346 Ga0213876_10102352 3300021384 Bacteria 1518
347 Ga0213876_10324749 3300021384 Bacteria 818
348 Ga0213875_10169515 3300021388 Bacteria 1025
349 Ga0213871_10121533 3300021441 Bacteria 779
350 Ga0224712_10019428 3300022467 Bacteria 2291
351 Ga0224712_10028710 3300022467 Bacteria 1991
352 Ga0224712_10227980 3300022467 Bacteria 855
353 Ga0224712_10228245 3300022467 Bacteria 854
354 Ga0224572_1004275 3300024225 Bacteria 2472
355 Ga0207656_10665156 3300025321 Bacteria 533
356 Ga0207653_10000045 3300025885 Bacteria 94691
357 Ga0207682_10267410 3300025893 Bacteria 798
358 Ga0207692_10587399 3300025898 Bacteria 715
359 Ga0207692_10681883 3300025898 Bacteria 666
360 Ga0207642_10068032 3300025899 Bacteria 1683
361 Ga0207642_10219840 3300025899 Bacteria 1061
362 Ga0207642_10608802 3300025899 Bacteria 681
363 Ga0207642_10643848 3300025899 Bacteria 663
364 Ga0207642_10689118 3300025899 Bacteria 643
365 Ga0207642_10743450 3300025899 Bacteria 621
366 Ga0207642_10900498 3300025899 Bacteria 567
367 Ga0207710_10168589 3300025900 Bacteria 1070
368 Ga0207710_10246278 3300025900 Bacteria 893
369 Ga0207680_10114063 3300025903 Bacteria 1758
370 Ga0207680_10904093 3300025903 Bacteria 633
371 Ga0207680_11068818 3300025903 Bacteria 577
372 Ga0207685_10020610 3300025905 Bacteria 2195
373 Ga0207645_10044165 3300025907 Bacteria 2852
374 Ga0207645_10538690 3300025907 Bacteria 791
375 Ga0207643_10116730 3300025908 Bacteria 1577
376 Ga0207684_10016123 3300025910 Bacteria 6419
377 Ga0207684_10017792 3300025910 Bacteria 6096
378 Ga0207684_10211663 3300025910 Bacteria 1672
379 Ga0207684_10492400 3300025910 Bacteria 1051
380 Ga0207684_11021094 3300025910 Bacteria 691
381 Ga0207654_10189935 3300025911 Bacteria 1345
382 Ga0207654_10842662 3300025911 Bacteria 663
383 Ga0207707_10135393 3300025912 Bacteria 2154
384 Ga0207707_10250725 3300025912 Bacteria 1538
385 Ga0207707_10563986 3300025912 Bacteria 966
386 Ga0207693_10009145 3300025915 Bacteria 8089
387 Ga0207660_10430911 3300025917 Bacteria 1065
388 Ga0207660_10719411 3300025917 Bacteria 814
389 Ga0207662_10336092 3300025918 Bacteria 1011
390 Ga0207657_10308237 3300025919 Bacteria 1253
391 Ga0207657_10573879 3300025919 Bacteria 881
392 Ga0207657_10930695 3300025919 Bacteria 669
393 Ga0207652_11664138 3300025921 Bacteria 543
394 Ga0207646_10363971 3300025922 Bacteria 1306
395 Ga0207646_11265922 3300025922 Bacteria 645
396 Ga0207681_10166888 3300025923 Bacteria 1665
397 Ga0207694_10083233 3300025924 Bacteria 2516
398 Ga0207694_10083865 3300025924 Bacteria 2506
399 Ga0207694_10540638 3300025924 Bacteria 977
400 Ga0207694_10880160 3300025924 Bacteria 757
401 Ga0207650_11199540 3300025925 Bacteria 646
402 Ga0207659_10222511 3300025926 Bacteria 1518
403 Ga0207659_10276540 3300025926 Bacteria 1371
404 Ga0207659_10504945 3300025926 Bacteria 1024
405 Ga0207659_10763910 3300025926 Bacteria 830
406 Ga0207687_10004768 3300025927 Bacteria 9019
407 Ga0207687_10052063 3300025927 Bacteria 2856
408 Ga0207687_10075251 3300025927 Bacteria 2423
409 Ga0207687_10078661 3300025927 Bacteria 2375
410 Ga0207687_10354080 3300025927 Bacteria 1197
411 Ga0207687_10491070 3300025927 Bacteria 1024
412 Ga0207687_11282036 3300025927 Bacteria 630
413 Ga0207700_10156599 3300025928 Bacteria 1888
414 Ga0207700_10941816 3300025928 Bacteria 773
415 Ga0207664_10180339 3300025929 Bacteria 1813
416 Ga0207644_10024696 3300025931 Bacteria 4127
417 Ga0207644_10378813 3300025931 Bacteria 1154
418 Ga0207644_10755044 3300025931 Bacteria 813
419 Ga0207644_10906082 3300025931 Bacteria 739
420 Ga0207690_10251186 3300025932 Bacteria 1366
421 Ga0207690_10625782 3300025932 Bacteria 880
422 Ga0207690_11094134 3300025932 Bacteria 664
423 Ga0207706_10352156 3300025933 Bacteria 1280
424 Ga0207686_10034275 3300025934 Bacteria 3038
425 Ga0207686_10077774 3300025934 Bacteria 2155
426 Ga0207686_10169437 3300025934 Bacteria 1538
427 Ga0207686_10602952 3300025934 Bacteria 864
428 Ga0207686_10658265 3300025934 Bacteria 829
429 Ga0207686_10712261 3300025934 Bacteria 799
430 Ga0207709_10041719 3300025935 Bacteria 2756
431 Ga0207709_10063111 3300025935 Bacteria 2321
432 Ga0207709_10096836 3300025935 Bacteria 1942
433 Ga0207709_10185438 3300025935 Bacteria 1473
434 Ga0207709_10333144 3300025935 Bacteria 1140
435 Ga0207709_11224895 3300025935 Bacteria 619
436 Ga0207670_10838529 3300025936 Bacteria 767
437 Ga0207670_11715960 3300025936 Bacteria 534
438 Ga0207669_10181517 3300025937 Bacteria 1509
439 Ga0207669_10197025 3300025937 Bacteria 1459
440 Ga0207669_10265581 3300025937 Bacteria 1286
441 Ga0207669_10287396 3300025937 Bacteria 1243
442 Ga0207704_10060997 3300025938 Bacteria 2336
443 Ga0207704_10209774 3300025938 Bacteria 1432
444 Ga0207704_10748357 3300025938 Bacteria 813
445 Ga0207704_11564044 3300025938 Bacteria 566
446 Ga0207691_11003204 3300025940 Bacteria 697
447 Ga0207711_10121179 3300025941 Bacteria 2335
448 Ga0207689_10042243 3300025942 Bacteria 3772
449 Ga0207689_10159946 3300025942 Bacteria 1856
450 Ga0207689_10193029 3300025942 Bacteria 1680
451 Ga0207689_10512650 3300025942 Bacteria 1005
452 Ga0207689_10624354 3300025942 Bacteria 907
453 Ga0207661_10111867 3300025944 Bacteria 2311
454 Ga0207661_10381523 3300025944 Bacteria 1276
455 Ga0207661_10695409 3300025944 Bacteria 935
456 Ga0207661_11004067 3300025944 Bacteria 769
457 Ga0207679_10326778 3300025945 Bacteria 1330
458 Ga0207679_10596116 3300025945 Bacteria 995
459 Ga0207679_10670452 3300025945 Bacteria 939
460 Ga0207679_10860936 3300025945 Bacteria 828
461 Ga0207651_10219243 3300025960 Bacteria 1537
462 Ga0207651_10315054 3300025960 Bacteria 1306
463 Ga0207651_10962973 3300025960 Bacteria 762
464 Ga0207712_10169521 3300025961 Bacteria 1705
465 Ga0207712_10265400 3300025961 Bacteria 1394
466 Ga0207712_10343007 3300025961 Bacteria 1239
467 Ga0207712_11288300 3300025961 Bacteria 653
468 Ga0207668_10337680 3300025972 Bacteria 1256
469 Ga0207668_10580989 3300025972 Bacteria 974
470 Ga0207640_10060121 3300025981 Bacteria 2510
471 Ga0207640_10367029 3300025981 Bacteria 1162
472 Ga0207640_10752220 3300025981 Bacteria 840
473 Ga0207640_12059043 3300025981 Bacteria 517
474 Ga0207677_10006919 3300026023 Bacteria 6235
475 Ga0207677_10381996 3300026023 Bacteria 1189
476 Ga0207677_11326933 3300026023 Bacteria 661
477 Ga0207703_10031625 3300026035 Bacteria 4186
478 Ga0207703_10063898 3300026035 Bacteria 3019
479 Ga0207639_10877692 3300026041 Bacteria 838
480 Ga0207678_10505220 3300026067 Bacteria 1054
481 Ga0207708_10104624 3300026075 Bacteria 2193
482 Ga0207708_10215765 3300026075 Bacteria 1535
483 Ga0207708_10272688 3300026075 Bacteria 1369
484 Ga0207708_10876864 3300026075 Bacteria 776
485 Ga0207708_11465389 3300026075 Bacteria 599
486 Ga0207708_11655153 3300026075 Bacteria 562
487 Ga0207702_10380229 3300026078 Bacteria 1358
488 Ga0207702_10722817 3300026078 Bacteria 982
489 Ga0207702_12045325 3300026078 Bacteria 563
490 Ga0207641_10271992 3300026088 Bacteria 1590
491 Ga0207641_10283867 3300026088 Bacteria 1558
492 Ga0207648_10004913 3300026089 Bacteria 13614
493 Ga0207648_10066187 3300026089 Bacteria 3151
494 Ga0207648_10213891 3300026089 Bacteria 1712
495 Ga0207648_10563249 3300026089 Bacteria 1048
496 Ga0207648_10927662 3300026089 Bacteria 814
497 Ga0207676_10154279 3300026095 Bacteria 1981
498 Ga0207675_100061154 3300026118 Bacteria 3516
499 Ga0207675_100165622 3300026118 Bacteria 2111
500 Ga0207675_100226152 3300026118 Bacteria 1804
501 Ga0207675_100459885 3300026118 Bacteria 1262
502 Ga0207675_101140219 3300026118 Bacteria 800
503 Ga0207683_10015626 3300026121 Bacteria 6461
504 Ga0207683_10032516 3300026121 Bacteria 4531
505 Ga0207683_10058103 3300026121 Bacteria 3396
506 Ga0207683_11218865 3300026121 Bacteria 697
507 Ga0207698_10328741 3300026142 Bacteria 1435
508 Ga0207698_10475130 3300026142 Bacteria 1211
509 Ga0209966_1022750 3300027695 Bacteria 1228
510 Ga0268266_10653763 3300028379 Bacteria 1012
511 Ga0268266_11759336 3300028379 Bacteria 595
512 Ga0268266_11944939 3300028379 Bacteria 562
513 Ga0268265_10990808 3300028380 Bacteria 830
514 Ga0268265_12342304 3300028380 Bacteria 541
515 Ga0268264_10089199 3300028381 Bacteria 2655
516 Ga0268264_10226672 3300028381 Bacteria 1723
517 Ga0268264_10379671 3300028381 Bacteria 1353
518 Ga0265334_10260162 3300028573 Bacteria 597
519 Ga0265338_10038787 3300028800 Bacteria 4506
520 Ga0265338_10070877 3300028800 Bacteria 2985
521 Ga0265338_10571913 3300028800 Bacteria 789
522 Ga0265338_10785825 3300028800 Bacteria 653
523 Ga0314311_1025355 3300030733 Bacteria 674
524 Ga0316183_1183600 3300030742 Bacteria 804
525 Ga0316181_1287649 3300030744 Bacteria 740
526 Ga0316182_1245851 3300030745 Bacteria 866
527 Ga0265762_1049059 3300030760 Bacteria 843
528 Ga0265762_1074873 3300030760 Bacteria 716
529 Ga0265775_108444 3300030762 Bacteria 627
530 Ga0265777_109454 3300030877 Bacteria 704
531 Ga0265771_1005386 3300031010 Bacteria 812
532 Ga0265760_10017276 3300031090 Bacteria 2072
533 Ga0265332_10294011 3300031238 Bacteria 671
534 Ga0265340_10291174 3300031247 Bacteria 725
535 Ga0265327_10001686 3300031251 Bacteria 26426
536 Ga0265327_10002304 3300031251 Bacteria 20409
537 Ga0265327_10007639 3300031251 Bacteria 8285
538 Ga0265327_10100083 3300031251 Bacteria 1400
539 Ga0265316_10296449 3300031344 Bacteria 1179
540 Ga0265316_10672727 3300031344 Bacteria 731
541 Ga0307408_100340117 3300031548 Bacteria 1270
542 Ga0307408_100518884 3300031548 Bacteria 1046
543 Ga0316576_10326085 3300031727 Bacteria 1145
544 Ga0316578_10049797 3300031728 Bacteria 2449
545 Ga0307413_12058897 3300031824 Bacteria 515
546 Ga0307410_10094631 3300031852 Bacteria 2128
547 Ga0307412_10630648 3300031911 Bacteria 912
548 Ga0307409_100018566 3300031995 Bacteria 4681
549 Ga0307409_100078408 3300031995 Bacteria 2657
550 Ga0307416_101200879 3300032002 Bacteria 864
551 Ga0307416_101484776 3300032002 Bacteria 784
552 Ga0307416_101994034 3300032002 Bacteria 683
553 Ga0307416_102940131 3300032002 Bacteria 570
554 Ga0307414_10027589 3300032004 Bacteria 3672
555 Ga0307411_10229688 3300032005 Bacteria 1445
556 Ga0373930_0001122 3300034816 Bacteria 3897
557 Ga0373948_0001464 3300034817 Bacteria 3283
558 Ga0373959_0116446 3300034820 Bacteria 650
559 Ga0373926_0002170 3300035083 Bacteria 6180
560 Ga0373928_0007240 3300035084 Bacteria 2139
561 Ga0373929_0100420 3300035085 Bacteria 729
562 Ga0373934_0177926 3300035086 Bacteria 874
563 Ga0373934_0380024 3300035086 Bacteria 589
564 Ga0373944_0001156 3300035089 Bacteria 6571
565 Ga0373951_0007578 3300035091 Bacteria 2464
566 Ga0373923_0385662 3300035111 Bacteria 673
567 Ga0373932_0000128 3300035112 Bacteria 21346
568 Ga0373932_0035608 3300035112 Bacteria 1408
569 Ga0373932_0439123 3300035112 Bacteria 511
570 Ga0373936_0009500 3300035113 Bacteria 3666
571 Ga0373939_0261088 3300035114 Bacteria 678
572 Ga0373945_0004843 3300035116 Bacteria 4287
573 Ga0373953_0120121 3300035117 Bacteria 1116
574 Ga0373954_0280577 3300035118 Bacteria 821
575 Ga0373960_0123381 3300035121 Bacteria 862
576 Ga0373943_0011049 3300035170 Bacteria 4055
577 Ga0373943_0142890 3300035170 Bacteria 1291
578 Ga0373943_0460647 3300035170 Bacteria 740
579 Ga0373946_0002234 3300035171 Bacteria 6833
580 Ga0373955_0104717 3300035172 Bacteria 1628
581 Ga0373961_0011680 3300035241 Bacteria 2183
582 Ga0373961_0110361 3300035241 Bacteria 901
583 Ga0373924_0253362 3300035410 Bacteria 779
584 Ga0373931_0000003 3300035691 Bacteria 560286
585 Ga0373931_0000106 3300035691 Bacteria 38061
586 Ga0373931_0304222 3300035691 Bacteria 986
587 Ga0373935_0022388 3300035692 Bacteria 3874
588 Ga0373935_1076332 3300035692 Bacteria 598
589 Ga0373927_0011849 3300035695 Bacteria 5807
590 Ga0373927_0884676 3300035695 Bacteria 590
591 Ga0373933_0089488 3300035724 Bacteria 1898
592 Ga0373947_0002057 3300035725 Bacteria 12270
593 Ga0373947_0733849 3300035725 Bacteria 674
594 Ga0373937_0334807 3300036401 Bacteria 1433
595 Ga0373937_1393493 3300036401 Bacteria 649
596 Ga0372808_047244 3300036459 Bacteria 616
597 Ga0316584_0264961 3300036712 Bacteria 1252
598 Ga0373925_0021904 3300037068 Bacteria 4658
599 Ga0373925_1128285 3300037068 Bacteria 645
600 Ga0395900_0373303 3300037418 Bacteria 1396
601 Ga0395898_0059374 3300037466 Bacteria 3721
602 Ga0436364_0866303 3300037853 Bacteria 1972
603 Ga0436364_1329927 3300037853 Bacteria 2091
604 Ga0436364_1381779 3300037853 Bacteria 1253
605 Ga0395901_0017551 3300038443 Bacteria 7306
606 Ga0395901_0444755 3300038443 Bacteria 1326
607 Ga0436365_0757378 3300039437 Bacteria 1028
608 Ga0436365_0825774 3300039437 Bacteria 4718
609 Ga0436365_1123200 3300039437 Bacteria 3671
610 Ga0436365_1153046 3300039437 Bacteria 553
611 Ga0436365_1306079 3300039437 Bacteria 1195
612 Ga0436365_1432336 3300039437 Bacteria 586
613 Ga0436365_1761886 3300039437 Bacteria 1682
614 Ga0436365_1808656 3300039437 Bacteria 3808
615 Ga0436365_1894830 3300039437 Bacteria 847
616 Ga0436360_0096903 3300039438 Bacteria 3667
617 Ga0436360_0376719 3300039438 Bacteria 984
618 Ga0436360_0496509 3300039438 Bacteria 533
619 Ga0436360_0828962 3300039438 Bacteria 1621
620 Ga0436361_0130315 3300039447 Bacteria 4213
621 Ga0436361_0749762 3300039447 Bacteria 803
622 Ga0436363_0601662 3300039450 Bacteria 620
623 Ga0436363_1014237 3300039450 Bacteria 774
624 Ga0436363_1406155 3300039450 Bacteria 1765
625 Ga0436363_1682249 3300039450 Bacteria 508
626 Ga0436362_0151148 3300039453 Bacteria 8035
627 Ga0436362_0209718 3300039453 Bacteria 2519
628 Ga0436362_0667111 3300039453 Bacteria 592
629 Ga0436362_0750007 3300039453 Bacteria 2971
630 Ga0436362_0953726 3300039453 Bacteria 1453
631 Ga0436362_1076925 3300039453 Bacteria 1202
632 Ga0436362_1116774 3300039453 Bacteria 903
633 Ga0436362_1153288 3300039453 Bacteria 609
634 Ga0439436_0021096 3300041404 Bacteria 1939
635 Ga0439438_143844 3300041405 Bacteria 570
636 Ga0439461_0037616 3300041410 Bacteria 1034
637 Ga0439466_0168151 3300041411 Bacteria 670
638 Ga0451789_0615416 3300041443 Bacteria 565
639 Ga0451802_0378443 3300041460 Bacteria 582
640 Ga0451804_0819133 3300041463 Bacteria 564
641 Ga0451843_0706509 3300041509 Bacteria 529
642 Ga0451855_0509808 3300041511 Bacteria 626
643 Ga0439432_117955 3300042006 Bacteria 787
644 Ga0439450_109521 3300042008 Bacteria 706
645 Ga0439462_0157511 3300042015 Bacteria 640
646 Ga0450906_056126 3300042145 Bacteria 698
647 Ga0439446_0047733 3300042156 Bacteria 1274
648 Ga0439434_0038838 3300042435 Bacteria 1460
649 Ga0451577_0273721 3300042876 Bacteria 1529
650 Ga0466969_0039743 3300044656 Bacteria 2361
651 Ga0466965_0798825 3300044683 Bacteria 546
652 Ga0466966_0022847 3300044684 Bacteria 4099
653 Ga0466966_0270913 3300044684 Bacteria 1021
654 Ga0466961_0042005 3300044693 Bacteria 2932
655 Ga0466961_0388681 3300044693 Bacteria 847
656 Ga0466961_0444558 3300044693 Bacteria 785
657 Ga0466961_0555323 3300044693 Bacteria 691
658 Ga0466963_0112526 3300044694 Bacteria 1869
659 Ga0466963_0163117 3300044694 Bacteria 1552
660 Ga0466963_1235637 3300044694 Bacteria 525
661 Ga0453684_0964314 3300044712 Bacteria 909
662 Ga0466971_0157586 3300044719 Bacteria 1062
663 Ga0466968_0088330 3300044735 Bacteria 1370
664 Ga0466968_0215113 3300044735 Bacteria 904
665 Ga0466957_0139873 3300044842 Bacteria 1559
666 Ga0466957_0605704 3300044842 Bacteria 767
667 Ga0466960_0580737 3300044901 Bacteria 664
668 Ga0466959_0039379 3300045049 Bacteria 3493
669 Ga0466959_0232887 3300045049 Bacteria 1274
670 Ga0466959_0268900 3300045049 Bacteria 1172
671 Ga0466958_0130537 3300045836 Bacteria 1578
672 Ga0466958_0392114 3300045836 Bacteria 896
673 Ga0466967_0919189 3300045976 Bacteria 870
674 Ga0495592_0175635 3300046454 Bacteria 1463
675 Ga0495592_0211815 3300046454 Bacteria 1301
676 Ga0495592_0306989 3300046454 Bacteria 1030
677 Ga0495592_0533700 3300046454 Bacteria 724
678 Ga0495592_0620301 3300046454 Bacteria 658
679 Ga0495603_0098014 3300046455 Bacteria 1712
680 Ga0495603_0174579 3300046455 Bacteria 1244
681 Ga0495603_0181383 3300046455 Bacteria 1218
682 Ga0495603_0256707 3300046455 Bacteria 1006
683 Ga0495603_0306954 3300046455 Bacteria 911
684 Ga0495603_0346216 3300046455 Bacteria 853
685 Ga0495591_114037 3300046458 Bacteria 662
686 Ga0495629_0049329 3300046459 Bacteria 2950
687 Ga0495629_0287369 3300046459 Bacteria 1128
688 Ga0495629_0396659 3300046459 Bacteria 938
689 Ga0495629_0523889 3300046459 Bacteria 797
690 Ga0495629_1116261 3300046459 Bacteria 509
691 Ga0495638_0296999 3300046460 Bacteria 872
692 Ga0495641_0001712 3300046461 Bacteria 18335
693 Ga0495641_0373576 3300046461 Bacteria 646
694 Ga0495641_0523479 3300046461 Bacteria 541
695 Ga0495651_0004813 3300046462 Bacteria 10332
696 Ga0495651_0470299 3300046462 Bacteria 809
697 Ga0495653_0052427 3300046463 Bacteria 3126
698 Ga0495653_0129192 3300046463 Bacteria 1791
699 Ga0495653_0129403 3300046463 Bacteria 1789
700 Ga0495653_0319390 3300046463 Bacteria 1007
701 Ga0495653_0329509 3300046463 Bacteria 987
702 Ga0495653_0477938 3300046463 Bacteria 780
703 Ga0495653_0919635 3300046463 Bacteria 520
704 Ga0495580_0064765 3300046472 Bacteria 2561
705 Ga0495580_0125895 3300046472 Bacteria 1778
706 Ga0495580_0829919 3300046472 Bacteria 598
707 Ga0495582_0064566 3300046473 Bacteria 2021
708 Ga0495582_0130630 3300046473 Bacteria 1419
709 Ga0495582_0242871 3300046473 Bacteria 1032
710 Ga0495582_0437119 3300046473 Bacteria 755
711 Ga0495639_0001433 3300046475 Bacteria 10663
712 Ga0495639_0065791 3300046475 Bacteria 1668
713 Ga0495639_0407039 3300046475 Bacteria 688
714 Ga0495662_0004361 3300046476 Bacteria 7102
715 Ga0495662_0083082 3300046476 Bacteria 1559
716 Ga0495662_0089132 3300046476 Bacteria 1503
717 Ga0495662_0595722 3300046476 Bacteria 541
718 Ga0495664_0223462 3300046477 Bacteria 1140
719 Ga0495664_0303524 3300046477 Bacteria 964
720 Ga0495664_0658153 3300046477 Bacteria 620
721 Ga0495664_0672770 3300046477 Bacteria 613
722 Ga0495584_0071852 3300046491 Bacteria 1739
723 Ga0495584_0101981 3300046491 Bacteria 1451
724 Ga0495585_0295661 3300046492 Bacteria 797
725 Ga0495585_0428036 3300046492 Bacteria 635
726 Ga0495594_0170210 3300046499 Bacteria 1239
727 Ga0495594_0269142 3300046499 Bacteria 971
728 Ga0495594_0519080 3300046499 Bacteria 676
729 Ga0495596_0098321 3300046500 Bacteria 1136
730 Ga0495607_0115970 3300046501 Bacteria 1413
731 Ga0495608_0063614 3300046511 Bacteria 2420
732 Ga0495608_0448939 3300046511 Bacteria 785
733 Ga0495618_0329707 3300046514 Bacteria 944
734 Ga0495618_0457013 3300046514 Bacteria 774
735 Ga0495628_0246680 3300046516 Bacteria 1334
736 Ga0495628_0403711 3300046516 Bacteria 998
737 Ga0495628_0474187 3300046516 Bacteria 906
738 Ga0495628_0550138 3300046516 Bacteria 829
739 Ga0495628_0914114 3300046516 Bacteria 608
740 Ga0495630_0012230 3300046517 Bacteria 6224
741 Ga0495630_0134424 3300046517 Bacteria 1879
742 Ga0495630_0193432 3300046517 Bacteria 1552
743 Ga0495630_0350345 3300046517 Bacteria 1130
744 Ga0495630_0420574 3300046517 Bacteria 1024
745 Ga0495630_0850758 3300046517 Bacteria 695
746 Ga0495631_0211312 3300046518 Bacteria 829
747 Ga0495637_0054933 3300046520 Bacteria 1653
748 Ga0495637_0316467 3300046520 Bacteria 552
749 Ga0495644_0014236 3300046523 Bacteria 3047
750 Ga0495644_0127936 3300046523 Bacteria 968
751 Ga0495663_0005126 3300046525 Bacteria 3654
752 Ga0495663_0029820 3300046525 Bacteria 1613
753 Ga0495663_0268874 3300046525 Bacteria 609
754 Ga0495666_0003428 3300046526 Bacteria 7997
755 Ga0495642_0038020 3300046528 Bacteria 1949
756 Ga0495642_0104889 3300046528 Bacteria 1206
757 Ga0495642_0310884 3300046528 Bacteria 691
758 Ga0495652_0116165 3300046529 Bacteria 2143
759 Ga0495652_0209714 3300046529 Bacteria 1472
760 Ga0495652_0332407 3300046529 Bacteria 1094
761 Ga0495665_0005734 3300046531 Bacteria 6702
762 Ga0495640_0015599 3300046533 Bacteria 5710
763 Ga0495640_0209461 3300046533 Bacteria 1233
764 Ga0495640_0225883 3300046533 Bacteria 1179
765 Ga0495640_0320046 3300046533 Bacteria 961
766 Ga0495586_0015388 3300046535 Bacteria 4070
767 Ga0495586_0043241 3300046535 Bacteria 2427
768 Ga0495586_0093561 3300046535 Bacteria 1662
769 Ga0495586_0334000 3300046535 Bacteria 870
770 Ga0495586_0427597 3300046535 Bacteria 763
771 Ga0495586_0511832 3300046535 Bacteria 693
772 Ga0495586_0524644 3300046535 Bacteria 684
773 Ga0495586_0546978 3300046535 Bacteria 668
774 Ga0495586_0678352 3300046535 Bacteria 595
775 Ga0495587_0041055 3300046536 Bacteria 2761
776 Ga0495587_0119085 3300046536 Bacteria 1513
777 Ga0495587_0449872 3300046536 Bacteria 714
778 Ga0495609_0094319 3300046538 Bacteria 1300
779 Ga0495609_0212526 3300046538 Bacteria 805
780 Ga0495609_0249713 3300046538 Bacteria 731
781 Ga0495621_0001746 3300046539 Bacteria 5708
782 Ga0495621_0166753 3300046539 Bacteria 873
783 Ga0495597_0260280 3300046542 Bacteria 680
784 Ga0495633_0176020 3300046558 Bacteria 985
785 Ga0495667_0002578 3300046559 Bacteria 12112
786 Ga0495667_0294658 3300046559 Bacteria 1028
787 Ga0495656_0007219 3300046615 Bacteria 3922
788 Ga0495656_0121523 3300046615 Bacteria 1233
789 Ga0495656_0265427 3300046615 Bacteria 871
790 Ga0495656_0293476 3300046615 Bacteria 832
791 Ga0495656_0403630 3300046615 Bacteria 715
792 Ga0495668_0860042 3300046616 Bacteria 503
793 Ga0495634_0006384 3300046642 Bacteria 8962
794 Ga0495634_0016753 3300046642 Bacteria 5236
795 Ga0495634_0103357 3300046642 Bacteria 1839
796 Ga0495634_0195702 3300046642 Bacteria 1258
797 Ga0495634_0800061 3300046642 Bacteria 538
798 Ga0495611_0071036 3300046648 Bacteria 1591
799 Ga0495611_0114256 3300046648 Bacteria 1258
800 Ga0495635_0016528 3300046663 Bacteria 5156
801 Ga0495635_0060316 3300046663 Bacteria 2607
802 Ga0495635_0393325 3300046663 Bacteria 921
803 Ga0495659_0024672 3300046664 Bacteria 2052
804 Ga0495661_0418739 3300046665 Bacteria 649
805 Ga0495661_0459535 3300046665 Bacteria 612
806 Ga0495588_0002482 3300046674 Bacteria 7904
807 Ga0495588_0025412 3300046674 Bacteria 2950
808 Ga0495657_0001765 3300046675 Bacteria 18492
809 Ga0495657_0132814 3300046675 Bacteria 1558
810 Ga0495657_0222169 3300046675 Bacteria 1145
811 Ga0495657_0266021 3300046675 Bacteria 1029
812 Ga0495599_0132192 3300046678 Bacteria 1549
813 Ga0495599_0425316 3300046678 Bacteria 789
814 Ga0495599_0593196 3300046678 Bacteria 646
815 Ga0495599_0613017 3300046678 Bacteria 633
816 Ga0495623_0027040 3300046679 Bacteria 3690
817 Ga0495623_0257910 3300046679 Bacteria 978
818 Ga0495647_0000723 3300046681 Bacteria 9761
819 Ga0495647_0292930 3300046681 Bacteria 732
820 Ga0495647_0568150 3300046681 Bacteria 531
821 Ga0495658_0008640 3300046683 Bacteria 5054
822 Ga0495658_0193648 3300046683 Bacteria 1265
823 Ga0495658_0312022 3300046683 Bacteria 996
824 Ga0495669_0074928 3300046684 Bacteria 1548
825 Ga0495669_0577258 3300046684 Bacteria 547
826 Ga0495613_0001106 3300046689 Bacteria 20586
827 Ga0495613_0203568 3300046689 Bacteria 1395
828 Ga0495613_0645102 3300046689 Bacteria 701
829 Ga0495613_0954439 3300046689 Bacteria 553
830 Ga0495613_1036532 3300046689 Bacteria 526
831 Ga0495624_0006221 3300046690 Bacteria 8485
832 Ga0495624_0326939 3300046690 Bacteria 923
833 Ga0495624_0359395 3300046690 Bacteria 876
834 Ga0495670_0031381 3300046691 Bacteria 2640
835 Ga0495670_0052710 3300046691 Bacteria 2037
836 Ga0495670_0077233 3300046691 Bacteria 1693
837 Ga0495670_0825047 3300046691 Bacteria 506
838 Ga0495649_0369232 3300046694 Bacteria 723
839 Ga0495589_0030296 3300046794 Bacteria 2725
840 Ga0495589_0117837 3300046794 Bacteria 1279
841 Ga0495589_0200885 3300046794 Bacteria 941
842 Ga0495589_0271282 3300046794 Bacteria 790
843 Ga0495600_0016031 3300046809 Bacteria 4751
844 Ga0495600_0234419 3300046809 Bacteria 1171
845 Ga0495600_0312840 3300046809 Bacteria 989
846 Ga0495600_0783302 3300046809 Bacteria 569
847 Ga0495581_0036306 3300047315 Bacteria 2851
848 Ga0495604_0512673 3300047317 Bacteria 777
849 Ga0495604_0818509 3300047317 Bacteria 586
850 Ga0495604_0842200 3300047317 Bacteria 576
851 Ga0495636_0445267 3300047318 Bacteria 621
852 Ga0495674_0021479 3300047319 Bacteria 5970
853 Ga0495674_0173897 3300047319 Bacteria 1796
854 Ga0495674_0201212 3300047319 Bacteria 1652
855 Ga0495674_0476998 3300047319 Bacteria 1000
856 Ga0495674_0534482 3300047319 Bacteria 935
857 Ga0495674_0543750 3300047319 Bacteria 925
858 Ga0495674_1152092 3300047319 Bacteria 588
859 Ga0495676_0057213 3300047321 Bacteria 3078
860 Ga0495676_0065217 3300047321 Bacteria 2828
861 Ga0495676_0077090 3300047321 Bacteria 2542
862 Ga0495676_0101835 3300047321 Bacteria 2123
863 Ga0495676_0276125 3300047321 Bacteria 1139
864 Ga0495676_0295326 3300047321 Bacteria 1094
865 Ga0495676_0397929 3300047321 Bacteria 914
866 Ga0495680_0004189 3300047322 Bacteria 13854
867 Ga0495680_0008963 3300047322 Bacteria 9041
868 Ga0495680_0207610 3300047322 Bacteria 1403
869 Ga0495680_0242936 3300047322 Bacteria 1278
870 Ga0495680_0304550 3300047322 Bacteria 1118
871 Ga0495680_1102723 3300047322 Bacteria 501
872 Ga0495683_0260941 3300047323 Bacteria 757
873 Ga0495675_0068857 3300047444 Bacteria 2235
874 Ga0495677_0066988 3300047445 Bacteria 1336
875 Ga0495673_0164950 3300047469 Bacteria 848
876 Ga0495684_0054111 3300047471 Bacteria 3062
877 Ga0495684_0080311 3300047471 Bacteria 2476
878 Ga0495684_0565179 3300047471 Bacteria 772
879 Ga0495684_0605218 3300047471 Bacteria 739
880 Ga0495593_0001673 3300047673 Bacteria 13132
881 Ga0495593_0160764 3300047673 Bacteria 1134
882 Ga0495602_0076237 3300048088 Bacteria 2842
883 Ga0495602_0565901 3300048088 Bacteria 786
884 Ga0495614_0155100 3300048089 Bacteria 1023
885 Ga0495614_0191338 3300048089 Bacteria 923
886 Ga0495614_0340489 3300048089 Bacteria 698
887 Ga0495615_0202840 3300048090 Bacteria 613
888 Ga0496100_0041895 3300048903 Bacteria 2921
889 Ga0496100_0057169 3300048903 Bacteria 2554
890 Ga0496100_0270774 3300048903 Bacteria 1263
891 Ga0496100_0780368 3300048903 Bacteria 748
892 Ga0496100_1486514 3300048903 Bacteria 535
893 Ga0496100_1635770 3300048903 Bacteria 509
894 Ga0496101_0025291 3300048904 Bacteria 4117
895 Ga0496101_0149994 3300048904 Bacteria 1783
896 Ga0496101_0432977 3300048904 Bacteria 1037
897 Ga0496101_0576568 3300048904 Bacteria 890
898 Ga0496101_0714647 3300048904 Bacteria 791
899 Ga0496102_0018527 3300048905 Bacteria 6119
900 Ga0496102_0234599 3300048905 Bacteria 1729
901 Ga0496102_0331214 3300048905 Bacteria 1434
902 Ga0496102_0480328 3300048905 Bacteria 1164
903 Ga0496102_0480795 3300048905 Bacteria 1163
904 Ga0496102_0742734 3300048905 Bacteria 904
905 Ga0496102_1238289 3300048905 Bacteria 666
906 Ga0496103_0102296 3300048906 Bacteria 1814
907 Ga0496103_0229384 3300048906 Bacteria 1194
908 Ga0496103_0250916 3300048906 Bacteria 1139
909 Ga0496103_0705985 3300048906 Bacteria 639
910 Ga0496103_0812326 3300048906 Bacteria 589
911 Ga0496104_0080130 3300048907 Bacteria 3113
912 Ga0496104_0107421 3300048907 Bacteria 2674
913 Ga0496104_0205874 3300048907 Bacteria 1879
914 Ga0496104_0220462 3300048907 Bacteria 1809
915 Ga0496104_0520764 3300048907 Bacteria 1100
916 Ga0496105_0054938 3300048908 Bacteria 3288
917 Ga0496105_0056610 3300048908 Bacteria 3236
918 Ga0496105_0163527 3300048908 Bacteria 1827
919 Ga0496105_0187178 3300048908 Bacteria 1694
920 Ga0496105_0327281 3300048908 Bacteria 1227
921 Ga0496106_0008125 3300048909 Bacteria 7749
922 Ga0496106_0195471 3300048909 Bacteria 1609
923 Ga0496106_0525198 3300048909 Bacteria 950
924 Ga0496106_0774926 3300048909 Bacteria 762
925 Ga0496107_0006741 3300048910 Bacteria 7904
926 Ga0496107_0043569 3300048910 Bacteria 3224
927 Ga0496107_0275344 3300048910 Bacteria 1253
928 Ga0496107_0463841 3300048910 Bacteria 940
929 Ga0496107_0500860 3300048910 Bacteria 901
930 Ga0496108_0016189 3300048911 Bacteria 6081
931 Ga0496108_0023793 3300048911 Bacteria 5040
932 Ga0496108_0034475 3300048911 Bacteria 4206
933 Ga0496108_0060328 3300048911 Bacteria 3192
934 Ga0496108_0079575 3300048911 Bacteria 2775
935 Ga0496108_0593180 3300048911 Bacteria 966
936 Ga0496109_0002583 3300048912 Bacteria 15165
937 Ga0496109_0004660 3300048912 Bacteria 11447
938 Ga0496109_0004877 3300048912 Bacteria 11204
939 Ga0496109_0026262 3300048912 Bacteria 5193
940 Ga0496109_0184417 3300048912 Bacteria 1961
941 Ga0496109_0234895 3300048912 Bacteria 1725
942 Ga0496109_0602136 3300048912 Bacteria 1035
943 Ga0496109_0624980 3300048912 Bacteria 1014
944 Ga0496109_0627537 3300048912 Bacteria 1011
945 Ga0496109_0675396 3300048912 Bacteria 970
946 Ga0496109_1326514 3300048912 Bacteria 655
947 Ga0496109_1809704 3300048912 Bacteria 544
948 Ga0496110_0004643 3300048913 Bacteria 10677
949 Ga0496110_0027911 3300048913 Bacteria 4842
950 Ga0496110_0089463 3300048913 Bacteria 2752
951 Ga0496110_0091123 3300048913 Bacteria 2727
952 Ga0496110_0170208 3300048913 Bacteria 1976
953 Ga0496110_0961526 3300048913 Bacteria 761
954 Ga0496110_1161634 3300048913 Bacteria 681
955 Ga0496110_1829298 3300048913 Bacteria 517
956 Ga0496111_0010628 3300048914 Bacteria 6186
957 Ga0496111_0027483 3300048914 Bacteria 4025
958 Ga0496111_0032586 3300048914 Bacteria 3715
959 Ga0496111_0078099 3300048914 Bacteria 2414
960 Ga0496111_0874062 3300048914 Bacteria 648
961 Ga0496112_0002114 3300048915 Bacteria 15764
962 Ga0496112_0003519 3300048915 Bacteria 12986
963 Ga0496112_0013302 3300048915 Bacteria 7598
964 Ga0496112_0049244 3300048915 Bacteria 4130
965 Ga0496112_0291808 3300048915 Bacteria 1577
966 Ga0496112_0427348 3300048915 Bacteria 1263
967 Ga0496112_1286805 3300048915 Bacteria 647
968 Ga0496113_0077648 3300048916 Bacteria 2539
969 Ga0496113_0149600 3300048916 Bacteria 1841
970 Ga0496113_0153627 3300048916 Bacteria 1817
971 Ga0496113_0273407 3300048916 Bacteria 1350
972 Ga0496113_0306589 3300048916 Bacteria 1272
973 Ga0496113_0410932 3300048916 Bacteria 1087
974 Ga0496113_0478416 3300048916 Bacteria 1000
975 Ga0496113_1610159 3300048916 Bacteria 500
976 Ga0496114_0004194 3300048917 Bacteria 11164
977 Ga0496114_0012594 3300048917 Bacteria 6775
978 Ga0496114_0066061 3300048917 Bacteria 3032
979 Ga0496114_0100423 3300048917 Bacteria 2469
980 Ga0496114_0187946 3300048917 Bacteria 1806
981 Ga0496114_0220275 3300048917 Bacteria 1666
982 Ga0496114_0508810 3300048917 Bacteria 1065
983 Ga0496114_0936756 3300048917 Bacteria 748
984 Ga0496114_1518317 3300048917 Bacteria 558
985 Ga0496115_0069392 3300048918 Bacteria 2855
986 Ga0496115_0298175 3300048918 Bacteria 1321
987 Ga0496115_0315454 3300048918 Bacteria 1280
988 Ga0496115_0479967 3300048918 Bacteria 1001
989 Ga0496115_0694149 3300048918 Bacteria 801
990 Ga0496115_0995662 3300048918 Bacteria 641
991 Ga0496119_0286724 3300048922 Bacteria 817
992 Ga0496119_0540121 3300048922 Bacteria 537
993 Ga0501307_056665 3300049162 Bacteria 600
994 Ga0501311_053539 3300049527 Bacteria 638
995 Ga0501031_0214433 3300049568 Bacteria 1254
996 Ga0501031_0721495 3300049568 Bacteria 640
997 Ga0501033_0000586 3300049570 Bacteria 33688
998 Ga0501033_0501159 3300049570 Bacteria 840
999 Ga0501034_0009423 3300049571 Bacteria 10220
1000 Ga0501036_0045609 3300049572 Bacteria 3713
1001 Ga0501036_0056989 3300049572 Bacteria 3310
1002 Ga0501036_0194170 3300049572 Bacteria 1708
1003 Ga0501036_0243147 3300049572 Bacteria 1509
1004 Ga0501036_0459935 3300049572 Bacteria 1060
1005 Ga0501036_0475806 3300049572 Bacteria 1040
1006 Ga0501036_0959563 3300049572 Bacteria 701
1007 Ga0501038_0105410 3300049574 Bacteria 2342
1008 Ga0501038_0159909 3300049574 Bacteria 1831
1009 Ga0501038_1371529 3300049574 Bacteria 509
1010 Ga0501039_0114246 3300049575 Bacteria 2112
1011 Ga0501039_1331379 3300049575 Bacteria 554
1012 Ga0501040_0013186 3300049576 Bacteria 5437
1013 Ga0501040_0469841 3300049576 Bacteria 906
1014 Ga0501040_0534645 3300049576 Bacteria 846
1015 Ga0501040_0646003 3300049576 Bacteria 765
1016 Ga0501040_0751493 3300049576 Bacteria 705
1017 Ga0501040_1010240 3300049576 Bacteria 603
1018 Ga0501041_0039470 3300049577 Bacteria 2865
1019 Ga0501042_0147634 3300049578 Bacteria 1695
1020 Ga0501042_0334483 3300049578 Bacteria 1095
1021 Ga0501042_0555026 3300049578 Bacteria 835
1022 Ga0501042_0799643 3300049578 Bacteria 686
1023 Ga0501046_0454593 3300049580 Bacteria 921
1024 Ga0501047_0390651 3300049581 Bacteria 1225
1025 Ga0501048_0009882 3300049582 Bacteria 7153
1026 Ga0501048_0998142 3300049582 Bacteria 602
1027 Ga0501048_1179221 3300049582 Bacteria 551
1028 Ga0501067_0561673 3300049583 Bacteria 639
1029 Ga0501068_0263687 3300049584 Bacteria 1099
1030 Ga0501068_0639683 3300049584 Bacteria 694
1031 Ga0501069_0102362 3300049585 Bacteria 1626
1032 Ga0501069_0118008 3300049585 Bacteria 1514
1033 Ga0501070_0871175 3300049586 Bacteria 704
1034 Ga0501071_0130118 3300049587 Bacteria 1869
1035 Ga0501071_1105905 3300049587 Bacteria 612
1036 Ga0501072_0004460 3300049588 Bacteria 10637
1037 Ga0501072_0125602 3300049588 Bacteria 2044
1038 Ga0501072_0421551 3300049588 Bacteria 1058
1039 Ga0501072_0541374 3300049588 Bacteria 920
1040 Ga0501072_1571552 3300049588 Bacteria 507
1041 Ga0501073_0034729 3300049589 Bacteria 3587
1042 Ga0501073_1085202 3300049589 Bacteria 550
1043 Ga0501074_0091842 3300049590 Bacteria 2174
1044 Ga0501074_0468695 3300049590 Bacteria 893
1045 Ga0501074_1052978 3300049590 Bacteria 572
1046 Ga0501075_0073190 3300049591 Bacteria 2591
1047 Ga0501075_0194521 3300049591 Bacteria 1547
1048 Ga0501075_0334097 3300049591 Bacteria 1155
1049 Ga0501075_1016701 3300049591 Bacteria 630
1050 Ga0501076_0029561 3300049592 Bacteria 4262
1051 Ga0501076_0274419 3300049592 Bacteria 1381
1052 Ga0501076_0444788 3300049592 Bacteria 1067
1053 Ga0501076_0583041 3300049592 Bacteria 922
1054 Ga0501076_0965988 3300049592 Bacteria 702
1055 Ga0501076_1241924 3300049592 Bacteria 613
1056 Ga0501077_0040119 3300049593 Bacteria 2983
1057 Ga0501077_0058942 3300049593 Bacteria 2437
1058 Ga0501077_0388293 3300049593 Bacteria 892
1059 Ga0501077_0915839 3300049593 Bacteria 564
1060 Ga0501079_0027551 3300049741 Bacteria 4358
1061 Ga0501080_0278615 3300049742 Bacteria 1521
1062 Ga0501080_0338523 3300049742 Bacteria 1360
1063 Ga0501080_1882703 3300049742 Bacteria 501
1064 Ga0501081_0018885 3300049743 Bacteria 4581
1065 Ga0501081_0331403 3300049743 Bacteria 1120
1066 Ga0501081_0459930 3300049743 Bacteria 946
1067 Ga0501081_0655760 3300049743 Bacteria 787
1068 Ga0501083_0944640 3300049744 Bacteria 561
1069 Ga0501035_0543018 3300049822 Bacteria 953
1070 Ga0501035_0715118 3300049822 Bacteria 807
1071 Ga0501044_0003799 3300049823 Bacteria 16954
1072 Ga0501045_0020878 3300049824 Bacteria 4682
1073 Ga0501045_0184575 3300049824 Bacteria 1554
1074 Ga0501045_0384405 3300049824 Bacteria 1045
1075 Ga0501045_0867072 3300049824 Bacteria 664
1076 nmdc:mga03n38_30805_c1 3300050490 Bacteria 2259
1077 nmdc:mga03n38_445852_c1 3300050490 Bacteria 719
1078 nmdc:mga00v17_15891_c1 3300050491 Bacteria 4235
1079 nmdc:mga0yw44_1060720_c1 3300050492 Bacteria 548
1080 nmdc:mga0yw44_138029_c1 3300050492 Bacteria 1583
1081 nmdc:mga0yw44_15898_c1 3300050492 Bacteria 4048
1082 nmdc:mga0yw44_175904_c1 3300050492 Bacteria 1407
1083 nmdc:mga0yw44_611903_c1 3300050492 Bacteria 740
1084 nmdc:mga0k408_305633_c1 3300050493 Bacteria 539
1085 nmdc:mga06z11_174222_c1 3300050494 Bacteria 1237
1086 nmdc:mga06z11_40797_c1 3300050494 Bacteria 2319
1087 nmdc:mga06z11_84327_c1 3300050494 Bacteria 1712
1088 nmdc:mga07m45_100310_c1 3300050496 Bacteria 1662
1089 nmdc:mga05p37_10502_c1 3300050507 Bacteria 10983
1090 nmdc:mga05p37_1223129_c1 3300050507 Bacteria 774
1091 nmdc:mga05p37_242254_c1 3300050507 Bacteria 2167
1092 nmdc:mga05p37_330960_c1 3300050507 Bacteria 1799
1093 nmdc:mga05p37_81637_c1 3300050507 Bacteria 3982
1094 nmdc:mga09592_258024_c1 3300050508 Bacteria 1511
1095 nmdc:mga0qj67_49532_c1 3300050509 Bacteria 3320
1096 nmdc:mga08y16_1539241_c1 3300050511 Bacteria 624
1097 nmdc:mga08y16_209788_c1 3300050511 Bacteria 2017
1098 nmdc:mga0n895_1217359_c1 3300050512 Bacteria 726
1099 nmdc:mga0n895_266406_c1 3300050512 Bacteria 1738
1100 nmdc:mga0n895_271050_c1 3300050512 Bacteria 1722
1101 nmdc:mga0n895_37338_c1 3300050512 Bacteria 4699
1102 nmdc:mga0rr50_1357325_c1 3300050513 Bacteria 602
1103 nmdc:mga0rr50_294370_c1 3300050513 Bacteria 1357
1104 nmdc:mga0rr50_643440_c1 3300050513 Bacteria 905
1105 nmdc:mga08x19_506806_c1 3300050514 Bacteria 852
1106 nmdc:mga08x19_79672_c1 3300050514 Bacteria 2148
1107 nmdc:mga0a205_1011_c1 3300050515 Bacteria 23356
1108 nmdc:mga0sz30_37512_c1 3300050516 Bacteria 2028
1109 Ga0495601_0147738 3300053077 Bacteria 1534
1110 Ga0495601_0161174 3300053077 Bacteria 1466
1111 Ga0495601_0287279 3300053077 Bacteria 1072
1112 Ga0495601_0333152 3300053077 Bacteria 988
1113 Ga0495601_0377352 3300053077 Bacteria 920
1114 Ga0495601_0790304 3300053077 Bacteria 603
1115 Ga0495601_0935447 3300053077 Bacteria 547
1116 Ga0495612_0580716 3300053078 Bacteria 517
1117 Ga0495655_0022559 3300053083 Bacteria 1440
1118 Ga0495655_0044071 3300053083 Bacteria 1153
1119 Ga0495655_0103579 3300053083 Bacteria 846
1120 Ga0495595_0064354 3300053084 Bacteria 1723
1121 Ga0495595_0094688 3300053084 Bacteria 1436
1122 Ga0495595_0127575 3300053084 Bacteria 1242
1123 Ga0495595_0133979 3300053084 Bacteria 1213
1124 Ga0495619_0030323 3300053085 Bacteria 3500
1125 Ga0495619_0049221 3300053085 Bacteria 2779
1126 Ga0495619_0057521 3300053085 Bacteria 2580
1127 Ga0495619_0120735 3300053085 Bacteria 1797
1128 Ga0495619_0138483 3300053085 Bacteria 1675
1129 Ga0495619_0241086 3300053085 Bacteria 1253
1130 Ga0495619_0307443 3300053085 Bacteria 1098
1131 Ga0495619_1153412 3300053085 Bacteria 514
1132 Ga0500646_0084380 3300053090 Bacteria 974
1133 Ga0500646_0108258 3300053090 Bacteria 881
1134 Ga0500566_0000391 3300053094 Bacteria 24277
1135 Ga0500641_0007941 3300053096 Bacteria 3784
1136 Ga0500577_0488842 3300053142 Bacteria 538
1137 Ga0500616_0000816 3300053153 Bacteria 35390
1138 Ga0500616_0003439 3300053153 Bacteria 12093
1139 Ga0500616_0141118 3300053153 Bacteria 1126
1140 Ga0500616_0168022 3300053153 Bacteria 999
1141 Ga0500620_200098 3300053155 Bacteria 682
1142 Ga0501084_0000241 3300054114 Bacteria 41258
1143 Ga0501084_0017951 3300054114 Bacteria 5892
1144 Ga0501084_0605061 3300054114 Bacteria 926
1145 Ga0501084_0907842 3300054114 Bacteria 741
1146 Ga0501084_1314946 3300054114 Bacteria 606
1147 Ga0590075_081463 3300059424 Bacteria 839
1148 Ga0587073_0108672 3300059492 Bacteria 732
1149 Ga0587090_127763 3300059510 Bacteria 557
1150 Ga0587117_080537 3300059627 Bacteria 592
1151 Ga0587128_059009 3300059630 Bacteria 720
1152 Ga0587128_095601 3300059630 Bacteria 616
1153 Ga0587072_020414 3300059643 Bacteria 1167
1154 Ga0587079_161957 3300059647 Bacteria 586
1155 Ga0501082_0024808 3300060353 Bacteria 5168
1156 Ga0501082_0610613 3300060353 Bacteria 954
1157 Ga0501082_0671005 3300060353 Bacteria 907
1158 Ga0501082_0974926 3300060353 Bacteria 741
1159 Ga0501082_1436838 3300060353 Bacteria 602
1160 Ga0501082_1527490 3300060353 Bacteria 583
1161 Ga0501082_1933548 3300060353 Bacteria 514
1162 Ga0466962_0404773 3300061719 Bacteria 683
1163 Ga0530510_0031838 3300061734 Bacteria 3792
1164 Ga0530510_0304989 3300061734 Bacteria 1192
1165 Ga0530510_0499378 3300061734 Bacteria 922

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10485627 Ga0065707_104856271 119
2 3300039453 Ga0436362_1116774 Ga0436362_1116774_278_679 120
3 3300046535 Ga0495586_0524644 Ga0495586_0524644_62_460 120
4 3300046473 Ga0495582_0437119 Ga0495582_0437119_89_481 123
5 3300020080 Ga0206350_10920527 Ga0206350_109205273 127
6 3300014326 Ga0157380_10304111 Ga0157380_103041111 128
7 3300048912 Ga0496109_0602136 Ga0496109_0602136_503_895 128
8 3300005353 Ga0070669_101456492 Ga0070669_1014564921 129
9 3300025961 Ga0207712_11288300 Ga0207712_112883002 129
10 3300026075 Ga0207708_11465389 Ga0207708_114653892 129
11 3300030877 Ga0265777_109454 Ga0265777_1094542 129
12 3300031090 Ga0265760_10017276 Ga0265760_100172764 129
13 3300044712 Ga0453684_0964314 Ga0453684_0964314_502_894 129
14 3300046516 Ga0495628_0914114 Ga0495628_0914114_49_444 129
15 3300002073 JGI24745J21846_1001877 JGI24745J21846_10018775 130
16 3300004799 Ga0058863_11918246 Ga0058863_119182461 130
17 3300004799 Ga0058863_11957316 Ga0058863_119573163 130
18 3300005290 Ga0065712_10113701 Ga0065712_101137012 130
19 3300005293 Ga0065715_10063152 Ga0065715_100631522 130
20 3300005329 Ga0070683_100363808 Ga0070683_1003638082 130
21 3300005329 Ga0070683_101340454 Ga0070683_1013404542 130
22 3300005330 Ga0070690_100048896 Ga0070690_1000488964 130
23 3300005330 Ga0070690_100334046 Ga0070690_1003340461 130
24 3300005330 Ga0070690_101584607 Ga0070690_1015846071 130
25 3300005331 Ga0070670_100751242 Ga0070670_1007512422 130
26 3300005331 Ga0070670_101121483 Ga0070670_1011214832 130
27 3300005334 Ga0068869_102125525 Ga0068869_1021255251 130
28 3300005335 Ga0070666_10781288 Ga0070666_107812882 130
29 3300005336 Ga0070680_100373398 Ga0070680_1003733982 130
30 3300005336 Ga0070680_101020262 Ga0070680_1010202622 130
31 3300005338 Ga0068868_100151741 Ga0068868_1001517414 130
32 3300005338 Ga0068868_100403634 Ga0068868_1004036341 130
33 3300005339 Ga0070660_100123948 Ga0070660_1001239484 130
34 3300005339 Ga0070660_100261615 Ga0070660_1002616152 130
35 3300005339 Ga0070660_100593135 Ga0070660_1005931352 130
36 3300005339 Ga0070660_101068235 Ga0070660_1010682351 130
37 3300005340 Ga0070689_100804299 Ga0070689_1008042991 130
38 3300005341 Ga0070691_10023408 Ga0070691_100234085 130
39 3300005341 Ga0070691_10189233 Ga0070691_101892332 130
40 3300005341 Ga0070691_10717507 Ga0070691_107175071 130
41 3300005343 Ga0070687_100356924 Ga0070687_1003569241 130
42 3300005344 Ga0070661_100778634 Ga0070661_1007786342 130
43 3300005344 Ga0070661_101452217 Ga0070661_1014522171 130
44 3300005345 Ga0070692_10225988 Ga0070692_102259882 130
45 3300005345 Ga0070692_10527502 Ga0070692_105275022 130
46 3300005347 Ga0070668_100254737 Ga0070668_1002547372 130
47 3300005347 Ga0070668_100793922 Ga0070668_1007939221 130
48 3300005353 Ga0070669_100078134 Ga0070669_1000781343 130
49 3300005353 Ga0070669_101298822 Ga0070669_1012988221 130
50 3300005354 Ga0070675_100041662 Ga0070675_1000416622 130
51 3300005354 Ga0070675_100418939 Ga0070675_1004189393 130
52 3300005354 Ga0070675_101189689 Ga0070675_1011896892 130
53 3300005354 Ga0070675_101392756 Ga0070675_1013927561 130
54 3300005355 Ga0070671_101524059 Ga0070671_1015240591 130
55 3300005356 Ga0070674_100026741 Ga0070674_1000267415 130
56 3300005356 Ga0070674_100064122 Ga0070674_1000641224 130
57 3300005356 Ga0070674_100125926 Ga0070674_1001259262 130
58 3300005356 Ga0070674_100160059 Ga0070674_1001600591 130
59 3300005364 Ga0070673_100177821 Ga0070673_1001778213 130
60 3300005364 Ga0070673_100439083 Ga0070673_1004390831 130
61 3300005364 Ga0070673_100664790 Ga0070673_1006647902 130
62 3300005365 Ga0070688_100946637 Ga0070688_1009466372 130
63 3300005365 Ga0070688_101109780 Ga0070688_1011097802 130
64 3300005366 Ga0070659_100345404 Ga0070659_1003454043 130
65 3300005366 Ga0070659_100560527 Ga0070659_1005605272 130
66 3300005367 Ga0070667_100349742 Ga0070667_1003497423 130
67 3300005367 Ga0070667_100656317 Ga0070667_1006563172 130
68 3300005406 Ga0070703_10006895 Ga0070703_100068955 130
69 3300005435 Ga0070714_100542434 Ga0070714_1005424342 130
70 3300005436 Ga0070713_100234062 Ga0070713_1002340623 130
71 3300005436 Ga0070713_101081728 Ga0070713_1010817282 130
72 3300005436 Ga0070713_101976119 Ga0070713_1019761191 130
73 3300005436 Ga0070713_102267855 Ga0070713_1022678551 130
74 3300005437 Ga0070710_11149834 Ga0070710_111498341 130
75 3300005438 Ga0070701_10004277 Ga0070701_100042774 130
76 3300005438 Ga0070701_10284544 Ga0070701_102845441 130
77 3300005438 Ga0070701_10576572 Ga0070701_105765721 130
78 3300005439 Ga0070711_100048282 Ga0070711_1000482824 130
79 3300005440 Ga0070705_100008111 Ga0070705_1000081111 130
80 3300005440 Ga0070705_100045233 Ga0070705_1000452334 130
81 3300005440 Ga0070705_100061337 Ga0070705_1000613374 130
82 3300005440 Ga0070705_100114960 Ga0070705_1001149602 130
83 3300005440 Ga0070705_101007065 Ga0070705_1010070652 130
84 3300005440 Ga0070705_101662880 Ga0070705_1016628801 130
85 3300005441 Ga0070700_100013216 Ga0070700_1000132166 130
86 3300005441 Ga0070700_100622564 Ga0070700_1006225642 130
87 3300005444 Ga0070694_100285083 Ga0070694_1002850832 130
88 3300005444 Ga0070694_100317209 Ga0070694_1003172092 130
89 3300005445 Ga0070708_100002882 Ga0070708_1000028829 130
90 3300005445 Ga0070708_100014721 Ga0070708_1000147217 130
91 3300005445 Ga0070708_100051650 Ga0070708_1000516503 130
92 3300005445 Ga0070708_100114650 Ga0070708_1001146503 130
93 3300005445 Ga0070708_100175853 Ga0070708_1001758532 130
94 3300005445 Ga0070708_101667802 Ga0070708_1016678021 130
95 3300005456 Ga0070678_100055745 Ga0070678_1000557454 130
96 3300005456 Ga0070678_100070399 Ga0070678_1000703991 130
97 3300005456 Ga0070678_100484892 Ga0070678_1004848922 130
98 3300005456 Ga0070678_100667602 Ga0070678_1006676022 130
99 3300005456 Ga0070678_100738527 Ga0070678_1007385272 130
100 3300005456 Ga0070678_101498867 Ga0070678_1014988671 130
101 3300005457 Ga0070662_101119680 Ga0070662_1011196801 130
102 3300005458 Ga0070681_10162793 Ga0070681_101627933 130
103 3300005458 Ga0070681_10302860 Ga0070681_103028603 130
104 3300005458 Ga0070681_10551492 Ga0070681_105514922 130
105 3300005458 Ga0070681_10622920 Ga0070681_106229202 130
106 3300005458 Ga0070681_11597320 Ga0070681_115973202 130
107 3300005459 Ga0068867_100034170 Ga0068867_1000341704 130
108 3300005459 Ga0068867_100043147 Ga0068867_1000431475 130
109 3300005459 Ga0068867_100065006 Ga0068867_1000650064 130
110 3300005459 Ga0068867_100316760 Ga0068867_1003167601 130
111 3300005459 Ga0068867_100491185 Ga0068867_1004911851 130
112 3300005467 Ga0070706_100012452 Ga0070706_1000124524 130
113 3300005467 Ga0070706_100229885 Ga0070706_1002298853 130
114 3300005467 Ga0070706_100830639 Ga0070706_1008306392 130
115 3300005468 Ga0070707_100086130 Ga0070707_1000861304 130
116 3300005471 Ga0070698_100007643 Ga0070698_1000076436 130
117 3300005471 Ga0070698_101171535 Ga0070698_1011715352 130
118 3300005518 Ga0070699_100715826 Ga0070699_1007158262 130
119 3300005518 Ga0070699_100864895 Ga0070699_1008648952 130
120 3300005535 Ga0070684_101005174 Ga0070684_1010051741 130
121 3300005536 Ga0070697_100586951 Ga0070697_1005869512 130
122 3300005536 Ga0070697_100686513 Ga0070697_1006865131 130
123 3300005543 Ga0070672_100285086 Ga0070672_1002850864 130
124 3300005543 Ga0070672_100362166 Ga0070672_1003621662 130
125 3300005544 Ga0070686_100043668 Ga0070686_1000436682 130
126 3300005544 Ga0070686_100638962 Ga0070686_1006389621 130
127 3300005544 Ga0070686_101293685 Ga0070686_1012936851 130
128 3300005545 Ga0070695_100004664 Ga0070695_1000046645 130
129 3300005545 Ga0070695_100384825 Ga0070695_1003848252 130
130 3300005545 Ga0070695_100915954 Ga0070695_1009159541 130
131 3300005546 Ga0070696_100005392 Ga0070696_1000053923 130
132 3300005546 Ga0070696_100034118 Ga0070696_1000341184 130
133 3300005546 Ga0070696_100072784 Ga0070696_1000727844 130
134 3300005546 Ga0070696_101507314 Ga0070696_1015073142 130
135 3300005547 Ga0070693_100136617 Ga0070693_1001366172 130
136 3300005547 Ga0070693_100726481 Ga0070693_1007264811 130
137 3300005548 Ga0070665_100494877 Ga0070665_1004948772 130
138 3300005548 Ga0070665_100898040 Ga0070665_1008980402 130
139 3300005548 Ga0070665_101499362 Ga0070665_1014993622 130
140 3300005549 Ga0070704_100190204 Ga0070704_1001902041 130
141 3300005549 Ga0070704_100199142 Ga0070704_1001991422 130
142 3300005549 Ga0070704_100272886 Ga0070704_1002728862 130
143 3300005549 Ga0070704_100287871 Ga0070704_1002878713 130
144 3300005549 Ga0070704_100312409 Ga0070704_1003124092 130
145 3300005549 Ga0070704_100466094 Ga0070704_1004660942 130
146 3300005549 Ga0070704_101696730 Ga0070704_1016967301 130
147 3300005563 Ga0068855_100535872 Ga0068855_1005358722 130
148 3300005564 Ga0070664_100178694 Ga0070664_1001786942 130
149 3300005564 Ga0070664_100411456 Ga0070664_1004114563 130
150 3300005564 Ga0070664_100625012 Ga0070664_1006250122 130
151 3300005564 Ga0070664_100936687 Ga0070664_1009366872 130
152 3300005578 Ga0068854_100914679 Ga0068854_1009146792 130
153 3300005578 Ga0068854_100938550 Ga0068854_1009385501 130
154 3300005614 Ga0068856_100316577 Ga0068856_1003165772 130
155 3300005614 Ga0068856_101090923 Ga0068856_1010909232 130
156 3300005614 Ga0068856_102303174 Ga0068856_1023031741 130
157 3300005615 Ga0070702_100070055 Ga0070702_1000700551 130
158 3300005615 Ga0070702_100203069 Ga0070702_1002030692 130
159 3300005615 Ga0070702_100267871 Ga0070702_1002678713 130
160 3300005615 Ga0070702_100273695 Ga0070702_1002736952 130
161 3300005616 Ga0068852_100063116 Ga0068852_1000631162 130
162 3300005616 Ga0068852_102255945 Ga0068852_1022559451 130
163 3300005617 Ga0068859_100265412 Ga0068859_1002654122 130
164 3300005617 Ga0068859_102896517 Ga0068859_1028965171 130
165 3300005618 Ga0068864_100024465 Ga0068864_1000244652 130
166 3300005618 Ga0068864_100551791 Ga0068864_1005517912 130
167 3300005718 Ga0068866_10165170 Ga0068866_101651702 130
168 3300005719 Ga0068861_100269045 Ga0068861_1002690452 130
169 3300005719 Ga0068861_100383439 Ga0068861_1003834393 130
170 3300005719 Ga0068861_101190162 Ga0068861_1011901622 130
171 3300005719 Ga0068861_101196440 Ga0068861_1011964402 130
172 3300005719 Ga0068861_101233368 Ga0068861_1012333682 130
173 3300005834 Ga0068851_10768583 Ga0068851_107685831 130
174 3300005840 Ga0068870_10169134 Ga0068870_101691343 130
175 3300005841 Ga0068863_100163339 Ga0068863_1001633393 130
176 3300005841 Ga0068863_100425701 Ga0068863_1004257012 130
177 3300005842 Ga0068858_100230507 Ga0068858_1002305073 130
178 3300005842 Ga0068858_100660742 Ga0068858_1006607422 130
179 3300005843 Ga0068860_100190707 Ga0068860_1001907072 130
180 3300005843 Ga0068860_100354464 Ga0068860_1003544642 130
181 3300005843 Ga0068860_100451668 Ga0068860_1004516682 130
182 3300005843 Ga0068860_100527037 Ga0068860_1005270372 130
183 3300005844 Ga0068862_101266403 Ga0068862_1012664031 130
184 3300005844 Ga0068862_102533836 Ga0068862_1025338361 130
185 3300005937 Ga0081455_10166672 Ga0081455_101666722 130
186 3300005985 Ga0081539_10008891 Ga0081539_1000889118 130
187 3300005985 Ga0081539_10011391 Ga0081539_100113918 130
188 3300006038 Ga0075365_10128755 Ga0075365_101287553 130
189 3300006038 Ga0075365_10436419 Ga0075365_104364192 130
190 3300006038 Ga0075365_10438268 Ga0075365_104382682 130
191 3300006038 Ga0075365_10782487 Ga0075365_107824872 130
192 3300006048 Ga0075363_100037884 Ga0075363_1000378845 130
193 3300006051 Ga0075364_10123739 Ga0075364_101237394 130
194 3300006051 Ga0075364_10421099 Ga0075364_104210992 130
195 3300006175 Ga0070712_100332471 Ga0070712_1003324712 130
196 3300006175 Ga0070712_100589458 Ga0070712_1005894582 130
197 3300006175 Ga0070712_100837696 Ga0070712_1008376961 130
198 3300006178 Ga0075367_10044620 Ga0075367_100446203 130
199 3300006178 Ga0075367_10220586 Ga0075367_102205862 130
200 3300006237 Ga0097621_100214381 Ga0097621_1002143815 130
201 3300006353 Ga0075370_10352225 Ga0075370_103522252 130
202 3300006358 Ga0068871_100450337 Ga0068871_1004503371 130
203 3300006358 Ga0068871_102431149 Ga0068871_1024311492 130
204 3300006844 Ga0075428_100000238 Ga0075428_10000023824 130
205 3300006844 Ga0075428_102135036 Ga0075428_1021350362 130
206 3300006846 Ga0075430_100029304 Ga0075430_1000293046 130
207 3300006846 Ga0075430_100368645 Ga0075430_1003686452 130
208 3300006846 Ga0075430_100691089 Ga0075430_1006910892 130
209 3300006852 Ga0075433_10433733 Ga0075433_104337334 130
210 3300006852 Ga0075433_11892593 Ga0075433_118925931 130
211 3300006871 Ga0075434_100004540 Ga0075434_10000454011 130
212 3300006871 Ga0075434_100283026 Ga0075434_1002830264 130
213 3300006871 Ga0075434_100534892 Ga0075434_1005348922 130
214 3300006871 Ga0075434_101926987 Ga0075434_1019269871 130
215 3300006881 Ga0068865_100170866 Ga0068865_1001708661 130
216 3300006881 Ga0068865_100292548 Ga0068865_1002925482 130
217 3300006881 Ga0068865_101007708 Ga0068865_1010077082 130
218 3300006914 Ga0075436_100441394 Ga0075436_1004413942 130
219 3300006931 Ga0097620_100265432 Ga0097620_1002654324 130
220 3300006931 Ga0097620_102896492 Ga0097620_1028964921 130
221 3300007076 Ga0075435_100304394 Ga0075435_1003043942 130
222 3300007076 Ga0075435_100436464 Ga0075435_1004364644 130
223 3300007076 Ga0075435_100735764 Ga0075435_1007357641 130
224 3300007076 Ga0075435_101449258 Ga0075435_1014492581 130
225 3300009011 Ga0105251_10150715 Ga0105251_101507152 130
226 3300009011 Ga0105251_10156309 Ga0105251_101563092 130
227 3300009093 Ga0105240_11571517 Ga0105240_115715172 130
228 3300009093 Ga0105240_11595821 Ga0105240_115958212 130
229 3300009093 Ga0105240_12017406 Ga0105240_120174062 130
230 3300009094 Ga0111539_11173410 Ga0111539_111734101 130
231 3300009098 Ga0105245_10010831 Ga0105245_100108316 130
232 3300009098 Ga0105245_10107113 Ga0105245_101071132 130
233 3300009098 Ga0105245_10182636 Ga0105245_101826361 130
234 3300009098 Ga0105245_10395950 Ga0105245_103959502 130
235 3300009098 Ga0105245_10614923 Ga0105245_106149233 130
236 3300009098 Ga0105245_10711509 Ga0105245_107115092 130
237 3300009098 Ga0105245_12587692 Ga0105245_125876921 130
238 3300009101 Ga0105247_10048269 Ga0105247_100482694 130
239 3300009101 Ga0105247_10157730 Ga0105247_101577302 130
240 3300009101 Ga0105247_10787307 Ga0105247_107873071 130
241 3300009101 Ga0105247_11124999 Ga0105247_111249991 130
242 3300009147 Ga0114129_10013928 Ga0114129_100139289 130
243 3300009147 Ga0114129_10095509 Ga0114129_100955096 130
244 3300009147 Ga0114129_10306806 Ga0114129_103068061 130
245 3300009147 Ga0114129_11533637 Ga0114129_115336371 130
246 3300009147 Ga0114129_12077752 Ga0114129_120777521 130
247 3300009148 Ga0105243_10010219 Ga0105243_100102196 130
248 3300009148 Ga0105243_10117905 Ga0105243_101179051 130
249 3300009148 Ga0105243_10184492 Ga0105243_101844923 130
250 3300009148 Ga0105243_10381517 Ga0105243_103815172 130
251 3300009148 Ga0105243_10517779 Ga0105243_105177791 130
252 3300009148 Ga0105243_11100438 Ga0105243_111004382 130
253 3300009148 Ga0105243_11136870 Ga0105243_111368702 130
254 3300009174 Ga0105241_11183774 Ga0105241_111837742 130
255 3300009176 Ga0105242_10014288 Ga0105242_100142884 130
256 3300009176 Ga0105242_10048621 Ga0105242_100486214 130
257 3300009176 Ga0105242_10141150 Ga0105242_101411505 130
258 3300009176 Ga0105242_10162792 Ga0105242_101627923 130
259 3300009176 Ga0105242_11035059 Ga0105242_110350591 130
260 3300009176 Ga0105242_11425123 Ga0105242_114251231 130
261 3300009176 Ga0105242_12932557 Ga0105242_129325571 130
262 3300009177 Ga0105248_10029357 Ga0105248_100293572 130
263 3300009177 Ga0105248_11251043 Ga0105248_112510432 130
264 3300009177 Ga0105248_11410131 Ga0105248_114101312 130
265 3300009177 Ga0105248_11961100 Ga0105248_119611001 130
266 3300009551 Ga0105238_10151244 Ga0105238_101512442 130
267 3300009551 Ga0105238_10189405 Ga0105238_101894052 130
268 3300009551 Ga0105238_10252118 Ga0105238_102521183 130
269 3300009551 Ga0105238_10766213 Ga0105238_107662132 130
270 3300009551 Ga0105238_11066666 Ga0105238_110666662 130
271 3300009551 Ga0105238_11231728 Ga0105238_112317281 130
272 3300009551 Ga0105238_11302686 Ga0105238_113026861 130
273 3300009553 Ga0105249_10180331 Ga0105249_101803311 130
274 3300009553 Ga0105249_10474493 Ga0105249_104744932 130
275 3300009553 Ga0105249_10839747 Ga0105249_108397472 130
276 3300009553 Ga0105249_11076305 Ga0105249_110763052 130
277 3300010375 Ga0105239_10102797 Ga0105239_101027972 130
278 3300010375 Ga0105239_10109180 Ga0105239_101091802 130
279 3300010375 Ga0105239_10882087 Ga0105239_108820872 130
280 3300010375 Ga0105239_13580572 Ga0105239_135805721 130
281 3300011119 Ga0105246_10460966 Ga0105246_104609661 130
282 3300012494 Ga0157341_1010957 Ga0157341_10109572 130
283 3300012494 Ga0157341_1014538 Ga0157341_10145381 130
284 3300013044 Ga0154019_138530 Ga0154019_1385301 130
285 3300013102 Ga0157371_10413641 Ga0157371_104136412 130
286 3300013104 Ga0157370_10993703 Ga0157370_109937032 130
287 3300013105 Ga0157369_10404394 Ga0157369_104043943 130
288 3300013296 Ga0157374_10128946 Ga0157374_101289463 130
289 3300013296 Ga0157374_11419756 Ga0157374_114197561 130
290 3300013296 Ga0157374_12567545 Ga0157374_125675451 130
291 3300013297 Ga0157378_10011509 Ga0157378_100115092 130
292 3300013297 Ga0157378_10114709 Ga0157378_101147093 130
293 3300013297 Ga0157378_10200215 Ga0157378_102002153 130
294 3300013297 Ga0157378_10245590 Ga0157378_102455902 130
295 3300013297 Ga0157378_10291057 Ga0157378_102910572 130
296 3300013297 Ga0157378_10474056 Ga0157378_104740562 130
297 3300013297 Ga0157378_10490338 Ga0157378_104903384 130
298 3300013297 Ga0157378_11859649 Ga0157378_118596492 130
299 3300013297 Ga0157378_13176213 Ga0157378_131762131 130
300 3300013306 Ga0163162_10157494 Ga0163162_101574942 130
301 3300013306 Ga0163162_10317375 Ga0163162_103173752 130
302 3300013306 Ga0163162_10912293 Ga0163162_109122931 130
303 3300013307 Ga0157372_11397127 Ga0157372_113971271 130
304 3300013307 Ga0157372_11728799 Ga0157372_117287991 130
305 3300013307 Ga0157372_12194534 Ga0157372_121945342 130
306 3300013307 Ga0157372_12695434 Ga0157372_126954341 130
307 3300013307 Ga0157372_13364805 Ga0157372_133648051 130
308 3300013308 Ga0157375_11141309 Ga0157375_111413092 130
309 3300013308 Ga0157375_11405038 Ga0157375_114050382 130
310 3300013308 Ga0157375_11779705 Ga0157375_117797052 130
311 3300014325 Ga0163163_10050944 Ga0163163_100509442 130
312 3300014325 Ga0163163_10110359 Ga0163163_101103594 130
313 3300014325 Ga0163163_10709971 Ga0163163_107099711 130
314 3300014325 Ga0163163_11132635 Ga0163163_111326351 130
315 3300014325 Ga0163163_11479394 Ga0163163_114793942 130
316 3300014326 Ga0157380_10341821 Ga0157380_103418212 130
317 3300014326 Ga0157380_10900440 Ga0157380_109004402 130
318 3300014326 Ga0157380_11071261 Ga0157380_110712612 130
319 3300014497 Ga0182008_10015863 Ga0182008_100158635 130
320 3300014745 Ga0157377_10978391 Ga0157377_109783912 130
321 3300014968 Ga0157379_10294062 Ga0157379_102940624 130
322 3300014968 Ga0157379_10378122 Ga0157379_103781222 130
323 3300014968 Ga0157379_10524474 Ga0157379_105244742 130
324 3300014968 Ga0157379_11222197 Ga0157379_112221972 130
325 3300014968 Ga0157379_11447265 Ga0157379_114472652 130
326 3300014968 Ga0157379_11859297 Ga0157379_118592972 130
327 3300014969 Ga0157376_10562994 Ga0157376_105629942 130
328 3300014969 Ga0157376_11402738 Ga0157376_114027381 130
329 3300017792 Ga0163161_10224975 Ga0163161_102249753 130
330 3300017792 Ga0163161_10635450 Ga0163161_106354501 130
331 3300017792 Ga0163161_10988827 Ga0163161_109888272 130
332 3300020069 Ga0197907_10066917 Ga0197907_100669172 130
333 3300020069 Ga0197907_10138522 Ga0197907_101385223 130
334 3300020069 Ga0197907_10234640 Ga0197907_102346402 130
335 3300020069 Ga0197907_10258355 Ga0197907_102583556 130
336 3300020069 Ga0197907_10620110 Ga0197907_106201104 130
337 3300020069 Ga0197907_10658576 Ga0197907_106585761 130
338 3300020070 Ga0206356_11448412 Ga0206356_114484123 130
339 3300020070 Ga0206356_11662501 Ga0206356_116625012 130
340 3300020070 Ga0206356_11884025 Ga0206356_118840253 130
341 3300020075 Ga0206349_1416863 Ga0206349_14168632 130
342 3300020075 Ga0206349_1666946 Ga0206349_16669462 130
343 3300020077 Ga0206351_10988002 Ga0206351_109880022 130
344 3300020078 Ga0206352_10352027 Ga0206352_103520272 130
345 3300020078 Ga0206352_10877631 Ga0206352_108776311 130
346 3300020080 Ga0206350_10761397 Ga0206350_107613973 130
347 3300020081 Ga0206354_11473189 Ga0206354_114731891 130
348 3300020081 Ga0206354_11626811 Ga0206354_116268115 130
349 3300020082 Ga0206353_11486044 Ga0206353_114860441 130
350 3300020082 Ga0206353_11522619 Ga0206353_115226192 130
351 3300020082 Ga0206353_11601702 Ga0206353_116017022 130
352 3300020082 Ga0206353_11684874 Ga0206353_116848742 130
353 3300020082 Ga0206353_11971528 Ga0206353_119715283 130
354 3300020610 Ga0154015_1336961 Ga0154015_13369612 130
355 3300021358 Ga0213873_10004180 Ga0213873_100041804 130
356 3300021384 Ga0213876_10102352 Ga0213876_101023524 130
357 3300021384 Ga0213876_10324749 Ga0213876_103247492 130
358 3300021388 Ga0213875_10169515 Ga0213875_101695151 130
359 3300021441 Ga0213871_10121533 Ga0213871_101215332 130
360 3300022467 Ga0224712_10019428 Ga0224712_100194283 130
361 3300022467 Ga0224712_10028710 Ga0224712_100287104 130
362 3300022467 Ga0224712_10227980 Ga0224712_102279802 130
363 3300022467 Ga0224712_10228245 Ga0224712_102282452 130
364 3300024225 Ga0224572_1004275 Ga0224572_10042753 130
365 3300025321 Ga0207656_10665156 Ga0207656_106651561 130
366 3300025885 Ga0207653_10000045 Ga0207653_1000004518 130
367 3300025893 Ga0207682_10267410 Ga0207682_102674102 130
368 3300025898 Ga0207692_10587399 Ga0207692_105873992 130
369 3300025898 Ga0207692_10681883 Ga0207692_106818831 130
370 3300025899 Ga0207642_10068032 Ga0207642_100680322 130
371 3300025899 Ga0207642_10219840 Ga0207642_102198402 130
372 3300025899 Ga0207642_10608802 Ga0207642_106088022 130
373 3300025899 Ga0207642_10643848 Ga0207642_106438482 130
374 3300025899 Ga0207642_10689118 Ga0207642_106891182 130
375 3300025899 Ga0207642_10743450 Ga0207642_107434502 130
376 3300025899 Ga0207642_10900498 Ga0207642_109004981 130
377 3300025900 Ga0207710_10168589 Ga0207710_101685893 130
378 3300025900 Ga0207710_10246278 Ga0207710_102462782 130
379 3300025903 Ga0207680_10114063 Ga0207680_101140633 130
380 3300025903 Ga0207680_10904093 Ga0207680_109040931 130
381 3300025903 Ga0207680_11068818 Ga0207680_110688181 130
382 3300025905 Ga0207685_10020610 Ga0207685_100206103 130
383 3300025907 Ga0207645_10044165 Ga0207645_100441654 130
384 3300025907 Ga0207645_10538690 Ga0207645_105386902 130
385 3300025908 Ga0207643_10116730 Ga0207643_101167302 130
386 3300025910 Ga0207684_10016123 Ga0207684_100161234 130
387 3300025910 Ga0207684_10017792 Ga0207684_100177927 130
388 3300025910 Ga0207684_10211663 Ga0207684_102116632 130
389 3300025910 Ga0207684_10492400 Ga0207684_104924001 130
390 3300025910 Ga0207684_11021094 Ga0207684_110210941 130
391 3300025911 Ga0207654_10189935 Ga0207654_101899352 130
392 3300025911 Ga0207654_10842662 Ga0207654_108426622 130
393 3300025912 Ga0207707_10135393 Ga0207707_101353933 130
394 3300025912 Ga0207707_10250725 Ga0207707_102507252 130
395 3300025912 Ga0207707_10563986 Ga0207707_105639861 130
396 3300025915 Ga0207693_10009145 Ga0207693_100091457 130
397 3300025917 Ga0207660_10430911 Ga0207660_104309112 130
398 3300025917 Ga0207660_10719411 Ga0207660_107194112 130
399 3300025918 Ga0207662_10336092 Ga0207662_103360922 130
400 3300025919 Ga0207657_10308237 Ga0207657_103082373 130
401 3300025919 Ga0207657_10573879 Ga0207657_105738791 130
402 3300025919 Ga0207657_10930695 Ga0207657_109306952 130
403 3300025921 Ga0207652_11664138 Ga0207652_116641382 130
404 3300025922 Ga0207646_10363971 Ga0207646_103639712 130
405 3300025922 Ga0207646_11265922 Ga0207646_112659221 130
406 3300025923 Ga0207681_10166888 Ga0207681_101668882 130
407 3300025924 Ga0207694_10083233 Ga0207694_100832335 130
408 3300025924 Ga0207694_10083865 Ga0207694_100838652 130
409 3300025924 Ga0207694_10540638 Ga0207694_105406382 130
410 3300025924 Ga0207694_10880160 Ga0207694_108801602 130
411 3300025925 Ga0207650_11199540 Ga0207650_111995401 130
412 3300025926 Ga0207659_10222511 Ga0207659_102225112 130
413 3300025926 Ga0207659_10276540 Ga0207659_102765401 130
414 3300025926 Ga0207659_10504945 Ga0207659_105049452 130
415 3300025926 Ga0207659_10763910 Ga0207659_107639102 130
416 3300025927 Ga0207687_10004768 Ga0207687_100047688 130
417 3300025927 Ga0207687_10052063 Ga0207687_100520632 130
418 3300025927 Ga0207687_10075251 Ga0207687_100752515 130
419 3300025927 Ga0207687_10078661 Ga0207687_100786612 130
420 3300025927 Ga0207687_10354080 Ga0207687_103540802 130
421 3300025927 Ga0207687_10491070 Ga0207687_104910701 130
422 3300025927 Ga0207687_11282036 Ga0207687_112820362 130
423 3300025928 Ga0207700_10156599 Ga0207700_101565992 130
424 3300025928 Ga0207700_10941816 Ga0207700_109418162 130
425 3300025929 Ga0207664_10180339 Ga0207664_101803392 130
426 3300025931 Ga0207644_10024696 Ga0207644_100246962 130
427 3300025931 Ga0207644_10378813 Ga0207644_103788133 130
428 3300025931 Ga0207644_10755044 Ga0207644_107550442 130
429 3300025931 Ga0207644_10906082 Ga0207644_109060821 130
430 3300025932 Ga0207690_10251186 Ga0207690_102511862 130
431 3300025932 Ga0207690_10625782 Ga0207690_106257822 130
432 3300025932 Ga0207690_11094134 Ga0207690_110941342 130
433 3300025933 Ga0207706_10352156 Ga0207706_103521562 130
434 3300025934 Ga0207686_10034275 Ga0207686_100342754 130
435 3300025934 Ga0207686_10077774 Ga0207686_100777742 130
436 3300025934 Ga0207686_10169437 Ga0207686_101694373 130
437 3300025934 Ga0207686_10602952 Ga0207686_106029522 130
438 3300025934 Ga0207686_10658265 Ga0207686_106582652 130
439 3300025934 Ga0207686_10712261 Ga0207686_107122612 130
440 3300025935 Ga0207709_10041719 Ga0207709_100417194 130
441 3300025935 Ga0207709_10063111 Ga0207709_100631114 130
442 3300025935 Ga0207709_10096836 Ga0207709_100968362 130
443 3300025935 Ga0207709_10185438 Ga0207709_101854382 130
444 3300025935 Ga0207709_10333144 Ga0207709_103331441 130
445 3300025935 Ga0207709_11224895 Ga0207709_112248952 130
446 3300025936 Ga0207670_10838529 Ga0207670_108385292 130
447 3300025936 Ga0207670_11715960 Ga0207670_117159601 130
448 3300025937 Ga0207669_10181517 Ga0207669_101815171 130
449 3300025937 Ga0207669_10197025 Ga0207669_101970252 130
450 3300025937 Ga0207669_10265581 Ga0207669_102655813 130
451 3300025937 Ga0207669_10287396 Ga0207669_102873962 130
452 3300025938 Ga0207704_10060997 Ga0207704_100609972 130
453 3300025938 Ga0207704_10209774 Ga0207704_102097742 130
454 3300025938 Ga0207704_10748357 Ga0207704_107483572 130
455 3300025938 Ga0207704_11564044 Ga0207704_115640441 130
456 3300025940 Ga0207691_11003204 Ga0207691_110032041 130
457 3300025941 Ga0207711_10121179 Ga0207711_101211794 130
458 3300025942 Ga0207689_10042243 Ga0207689_100422434 130
459 3300025942 Ga0207689_10159946 Ga0207689_101599463 130
460 3300025942 Ga0207689_10193029 Ga0207689_101930292 130
461 3300025942 Ga0207689_10512650 Ga0207689_105126502 130
462 3300025942 Ga0207689_10624354 Ga0207689_106243542 130
463 3300025944 Ga0207661_10111867 Ga0207661_101118673 130
464 3300025944 Ga0207661_10381523 Ga0207661_103815232 130
465 3300025944 Ga0207661_10695409 Ga0207661_106954092 130
466 3300025944 Ga0207661_11004067 Ga0207661_110040672 130
467 3300025945 Ga0207679_10326778 Ga0207679_103267783 130
468 3300025945 Ga0207679_10596116 Ga0207679_105961162 130
469 3300025945 Ga0207679_10670452 Ga0207679_106704521 130
470 3300025945 Ga0207679_10860936 Ga0207679_108609362 130
471 3300025960 Ga0207651_10219243 Ga0207651_102192432 130
472 3300025960 Ga0207651_10315054 Ga0207651_103150542 130
473 3300025960 Ga0207651_10962973 Ga0207651_109629731 130
474 3300025961 Ga0207712_10169521 Ga0207712_101695212 130
475 3300025961 Ga0207712_10265400 Ga0207712_102654003 130
476 3300025961 Ga0207712_10343007 Ga0207712_103430072 130
477 3300025972 Ga0207668_10337680 Ga0207668_103376802 130
478 3300025972 Ga0207668_10580989 Ga0207668_105809892 130
479 3300025981 Ga0207640_10060121 Ga0207640_100601212 130
480 3300025981 Ga0207640_10367029 Ga0207640_103670292 130
481 3300025981 Ga0207640_10752220 Ga0207640_107522202 130
482 3300025981 Ga0207640_12059043 Ga0207640_120590431 130
483 3300026023 Ga0207677_10006919 Ga0207677_100069192 130
484 3300026023 Ga0207677_10381996 Ga0207677_103819961 130
485 3300026023 Ga0207677_11326933 Ga0207677_113269332 130
486 3300026035 Ga0207703_10031625 Ga0207703_100316255 130
487 3300026035 Ga0207703_10063898 Ga0207703_100638985 130
488 3300026041 Ga0207639_10877692 Ga0207639_108776922 130
489 3300026067 Ga0207678_10505220 Ga0207678_105052202 130
490 3300026075 Ga0207708_10104624 Ga0207708_101046242 130
491 3300026075 Ga0207708_10215765 Ga0207708_102157652 130
492 3300026075 Ga0207708_10272688 Ga0207708_102726884 130
493 3300026075 Ga0207708_10876864 Ga0207708_108768642 130
494 3300026075 Ga0207708_11655153 Ga0207708_116551532 130
495 3300026078 Ga0207702_10380229 Ga0207702_103802292 130
496 3300026078 Ga0207702_10722817 Ga0207702_107228172 130
497 3300026078 Ga0207702_12045325 Ga0207702_120453251 130
498 3300026088 Ga0207641_10271992 Ga0207641_102719922 130
499 3300026088 Ga0207641_10283867 Ga0207641_102838672 130
500 3300026089 Ga0207648_10004913 Ga0207648_100049137 130
501 3300026089 Ga0207648_10066187 Ga0207648_100661875 130
502 3300026089 Ga0207648_10213891 Ga0207648_102138912 130
503 3300026089 Ga0207648_10563249 Ga0207648_105632492 130
504 3300026089 Ga0207648_10927662 Ga0207648_109276622 130
505 3300026095 Ga0207676_10154279 Ga0207676_101542794 130
506 3300026118 Ga0207675_100061154 Ga0207675_1000611542 130
507 3300026118 Ga0207675_100165622 Ga0207675_1001656221 130
508 3300026118 Ga0207675_100226152 Ga0207675_1002261523 130
509 3300026118 Ga0207675_100459885 Ga0207675_1004598852 130
510 3300026118 Ga0207675_101140219 Ga0207675_1011402192 130
511 3300026121 Ga0207683_10015626 Ga0207683_100156265 130
512 3300026121 Ga0207683_10032516 Ga0207683_100325166 130
513 3300026121 Ga0207683_10058103 Ga0207683_100581036 130
514 3300026121 Ga0207683_11218865 Ga0207683_112188651 130
515 3300026142 Ga0207698_10328741 Ga0207698_103287413 130
516 3300026142 Ga0207698_10475130 Ga0207698_104751302 130
517 3300027695 Ga0209966_1022750 Ga0209966_10227502 130
518 3300028379 Ga0268266_10653763 Ga0268266_106537632 130
519 3300028379 Ga0268266_11759336 Ga0268266_117593362 130
520 3300028379 Ga0268266_11944939 Ga0268266_119449392 130
521 3300028380 Ga0268265_10990808 Ga0268265_109908082 130
522 3300028380 Ga0268265_12342304 Ga0268265_123423042 130
523 3300028381 Ga0268264_10089199 Ga0268264_100891994 130
524 3300028381 Ga0268264_10226672 Ga0268264_102266723 130
525 3300028381 Ga0268264_10379671 Ga0268264_103796712 130
526 3300028573 Ga0265334_10260162 Ga0265334_102601621 130
527 3300028800 Ga0265338_10038787 Ga0265338_100387876 130
528 3300028800 Ga0265338_10070877 Ga0265338_100708773 130
529 3300028800 Ga0265338_10571913 Ga0265338_105719132 130
530 3300028800 Ga0265338_10785825 Ga0265338_107858252 130
531 3300030733 Ga0314311_1025355 Ga0314311_10253552 130
532 3300030742 Ga0316183_1183600 Ga0316183_11836001 130
533 3300030744 Ga0316181_1287649 Ga0316181_12876492 130
534 3300030745 Ga0316182_1245851 Ga0316182_12458511 130
535 3300030760 Ga0265762_1049059 Ga0265762_10490591 130
536 3300030760 Ga0265762_1074873 Ga0265762_10748731 130
537 3300030762 Ga0265775_108444 Ga0265775_1084442 130
538 3300031010 Ga0265771_1005386 Ga0265771_10053862 130
539 3300031238 Ga0265332_10294011 Ga0265332_102940113 130
540 3300031247 Ga0265340_10291174 Ga0265340_102911741 130
541 3300031251 Ga0265327_10001686 Ga0265327_1000168627 130
542 3300031251 Ga0265327_10002304 Ga0265327_1000230412 130
543 3300031251 Ga0265327_10007639 Ga0265327_100076398 130
544 3300031251 Ga0265327_10100083 Ga0265327_101000832 130
545 3300031344 Ga0265316_10296449 Ga0265316_102964492 130
546 3300031344 Ga0265316_10672727 Ga0265316_106727271 130
547 3300031548 Ga0307408_100340117 Ga0307408_1003401172 130
548 3300031548 Ga0307408_100518884 Ga0307408_1005188842 130
549 3300031727 Ga0316576_10326085 Ga0316576_103260852 130
550 3300031728 Ga0316578_10049797 Ga0316578_100497973 130
551 3300031824 Ga0307413_12058897 Ga0307413_120588971 130
552 3300031852 Ga0307410_10094631 Ga0307410_100946312 130
553 3300031911 Ga0307412_10630648 Ga0307412_106306482 130
554 3300031995 Ga0307409_100018566 Ga0307409_1000185667 130
555 3300031995 Ga0307409_100078408 Ga0307409_1000784083 130
556 3300032002 Ga0307416_101200879 Ga0307416_1012008792 130
557 3300032002 Ga0307416_101484776 Ga0307416_1014847762 130
558 3300032002 Ga0307416_101994034 Ga0307416_1019940342 130
559 3300032002 Ga0307416_102940131 Ga0307416_1029401312 130
560 3300032004 Ga0307414_10027589 Ga0307414_100275893 130
561 3300032005 Ga0307411_10229688 Ga0307411_102296882 130
562 3300034816 Ga0373930_0001122 Ga0373930_0001122_2137_2535 130
563 3300034817 Ga0373948_0001464 Ga0373948_0001464_858_1256 130
564 3300034820 Ga0373959_0116446 Ga0373959_0116446_200_598 130
565 3300035083 Ga0373926_0002170 Ga0373926_0002170_4638_5030 130
566 3300035084 Ga0373928_0007240 Ga0373928_0007240_544_942 130
567 3300035085 Ga0373929_0100420 Ga0373929_0100420_92_490 130
568 3300035086 Ga0373934_0177926 Ga0373934_0177926_122_520 130
569 3300035086 Ga0373934_0380024 Ga0373934_0380024_108_500 130
570 3300035089 Ga0373944_0001156 Ga0373944_0001156_1102_1494 130
571 3300035091 Ga0373951_0007578 Ga0373951_0007578_454_852 130
572 3300035111 Ga0373923_0385662 Ga0373923_0385662_110_508 130
573 3300035112 Ga0373932_0000128 Ga0373932_0000128_17044_17442 130
574 3300035112 Ga0373932_0035608 Ga0373932_0035608_313_711 130
575 3300035112 Ga0373932_0439123 Ga0373932_0439123_28_420 130
576 3300035113 Ga0373936_0009500 Ga0373936_0009500_1214_1606 130
577 3300035114 Ga0373939_0261088 Ga0373939_0261088_155_553 130
578 3300035116 Ga0373945_0004843 Ga0373945_0004843_2685_3077 130
579 3300035117 Ga0373953_0120121 Ga0373953_0120121_702_1100 130
580 3300035118 Ga0373954_0280577 Ga0373954_0280577_333_731 130
581 3300035121 Ga0373960_0123381 Ga0373960_0123381_168_566 130
582 3300035170 Ga0373943_0011049 Ga0373943_0011049_1934_2326 130
583 3300035170 Ga0373943_0142890 Ga0373943_0142890_745_1143 130
584 3300035170 Ga0373943_0460647 Ga0373943_0460647_226_624 130
585 3300035171 Ga0373946_0002234 Ga0373946_0002234_5219_5611 130
586 3300035172 Ga0373955_0104717 Ga0373955_0104717_574_972 130
587 3300035241 Ga0373961_0011680 Ga0373961_0011680_906_1304 130
588 3300035241 Ga0373961_0110361 Ga0373961_0110361_31_429 130
589 3300035410 Ga0373924_0253362 Ga0373924_0253362_339_731 130
590 3300035691 Ga0373931_0000003 Ga0373931_0000003_380756_381154 130
591 3300035691 Ga0373931_0000106 Ga0373931_0000106_16214_16612 130
592 3300035691 Ga0373931_0304222 Ga0373931_0304222_260_658 130
593 3300035692 Ga0373935_0022388 Ga0373935_0022388_2831_3223 130
594 3300035692 Ga0373935_1076332 Ga0373935_1076332_81_479 130
595 3300035695 Ga0373927_0011849 Ga0373927_0011849_417_809 130
596 3300035695 Ga0373927_0884676 Ga0373927_0884676_92_490 130
597 3300035724 Ga0373933_0089488 Ga0373933_0089488_1461_1859 130
598 3300035725 Ga0373947_0002057 Ga0373947_0002057_6321_6713 130
599 3300035725 Ga0373947_0733849 Ga0373947_0733849_215_613 130
600 3300036401 Ga0373937_0334807 Ga0373937_0334807_704_1102 130
601 3300036401 Ga0373937_1393493 Ga0373937_1393493_88_486 130
602 3300036459 Ga0372808_047244 Ga0372808_047244_106_507 130
603 3300036712 Ga0316584_0264961 Ga0316584_0264961_610_1008 130
604 3300037068 Ga0373925_0021904 Ga0373925_0021904_3689_4081 130
605 3300037068 Ga0373925_1128285 Ga0373925_1128285_81_479 130
606 3300037418 Ga0395900_0373303 Ga0395900_0373303_157_555 130
607 3300037466 Ga0395898_0059374 Ga0395898_0059374_1549_1956 130
608 3300037853 Ga0436364_0866303 Ga0436364_0866303_20_418 130
609 3300037853 Ga0436364_1329927 Ga0436364_1329927_1113_1511 130
610 3300037853 Ga0436364_1381779 Ga0436364_1381779_28_432 130
611 3300038443 Ga0395901_0017551 Ga0395901_0017551_2135_2542 130
612 3300038443 Ga0395901_0444755 Ga0395901_0444755_490_882 130
613 3300039437 Ga0436365_0757378 Ga0436365_0757378_421_819 130
614 3300039437 Ga0436365_0825774 Ga0436365_0825774_234_632 130
615 3300039437 Ga0436365_1123200 Ga0436365_1123200_2291_2689 130
616 3300039437 Ga0436365_1153046 Ga0436365_1153046_141_539 130
617 3300039437 Ga0436365_1306079 Ga0436365_1306079_469_867 130
618 3300039437 Ga0436365_1432336 Ga0436365_1432336_19_417 130
619 3300039437 Ga0436365_1761886 Ga0436365_1761886_1065_1463 130
620 3300039437 Ga0436365_1808656 Ga0436365_1808656_2802_3200 130
621 3300039437 Ga0436365_1894830 Ga0436365_1894830_254_652 130
622 3300039438 Ga0436360_0096903 Ga0436360_0096903_3109_3507 130
623 3300039438 Ga0436360_0376719 Ga0436360_0376719_359_760 130
624 3300039438 Ga0436360_0496509 Ga0436360_0496509_73_474 130
625 3300039438 Ga0436360_0828962 Ga0436360_0828962_1181_1588 130
626 3300039447 Ga0436361_0130315 Ga0436361_0130315_896_1294 130
627 3300039447 Ga0436361_0749762 Ga0436361_0749762_217_618 130
628 3300039450 Ga0436363_0601662 Ga0436363_0601662_190_588 130
629 3300039450 Ga0436363_1014237 Ga0436363_1014237_244_651 130
630 3300039450 Ga0436363_1406155 Ga0436363_1406155_312_710 130
631 3300039450 Ga0436363_1682249 Ga0436363_1682249_10_408 130
632 3300039453 Ga0436362_0151148 Ga0436362_0151148_6807_7205 130
633 3300039453 Ga0436362_0209718 Ga0436362_0209718_1618_2016 130
634 3300039453 Ga0436362_0667111 Ga0436362_0667111_162_560 130
635 3300039453 Ga0436362_0750007 Ga0436362_0750007_842_1240 130
636 3300039453 Ga0436362_0953726 Ga0436362_0953726_137_535 130
637 3300039453 Ga0436362_1076925 Ga0436362_1076925_444_851 130
638 3300039453 Ga0436362_1153288 Ga0436362_1153288_148_546 130
639 3300041404 Ga0439436_0021096 Ga0439436_0021096_943_1341 130
640 3300041405 Ga0439438_143844 Ga0439438_143844_68_466 130
641 3300041410 Ga0439461_0037616 Ga0439461_0037616_604_1002 130
642 3300041411 Ga0439466_0168151 Ga0439466_0168151_190_582 130
643 3300041443 Ga0451789_0615416 Ga0451789_0615416_53_451 130
644 3300041460 Ga0451802_0378443 Ga0451802_0378443_63_461 130
645 3300041463 Ga0451804_0819133 Ga0451804_0819133_31_429 130
646 3300041509 Ga0451843_0706509 Ga0451843_0706509_33_431 130
647 3300041511 Ga0451855_0509808 Ga0451855_0509808_18_416 130
648 3300042006 Ga0439432_117955 Ga0439432_117955_168_566 130
649 3300042008 Ga0439450_109521 Ga0439450_109521_115_513 130
650 3300042015 Ga0439462_0157511 Ga0439462_0157511_19_417 130
651 3300042145 Ga0450906_056126 Ga0450906_056126_161_559 130
652 3300042156 Ga0439446_0047733 Ga0439446_0047733_652_1050 130
653 3300042435 Ga0439434_0038838 Ga0439434_0038838_564_962 130
654 3300042876 Ga0451577_0273721 Ga0451577_0273721_441_839 130
655 3300044656 Ga0466969_0039743 Ga0466969_0039743_104_502 130
656 3300044683 Ga0466965_0798825 Ga0466965_0798825_115_513 130
657 3300044684 Ga0466966_0022847 Ga0466966_0022847_816_1214 130
658 3300044684 Ga0466966_0270913 Ga0466966_0270913_480_878 130
659 3300044693 Ga0466961_0042005 Ga0466961_0042005_1622_2020 130
660 3300044693 Ga0466961_0388681 Ga0466961_0388681_337_735 130
661 3300044693 Ga0466961_0444558 Ga0466961_0444558_261_659 130
662 3300044693 Ga0466961_0555323 Ga0466961_0555323_214_612 130
663 3300044694 Ga0466963_0112526 Ga0466963_0112526_879_1277 130
664 3300044694 Ga0466963_0163117 Ga0466963_0163117_679_1077 130
665 3300044694 Ga0466963_1235637 Ga0466963_1235637_71_469 130
666 3300044719 Ga0466971_0157586 Ga0466971_0157586_339_737 130
667 3300044735 Ga0466968_0088330 Ga0466968_0088330_553_951 130
668 3300044735 Ga0466968_0215113 Ga0466968_0215113_400_798 130
669 3300044842 Ga0466957_0139873 Ga0466957_0139873_724_1122 130
670 3300044842 Ga0466957_0605704 Ga0466957_0605704_343_741 130
671 3300044901 Ga0466960_0580737 Ga0466960_0580737_29_427 130
672 3300045049 Ga0466959_0039379 Ga0466959_0039379_2717_3115 130
673 3300045049 Ga0466959_0232887 Ga0466959_0232887_789_1187 130
674 3300045049 Ga0466959_0268900 Ga0466959_0268900_367_765 130
675 3300045836 Ga0466958_0130537 Ga0466958_0130537_930_1328 130
676 3300045836 Ga0466958_0392114 Ga0466958_0392114_117_515 130
677 3300045976 Ga0466967_0919189 Ga0466967_0919189_224_622 130
678 3300046454 Ga0495592_0175635 Ga0495592_0175635_134_532 130
679 3300046454 Ga0495592_0211815 Ga0495592_0211815_147_545 130
680 3300046454 Ga0495592_0306989 Ga0495592_0306989_344_742 130
681 3300046454 Ga0495592_0533700 Ga0495592_0533700_231_632 130
682 3300046454 Ga0495592_0620301 Ga0495592_0620301_109_507 130
683 3300046455 Ga0495603_0098014 Ga0495603_0098014_675_1067 130
684 3300046455 Ga0495603_0174579 Ga0495603_0174579_132_524 130
685 3300046455 Ga0495603_0181383 Ga0495603_0181383_557_949 130
686 3300046455 Ga0495603_0256707 Ga0495603_0256707_441_839 130
687 3300046455 Ga0495603_0306954 Ga0495603_0306954_208_606 130
688 3300046455 Ga0495603_0346216 Ga0495603_0346216_285_683 130
689 3300046458 Ga0495591_114037 Ga0495591_114037_184_576 130
690 3300046459 Ga0495629_0049329 Ga0495629_0049329_1313_1705 130
691 3300046459 Ga0495629_0287369 Ga0495629_0287369_58_456 130
692 3300046459 Ga0495629_0396659 Ga0495629_0396659_516_914 130
693 3300046459 Ga0495629_0523889 Ga0495629_0523889_380_778 130
694 3300046459 Ga0495629_1116261 Ga0495629_1116261_48_446 130
695 3300046460 Ga0495638_0296999 Ga0495638_0296999_244_642 130
696 3300046461 Ga0495641_0001712 Ga0495641_0001712_12559_12951 130
697 3300046461 Ga0495641_0373576 Ga0495641_0373576_204_602 130
698 3300046461 Ga0495641_0523479 Ga0495641_0523479_37_435 130
699 3300046462 Ga0495651_0004813 Ga0495651_0004813_8776_9174 130
700 3300046462 Ga0495651_0470299 Ga0495651_0470299_379_780 130
701 3300046463 Ga0495653_0052427 Ga0495653_0052427_1099_1497 130
702 3300046463 Ga0495653_0129192 Ga0495653_0129192_1095_1496 130
703 3300046463 Ga0495653_0129403 Ga0495653_0129403_1062_1460 130
704 3300046463 Ga0495653_0319390 Ga0495653_0319390_192_584 130
705 3300046463 Ga0495653_0329509 Ga0495653_0329509_102_500 130
706 3300046463 Ga0495653_0477938 Ga0495653_0477938_170_568 130
707 3300046463 Ga0495653_0919635 Ga0495653_0919635_32_430 130
708 3300046472 Ga0495580_0064765 Ga0495580_0064765_1116_1508 130
709 3300046472 Ga0495580_0125895 Ga0495580_0125895_577_969 130
710 3300046472 Ga0495580_0829919 Ga0495580_0829919_70_468 130
711 3300046473 Ga0495582_0064566 Ga0495582_0064566_511_903 130
712 3300046473 Ga0495582_0130630 Ga0495582_0130630_929_1327 130
713 3300046473 Ga0495582_0242871 Ga0495582_0242871_413_811 130
714 3300046475 Ga0495639_0001433 Ga0495639_0001433_1219_1611 130
715 3300046475 Ga0495639_0065791 Ga0495639_0065791_595_993 130
716 3300046475 Ga0495639_0407039 Ga0495639_0407039_10_408 130
717 3300046476 Ga0495662_0004361 Ga0495662_0004361_5727_6119 130
718 3300046476 Ga0495662_0083082 Ga0495662_0083082_886_1278 130
719 3300046476 Ga0495662_0089132 Ga0495662_0089132_384_782 130
720 3300046476 Ga0495662_0595722 Ga0495662_0595722_55_453 130
721 3300046477 Ga0495664_0223462 Ga0495664_0223462_54_455 130
722 3300046477 Ga0495664_0303524 Ga0495664_0303524_338_736 130
723 3300046477 Ga0495664_0658153 Ga0495664_0658153_159_557 130
724 3300046477 Ga0495664_0672770 Ga0495664_0672770_18_416 130
725 3300046491 Ga0495584_0071852 Ga0495584_0071852_1029_1421 130
726 3300046491 Ga0495584_0101981 Ga0495584_0101981_966_1358 130
727 3300046492 Ga0495585_0295661 Ga0495585_0295661_348_740 130
728 3300046492 Ga0495585_0428036 Ga0495585_0428036_68_460 130
729 3300046499 Ga0495594_0170210 Ga0495594_0170210_646_1038 130
730 3300046499 Ga0495594_0269142 Ga0495594_0269142_221_619 130
731 3300046499 Ga0495594_0519080 Ga0495594_0519080_105_497 130
732 3300046500 Ga0495596_0098321 Ga0495596_0098321_711_1103 130
733 3300046501 Ga0495607_0115970 Ga0495607_0115970_894_1286 130
734 3300046511 Ga0495608_0063614 Ga0495608_0063614_1029_1427 130
735 3300046511 Ga0495608_0448939 Ga0495608_0448939_33_431 130
736 3300046514 Ga0495618_0329707 Ga0495618_0329707_123_521 130
737 3300046514 Ga0495618_0457013 Ga0495618_0457013_184_585 130
738 3300046516 Ga0495628_0246680 Ga0495628_0246680_103_501 130
739 3300046516 Ga0495628_0403711 Ga0495628_0403711_180_578 130
740 3300046516 Ga0495628_0474187 Ga0495628_0474187_413_811 130
741 3300046516 Ga0495628_0550138 Ga0495628_0550138_368_766 130
742 3300046517 Ga0495630_0012230 Ga0495630_0012230_5285_5677 130
743 3300046517 Ga0495630_0134424 Ga0495630_0134424_60_458 130
744 3300046517 Ga0495630_0193432 Ga0495630_0193432_932_1330 130
745 3300046517 Ga0495630_0350345 Ga0495630_0350345_116_514 130
746 3300046517 Ga0495630_0420574 Ga0495630_0420574_11_409 130
747 3300046517 Ga0495630_0850758 Ga0495630_0850758_39_437 130
748 3300046518 Ga0495631_0211312 Ga0495631_0211312_271_663 130
749 3300046520 Ga0495637_0054933 Ga0495637_0054933_149_541 130
750 3300046520 Ga0495637_0316467 Ga0495637_0316467_75_473 130
751 3300046523 Ga0495644_0014236 Ga0495644_0014236_1408_1800 130
752 3300046523 Ga0495644_0127936 Ga0495644_0127936_287_679 130
753 3300046525 Ga0495663_0005126 Ga0495663_0005126_2717_3109 130
754 3300046525 Ga0495663_0029820 Ga0495663_0029820_782_1174 130
755 3300046525 Ga0495663_0268874 Ga0495663_0268874_186_578 130
756 3300046526 Ga0495666_0003428 Ga0495666_0003428_3528_3920 130
757 3300046528 Ga0495642_0038020 Ga0495642_0038020_855_1247 130
758 3300046528 Ga0495642_0104889 Ga0495642_0104889_618_1016 130
759 3300046528 Ga0495642_0310884 Ga0495642_0310884_256_648 130
760 3300046529 Ga0495652_0116165 Ga0495652_0116165_1260_1658 130
761 3300046529 Ga0495652_0209714 Ga0495652_0209714_841_1239 130
762 3300046529 Ga0495652_0332407 Ga0495652_0332407_329_727 130
763 3300046531 Ga0495665_0005734 Ga0495665_0005734_511_903 130
764 3300046533 Ga0495640_0015599 Ga0495640_0015599_2709_3101 130
765 3300046533 Ga0495640_0209461 Ga0495640_0209461_505_903 130
766 3300046533 Ga0495640_0225883 Ga0495640_0225883_257_655 130
767 3300046533 Ga0495640_0320046 Ga0495640_0320046_332_730 130
768 3300046535 Ga0495586_0015388 Ga0495586_0015388_2389_2781 130
769 3300046535 Ga0495586_0043241 Ga0495586_0043241_1512_1904 130
770 3300046535 Ga0495586_0093561 Ga0495586_0093561_593_991 130
771 3300046535 Ga0495586_0334000 Ga0495586_0334000_34_432 130
772 3300046535 Ga0495586_0427597 Ga0495586_0427597_208_606 130
773 3300046535 Ga0495586_0511832 Ga0495586_0511832_134_532 130
774 3300046535 Ga0495586_0546978 Ga0495586_0546978_119_520 130
775 3300046535 Ga0495586_0678352 Ga0495586_0678352_113_511 130
776 3300046536 Ga0495587_0041055 Ga0495587_0041055_576_974 130
777 3300046536 Ga0495587_0119085 Ga0495587_0119085_825_1223 130
778 3300046536 Ga0495587_0449872 Ga0495587_0449872_148_549 130
779 3300046538 Ga0495609_0094319 Ga0495609_0094319_700_1092 130
780 3300046538 Ga0495609_0212526 Ga0495609_0212526_365_757 130
781 3300046538 Ga0495609_0249713 Ga0495609_0249713_166_564 130
782 3300046539 Ga0495621_0001746 Ga0495621_0001746_3629_4027 130
783 3300046539 Ga0495621_0166753 Ga0495621_0166753_61_453 130
784 3300046542 Ga0495597_0260280 Ga0495597_0260280_200_598 130
785 3300046558 Ga0495633_0176020 Ga0495633_0176020_186_578 130
786 3300046559 Ga0495667_0002578 Ga0495667_0002578_9120_9518 130
787 3300046559 Ga0495667_0294658 Ga0495667_0294658_446_844 130
788 3300046615 Ga0495656_0007219 Ga0495656_0007219_3099_3491 130
789 3300046615 Ga0495656_0121523 Ga0495656_0121523_674_1066 130
790 3300046615 Ga0495656_0265427 Ga0495656_0265427_161_553 130
791 3300046615 Ga0495656_0293476 Ga0495656_0293476_307_705 130
792 3300046615 Ga0495656_0403630 Ga0495656_0403630_255_647 130
793 3300046616 Ga0495668_0860042 Ga0495668_0860042_34_432 130
794 3300046642 Ga0495634_0006384 Ga0495634_0006384_4381_4779 130
795 3300046642 Ga0495634_0016753 Ga0495634_0016753_4505_4897 130
796 3300046642 Ga0495634_0103357 Ga0495634_0103357_1126_1524 130
797 3300046642 Ga0495634_0195702 Ga0495634_0195702_547_945 130
798 3300046642 Ga0495634_0800061 Ga0495634_0800061_90_488 130
799 3300046648 Ga0495611_0071036 Ga0495611_0071036_269_661 130
800 3300046648 Ga0495611_0114256 Ga0495611_0114256_149_541 130
801 3300046663 Ga0495635_0016528 Ga0495635_0016528_1195_1593 130
802 3300046663 Ga0495635_0060316 Ga0495635_0060316_1204_1596 130
803 3300046663 Ga0495635_0393325 Ga0495635_0393325_211_609 130
804 3300046664 Ga0495659_0024672 Ga0495659_0024672_829_1221 130
805 3300046665 Ga0495661_0418739 Ga0495661_0418739_16_408 130
806 3300046665 Ga0495661_0459535 Ga0495661_0459535_134_526 130
807 3300046674 Ga0495588_0002482 Ga0495588_0002482_6184_6576 130
808 3300046674 Ga0495588_0025412 Ga0495588_0025412_1704_2096 130
809 3300046675 Ga0495657_0001765 Ga0495657_0001765_5362_5760 130
810 3300046675 Ga0495657_0132814 Ga0495657_0132814_921_1322 130
811 3300046675 Ga0495657_0222169 Ga0495657_0222169_183_581 130
812 3300046675 Ga0495657_0266021 Ga0495657_0266021_146_544 130
813 3300046678 Ga0495599_0132192 Ga0495599_0132192_451_849 130
814 3300046678 Ga0495599_0425316 Ga0495599_0425316_49_447 130
815 3300046678 Ga0495599_0593196 Ga0495599_0593196_29_430 130
816 3300046678 Ga0495599_0613017 Ga0495599_0613017_86_484 130
817 3300046679 Ga0495623_0027040 Ga0495623_0027040_2291_2689 130
818 3300046679 Ga0495623_0257910 Ga0495623_0257910_198_596 130
819 3300046681 Ga0495647_0000723 Ga0495647_0000723_1934_2326 130
820 3300046681 Ga0495647_0292930 Ga0495647_0292930_183_581 130
821 3300046681 Ga0495647_0568150 Ga0495647_0568150_26_424 130
822 3300046683 Ga0495658_0008640 Ga0495658_0008640_2784_3176 130
823 3300046683 Ga0495658_0193648 Ga0495658_0193648_307_705 130
824 3300046683 Ga0495658_0312022 Ga0495658_0312022_493_885 130
825 3300046684 Ga0495669_0074928 Ga0495669_0074928_465_857 130
826 3300046684 Ga0495669_0577258 Ga0495669_0577258_88_486 130
827 3300046689 Ga0495613_0001106 Ga0495613_0001106_16881_17279 130
828 3300046689 Ga0495613_0203568 Ga0495613_0203568_759_1157 130
829 3300046689 Ga0495613_0645102 Ga0495613_0645102_20_418 130
830 3300046689 Ga0495613_0954439 Ga0495613_0954439_27_425 130
831 3300046689 Ga0495613_1036532 Ga0495613_1036532_50_448 130
832 3300046690 Ga0495624_0006221 Ga0495624_0006221_828_1220 130
833 3300046690 Ga0495624_0326939 Ga0495624_0326939_238_636 130
834 3300046690 Ga0495624_0359395 Ga0495624_0359395_339_737 130
835 3300046691 Ga0495670_0031381 Ga0495670_0031381_1487_1879 130
836 3300046691 Ga0495670_0052710 Ga0495670_0052710_591_983 130
837 3300046691 Ga0495670_0077233 Ga0495670_0077233_976_1368 130
838 3300046691 Ga0495670_0825047 Ga0495670_0825047_84_476 130
839 3300046694 Ga0495649_0369232 Ga0495649_0369232_43_435 130
840 3300046794 Ga0495589_0030296 Ga0495589_0030296_870_1268 130
841 3300046794 Ga0495589_0117837 Ga0495589_0117837_874_1266 130
842 3300046794 Ga0495589_0200885 Ga0495589_0200885_180_572 130
843 3300046794 Ga0495589_0271282 Ga0495589_0271282_152_544 130
844 3300046809 Ga0495600_0016031 Ga0495600_0016031_557_955 130
845 3300046809 Ga0495600_0234419 Ga0495600_0234419_185_586 130
846 3300046809 Ga0495600_0312840 Ga0495600_0312840_576_974 130
847 3300046809 Ga0495600_0783302 Ga0495600_0783302_77_475 130
848 3300047315 Ga0495581_0036306 Ga0495581_0036306_1898_2290 130
849 3300047317 Ga0495604_0512673 Ga0495604_0512673_58_456 130
850 3300047317 Ga0495604_0818509 Ga0495604_0818509_21_419 130
851 3300047317 Ga0495604_0842200 Ga0495604_0842200_38_436 130
852 3300047318 Ga0495636_0445267 Ga0495636_0445267_217_609 130
853 3300047319 Ga0495674_0021479 Ga0495674_0021479_5199_5591 130
854 3300047319 Ga0495674_0173897 Ga0495674_0173897_1097_1495 130
855 3300047319 Ga0495674_0201212 Ga0495674_0201212_154_552 130
856 3300047319 Ga0495674_0476998 Ga0495674_0476998_531_929 130
857 3300047319 Ga0495674_0534482 Ga0495674_0534482_345_737 130
858 3300047319 Ga0495674_0543750 Ga0495674_0543750_497_895 130
859 3300047319 Ga0495674_1152092 Ga0495674_1152092_67_465 130
860 3300047321 Ga0495676_0057213 Ga0495676_0057213_876_1274 130
861 3300047321 Ga0495676_0065217 Ga0495676_0065217_1617_2015 130
862 3300047321 Ga0495676_0077090 Ga0495676_0077090_1063_1455 130
863 3300047321 Ga0495676_0101835 Ga0495676_0101835_1597_1989 130
864 3300047321 Ga0495676_0276125 Ga0495676_0276125_126_524 130
865 3300047321 Ga0495676_0295326 Ga0495676_0295326_343_741 130
866 3300047321 Ga0495676_0397929 Ga0495676_0397929_398_790 130
867 3300047322 Ga0495680_0004189 Ga0495680_0004189_9301_9699 130
868 3300047322 Ga0495680_0008963 Ga0495680_0008963_5961_6353 130
869 3300047322 Ga0495680_0207610 Ga0495680_0207610_839_1237 130
870 3300047322 Ga0495680_0242936 Ga0495680_0242936_44_442 130
871 3300047322 Ga0495680_0304550 Ga0495680_0304550_702_1100 130
872 3300047322 Ga0495680_1102723 Ga0495680_1102723_81_473 130
873 3300047323 Ga0495683_0260941 Ga0495683_0260941_140_532 130
874 3300047444 Ga0495675_0068857 Ga0495675_0068857_934_1332 130
875 3300047445 Ga0495677_0066988 Ga0495677_0066988_849_1241 130
876 3300047469 Ga0495673_0164950 Ga0495673_0164950_153_551 130
877 3300047471 Ga0495684_0054111 Ga0495684_0054111_121_522 130
878 3300047471 Ga0495684_0080311 Ga0495684_0080311_1345_1743 130
879 3300047471 Ga0495684_0565179 Ga0495684_0565179_190_588 130
880 3300047471 Ga0495684_0605218 Ga0495684_0605218_191_589 130
881 3300047673 Ga0495593_0001673 Ga0495593_0001673_10683_11075 130
882 3300047673 Ga0495593_0160764 Ga0495593_0160764_560_958 130
883 3300048088 Ga0495602_0076237 Ga0495602_0076237_249_647 130
884 3300048088 Ga0495602_0565901 Ga0495602_0565901_313_711 130
885 3300048089 Ga0495614_0155100 Ga0495614_0155100_404_802 130
886 3300048089 Ga0495614_0191338 Ga0495614_0191338_336_734 130
887 3300048089 Ga0495614_0340489 Ga0495614_0340489_44_442 130
888 3300048090 Ga0495615_0202840 Ga0495615_0202840_203_601 130
889 3300048903 Ga0496100_0041895 Ga0496100_0041895_1807_2199 130
890 3300048903 Ga0496100_0057169 Ga0496100_0057169_35_427 130
891 3300048903 Ga0496100_0270774 Ga0496100_0270774_76_474 130
892 3300048903 Ga0496100_0780368 Ga0496100_0780368_145_543 130
893 3300048903 Ga0496100_1486514 Ga0496100_1486514_10_408 130
894 3300048903 Ga0496100_1635770 Ga0496100_1635770_55_453 130
895 3300048904 Ga0496101_0025291 Ga0496101_0025291_1956_2348 130
896 3300048904 Ga0496101_0149994 Ga0496101_0149994_1083_1481 130
897 3300048904 Ga0496101_0432977 Ga0496101_0432977_126_518 130
898 3300048904 Ga0496101_0576568 Ga0496101_0576568_21_419 130
899 3300048904 Ga0496101_0714647 Ga0496101_0714647_182_580 130
900 3300048905 Ga0496102_0018527 Ga0496102_0018527_2698_3090 130
901 3300048905 Ga0496102_0234599 Ga0496102_0234599_392_784 130
902 3300048905 Ga0496102_0331214 Ga0496102_0331214_177_575 130
903 3300048905 Ga0496102_0480328 Ga0496102_0480328_684_1076 130
904 3300048905 Ga0496102_0480795 Ga0496102_0480795_648_1046 130
905 3300048905 Ga0496102_0742734 Ga0496102_0742734_205_603 130
906 3300048905 Ga0496102_1238289 Ga0496102_1238289_139_531 130
907 3300048906 Ga0496103_0102296 Ga0496103_0102296_820_1212 130
908 3300048906 Ga0496103_0229384 Ga0496103_0229384_515_907 130
909 3300048906 Ga0496103_0250916 Ga0496103_0250916_524_922 130
910 3300048906 Ga0496103_0705985 Ga0496103_0705985_61_459 130
911 3300048906 Ga0496103_0812326 Ga0496103_0812326_167_559 130
912 3300048907 Ga0496104_0080130 Ga0496104_0080130_67_465 130
913 3300048907 Ga0496104_0107421 Ga0496104_0107421_2140_2538 130
914 3300048907 Ga0496104_0205874 Ga0496104_0205874_867_1259 130
915 3300048907 Ga0496104_0220462 Ga0496104_0220462_274_672 130
916 3300048907 Ga0496104_0520764 Ga0496104_0520764_169_567 130
917 3300048908 Ga0496105_0054938 Ga0496105_0054938_2241_2639 130
918 3300048908 Ga0496105_0056610 Ga0496105_0056610_2256_2654 130
919 3300048908 Ga0496105_0163527 Ga0496105_0163527_734_1132 130
920 3300048908 Ga0496105_0187178 Ga0496105_0187178_786_1178 130
921 3300048908 Ga0496105_0327281 Ga0496105_0327281_770_1168 130
922 3300048909 Ga0496106_0008125 Ga0496106_0008125_4490_4882 130
923 3300048909 Ga0496106_0195471 Ga0496106_0195471_632_1030 130
924 3300048909 Ga0496106_0525198 Ga0496106_0525198_358_750 130
925 3300048909 Ga0496106_0774926 Ga0496106_0774926_338_736 130
926 3300048910 Ga0496107_0006741 Ga0496107_0006741_2745_3137 130
927 3300048910 Ga0496107_0043569 Ga0496107_0043569_1897_2289 130
928 3300048910 Ga0496107_0275344 Ga0496107_0275344_782_1180 130
929 3300048910 Ga0496107_0463841 Ga0496107_0463841_156_548 130
930 3300048910 Ga0496107_0500860 Ga0496107_0500860_460_858 130
931 3300048911 Ga0496108_0016189 Ga0496108_0016189_4287_4679 130
932 3300048911 Ga0496108_0023793 Ga0496108_0023793_3136_3528 130
933 3300048911 Ga0496108_0034475 Ga0496108_0034475_2814_3212 130
934 3300048911 Ga0496108_0060328 Ga0496108_0060328_2747_3145 130
935 3300048911 Ga0496108_0079575 Ga0496108_0079575_791_1189 130
936 3300048911 Ga0496108_0593180 Ga0496108_0593180_275_673 130
937 3300048912 Ga0496109_0002583 Ga0496109_0002583_1956_2348 130
938 3300048912 Ga0496109_0004660 Ga0496109_0004660_6813_7211 130
939 3300048912 Ga0496109_0004877 Ga0496109_0004877_5853_6251 130
940 3300048912 Ga0496109_0026262 Ga0496109_0026262_736_1128 130
941 3300048912 Ga0496109_0184417 Ga0496109_0184417_1033_1431 130
942 3300048912 Ga0496109_0234895 Ga0496109_0234895_223_621 130
943 3300048912 Ga0496109_0624980 Ga0496109_0624980_248_646 130
944 3300048912 Ga0496109_0627537 Ga0496109_0627537_55_453 130
945 3300048912 Ga0496109_0675396 Ga0496109_0675396_232_630 130
946 3300048912 Ga0496109_1326514 Ga0496109_1326514_196_588 130
947 3300048912 Ga0496109_1809704 Ga0496109_1809704_64_462 130
948 3300048913 Ga0496110_0004643 Ga0496110_0004643_2854_3252 130
949 3300048913 Ga0496110_0027911 Ga0496110_0027911_1897_2289 130
950 3300048913 Ga0496110_0089463 Ga0496110_0089463_1864_2262 130
951 3300048913 Ga0496110_0091123 Ga0496110_0091123_980_1378 130
952 3300048913 Ga0496110_0170208 Ga0496110_0170208_1013_1411 130
953 3300048913 Ga0496110_0961526 Ga0496110_0961526_11_409 130
954 3300048913 Ga0496110_1161634 Ga0496110_1161634_168_566 130
955 3300048913 Ga0496110_1829298 Ga0496110_1829298_58_456 130
956 3300048914 Ga0496111_0010628 Ga0496111_0010628_3415_3813 130
957 3300048914 Ga0496111_0027483 Ga0496111_0027483_1582_1980 130
958 3300048914 Ga0496111_0032586 Ga0496111_0032586_978_1370 130
959 3300048914 Ga0496111_0078099 Ga0496111_0078099_908_1306 130
960 3300048914 Ga0496111_0874062 Ga0496111_0874062_68_466 130
961 3300048915 Ga0496112_0002114 Ga0496112_0002114_7614_8012 130
962 3300048915 Ga0496112_0003519 Ga0496112_0003519_6461_6859 130
963 3300048915 Ga0496112_0013302 Ga0496112_0013302_5550_5948 130
964 3300048915 Ga0496112_0049244 Ga0496112_0049244_872_1264 130
965 3300048915 Ga0496112_0291808 Ga0496112_0291808_467_865 130
966 3300048915 Ga0496112_0427348 Ga0496112_0427348_337_735 130
967 3300048915 Ga0496112_1286805 Ga0496112_1286805_95_493 130
968 3300048916 Ga0496113_0077648 Ga0496113_0077648_414_806 130
969 3300048916 Ga0496113_0149600 Ga0496113_0149600_981_1379 130
970 3300048916 Ga0496113_0153627 Ga0496113_0153627_598_996 130
971 3300048916 Ga0496113_0273407 Ga0496113_0273407_366_764 130
972 3300048916 Ga0496113_0306589 Ga0496113_0306589_549_947 130
973 3300048916 Ga0496113_0410932 Ga0496113_0410932_321_719 130
974 3300048916 Ga0496113_0478416 Ga0496113_0478416_428_820 130
975 3300048916 Ga0496113_1610159 Ga0496113_1610159_29_427 130
976 3300048917 Ga0496114_0004194 Ga0496114_0004194_9677_10075 130
977 3300048917 Ga0496114_0012594 Ga0496114_0012594_886_1278 130
978 3300048917 Ga0496114_0066061 Ga0496114_0066061_182_580 130
979 3300048917 Ga0496114_0100423 Ga0496114_0100423_1577_1975 130
980 3300048917 Ga0496114_0187946 Ga0496114_0187946_508_906 130
981 3300048917 Ga0496114_0220275 Ga0496114_0220275_515_907 130
982 3300048917 Ga0496114_0508810 Ga0496114_0508810_623_1021 130
983 3300048917 Ga0496114_0936756 Ga0496114_0936756_290_688 130
984 3300048917 Ga0496114_1518317 Ga0496114_1518317_100_498 130
985 3300048918 Ga0496115_0069392 Ga0496115_0069392_834_1232 130
986 3300048918 Ga0496115_0298175 Ga0496115_0298175_70_462 130
987 3300048918 Ga0496115_0315454 Ga0496115_0315454_11_403 130
988 3300048918 Ga0496115_0479967 Ga0496115_0479967_303_701 130
989 3300048918 Ga0496115_0694149 Ga0496115_0694149_132_530 130
990 3300048918 Ga0496115_0995662 Ga0496115_0995662_194_592 130
991 3300048922 Ga0496119_0286724 Ga0496119_0286724_145_543 130
992 3300048922 Ga0496119_0540121 Ga0496119_0540121_58_456 130
993 3300049162 Ga0501307_056665 Ga0501307_056665_32_430 130
994 3300049527 Ga0501311_053539 Ga0501311_053539_73_471 130
995 3300049568 Ga0501031_0214433 Ga0501031_0214433_304_702 130
996 3300049568 Ga0501031_0721495 Ga0501031_0721495_217_615 130
997 3300049570 Ga0501033_0000586 Ga0501033_0000586_25639_26037 130
998 3300049570 Ga0501033_0501159 Ga0501033_0501159_356_754 130
999 3300049571 Ga0501034_0009423 Ga0501034_0009423_9392_9790 130
1000 3300049572 Ga0501036_0045609 Ga0501036_0045609_1285_1683 130
1001 3300049572 Ga0501036_0056989 Ga0501036_0056989_2739_3137 130
1002 3300049572 Ga0501036_0194170 Ga0501036_0194170_427_825 130
1003 3300049572 Ga0501036_0243147 Ga0501036_0243147_401_799 130
1004 3300049572 Ga0501036_0459935 Ga0501036_0459935_296_691 130
1005 3300049572 Ga0501036_0475806 Ga0501036_0475806_248_646 130
1006 3300049572 Ga0501036_0959563 Ga0501036_0959563_45_443 130
1007 3300049574 Ga0501038_0105410 Ga0501038_0105410_1059_1457 130
1008 3300049574 Ga0501038_0159909 Ga0501038_0159909_918_1316 130
1009 3300049574 Ga0501038_1371529 Ga0501038_1371529_73_471 130
1010 3300049575 Ga0501039_0114246 Ga0501039_0114246_805_1203 130
1011 3300049575 Ga0501039_1331379 Ga0501039_1331379_142_540 130
1012 3300049576 Ga0501040_0013186 Ga0501040_0013186_3211_3609 130
1013 3300049576 Ga0501040_0469841 Ga0501040_0469841_369_767 130
1014 3300049576 Ga0501040_0534645 Ga0501040_0534645_98_496 130
1015 3300049576 Ga0501040_0646003 Ga0501040_0646003_301_699 130
1016 3300049576 Ga0501040_0751493 Ga0501040_0751493_268_660 130
1017 3300049576 Ga0501040_1010240 Ga0501040_1010240_52_450 130
1018 3300049577 Ga0501041_0039470 Ga0501041_0039470_685_1083 130
1019 3300049578 Ga0501042_0147634 Ga0501042_0147634_464_862 130
1020 3300049578 Ga0501042_0334483 Ga0501042_0334483_29_427 130
1021 3300049578 Ga0501042_0555026 Ga0501042_0555026_247_645 130
1022 3300049578 Ga0501042_0799643 Ga0501042_0799643_217_615 130
1023 3300049580 Ga0501046_0454593 Ga0501046_0454593_221_619 130
1024 3300049581 Ga0501047_0390651 Ga0501047_0390651_543_941 130
1025 3300049582 Ga0501048_0009882 Ga0501048_0009882_6515_6913 130
1026 3300049582 Ga0501048_0998142 Ga0501048_0998142_122_520 130
1027 3300049582 Ga0501048_1179221 Ga0501048_1179221_47_445 130
1028 3300049583 Ga0501067_0561673 Ga0501067_0561673_148_546 130
1029 3300049584 Ga0501068_0263687 Ga0501068_0263687_663_1061 130
1030 3300049584 Ga0501068_0639683 Ga0501068_0639683_37_435 130
1031 3300049585 Ga0501069_0102362 Ga0501069_0102362_311_709 130
1032 3300049585 Ga0501069_0118008 Ga0501069_0118008_503_895 130
1033 3300049586 Ga0501070_0871175 Ga0501070_0871175_52_450 130
1034 3300049587 Ga0501071_0130118 Ga0501071_0130118_106_504 130
1035 3300049587 Ga0501071_1105905 Ga0501071_1105905_115_513 130
1036 3300049588 Ga0501072_0004460 Ga0501072_0004460_60_458 130
1037 3300049588 Ga0501072_0125602 Ga0501072_0125602_1066_1464 130
1038 3300049588 Ga0501072_0421551 Ga0501072_0421551_493_891 130
1039 3300049588 Ga0501072_0541374 Ga0501072_0541374_45_443 130
1040 3300049588 Ga0501072_1571552 Ga0501072_1571552_28_426 130
1041 3300049589 Ga0501073_0034729 Ga0501073_0034729_566_964 130
1042 3300049589 Ga0501073_1085202 Ga0501073_1085202_139_537 130
1043 3300049590 Ga0501074_0091842 Ga0501074_0091842_785_1183 130
1044 3300049590 Ga0501074_0468695 Ga0501074_0468695_29_427 130
1045 3300049590 Ga0501074_1052978 Ga0501074_1052978_70_468 130
1046 3300049591 Ga0501075_0073190 Ga0501075_0073190_816_1214 130
1047 3300049591 Ga0501075_0194521 Ga0501075_0194521_495_890 130
1048 3300049591 Ga0501075_0334097 Ga0501075_0334097_133_525 130
1049 3300049591 Ga0501075_1016701 Ga0501075_1016701_131_529 130
1050 3300049592 Ga0501076_0029561 Ga0501076_0029561_544_942 130
1051 3300049592 Ga0501076_0274419 Ga0501076_0274419_49_447 130
1052 3300049592 Ga0501076_0444788 Ga0501076_0444788_68_466 130
1053 3300049592 Ga0501076_0583041 Ga0501076_0583041_340_738 130
1054 3300049592 Ga0501076_0965988 Ga0501076_0965988_102_497 130
1055 3300049592 Ga0501076_1241924 Ga0501076_1241924_107_505 130
1056 3300049593 Ga0501077_0040119 Ga0501077_0040119_1995_2387 130
1057 3300049593 Ga0501077_0058942 Ga0501077_0058942_1759_2157 130
1058 3300049593 Ga0501077_0388293 Ga0501077_0388293_266_664 130
1059 3300049593 Ga0501077_0915839 Ga0501077_0915839_102_500 130
1060 3300049741 Ga0501079_0027551 Ga0501079_0027551_2059_2457 130
1061 3300049742 Ga0501080_0278615 Ga0501080_0278615_96_494 130
1062 3300049742 Ga0501080_0338523 Ga0501080_0338523_721_1119 130
1063 3300049742 Ga0501080_1882703 Ga0501080_1882703_49_441 130
1064 3300049743 Ga0501081_0018885 Ga0501081_0018885_912_1310 130
1065 3300049743 Ga0501081_0331403 Ga0501081_0331403_66_461 130
1066 3300049743 Ga0501081_0459930 Ga0501081_0459930_172_564 130
1067 3300049743 Ga0501081_0655760 Ga0501081_0655760_283_681 130
1068 3300049744 Ga0501083_0944640 Ga0501083_0944640_10_408 130
1069 3300049822 Ga0501035_0543018 Ga0501035_0543018_61_459 130
1070 3300049822 Ga0501035_0715118 Ga0501035_0715118_377_769 130
1071 3300049823 Ga0501044_0003799 Ga0501044_0003799_8374_8772 130
1072 3300049824 Ga0501045_0020878 Ga0501045_0020878_2134_2532 130
1073 3300049824 Ga0501045_0184575 Ga0501045_0184575_108_506 130
1074 3300049824 Ga0501045_0384405 Ga0501045_0384405_425_823 130
1075 3300049824 Ga0501045_0867072 Ga0501045_0867072_151_543 130
1076 3300050490 nmdc:mga03n38_30805_c1 nmdc:mga03n38_30805_c1_1127_1525 130
1077 3300050490 nmdc:mga03n38_445852_c1 nmdc:mga03n38_445852_c1_64_462 130
1078 3300050491 nmdc:mga00v17_15891_c1 nmdc:mga00v17_15891_c1_2382_2780 130
1079 3300050492 nmdc:mga0yw44_1060720_c1 nmdc:mga0yw44_1060720_c1_58_456 130
1080 3300050492 nmdc:mga0yw44_138029_c1 nmdc:mga0yw44_138029_c1_70_468 130
1081 3300050492 nmdc:mga0yw44_15898_c1 nmdc:mga0yw44_15898_c1_2980_3378 130
1082 3300050492 nmdc:mga0yw44_175904_c1 nmdc:mga0yw44_175904_c1_843_1241 130
1083 3300050492 nmdc:mga0yw44_611903_c1 nmdc:mga0yw44_611903_c1_175_573 130
1084 3300050493 nmdc:mga0k408_305633_c1 nmdc:mga0k408_305633_c1_57_455 130
1085 3300050494 nmdc:mga06z11_174222_c1 nmdc:mga06z11_174222_c1_357_755 130
1086 3300050494 nmdc:mga06z11_40797_c1 nmdc:mga06z11_40797_c1_1301_1699 130
1087 3300050494 nmdc:mga06z11_84327_c1 nmdc:mga06z11_84327_c1_620_1018 130
1088 3300050496 nmdc:mga07m45_100310_c1 nmdc:mga07m45_100310_c1_169_567 130
1089 3300050507 nmdc:mga05p37_10502_c1 nmdc:mga05p37_10502_c1_1512_1904 130
1090 3300050507 nmdc:mga05p37_1223129_c1 nmdc:mga05p37_1223129_c1_128_526 130
1091 3300050507 nmdc:mga05p37_242254_c1 nmdc:mga05p37_242254_c1_750_1148 130
1092 3300050507 nmdc:mga05p37_330960_c1 nmdc:mga05p37_330960_c1_77_475 130
1093 3300050507 nmdc:mga05p37_81637_c1 nmdc:mga05p37_81637_c1_685_1083 130
1094 3300050508 nmdc:mga09592_258024_c1 nmdc:mga09592_258024_c1_685_1092 130
1095 3300050509 nmdc:mga0qj67_49532_c1 nmdc:mga0qj67_49532_c1_837_1235 130
1096 3300050511 nmdc:mga08y16_1539241_c1 nmdc:mga08y16_1539241_c1_157_555 130
1097 3300050511 nmdc:mga08y16_209788_c1 nmdc:mga08y16_209788_c1_1449_1865 130
1098 3300050512 nmdc:mga0n895_1217359_c1 nmdc:mga0n895_1217359_c1_60_458 130
1099 3300050512 nmdc:mga0n895_266406_c1 nmdc:mga0n895_266406_c1_177_569 130
1100 3300050512 nmdc:mga0n895_271050_c1 nmdc:mga0n895_271050_c1_1193_1585 130
1101 3300050512 nmdc:mga0n895_37338_c1 nmdc:mga0n895_37338_c1_2531_2923 130
1102 3300050513 nmdc:mga0rr50_1357325_c1 nmdc:mga0rr50_1357325_c1_148_546 130
1103 3300050513 nmdc:mga0rr50_294370_c1 nmdc:mga0rr50_294370_c1_671_1069 130
1104 3300050513 nmdc:mga0rr50_643440_c1 nmdc:mga0rr50_643440_c1_218_610 130
1105 3300050514 nmdc:mga08x19_506806_c1 nmdc:mga08x19_506806_c1_279_677 130
1106 3300050514 nmdc:mga08x19_79672_c1 nmdc:mga08x19_79672_c1_53_445 130
1107 3300050515 nmdc:mga0a205_1011_c1 nmdc:mga0a205_1011_c1_11830_12222 130
1108 3300050516 nmdc:mga0sz30_37512_c1 nmdc:mga0sz30_37512_c1_639_1037 130
1109 3300053077 Ga0495601_0147738 Ga0495601_0147738_574_972 130
1110 3300053077 Ga0495601_0161174 Ga0495601_0161174_1047_1445 130
1111 3300053077 Ga0495601_0287279 Ga0495601_0287279_487_885 130
1112 3300053077 Ga0495601_0333152 Ga0495601_0333152_555_953 130
1113 3300053077 Ga0495601_0377352 Ga0495601_0377352_154_552 130
1114 3300053077 Ga0495601_0790304 Ga0495601_0790304_61_468 130
1115 3300053077 Ga0495601_0935447 Ga0495601_0935447_44_442 130
1116 3300053078 Ga0495612_0580716 Ga0495612_0580716_63_461 130
1117 3300053083 Ga0495655_0022559 Ga0495655_0022559_118_510 130
1118 3300053083 Ga0495655_0044071 Ga0495655_0044071_19_411 130
1119 3300053083 Ga0495655_0103579 Ga0495655_0103579_272_664 130
1120 3300053084 Ga0495595_0064354 Ga0495595_0064354_1296_1694 130
1121 3300053084 Ga0495595_0094688 Ga0495595_0094688_257_658 130
1122 3300053084 Ga0495595_0127575 Ga0495595_0127575_225_623 130
1123 3300053084 Ga0495595_0133979 Ga0495595_0133979_288_686 130
1124 3300053085 Ga0495619_0030323 Ga0495619_0030323_2729_3121 130
1125 3300053085 Ga0495619_0049221 Ga0495619_0049221_1686_2084 130
1126 3300053085 Ga0495619_0057521 Ga0495619_0057521_1151_1549 130
1127 3300053085 Ga0495619_0120735 Ga0495619_0120735_574_972 130
1128 3300053085 Ga0495619_0138483 Ga0495619_0138483_1126_1524 130
1129 3300053085 Ga0495619_0241086 Ga0495619_0241086_383_790 130
1130 3300053085 Ga0495619_0307443 Ga0495619_0307443_596_994 130
1131 3300053085 Ga0495619_1153412 Ga0495619_1153412_88_486 130
1132 3300053090 Ga0500646_0084380 Ga0500646_0084380_87_485 130
1133 3300053090 Ga0500646_0108258 Ga0500646_0108258_281_679 130
1134 3300053094 Ga0500566_0000391 Ga0500566_0000391_2143_2541 130
1135 3300053096 Ga0500641_0007941 Ga0500641_0007941_1450_1848 130
1136 3300053142 Ga0500577_0488842 Ga0500577_0488842_61_459 130
1137 3300053153 Ga0500616_0000816 Ga0500616_0000816_12996_13394 130
1138 3300053153 Ga0500616_0003439 Ga0500616_0003439_6106_6504 130
1139 3300053153 Ga0500616_0141118 Ga0500616_0141118_138_536 130
1140 3300053153 Ga0500616_0168022 Ga0500616_0168022_413_811 130
1141 3300053155 Ga0500620_200098 Ga0500620_200098_115_513 130
1142 3300054114 Ga0501084_0000241 Ga0501084_0000241_19679_20077 130
1143 3300054114 Ga0501084_0017951 Ga0501084_0017951_3541_3939 130
1144 3300054114 Ga0501084_0605061 Ga0501084_0605061_61_456 130
1145 3300054114 Ga0501084_0907842 Ga0501084_0907842_286_684 130
1146 3300054114 Ga0501084_1314946 Ga0501084_1314946_117_515 130
1147 3300059424 Ga0590075_081463 Ga0590075_081463_221_619 130
1148 3300059492 Ga0587073_0108672 Ga0587073_0108672_224_622 130
1149 3300059510 Ga0587090_127763 Ga0587090_127763_55_447 130
1150 3300059627 Ga0587117_080537 Ga0587117_080537_118_516 130
1151 3300059630 Ga0587128_059009 Ga0587128_059009_255_653 130
1152 3300059630 Ga0587128_095601 Ga0587128_095601_108_506 130
1153 3300059643 Ga0587072_020414 Ga0587072_020414_668_1066 130
1154 3300059647 Ga0587079_161957 Ga0587079_161957_26_424 130
1155 3300060353 Ga0501082_0024808 Ga0501082_0024808_2643_3041 130
1156 3300060353 Ga0501082_0610613 Ga0501082_0610613_254_652 130
1157 3300060353 Ga0501082_0671005 Ga0501082_0671005_440_838 130
1158 3300060353 Ga0501082_0974926 Ga0501082_0974926_240_638 130
1159 3300060353 Ga0501082_1436838 Ga0501082_1436838_91_486 130
1160 3300060353 Ga0501082_1527490 Ga0501082_1527490_30_428 130
1161 3300060353 Ga0501082_1933548 Ga0501082_1933548_105_497 130
1162 3300061719 Ga0466962_0404773 Ga0466962_0404773_48_446 130
1163 3300061734 Ga0530510_0031838 Ga0530510_0031838_364_762 130
1164 3300061734 Ga0530510_0304989 Ga0530510_0304989_585_980 130
1165 3300061734 Ga0530510_0499378 Ga0530510_0499378_422_820 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00411

Ribosomal_S11

Ribosomal protein S11

22

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9381 16 116
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9292 17 108
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9292 16 116
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9196 17 108
4v48-assembly1.cif.gz_BK real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9169 15 114
ID Description Score Start End Superfamily
af_A0A1D6L052_103_280_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9294 20 47 3.60.21.10
4qs2K00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8765 15 126 3.30.420.80
af_A0A1D6DWZ1_6_279_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8714 20 47 3.30.420.40
6nf8K00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8609 15 130 3.30.420.80
af_Q23155_77_208_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.856 20 130 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9256 21 108 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E0GRJ6-F1-model_v4 30S ribosomal protein S11 0.9186 8 117 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Y5LCP1-F1-model_v4 Small ribosomal subunit protein uS11 0.9169 4 130 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7R9AEE6-F1-model_v4 Ribosomal protein 0.9169 8 123 GO:0003735
GO:0006412
GO:0015031
GO:0015934
GO:0015935
GO:0016020
GO:0019843
AF-A0A1A9X6B6-F1-model_v4 deleted 0.9155 17 130

Feature Viewer

pLDDT pTM Quality
82.64 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map