F491066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1165 | 446 | 1165 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300020080|Ga0206350_10920527|Ga0206350_109205273 |
| Length | 150 |
| Sequence | MAKPKPGGRRPRRRERKNIAYGVAHIKSSFNNTIISISDPQGNVLAWASAGNVGFKGSRKSTPFAAQLAAEACARRAMEHGVRKVDVLVKGPGSGRETAIRSLQNSGIEVSGIKDVTPSRTTAAAPRSVGGSDRWPATPDPSAGSVGARR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 104 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 197 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 198 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 199 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 260 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 261 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 262 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 263 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 267 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 270 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 271 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 378 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 431 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 434 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 438 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 446 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.97 |
| Metatranscriptomes | 4.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.92 |
| Nodule | 0 |
| Rhizoplane | 9.1 |
| Rhizosphere | 85.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1001877 | 3300002073 | Bacteria | 2086 |
| 2 | Ga0058863_11918246 | 3300004799 | Bacteria | 585 |
| 3 | Ga0058863_11957316 | 3300004799 | Bacteria | 1932 |
| 4 | Ga0065712_10113701 | 3300005290 | Bacteria | 1778 |
| 5 | Ga0065715_10063152 | 3300005293 | Bacteria | 809 |
| 6 | Ga0065707_10485627 | 3300005295 | Bacteria | 770 |
| 7 | Ga0070683_100363808 | 3300005329 | Bacteria | 1378 |
| 8 | Ga0070683_101340454 | 3300005329 | Bacteria | 688 |
| 9 | Ga0070690_100048896 | 3300005330 | Bacteria | 2695 |
| 10 | Ga0070690_100334046 | 3300005330 | Bacteria | 1096 |
| 11 | Ga0070690_101584607 | 3300005330 | Bacteria | 530 |
| 12 | Ga0070670_100751242 | 3300005331 | Bacteria | 879 |
| 13 | Ga0070670_101121483 | 3300005331 | Bacteria | 718 |
| 14 | Ga0068869_102125525 | 3300005334 | Bacteria | 505 |
| 15 | Ga0070666_10781288 | 3300005335 | Bacteria | 703 |
| 16 | Ga0070680_100373398 | 3300005336 | Bacteria | 1214 |
| 17 | Ga0070680_101020262 | 3300005336 | Bacteria | 715 |
| 18 | Ga0068868_100151741 | 3300005338 | Bacteria | 1908 |
| 19 | Ga0068868_100403634 | 3300005338 | Bacteria | 1180 |
| 20 | Ga0070660_100123948 | 3300005339 | Bacteria | 2064 |
| 21 | Ga0070660_100261615 | 3300005339 | Bacteria | 1413 |
| 22 | Ga0070660_100593135 | 3300005339 | Bacteria | 926 |
| 23 | Ga0070660_101068235 | 3300005339 | Bacteria | 683 |
| 24 | Ga0070689_100804299 | 3300005340 | Bacteria | 827 |
| 25 | Ga0070691_10023408 | 3300005341 | Bacteria | 2868 |
| 26 | Ga0070691_10189233 | 3300005341 | Bacteria | 1075 |
| 27 | Ga0070691_10717507 | 3300005341 | Bacteria | 602 |
| 28 | Ga0070687_100356924 | 3300005343 | Bacteria | 945 |
| 29 | Ga0070661_100778634 | 3300005344 | Bacteria | 784 |
| 30 | Ga0070661_101452217 | 3300005344 | Bacteria | 578 |
| 31 | Ga0070692_10225988 | 3300005345 | Bacteria | 1109 |
| 32 | Ga0070692_10527502 | 3300005345 | Bacteria | 770 |
| 33 | Ga0070668_100254737 | 3300005347 | Bacteria | 1458 |
| 34 | Ga0070668_100793922 | 3300005347 | Bacteria | 841 |
| 35 | Ga0070669_100078134 | 3300005353 | Bacteria | 2459 |
| 36 | Ga0070669_101298822 | 3300005353 | Bacteria | 630 |
| 37 | Ga0070669_101456492 | 3300005353 | Bacteria | 595 |
| 38 | Ga0070675_100041662 | 3300005354 | Bacteria | 3750 |
| 39 | Ga0070675_100418939 | 3300005354 | Bacteria | 1197 |
| 40 | Ga0070675_101189689 | 3300005354 | Bacteria | 702 |
| 41 | Ga0070675_101392756 | 3300005354 | Bacteria | 646 |
| 42 | Ga0070671_101524059 | 3300005355 | Bacteria | 592 |
| 43 | Ga0070674_100026741 | 3300005356 | Bacteria | 3772 |
| 44 | Ga0070674_100064122 | 3300005356 | Bacteria | 2573 |
| 45 | Ga0070674_100125926 | 3300005356 | Bacteria | 1903 |
| 46 | Ga0070674_100160059 | 3300005356 | Bacteria | 1707 |
| 47 | Ga0070673_100177821 | 3300005364 | Bacteria | 1820 |
| 48 | Ga0070673_100439083 | 3300005364 | Bacteria | 1173 |
| 49 | Ga0070673_100664790 | 3300005364 | Bacteria | 954 |
| 50 | Ga0070688_100946637 | 3300005365 | Bacteria | 682 |
| 51 | Ga0070688_101109780 | 3300005365 | Bacteria | 633 |
| 52 | Ga0070659_100345404 | 3300005366 | Bacteria | 1248 |
| 53 | Ga0070659_100560527 | 3300005366 | Bacteria | 979 |
| 54 | Ga0070667_100349742 | 3300005367 | Bacteria | 1338 |
| 55 | Ga0070667_100656317 | 3300005367 | Bacteria | 969 |
| 56 | Ga0070703_10006895 | 3300005406 | Bacteria | 3187 |
| 57 | Ga0070714_100542434 | 3300005435 | Bacteria | 1113 |
| 58 | Ga0070713_100234062 | 3300005436 | Bacteria | 1671 |
| 59 | Ga0070713_101081728 | 3300005436 | Bacteria | 775 |
| 60 | Ga0070713_101976119 | 3300005436 | Bacteria | 566 |
| 61 | Ga0070713_102267855 | 3300005436 | Bacteria | 526 |
| 62 | Ga0070710_11149834 | 3300005437 | Bacteria | 572 |
| 63 | Ga0070701_10004277 | 3300005438 | Bacteria | 5761 |
| 64 | Ga0070701_10284544 | 3300005438 | Bacteria | 1011 |
| 65 | Ga0070701_10576572 | 3300005438 | Bacteria | 742 |
| 66 | Ga0070711_100048282 | 3300005439 | Bacteria | 2909 |
| 67 | Ga0070705_100008111 | 3300005440 | Bacteria | 5195 |
| 68 | Ga0070705_100045233 | 3300005440 | Bacteria | 2532 |
| 69 | Ga0070705_100061337 | 3300005440 | Bacteria | 2234 |
| 70 | Ga0070705_100114960 | 3300005440 | Bacteria | 1727 |
| 71 | Ga0070705_101007065 | 3300005440 | Bacteria | 677 |
| 72 | Ga0070705_101662880 | 3300005440 | Bacteria | 539 |
| 73 | Ga0070700_100013216 | 3300005441 | Bacteria | 4633 |
| 74 | Ga0070700_100622564 | 3300005441 | Bacteria | 849 |
| 75 | Ga0070694_100285083 | 3300005444 | Bacteria | 1260 |
| 76 | Ga0070694_100317209 | 3300005444 | Bacteria | 1199 |
| 77 | Ga0070708_100002882 | 3300005445 | Bacteria | 13353 |
| 78 | Ga0070708_100014721 | 3300005445 | Bacteria | 6444 |
| 79 | Ga0070708_100051650 | 3300005445 | Bacteria | 3643 |
| 80 | Ga0070708_100114650 | 3300005445 | Bacteria | 2480 |
| 81 | Ga0070708_100175853 | 3300005445 | Bacteria | 2000 |
| 82 | Ga0070708_101667802 | 3300005445 | Bacteria | 593 |
| 83 | Ga0070678_100055745 | 3300005456 | Bacteria | 2887 |
| 84 | Ga0070678_100070399 | 3300005456 | Bacteria | 2614 |
| 85 | Ga0070678_100484892 | 3300005456 | Bacteria | 1088 |
| 86 | Ga0070678_100667602 | 3300005456 | Bacteria | 934 |
| 87 | Ga0070678_100738527 | 3300005456 | Bacteria | 889 |
| 88 | Ga0070678_101498867 | 3300005456 | Bacteria | 631 |
| 89 | Ga0070662_101119680 | 3300005457 | Bacteria | 676 |
| 90 | Ga0070681_10162793 | 3300005458 | Bacteria | 2155 |
| 91 | Ga0070681_10302860 | 3300005458 | Bacteria | 1508 |
| 92 | Ga0070681_10551492 | 3300005458 | Bacteria | 1066 |
| 93 | Ga0070681_10622920 | 3300005458 | Bacteria | 994 |
| 94 | Ga0070681_11597320 | 3300005458 | Bacteria | 577 |
| 95 | Ga0068867_100034170 | 3300005459 | Bacteria | 3685 |
| 96 | Ga0068867_100043147 | 3300005459 | Bacteria | 3301 |
| 97 | Ga0068867_100065006 | 3300005459 | Bacteria | 2713 |
| 98 | Ga0068867_100316760 | 3300005459 | Bacteria | 1291 |
| 99 | Ga0068867_100491185 | 3300005459 | Bacteria | 1053 |
| 100 | Ga0070706_100012452 | 3300005467 | Bacteria | 7880 |
| 101 | Ga0070706_100229885 | 3300005467 | Bacteria | 1731 |
| 102 | Ga0070706_100830639 | 3300005467 | Bacteria | 855 |
| 103 | Ga0070707_100086130 | 3300005468 | Bacteria | 3038 |
| 104 | Ga0070698_100007643 | 3300005471 | Bacteria | 11696 |
| 105 | Ga0070698_101171535 | 3300005471 | Bacteria | 718 |
| 106 | Ga0070699_100715826 | 3300005518 | Bacteria | 915 |
| 107 | Ga0070699_100864895 | 3300005518 | Bacteria | 828 |
| 108 | Ga0070684_101005174 | 3300005535 | Bacteria | 783 |
| 109 | Ga0070697_100586951 | 3300005536 | Bacteria | 979 |
| 110 | Ga0070697_100686513 | 3300005536 | Bacteria | 903 |
| 111 | Ga0070672_100285086 | 3300005543 | Bacteria | 1397 |
| 112 | Ga0070672_100362166 | 3300005543 | Bacteria | 1238 |
| 113 | Ga0070686_100043668 | 3300005544 | Bacteria | 2813 |
| 114 | Ga0070686_100638962 | 3300005544 | Bacteria | 843 |
| 115 | Ga0070686_101293685 | 3300005544 | Bacteria | 609 |
| 116 | Ga0070695_100004664 | 3300005545 | Bacteria | 8058 |
| 117 | Ga0070695_100384825 | 3300005545 | Bacteria | 1059 |
| 118 | Ga0070695_100915954 | 3300005545 | Bacteria | 709 |
| 119 | Ga0070696_100005392 | 3300005546 | Bacteria | 8530 |
| 120 | Ga0070696_100034118 | 3300005546 | Bacteria | 3500 |
| 121 | Ga0070696_100072784 | 3300005546 | Bacteria | 2421 |
| 122 | Ga0070696_101507314 | 3300005546 | Bacteria | 576 |
| 123 | Ga0070693_100136617 | 3300005547 | Bacteria | 1539 |
| 124 | Ga0070693_100726481 | 3300005547 | Bacteria | 729 |
| 125 | Ga0070665_100494877 | 3300005548 | Bacteria | 1234 |
| 126 | Ga0070665_100898040 | 3300005548 | Bacteria | 899 |
| 127 | Ga0070665_101499362 | 3300005548 | Bacteria | 683 |
| 128 | Ga0070704_100190204 | 3300005549 | Bacteria | 1649 |
| 129 | Ga0070704_100199142 | 3300005549 | Bacteria | 1615 |
| 130 | Ga0070704_100272886 | 3300005549 | Bacteria | 1398 |
| 131 | Ga0070704_100287871 | 3300005549 | Bacteria | 1364 |
| 132 | Ga0070704_100312409 | 3300005549 | Bacteria | 1314 |
| 133 | Ga0070704_100466094 | 3300005549 | Bacteria | 1091 |
| 134 | Ga0070704_101696730 | 3300005549 | Bacteria | 583 |
| 135 | Ga0068855_100535872 | 3300005563 | Bacteria | 1269 |
| 136 | Ga0070664_100178694 | 3300005564 | Bacteria | 1886 |
| 137 | Ga0070664_100411456 | 3300005564 | Bacteria | 1238 |
| 138 | Ga0070664_100625012 | 3300005564 | Bacteria | 1000 |
| 139 | Ga0070664_100936687 | 3300005564 | Bacteria | 813 |
| 140 | Ga0068854_100914679 | 3300005578 | Bacteria | 772 |
| 141 | Ga0068854_100938550 | 3300005578 | Bacteria | 762 |
| 142 | Ga0068856_100316577 | 3300005614 | Bacteria | 1578 |
| 143 | Ga0068856_101090923 | 3300005614 | Bacteria | 816 |
| 144 | Ga0068856_102303174 | 3300005614 | Bacteria | 547 |
| 145 | Ga0070702_100070055 | 3300005615 | Bacteria | 2068 |
| 146 | Ga0070702_100203069 | 3300005615 | Bacteria | 1313 |
| 147 | Ga0070702_100267871 | 3300005615 | Bacteria | 1166 |
| 148 | Ga0070702_100273695 | 3300005615 | Bacteria | 1156 |
| 149 | Ga0068852_100063116 | 3300005616 | Bacteria | 3225 |
| 150 | Ga0068852_102255945 | 3300005616 | Bacteria | 566 |
| 151 | Ga0068859_100265412 | 3300005617 | Bacteria | 1809 |
| 152 | Ga0068859_102896517 | 3300005617 | Bacteria | 526 |
| 153 | Ga0068864_100024465 | 3300005618 | Bacteria | 5081 |
| 154 | Ga0068864_100551791 | 3300005618 | Bacteria | 1114 |
| 155 | Ga0068866_10165170 | 3300005718 | Bacteria | 1294 |
| 156 | Ga0068861_100269045 | 3300005719 | Bacteria | 1463 |
| 157 | Ga0068861_100383439 | 3300005719 | Bacteria | 1242 |
| 158 | Ga0068861_101190162 | 3300005719 | Bacteria | 736 |
| 159 | Ga0068861_101196440 | 3300005719 | Bacteria | 735 |
| 160 | Ga0068861_101233368 | 3300005719 | Bacteria | 724 |
| 161 | Ga0068851_10768583 | 3300005834 | Bacteria | 597 |
| 162 | Ga0068870_10169134 | 3300005840 | Bacteria | 1303 |
| 163 | Ga0068863_100163339 | 3300005841 | Bacteria | 2135 |
| 164 | Ga0068863_100425701 | 3300005841 | Bacteria | 1301 |
| 165 | Ga0068858_100230507 | 3300005842 | Bacteria | 1756 |
| 166 | Ga0068858_100660742 | 3300005842 | Bacteria | 1016 |
| 167 | Ga0068860_100190707 | 3300005843 | Bacteria | 1984 |
| 168 | Ga0068860_100354464 | 3300005843 | Bacteria | 1444 |
| 169 | Ga0068860_100451668 | 3300005843 | Bacteria | 1278 |
| 170 | Ga0068860_100527037 | 3300005843 | Bacteria | 1182 |
| 171 | Ga0068862_101266403 | 3300005844 | Bacteria | 738 |
| 172 | Ga0068862_102533836 | 3300005844 | Bacteria | 525 |
| 173 | Ga0081455_10166672 | 3300005937 | Bacteria | 1682 |
| 174 | Ga0081539_10008891 | 3300005985 | Bacteria | 8576 |
| 175 | Ga0081539_10011391 | 3300005985 | Bacteria | 7035 |
| 176 | Ga0075365_10128755 | 3300006038 | Bacteria | 1751 |
| 177 | Ga0075365_10436419 | 3300006038 | Bacteria | 925 |
| 178 | Ga0075365_10438268 | 3300006038 | Bacteria | 923 |
| 179 | Ga0075365_10782487 | 3300006038 | Bacteria | 673 |
| 180 | Ga0075363_100037884 | 3300006048 | Bacteria | 2533 |
| 181 | Ga0075364_10123739 | 3300006051 | Bacteria | 1732 |
| 182 | Ga0075364_10421099 | 3300006051 | Bacteria | 912 |
| 183 | Ga0070712_100332471 | 3300006175 | Bacteria | 1238 |
| 184 | Ga0070712_100589458 | 3300006175 | Bacteria | 940 |
| 185 | Ga0070712_100837696 | 3300006175 | Bacteria | 791 |
| 186 | Ga0075367_10044620 | 3300006178 | Bacteria | 2600 |
| 187 | Ga0075367_10220586 | 3300006178 | Bacteria | 1187 |
| 188 | Ga0097621_100214381 | 3300006237 | Bacteria | 1676 |
| 189 | Ga0075370_10352225 | 3300006353 | Bacteria | 880 |
| 190 | Ga0068871_100450337 | 3300006358 | Bacteria | 1154 |
| 191 | Ga0068871_102431149 | 3300006358 | Bacteria | 500 |
| 192 | Ga0075428_100000238 | 3300006844 | Bacteria | 53672 |
| 193 | Ga0075428_102135036 | 3300006844 | Bacteria | 579 |
| 194 | Ga0075430_100029304 | 3300006846 | Bacteria | 4671 |
| 195 | Ga0075430_100368645 | 3300006846 | Bacteria | 1186 |
| 196 | Ga0075430_100691089 | 3300006846 | Bacteria | 841 |
| 197 | Ga0075433_10433733 | 3300006852 | Bacteria | 1158 |
| 198 | Ga0075433_11892593 | 3300006852 | Bacteria | 512 |
| 199 | Ga0075434_100004540 | 3300006871 | Bacteria | 12533 |
| 200 | Ga0075434_100283026 | 3300006871 | Bacteria | 1677 |
| 201 | Ga0075434_100534892 | 3300006871 | Bacteria | 1192 |
| 202 | Ga0075434_101926987 | 3300006871 | Bacteria | 597 |
| 203 | Ga0068865_100170866 | 3300006881 | Bacteria | 1666 |
| 204 | Ga0068865_100292548 | 3300006881 | Bacteria | 1301 |
| 205 | Ga0068865_101007708 | 3300006881 | Bacteria | 729 |
| 206 | Ga0075436_100441394 | 3300006914 | Bacteria | 947 |
| 207 | Ga0097620_100265432 | 3300006931 | Bacteria | 1809 |
| 208 | Ga0097620_102896492 | 3300006931 | Bacteria | 526 |
| 209 | Ga0075435_100304394 | 3300007076 | Bacteria | 1363 |
| 210 | Ga0075435_100436464 | 3300007076 | Bacteria | 1129 |
| 211 | Ga0075435_100735764 | 3300007076 | Bacteria | 858 |
| 212 | Ga0075435_101449258 | 3300007076 | Bacteria | 602 |
| 213 | Ga0105251_10150715 | 3300009011 | Bacteria | 1050 |
| 214 | Ga0105251_10156309 | 3300009011 | Bacteria | 1029 |
| 215 | Ga0105240_11571517 | 3300009093 | Bacteria | 689 |
| 216 | Ga0105240_11595821 | 3300009093 | Bacteria | 683 |
| 217 | Ga0105240_12017406 | 3300009093 | Bacteria | 599 |
| 218 | Ga0111539_11173410 | 3300009094 | Bacteria | 892 |
| 219 | Ga0105245_10010831 | 3300009098 | Bacteria | 7934 |
| 220 | Ga0105245_10107113 | 3300009098 | Bacteria | 2595 |
| 221 | Ga0105245_10182636 | 3300009098 | Bacteria | 2005 |
| 222 | Ga0105245_10395950 | 3300009098 | Bacteria | 1379 |
| 223 | Ga0105245_10614923 | 3300009098 | Bacteria | 1114 |
| 224 | Ga0105245_10711509 | 3300009098 | Bacteria | 1038 |
| 225 | Ga0105245_12587692 | 3300009098 | Bacteria | 561 |
| 226 | Ga0105247_10048269 | 3300009101 | Bacteria | 2615 |
| 227 | Ga0105247_10157730 | 3300009101 | Bacteria | 1500 |
| 228 | Ga0105247_10787307 | 3300009101 | Bacteria | 724 |
| 229 | Ga0105247_11124999 | 3300009101 | Bacteria | 621 |
| 230 | Ga0114129_10013928 | 3300009147 | Bacteria | 11456 |
| 231 | Ga0114129_10095509 | 3300009147 | Bacteria | 4117 |
| 232 | Ga0114129_10306806 | 3300009147 | Bacteria | 2114 |
| 233 | Ga0114129_11533637 | 3300009147 | Bacteria | 818 |
| 234 | Ga0114129_12077752 | 3300009147 | Bacteria | 686 |
| 235 | Ga0105243_10010219 | 3300009148 | Bacteria | 7133 |
| 236 | Ga0105243_10117905 | 3300009148 | Bacteria | 2233 |
| 237 | Ga0105243_10184492 | 3300009148 | Bacteria | 1817 |
| 238 | Ga0105243_10381517 | 3300009148 | Bacteria | 1304 |
| 239 | Ga0105243_10517779 | 3300009148 | Bacteria | 1134 |
| 240 | Ga0105243_11100438 | 3300009148 | Bacteria | 803 |
| 241 | Ga0105243_11136870 | 3300009148 | Bacteria | 791 |
| 242 | Ga0105241_11183774 | 3300009174 | Bacteria | 723 |
| 243 | Ga0105242_10014288 | 3300009176 | Bacteria | 6150 |
| 244 | Ga0105242_10048621 | 3300009176 | Bacteria | 3448 |
| 245 | Ga0105242_10141150 | 3300009176 | Bacteria | 2090 |
| 246 | Ga0105242_10162792 | 3300009176 | Bacteria | 1954 |
| 247 | Ga0105242_11035059 | 3300009176 | Bacteria | 831 |
| 248 | Ga0105242_11425123 | 3300009176 | Bacteria | 721 |
| 249 | Ga0105242_12932557 | 3300009176 | Bacteria | 527 |
| 250 | Ga0105248_10029357 | 3300009177 | Bacteria | 6135 |
| 251 | Ga0105248_11251043 | 3300009177 | Bacteria | 839 |
| 252 | Ga0105248_11410131 | 3300009177 | Bacteria | 788 |
| 253 | Ga0105248_11961100 | 3300009177 | Bacteria | 665 |
| 254 | Ga0105238_10151244 | 3300009551 | Bacteria | 2296 |
| 255 | Ga0105238_10189405 | 3300009551 | Bacteria | 2033 |
| 256 | Ga0105238_10252118 | 3300009551 | Bacteria | 1744 |
| 257 | Ga0105238_10766213 | 3300009551 | Bacteria | 979 |
| 258 | Ga0105238_11066666 | 3300009551 | Bacteria | 830 |
| 259 | Ga0105238_11231728 | 3300009551 | Bacteria | 773 |
| 260 | Ga0105238_11302686 | 3300009551 | Bacteria | 752 |
| 261 | Ga0105249_10180331 | 3300009553 | Bacteria | 2054 |
| 262 | Ga0105249_10474493 | 3300009553 | Bacteria | 1293 |
| 263 | Ga0105249_10839747 | 3300009553 | Bacteria | 984 |
| 264 | Ga0105249_11076305 | 3300009553 | Bacteria | 874 |
| 265 | Ga0105239_10102797 | 3300010375 | Bacteria | 3162 |
| 266 | Ga0105239_10109180 | 3300010375 | Bacteria | 3066 |
| 267 | Ga0105239_10882087 | 3300010375 | Bacteria | 1026 |
| 268 | Ga0105239_13580572 | 3300010375 | Bacteria | 505 |
| 269 | Ga0105246_10460966 | 3300011119 | Bacteria | 1070 |
| 270 | Ga0157341_1010957 | 3300012494 | Bacteria | 778 |
| 271 | Ga0157341_1014538 | 3300012494 | Bacteria | 715 |
| 272 | Ga0154019_138530 | 3300013044 | Bacteria | 543 |
| 273 | Ga0157371_10413641 | 3300013102 | Bacteria | 988 |
| 274 | Ga0157370_10993703 | 3300013104 | Bacteria | 760 |
| 275 | Ga0157369_10404394 | 3300013105 | Bacteria | 1416 |
| 276 | Ga0157374_10128946 | 3300013296 | Bacteria | 2446 |
| 277 | Ga0157374_11419756 | 3300013296 | Bacteria | 717 |
| 278 | Ga0157374_12567545 | 3300013296 | Bacteria | 537 |
| 279 | Ga0157378_10011509 | 3300013297 | Bacteria | 7745 |
| 280 | Ga0157378_10114709 | 3300013297 | Bacteria | 2475 |
| 281 | Ga0157378_10200215 | 3300013297 | Bacteria | 1888 |
| 282 | Ga0157378_10245590 | 3300013297 | Bacteria | 1712 |
| 283 | Ga0157378_10291057 | 3300013297 | Bacteria | 1577 |
| 284 | Ga0157378_10474056 | 3300013297 | Bacteria | 1246 |
| 285 | Ga0157378_10490338 | 3300013297 | Bacteria | 1226 |
| 286 | Ga0157378_11859649 | 3300013297 | Bacteria | 651 |
| 287 | Ga0157378_13176213 | 3300013297 | Bacteria | 510 |
| 288 | Ga0163162_10157494 | 3300013306 | Bacteria | 2392 |
| 289 | Ga0163162_10317375 | 3300013306 | Bacteria | 1691 |
| 290 | Ga0163162_10912293 | 3300013306 | Bacteria | 991 |
| 291 | Ga0157372_11397127 | 3300013307 | Bacteria | 807 |
| 292 | Ga0157372_11728799 | 3300013307 | Bacteria | 720 |
| 293 | Ga0157372_12194534 | 3300013307 | Bacteria | 634 |
| 294 | Ga0157372_12695434 | 3300013307 | Bacteria | 570 |
| 295 | Ga0157372_13364805 | 3300013307 | Bacteria | 509 |
| 296 | Ga0157375_11141309 | 3300013308 | Bacteria | 913 |
| 297 | Ga0157375_11405038 | 3300013308 | Bacteria | 822 |
| 298 | Ga0157375_11779705 | 3300013308 | Bacteria | 730 |
| 299 | Ga0163163_10050944 | 3300014325 | Bacteria | 4080 |
| 300 | Ga0163163_10110359 | 3300014325 | Bacteria | 2779 |
| 301 | Ga0163163_10709971 | 3300014325 | Bacteria | 1069 |
| 302 | Ga0163163_11132635 | 3300014325 | Bacteria | 845 |
| 303 | Ga0163163_11479394 | 3300014325 | Bacteria | 740 |
| 304 | Ga0157380_10304111 | 3300014326 | Bacteria | 1471 |
| 305 | Ga0157380_10341821 | 3300014326 | Bacteria | 1396 |
| 306 | Ga0157380_10900440 | 3300014326 | Bacteria | 911 |
| 307 | Ga0157380_11071261 | 3300014326 | Bacteria | 844 |
| 308 | Ga0182008_10015863 | 3300014497 | Bacteria | 3923 |
| 309 | Ga0157377_10978391 | 3300014745 | Bacteria | 639 |
| 310 | Ga0157379_10294062 | 3300014968 | Bacteria | 1479 |
| 311 | Ga0157379_10378122 | 3300014968 | Bacteria | 1299 |
| 312 | Ga0157379_10524474 | 3300014968 | Bacteria | 1100 |
| 313 | Ga0157379_11222197 | 3300014968 | Bacteria | 723 |
| 314 | Ga0157379_11447265 | 3300014968 | Bacteria | 667 |
| 315 | Ga0157379_11859297 | 3300014968 | Bacteria | 593 |
| 316 | Ga0157376_10562994 | 3300014969 | Bacteria | 1129 |
| 317 | Ga0157376_11402738 | 3300014969 | Bacteria | 730 |
| 318 | Ga0163161_10224975 | 3300017792 | Bacteria | 1454 |
| 319 | Ga0163161_10635450 | 3300017792 | Bacteria | 883 |
| 320 | Ga0163161_10988827 | 3300017792 | Bacteria | 718 |
| 321 | Ga0197907_10066917 | 3300020069 | Bacteria | 745 |
| 322 | Ga0197907_10138522 | 3300020069 | Bacteria | 1308 |
| 323 | Ga0197907_10234640 | 3300020069 | Bacteria | 1077 |
| 324 | Ga0197907_10258355 | 3300020069 | Bacteria | 3502 |
| 325 | Ga0197907_10620110 | 3300020069 | Bacteria | 1696 |
| 326 | Ga0197907_10658576 | 3300020069 | Bacteria | 898 |
| 327 | Ga0206356_11448412 | 3300020070 | Bacteria | 1484 |
| 328 | Ga0206356_11662501 | 3300020070 | Bacteria | 887 |
| 329 | Ga0206356_11884025 | 3300020070 | Bacteria | 1684 |
| 330 | Ga0206349_1416863 | 3300020075 | Bacteria | 1123 |
| 331 | Ga0206349_1666946 | 3300020075 | Bacteria | 1584 |
| 332 | Ga0206351_10988002 | 3300020077 | Bacteria | 775 |
| 333 | Ga0206352_10352027 | 3300020078 | Bacteria | 790 |
| 334 | Ga0206352_10877631 | 3300020078 | Bacteria | 544 |
| 335 | Ga0206350_10761397 | 3300020080 | Bacteria | 1427 |
| 336 | Ga0206350_10920527 | 3300020080 | Bacteria | 1625 |
| 337 | Ga0206354_11473189 | 3300020081 | Bacteria | 655 |
| 338 | Ga0206354_11626811 | 3300020081 | Bacteria | 3146 |
| 339 | Ga0206353_11486044 | 3300020082 | Bacteria | 610 |
| 340 | Ga0206353_11522619 | 3300020082 | Bacteria | 851 |
| 341 | Ga0206353_11601702 | 3300020082 | Bacteria | 811 |
| 342 | Ga0206353_11684874 | 3300020082 | Bacteria | 692 |
| 343 | Ga0206353_11971528 | 3300020082 | Bacteria | 1011 |
| 344 | Ga0154015_1336961 | 3300020610 | Bacteria | 1380 |
| 345 | Ga0213873_10004180 | 3300021358 | Bacteria | 2672 |
| 346 | Ga0213876_10102352 | 3300021384 | Bacteria | 1518 |
| 347 | Ga0213876_10324749 | 3300021384 | Bacteria | 818 |
| 348 | Ga0213875_10169515 | 3300021388 | Bacteria | 1025 |
| 349 | Ga0213871_10121533 | 3300021441 | Bacteria | 779 |
| 350 | Ga0224712_10019428 | 3300022467 | Bacteria | 2291 |
| 351 | Ga0224712_10028710 | 3300022467 | Bacteria | 1991 |
| 352 | Ga0224712_10227980 | 3300022467 | Bacteria | 855 |
| 353 | Ga0224712_10228245 | 3300022467 | Bacteria | 854 |
| 354 | Ga0224572_1004275 | 3300024225 | Bacteria | 2472 |
| 355 | Ga0207656_10665156 | 3300025321 | Bacteria | 533 |
| 356 | Ga0207653_10000045 | 3300025885 | Bacteria | 94691 |
| 357 | Ga0207682_10267410 | 3300025893 | Bacteria | 798 |
| 358 | Ga0207692_10587399 | 3300025898 | Bacteria | 715 |
| 359 | Ga0207692_10681883 | 3300025898 | Bacteria | 666 |
| 360 | Ga0207642_10068032 | 3300025899 | Bacteria | 1683 |
| 361 | Ga0207642_10219840 | 3300025899 | Bacteria | 1061 |
| 362 | Ga0207642_10608802 | 3300025899 | Bacteria | 681 |
| 363 | Ga0207642_10643848 | 3300025899 | Bacteria | 663 |
| 364 | Ga0207642_10689118 | 3300025899 | Bacteria | 643 |
| 365 | Ga0207642_10743450 | 3300025899 | Bacteria | 621 |
| 366 | Ga0207642_10900498 | 3300025899 | Bacteria | 567 |
| 367 | Ga0207710_10168589 | 3300025900 | Bacteria | 1070 |
| 368 | Ga0207710_10246278 | 3300025900 | Bacteria | 893 |
| 369 | Ga0207680_10114063 | 3300025903 | Bacteria | 1758 |
| 370 | Ga0207680_10904093 | 3300025903 | Bacteria | 633 |
| 371 | Ga0207680_11068818 | 3300025903 | Bacteria | 577 |
| 372 | Ga0207685_10020610 | 3300025905 | Bacteria | 2195 |
| 373 | Ga0207645_10044165 | 3300025907 | Bacteria | 2852 |
| 374 | Ga0207645_10538690 | 3300025907 | Bacteria | 791 |
| 375 | Ga0207643_10116730 | 3300025908 | Bacteria | 1577 |
| 376 | Ga0207684_10016123 | 3300025910 | Bacteria | 6419 |
| 377 | Ga0207684_10017792 | 3300025910 | Bacteria | 6096 |
| 378 | Ga0207684_10211663 | 3300025910 | Bacteria | 1672 |
| 379 | Ga0207684_10492400 | 3300025910 | Bacteria | 1051 |
| 380 | Ga0207684_11021094 | 3300025910 | Bacteria | 691 |
| 381 | Ga0207654_10189935 | 3300025911 | Bacteria | 1345 |
| 382 | Ga0207654_10842662 | 3300025911 | Bacteria | 663 |
| 383 | Ga0207707_10135393 | 3300025912 | Bacteria | 2154 |
| 384 | Ga0207707_10250725 | 3300025912 | Bacteria | 1538 |
| 385 | Ga0207707_10563986 | 3300025912 | Bacteria | 966 |
| 386 | Ga0207693_10009145 | 3300025915 | Bacteria | 8089 |
| 387 | Ga0207660_10430911 | 3300025917 | Bacteria | 1065 |
| 388 | Ga0207660_10719411 | 3300025917 | Bacteria | 814 |
| 389 | Ga0207662_10336092 | 3300025918 | Bacteria | 1011 |
| 390 | Ga0207657_10308237 | 3300025919 | Bacteria | 1253 |
| 391 | Ga0207657_10573879 | 3300025919 | Bacteria | 881 |
| 392 | Ga0207657_10930695 | 3300025919 | Bacteria | 669 |
| 393 | Ga0207652_11664138 | 3300025921 | Bacteria | 543 |
| 394 | Ga0207646_10363971 | 3300025922 | Bacteria | 1306 |
| 395 | Ga0207646_11265922 | 3300025922 | Bacteria | 645 |
| 396 | Ga0207681_10166888 | 3300025923 | Bacteria | 1665 |
| 397 | Ga0207694_10083233 | 3300025924 | Bacteria | 2516 |
| 398 | Ga0207694_10083865 | 3300025924 | Bacteria | 2506 |
| 399 | Ga0207694_10540638 | 3300025924 | Bacteria | 977 |
| 400 | Ga0207694_10880160 | 3300025924 | Bacteria | 757 |
| 401 | Ga0207650_11199540 | 3300025925 | Bacteria | 646 |
| 402 | Ga0207659_10222511 | 3300025926 | Bacteria | 1518 |
| 403 | Ga0207659_10276540 | 3300025926 | Bacteria | 1371 |
| 404 | Ga0207659_10504945 | 3300025926 | Bacteria | 1024 |
| 405 | Ga0207659_10763910 | 3300025926 | Bacteria | 830 |
| 406 | Ga0207687_10004768 | 3300025927 | Bacteria | 9019 |
| 407 | Ga0207687_10052063 | 3300025927 | Bacteria | 2856 |
| 408 | Ga0207687_10075251 | 3300025927 | Bacteria | 2423 |
| 409 | Ga0207687_10078661 | 3300025927 | Bacteria | 2375 |
| 410 | Ga0207687_10354080 | 3300025927 | Bacteria | 1197 |
| 411 | Ga0207687_10491070 | 3300025927 | Bacteria | 1024 |
| 412 | Ga0207687_11282036 | 3300025927 | Bacteria | 630 |
| 413 | Ga0207700_10156599 | 3300025928 | Bacteria | 1888 |
| 414 | Ga0207700_10941816 | 3300025928 | Bacteria | 773 |
| 415 | Ga0207664_10180339 | 3300025929 | Bacteria | 1813 |
| 416 | Ga0207644_10024696 | 3300025931 | Bacteria | 4127 |
| 417 | Ga0207644_10378813 | 3300025931 | Bacteria | 1154 |
| 418 | Ga0207644_10755044 | 3300025931 | Bacteria | 813 |
| 419 | Ga0207644_10906082 | 3300025931 | Bacteria | 739 |
| 420 | Ga0207690_10251186 | 3300025932 | Bacteria | 1366 |
| 421 | Ga0207690_10625782 | 3300025932 | Bacteria | 880 |
| 422 | Ga0207690_11094134 | 3300025932 | Bacteria | 664 |
| 423 | Ga0207706_10352156 | 3300025933 | Bacteria | 1280 |
| 424 | Ga0207686_10034275 | 3300025934 | Bacteria | 3038 |
| 425 | Ga0207686_10077774 | 3300025934 | Bacteria | 2155 |
| 426 | Ga0207686_10169437 | 3300025934 | Bacteria | 1538 |
| 427 | Ga0207686_10602952 | 3300025934 | Bacteria | 864 |
| 428 | Ga0207686_10658265 | 3300025934 | Bacteria | 829 |
| 429 | Ga0207686_10712261 | 3300025934 | Bacteria | 799 |
| 430 | Ga0207709_10041719 | 3300025935 | Bacteria | 2756 |
| 431 | Ga0207709_10063111 | 3300025935 | Bacteria | 2321 |
| 432 | Ga0207709_10096836 | 3300025935 | Bacteria | 1942 |
| 433 | Ga0207709_10185438 | 3300025935 | Bacteria | 1473 |
| 434 | Ga0207709_10333144 | 3300025935 | Bacteria | 1140 |
| 435 | Ga0207709_11224895 | 3300025935 | Bacteria | 619 |
| 436 | Ga0207670_10838529 | 3300025936 | Bacteria | 767 |
| 437 | Ga0207670_11715960 | 3300025936 | Bacteria | 534 |
| 438 | Ga0207669_10181517 | 3300025937 | Bacteria | 1509 |
| 439 | Ga0207669_10197025 | 3300025937 | Bacteria | 1459 |
| 440 | Ga0207669_10265581 | 3300025937 | Bacteria | 1286 |
| 441 | Ga0207669_10287396 | 3300025937 | Bacteria | 1243 |
| 442 | Ga0207704_10060997 | 3300025938 | Bacteria | 2336 |
| 443 | Ga0207704_10209774 | 3300025938 | Bacteria | 1432 |
| 444 | Ga0207704_10748357 | 3300025938 | Bacteria | 813 |
| 445 | Ga0207704_11564044 | 3300025938 | Bacteria | 566 |
| 446 | Ga0207691_11003204 | 3300025940 | Bacteria | 697 |
| 447 | Ga0207711_10121179 | 3300025941 | Bacteria | 2335 |
| 448 | Ga0207689_10042243 | 3300025942 | Bacteria | 3772 |
| 449 | Ga0207689_10159946 | 3300025942 | Bacteria | 1856 |
| 450 | Ga0207689_10193029 | 3300025942 | Bacteria | 1680 |
| 451 | Ga0207689_10512650 | 3300025942 | Bacteria | 1005 |
| 452 | Ga0207689_10624354 | 3300025942 | Bacteria | 907 |
| 453 | Ga0207661_10111867 | 3300025944 | Bacteria | 2311 |
| 454 | Ga0207661_10381523 | 3300025944 | Bacteria | 1276 |
| 455 | Ga0207661_10695409 | 3300025944 | Bacteria | 935 |
| 456 | Ga0207661_11004067 | 3300025944 | Bacteria | 769 |
| 457 | Ga0207679_10326778 | 3300025945 | Bacteria | 1330 |
| 458 | Ga0207679_10596116 | 3300025945 | Bacteria | 995 |
| 459 | Ga0207679_10670452 | 3300025945 | Bacteria | 939 |
| 460 | Ga0207679_10860936 | 3300025945 | Bacteria | 828 |
| 461 | Ga0207651_10219243 | 3300025960 | Bacteria | 1537 |
| 462 | Ga0207651_10315054 | 3300025960 | Bacteria | 1306 |
| 463 | Ga0207651_10962973 | 3300025960 | Bacteria | 762 |
| 464 | Ga0207712_10169521 | 3300025961 | Bacteria | 1705 |
| 465 | Ga0207712_10265400 | 3300025961 | Bacteria | 1394 |
| 466 | Ga0207712_10343007 | 3300025961 | Bacteria | 1239 |
| 467 | Ga0207712_11288300 | 3300025961 | Bacteria | 653 |
| 468 | Ga0207668_10337680 | 3300025972 | Bacteria | 1256 |
| 469 | Ga0207668_10580989 | 3300025972 | Bacteria | 974 |
| 470 | Ga0207640_10060121 | 3300025981 | Bacteria | 2510 |
| 471 | Ga0207640_10367029 | 3300025981 | Bacteria | 1162 |
| 472 | Ga0207640_10752220 | 3300025981 | Bacteria | 840 |
| 473 | Ga0207640_12059043 | 3300025981 | Bacteria | 517 |
| 474 | Ga0207677_10006919 | 3300026023 | Bacteria | 6235 |
| 475 | Ga0207677_10381996 | 3300026023 | Bacteria | 1189 |
| 476 | Ga0207677_11326933 | 3300026023 | Bacteria | 661 |
| 477 | Ga0207703_10031625 | 3300026035 | Bacteria | 4186 |
| 478 | Ga0207703_10063898 | 3300026035 | Bacteria | 3019 |
| 479 | Ga0207639_10877692 | 3300026041 | Bacteria | 838 |
| 480 | Ga0207678_10505220 | 3300026067 | Bacteria | 1054 |
| 481 | Ga0207708_10104624 | 3300026075 | Bacteria | 2193 |
| 482 | Ga0207708_10215765 | 3300026075 | Bacteria | 1535 |
| 483 | Ga0207708_10272688 | 3300026075 | Bacteria | 1369 |
| 484 | Ga0207708_10876864 | 3300026075 | Bacteria | 776 |
| 485 | Ga0207708_11465389 | 3300026075 | Bacteria | 599 |
| 486 | Ga0207708_11655153 | 3300026075 | Bacteria | 562 |
| 487 | Ga0207702_10380229 | 3300026078 | Bacteria | 1358 |
| 488 | Ga0207702_10722817 | 3300026078 | Bacteria | 982 |
| 489 | Ga0207702_12045325 | 3300026078 | Bacteria | 563 |
| 490 | Ga0207641_10271992 | 3300026088 | Bacteria | 1590 |
| 491 | Ga0207641_10283867 | 3300026088 | Bacteria | 1558 |
| 492 | Ga0207648_10004913 | 3300026089 | Bacteria | 13614 |
| 493 | Ga0207648_10066187 | 3300026089 | Bacteria | 3151 |
| 494 | Ga0207648_10213891 | 3300026089 | Bacteria | 1712 |
| 495 | Ga0207648_10563249 | 3300026089 | Bacteria | 1048 |
| 496 | Ga0207648_10927662 | 3300026089 | Bacteria | 814 |
| 497 | Ga0207676_10154279 | 3300026095 | Bacteria | 1981 |
| 498 | Ga0207675_100061154 | 3300026118 | Bacteria | 3516 |
| 499 | Ga0207675_100165622 | 3300026118 | Bacteria | 2111 |
| 500 | Ga0207675_100226152 | 3300026118 | Bacteria | 1804 |
| 501 | Ga0207675_100459885 | 3300026118 | Bacteria | 1262 |
| 502 | Ga0207675_101140219 | 3300026118 | Bacteria | 800 |
| 503 | Ga0207683_10015626 | 3300026121 | Bacteria | 6461 |
| 504 | Ga0207683_10032516 | 3300026121 | Bacteria | 4531 |
| 505 | Ga0207683_10058103 | 3300026121 | Bacteria | 3396 |
| 506 | Ga0207683_11218865 | 3300026121 | Bacteria | 697 |
| 507 | Ga0207698_10328741 | 3300026142 | Bacteria | 1435 |
| 508 | Ga0207698_10475130 | 3300026142 | Bacteria | 1211 |
| 509 | Ga0209966_1022750 | 3300027695 | Bacteria | 1228 |
| 510 | Ga0268266_10653763 | 3300028379 | Bacteria | 1012 |
| 511 | Ga0268266_11759336 | 3300028379 | Bacteria | 595 |
| 512 | Ga0268266_11944939 | 3300028379 | Bacteria | 562 |
| 513 | Ga0268265_10990808 | 3300028380 | Bacteria | 830 |
| 514 | Ga0268265_12342304 | 3300028380 | Bacteria | 541 |
| 515 | Ga0268264_10089199 | 3300028381 | Bacteria | 2655 |
| 516 | Ga0268264_10226672 | 3300028381 | Bacteria | 1723 |
| 517 | Ga0268264_10379671 | 3300028381 | Bacteria | 1353 |
| 518 | Ga0265334_10260162 | 3300028573 | Bacteria | 597 |
| 519 | Ga0265338_10038787 | 3300028800 | Bacteria | 4506 |
| 520 | Ga0265338_10070877 | 3300028800 | Bacteria | 2985 |
| 521 | Ga0265338_10571913 | 3300028800 | Bacteria | 789 |
| 522 | Ga0265338_10785825 | 3300028800 | Bacteria | 653 |
| 523 | Ga0314311_1025355 | 3300030733 | Bacteria | 674 |
| 524 | Ga0316183_1183600 | 3300030742 | Bacteria | 804 |
| 525 | Ga0316181_1287649 | 3300030744 | Bacteria | 740 |
| 526 | Ga0316182_1245851 | 3300030745 | Bacteria | 866 |
| 527 | Ga0265762_1049059 | 3300030760 | Bacteria | 843 |
| 528 | Ga0265762_1074873 | 3300030760 | Bacteria | 716 |
| 529 | Ga0265775_108444 | 3300030762 | Bacteria | 627 |
| 530 | Ga0265777_109454 | 3300030877 | Bacteria | 704 |
| 531 | Ga0265771_1005386 | 3300031010 | Bacteria | 812 |
| 532 | Ga0265760_10017276 | 3300031090 | Bacteria | 2072 |
| 533 | Ga0265332_10294011 | 3300031238 | Bacteria | 671 |
| 534 | Ga0265340_10291174 | 3300031247 | Bacteria | 725 |
| 535 | Ga0265327_10001686 | 3300031251 | Bacteria | 26426 |
| 536 | Ga0265327_10002304 | 3300031251 | Bacteria | 20409 |
| 537 | Ga0265327_10007639 | 3300031251 | Bacteria | 8285 |
| 538 | Ga0265327_10100083 | 3300031251 | Bacteria | 1400 |
| 539 | Ga0265316_10296449 | 3300031344 | Bacteria | 1179 |
| 540 | Ga0265316_10672727 | 3300031344 | Bacteria | 731 |
| 541 | Ga0307408_100340117 | 3300031548 | Bacteria | 1270 |
| 542 | Ga0307408_100518884 | 3300031548 | Bacteria | 1046 |
| 543 | Ga0316576_10326085 | 3300031727 | Bacteria | 1145 |
| 544 | Ga0316578_10049797 | 3300031728 | Bacteria | 2449 |
| 545 | Ga0307413_12058897 | 3300031824 | Bacteria | 515 |
| 546 | Ga0307410_10094631 | 3300031852 | Bacteria | 2128 |
| 547 | Ga0307412_10630648 | 3300031911 | Bacteria | 912 |
| 548 | Ga0307409_100018566 | 3300031995 | Bacteria | 4681 |
| 549 | Ga0307409_100078408 | 3300031995 | Bacteria | 2657 |
| 550 | Ga0307416_101200879 | 3300032002 | Bacteria | 864 |
| 551 | Ga0307416_101484776 | 3300032002 | Bacteria | 784 |
| 552 | Ga0307416_101994034 | 3300032002 | Bacteria | 683 |
| 553 | Ga0307416_102940131 | 3300032002 | Bacteria | 570 |
| 554 | Ga0307414_10027589 | 3300032004 | Bacteria | 3672 |
| 555 | Ga0307411_10229688 | 3300032005 | Bacteria | 1445 |
| 556 | Ga0373930_0001122 | 3300034816 | Bacteria | 3897 |
| 557 | Ga0373948_0001464 | 3300034817 | Bacteria | 3283 |
| 558 | Ga0373959_0116446 | 3300034820 | Bacteria | 650 |
| 559 | Ga0373926_0002170 | 3300035083 | Bacteria | 6180 |
| 560 | Ga0373928_0007240 | 3300035084 | Bacteria | 2139 |
| 561 | Ga0373929_0100420 | 3300035085 | Bacteria | 729 |
| 562 | Ga0373934_0177926 | 3300035086 | Bacteria | 874 |
| 563 | Ga0373934_0380024 | 3300035086 | Bacteria | 589 |
| 564 | Ga0373944_0001156 | 3300035089 | Bacteria | 6571 |
| 565 | Ga0373951_0007578 | 3300035091 | Bacteria | 2464 |
| 566 | Ga0373923_0385662 | 3300035111 | Bacteria | 673 |
| 567 | Ga0373932_0000128 | 3300035112 | Bacteria | 21346 |
| 568 | Ga0373932_0035608 | 3300035112 | Bacteria | 1408 |
| 569 | Ga0373932_0439123 | 3300035112 | Bacteria | 511 |
| 570 | Ga0373936_0009500 | 3300035113 | Bacteria | 3666 |
| 571 | Ga0373939_0261088 | 3300035114 | Bacteria | 678 |
| 572 | Ga0373945_0004843 | 3300035116 | Bacteria | 4287 |
| 573 | Ga0373953_0120121 | 3300035117 | Bacteria | 1116 |
| 574 | Ga0373954_0280577 | 3300035118 | Bacteria | 821 |
| 575 | Ga0373960_0123381 | 3300035121 | Bacteria | 862 |
| 576 | Ga0373943_0011049 | 3300035170 | Bacteria | 4055 |
| 577 | Ga0373943_0142890 | 3300035170 | Bacteria | 1291 |
| 578 | Ga0373943_0460647 | 3300035170 | Bacteria | 740 |
| 579 | Ga0373946_0002234 | 3300035171 | Bacteria | 6833 |
| 580 | Ga0373955_0104717 | 3300035172 | Bacteria | 1628 |
| 581 | Ga0373961_0011680 | 3300035241 | Bacteria | 2183 |
| 582 | Ga0373961_0110361 | 3300035241 | Bacteria | 901 |
| 583 | Ga0373924_0253362 | 3300035410 | Bacteria | 779 |
| 584 | Ga0373931_0000003 | 3300035691 | Bacteria | 560286 |
| 585 | Ga0373931_0000106 | 3300035691 | Bacteria | 38061 |
| 586 | Ga0373931_0304222 | 3300035691 | Bacteria | 986 |
| 587 | Ga0373935_0022388 | 3300035692 | Bacteria | 3874 |
| 588 | Ga0373935_1076332 | 3300035692 | Bacteria | 598 |
| 589 | Ga0373927_0011849 | 3300035695 | Bacteria | 5807 |
| 590 | Ga0373927_0884676 | 3300035695 | Bacteria | 590 |
| 591 | Ga0373933_0089488 | 3300035724 | Bacteria | 1898 |
| 592 | Ga0373947_0002057 | 3300035725 | Bacteria | 12270 |
| 593 | Ga0373947_0733849 | 3300035725 | Bacteria | 674 |
| 594 | Ga0373937_0334807 | 3300036401 | Bacteria | 1433 |
| 595 | Ga0373937_1393493 | 3300036401 | Bacteria | 649 |
| 596 | Ga0372808_047244 | 3300036459 | Bacteria | 616 |
| 597 | Ga0316584_0264961 | 3300036712 | Bacteria | 1252 |
| 598 | Ga0373925_0021904 | 3300037068 | Bacteria | 4658 |
| 599 | Ga0373925_1128285 | 3300037068 | Bacteria | 645 |
| 600 | Ga0395900_0373303 | 3300037418 | Bacteria | 1396 |
| 601 | Ga0395898_0059374 | 3300037466 | Bacteria | 3721 |
| 602 | Ga0436364_0866303 | 3300037853 | Bacteria | 1972 |
| 603 | Ga0436364_1329927 | 3300037853 | Bacteria | 2091 |
| 604 | Ga0436364_1381779 | 3300037853 | Bacteria | 1253 |
| 605 | Ga0395901_0017551 | 3300038443 | Bacteria | 7306 |
| 606 | Ga0395901_0444755 | 3300038443 | Bacteria | 1326 |
| 607 | Ga0436365_0757378 | 3300039437 | Bacteria | 1028 |
| 608 | Ga0436365_0825774 | 3300039437 | Bacteria | 4718 |
| 609 | Ga0436365_1123200 | 3300039437 | Bacteria | 3671 |
| 610 | Ga0436365_1153046 | 3300039437 | Bacteria | 553 |
| 611 | Ga0436365_1306079 | 3300039437 | Bacteria | 1195 |
| 612 | Ga0436365_1432336 | 3300039437 | Bacteria | 586 |
| 613 | Ga0436365_1761886 | 3300039437 | Bacteria | 1682 |
| 614 | Ga0436365_1808656 | 3300039437 | Bacteria | 3808 |
| 615 | Ga0436365_1894830 | 3300039437 | Bacteria | 847 |
| 616 | Ga0436360_0096903 | 3300039438 | Bacteria | 3667 |
| 617 | Ga0436360_0376719 | 3300039438 | Bacteria | 984 |
| 618 | Ga0436360_0496509 | 3300039438 | Bacteria | 533 |
| 619 | Ga0436360_0828962 | 3300039438 | Bacteria | 1621 |
| 620 | Ga0436361_0130315 | 3300039447 | Bacteria | 4213 |
| 621 | Ga0436361_0749762 | 3300039447 | Bacteria | 803 |
| 622 | Ga0436363_0601662 | 3300039450 | Bacteria | 620 |
| 623 | Ga0436363_1014237 | 3300039450 | Bacteria | 774 |
| 624 | Ga0436363_1406155 | 3300039450 | Bacteria | 1765 |
| 625 | Ga0436363_1682249 | 3300039450 | Bacteria | 508 |
| 626 | Ga0436362_0151148 | 3300039453 | Bacteria | 8035 |
| 627 | Ga0436362_0209718 | 3300039453 | Bacteria | 2519 |
| 628 | Ga0436362_0667111 | 3300039453 | Bacteria | 592 |
| 629 | Ga0436362_0750007 | 3300039453 | Bacteria | 2971 |
| 630 | Ga0436362_0953726 | 3300039453 | Bacteria | 1453 |
| 631 | Ga0436362_1076925 | 3300039453 | Bacteria | 1202 |
| 632 | Ga0436362_1116774 | 3300039453 | Bacteria | 903 |
| 633 | Ga0436362_1153288 | 3300039453 | Bacteria | 609 |
| 634 | Ga0439436_0021096 | 3300041404 | Bacteria | 1939 |
| 635 | Ga0439438_143844 | 3300041405 | Bacteria | 570 |
| 636 | Ga0439461_0037616 | 3300041410 | Bacteria | 1034 |
| 637 | Ga0439466_0168151 | 3300041411 | Bacteria | 670 |
| 638 | Ga0451789_0615416 | 3300041443 | Bacteria | 565 |
| 639 | Ga0451802_0378443 | 3300041460 | Bacteria | 582 |
| 640 | Ga0451804_0819133 | 3300041463 | Bacteria | 564 |
| 641 | Ga0451843_0706509 | 3300041509 | Bacteria | 529 |
| 642 | Ga0451855_0509808 | 3300041511 | Bacteria | 626 |
| 643 | Ga0439432_117955 | 3300042006 | Bacteria | 787 |
| 644 | Ga0439450_109521 | 3300042008 | Bacteria | 706 |
| 645 | Ga0439462_0157511 | 3300042015 | Bacteria | 640 |
| 646 | Ga0450906_056126 | 3300042145 | Bacteria | 698 |
| 647 | Ga0439446_0047733 | 3300042156 | Bacteria | 1274 |
| 648 | Ga0439434_0038838 | 3300042435 | Bacteria | 1460 |
| 649 | Ga0451577_0273721 | 3300042876 | Bacteria | 1529 |
| 650 | Ga0466969_0039743 | 3300044656 | Bacteria | 2361 |
| 651 | Ga0466965_0798825 | 3300044683 | Bacteria | 546 |
| 652 | Ga0466966_0022847 | 3300044684 | Bacteria | 4099 |
| 653 | Ga0466966_0270913 | 3300044684 | Bacteria | 1021 |
| 654 | Ga0466961_0042005 | 3300044693 | Bacteria | 2932 |
| 655 | Ga0466961_0388681 | 3300044693 | Bacteria | 847 |
| 656 | Ga0466961_0444558 | 3300044693 | Bacteria | 785 |
| 657 | Ga0466961_0555323 | 3300044693 | Bacteria | 691 |
| 658 | Ga0466963_0112526 | 3300044694 | Bacteria | 1869 |
| 659 | Ga0466963_0163117 | 3300044694 | Bacteria | 1552 |
| 660 | Ga0466963_1235637 | 3300044694 | Bacteria | 525 |
| 661 | Ga0453684_0964314 | 3300044712 | Bacteria | 909 |
| 662 | Ga0466971_0157586 | 3300044719 | Bacteria | 1062 |
| 663 | Ga0466968_0088330 | 3300044735 | Bacteria | 1370 |
| 664 | Ga0466968_0215113 | 3300044735 | Bacteria | 904 |
| 665 | Ga0466957_0139873 | 3300044842 | Bacteria | 1559 |
| 666 | Ga0466957_0605704 | 3300044842 | Bacteria | 767 |
| 667 | Ga0466960_0580737 | 3300044901 | Bacteria | 664 |
| 668 | Ga0466959_0039379 | 3300045049 | Bacteria | 3493 |
| 669 | Ga0466959_0232887 | 3300045049 | Bacteria | 1274 |
| 670 | Ga0466959_0268900 | 3300045049 | Bacteria | 1172 |
| 671 | Ga0466958_0130537 | 3300045836 | Bacteria | 1578 |
| 672 | Ga0466958_0392114 | 3300045836 | Bacteria | 896 |
| 673 | Ga0466967_0919189 | 3300045976 | Bacteria | 870 |
| 674 | Ga0495592_0175635 | 3300046454 | Bacteria | 1463 |
| 675 | Ga0495592_0211815 | 3300046454 | Bacteria | 1301 |
| 676 | Ga0495592_0306989 | 3300046454 | Bacteria | 1030 |
| 677 | Ga0495592_0533700 | 3300046454 | Bacteria | 724 |
| 678 | Ga0495592_0620301 | 3300046454 | Bacteria | 658 |
| 679 | Ga0495603_0098014 | 3300046455 | Bacteria | 1712 |
| 680 | Ga0495603_0174579 | 3300046455 | Bacteria | 1244 |
| 681 | Ga0495603_0181383 | 3300046455 | Bacteria | 1218 |
| 682 | Ga0495603_0256707 | 3300046455 | Bacteria | 1006 |
| 683 | Ga0495603_0306954 | 3300046455 | Bacteria | 911 |
| 684 | Ga0495603_0346216 | 3300046455 | Bacteria | 853 |
| 685 | Ga0495591_114037 | 3300046458 | Bacteria | 662 |
| 686 | Ga0495629_0049329 | 3300046459 | Bacteria | 2950 |
| 687 | Ga0495629_0287369 | 3300046459 | Bacteria | 1128 |
| 688 | Ga0495629_0396659 | 3300046459 | Bacteria | 938 |
| 689 | Ga0495629_0523889 | 3300046459 | Bacteria | 797 |
| 690 | Ga0495629_1116261 | 3300046459 | Bacteria | 509 |
| 691 | Ga0495638_0296999 | 3300046460 | Bacteria | 872 |
| 692 | Ga0495641_0001712 | 3300046461 | Bacteria | 18335 |
| 693 | Ga0495641_0373576 | 3300046461 | Bacteria | 646 |
| 694 | Ga0495641_0523479 | 3300046461 | Bacteria | 541 |
| 695 | Ga0495651_0004813 | 3300046462 | Bacteria | 10332 |
| 696 | Ga0495651_0470299 | 3300046462 | Bacteria | 809 |
| 697 | Ga0495653_0052427 | 3300046463 | Bacteria | 3126 |
| 698 | Ga0495653_0129192 | 3300046463 | Bacteria | 1791 |
| 699 | Ga0495653_0129403 | 3300046463 | Bacteria | 1789 |
| 700 | Ga0495653_0319390 | 3300046463 | Bacteria | 1007 |
| 701 | Ga0495653_0329509 | 3300046463 | Bacteria | 987 |
| 702 | Ga0495653_0477938 | 3300046463 | Bacteria | 780 |
| 703 | Ga0495653_0919635 | 3300046463 | Bacteria | 520 |
| 704 | Ga0495580_0064765 | 3300046472 | Bacteria | 2561 |
| 705 | Ga0495580_0125895 | 3300046472 | Bacteria | 1778 |
| 706 | Ga0495580_0829919 | 3300046472 | Bacteria | 598 |
| 707 | Ga0495582_0064566 | 3300046473 | Bacteria | 2021 |
| 708 | Ga0495582_0130630 | 3300046473 | Bacteria | 1419 |
| 709 | Ga0495582_0242871 | 3300046473 | Bacteria | 1032 |
| 710 | Ga0495582_0437119 | 3300046473 | Bacteria | 755 |
| 711 | Ga0495639_0001433 | 3300046475 | Bacteria | 10663 |
| 712 | Ga0495639_0065791 | 3300046475 | Bacteria | 1668 |
| 713 | Ga0495639_0407039 | 3300046475 | Bacteria | 688 |
| 714 | Ga0495662_0004361 | 3300046476 | Bacteria | 7102 |
| 715 | Ga0495662_0083082 | 3300046476 | Bacteria | 1559 |
| 716 | Ga0495662_0089132 | 3300046476 | Bacteria | 1503 |
| 717 | Ga0495662_0595722 | 3300046476 | Bacteria | 541 |
| 718 | Ga0495664_0223462 | 3300046477 | Bacteria | 1140 |
| 719 | Ga0495664_0303524 | 3300046477 | Bacteria | 964 |
| 720 | Ga0495664_0658153 | 3300046477 | Bacteria | 620 |
| 721 | Ga0495664_0672770 | 3300046477 | Bacteria | 613 |
| 722 | Ga0495584_0071852 | 3300046491 | Bacteria | 1739 |
| 723 | Ga0495584_0101981 | 3300046491 | Bacteria | 1451 |
| 724 | Ga0495585_0295661 | 3300046492 | Bacteria | 797 |
| 725 | Ga0495585_0428036 | 3300046492 | Bacteria | 635 |
| 726 | Ga0495594_0170210 | 3300046499 | Bacteria | 1239 |
| 727 | Ga0495594_0269142 | 3300046499 | Bacteria | 971 |
| 728 | Ga0495594_0519080 | 3300046499 | Bacteria | 676 |
| 729 | Ga0495596_0098321 | 3300046500 | Bacteria | 1136 |
| 730 | Ga0495607_0115970 | 3300046501 | Bacteria | 1413 |
| 731 | Ga0495608_0063614 | 3300046511 | Bacteria | 2420 |
| 732 | Ga0495608_0448939 | 3300046511 | Bacteria | 785 |
| 733 | Ga0495618_0329707 | 3300046514 | Bacteria | 944 |
| 734 | Ga0495618_0457013 | 3300046514 | Bacteria | 774 |
| 735 | Ga0495628_0246680 | 3300046516 | Bacteria | 1334 |
| 736 | Ga0495628_0403711 | 3300046516 | Bacteria | 998 |
| 737 | Ga0495628_0474187 | 3300046516 | Bacteria | 906 |
| 738 | Ga0495628_0550138 | 3300046516 | Bacteria | 829 |
| 739 | Ga0495628_0914114 | 3300046516 | Bacteria | 608 |
| 740 | Ga0495630_0012230 | 3300046517 | Bacteria | 6224 |
| 741 | Ga0495630_0134424 | 3300046517 | Bacteria | 1879 |
| 742 | Ga0495630_0193432 | 3300046517 | Bacteria | 1552 |
| 743 | Ga0495630_0350345 | 3300046517 | Bacteria | 1130 |
| 744 | Ga0495630_0420574 | 3300046517 | Bacteria | 1024 |
| 745 | Ga0495630_0850758 | 3300046517 | Bacteria | 695 |
| 746 | Ga0495631_0211312 | 3300046518 | Bacteria | 829 |
| 747 | Ga0495637_0054933 | 3300046520 | Bacteria | 1653 |
| 748 | Ga0495637_0316467 | 3300046520 | Bacteria | 552 |
| 749 | Ga0495644_0014236 | 3300046523 | Bacteria | 3047 |
| 750 | Ga0495644_0127936 | 3300046523 | Bacteria | 968 |
| 751 | Ga0495663_0005126 | 3300046525 | Bacteria | 3654 |
| 752 | Ga0495663_0029820 | 3300046525 | Bacteria | 1613 |
| 753 | Ga0495663_0268874 | 3300046525 | Bacteria | 609 |
| 754 | Ga0495666_0003428 | 3300046526 | Bacteria | 7997 |
| 755 | Ga0495642_0038020 | 3300046528 | Bacteria | 1949 |
| 756 | Ga0495642_0104889 | 3300046528 | Bacteria | 1206 |
| 757 | Ga0495642_0310884 | 3300046528 | Bacteria | 691 |
| 758 | Ga0495652_0116165 | 3300046529 | Bacteria | 2143 |
| 759 | Ga0495652_0209714 | 3300046529 | Bacteria | 1472 |
| 760 | Ga0495652_0332407 | 3300046529 | Bacteria | 1094 |
| 761 | Ga0495665_0005734 | 3300046531 | Bacteria | 6702 |
| 762 | Ga0495640_0015599 | 3300046533 | Bacteria | 5710 |
| 763 | Ga0495640_0209461 | 3300046533 | Bacteria | 1233 |
| 764 | Ga0495640_0225883 | 3300046533 | Bacteria | 1179 |
| 765 | Ga0495640_0320046 | 3300046533 | Bacteria | 961 |
| 766 | Ga0495586_0015388 | 3300046535 | Bacteria | 4070 |
| 767 | Ga0495586_0043241 | 3300046535 | Bacteria | 2427 |
| 768 | Ga0495586_0093561 | 3300046535 | Bacteria | 1662 |
| 769 | Ga0495586_0334000 | 3300046535 | Bacteria | 870 |
| 770 | Ga0495586_0427597 | 3300046535 | Bacteria | 763 |
| 771 | Ga0495586_0511832 | 3300046535 | Bacteria | 693 |
| 772 | Ga0495586_0524644 | 3300046535 | Bacteria | 684 |
| 773 | Ga0495586_0546978 | 3300046535 | Bacteria | 668 |
| 774 | Ga0495586_0678352 | 3300046535 | Bacteria | 595 |
| 775 | Ga0495587_0041055 | 3300046536 | Bacteria | 2761 |
| 776 | Ga0495587_0119085 | 3300046536 | Bacteria | 1513 |
| 777 | Ga0495587_0449872 | 3300046536 | Bacteria | 714 |
| 778 | Ga0495609_0094319 | 3300046538 | Bacteria | 1300 |
| 779 | Ga0495609_0212526 | 3300046538 | Bacteria | 805 |
| 780 | Ga0495609_0249713 | 3300046538 | Bacteria | 731 |
| 781 | Ga0495621_0001746 | 3300046539 | Bacteria | 5708 |
| 782 | Ga0495621_0166753 | 3300046539 | Bacteria | 873 |
| 783 | Ga0495597_0260280 | 3300046542 | Bacteria | 680 |
| 784 | Ga0495633_0176020 | 3300046558 | Bacteria | 985 |
| 785 | Ga0495667_0002578 | 3300046559 | Bacteria | 12112 |
| 786 | Ga0495667_0294658 | 3300046559 | Bacteria | 1028 |
| 787 | Ga0495656_0007219 | 3300046615 | Bacteria | 3922 |
| 788 | Ga0495656_0121523 | 3300046615 | Bacteria | 1233 |
| 789 | Ga0495656_0265427 | 3300046615 | Bacteria | 871 |
| 790 | Ga0495656_0293476 | 3300046615 | Bacteria | 832 |
| 791 | Ga0495656_0403630 | 3300046615 | Bacteria | 715 |
| 792 | Ga0495668_0860042 | 3300046616 | Bacteria | 503 |
| 793 | Ga0495634_0006384 | 3300046642 | Bacteria | 8962 |
| 794 | Ga0495634_0016753 | 3300046642 | Bacteria | 5236 |
| 795 | Ga0495634_0103357 | 3300046642 | Bacteria | 1839 |
| 796 | Ga0495634_0195702 | 3300046642 | Bacteria | 1258 |
| 797 | Ga0495634_0800061 | 3300046642 | Bacteria | 538 |
| 798 | Ga0495611_0071036 | 3300046648 | Bacteria | 1591 |
| 799 | Ga0495611_0114256 | 3300046648 | Bacteria | 1258 |
| 800 | Ga0495635_0016528 | 3300046663 | Bacteria | 5156 |
| 801 | Ga0495635_0060316 | 3300046663 | Bacteria | 2607 |
| 802 | Ga0495635_0393325 | 3300046663 | Bacteria | 921 |
| 803 | Ga0495659_0024672 | 3300046664 | Bacteria | 2052 |
| 804 | Ga0495661_0418739 | 3300046665 | Bacteria | 649 |
| 805 | Ga0495661_0459535 | 3300046665 | Bacteria | 612 |
| 806 | Ga0495588_0002482 | 3300046674 | Bacteria | 7904 |
| 807 | Ga0495588_0025412 | 3300046674 | Bacteria | 2950 |
| 808 | Ga0495657_0001765 | 3300046675 | Bacteria | 18492 |
| 809 | Ga0495657_0132814 | 3300046675 | Bacteria | 1558 |
| 810 | Ga0495657_0222169 | 3300046675 | Bacteria | 1145 |
| 811 | Ga0495657_0266021 | 3300046675 | Bacteria | 1029 |
| 812 | Ga0495599_0132192 | 3300046678 | Bacteria | 1549 |
| 813 | Ga0495599_0425316 | 3300046678 | Bacteria | 789 |
| 814 | Ga0495599_0593196 | 3300046678 | Bacteria | 646 |
| 815 | Ga0495599_0613017 | 3300046678 | Bacteria | 633 |
| 816 | Ga0495623_0027040 | 3300046679 | Bacteria | 3690 |
| 817 | Ga0495623_0257910 | 3300046679 | Bacteria | 978 |
| 818 | Ga0495647_0000723 | 3300046681 | Bacteria | 9761 |
| 819 | Ga0495647_0292930 | 3300046681 | Bacteria | 732 |
| 820 | Ga0495647_0568150 | 3300046681 | Bacteria | 531 |
| 821 | Ga0495658_0008640 | 3300046683 | Bacteria | 5054 |
| 822 | Ga0495658_0193648 | 3300046683 | Bacteria | 1265 |
| 823 | Ga0495658_0312022 | 3300046683 | Bacteria | 996 |
| 824 | Ga0495669_0074928 | 3300046684 | Bacteria | 1548 |
| 825 | Ga0495669_0577258 | 3300046684 | Bacteria | 547 |
| 826 | Ga0495613_0001106 | 3300046689 | Bacteria | 20586 |
| 827 | Ga0495613_0203568 | 3300046689 | Bacteria | 1395 |
| 828 | Ga0495613_0645102 | 3300046689 | Bacteria | 701 |
| 829 | Ga0495613_0954439 | 3300046689 | Bacteria | 553 |
| 830 | Ga0495613_1036532 | 3300046689 | Bacteria | 526 |
| 831 | Ga0495624_0006221 | 3300046690 | Bacteria | 8485 |
| 832 | Ga0495624_0326939 | 3300046690 | Bacteria | 923 |
| 833 | Ga0495624_0359395 | 3300046690 | Bacteria | 876 |
| 834 | Ga0495670_0031381 | 3300046691 | Bacteria | 2640 |
| 835 | Ga0495670_0052710 | 3300046691 | Bacteria | 2037 |
| 836 | Ga0495670_0077233 | 3300046691 | Bacteria | 1693 |
| 837 | Ga0495670_0825047 | 3300046691 | Bacteria | 506 |
| 838 | Ga0495649_0369232 | 3300046694 | Bacteria | 723 |
| 839 | Ga0495589_0030296 | 3300046794 | Bacteria | 2725 |
| 840 | Ga0495589_0117837 | 3300046794 | Bacteria | 1279 |
| 841 | Ga0495589_0200885 | 3300046794 | Bacteria | 941 |
| 842 | Ga0495589_0271282 | 3300046794 | Bacteria | 790 |
| 843 | Ga0495600_0016031 | 3300046809 | Bacteria | 4751 |
| 844 | Ga0495600_0234419 | 3300046809 | Bacteria | 1171 |
| 845 | Ga0495600_0312840 | 3300046809 | Bacteria | 989 |
| 846 | Ga0495600_0783302 | 3300046809 | Bacteria | 569 |
| 847 | Ga0495581_0036306 | 3300047315 | Bacteria | 2851 |
| 848 | Ga0495604_0512673 | 3300047317 | Bacteria | 777 |
| 849 | Ga0495604_0818509 | 3300047317 | Bacteria | 586 |
| 850 | Ga0495604_0842200 | 3300047317 | Bacteria | 576 |
| 851 | Ga0495636_0445267 | 3300047318 | Bacteria | 621 |
| 852 | Ga0495674_0021479 | 3300047319 | Bacteria | 5970 |
| 853 | Ga0495674_0173897 | 3300047319 | Bacteria | 1796 |
| 854 | Ga0495674_0201212 | 3300047319 | Bacteria | 1652 |
| 855 | Ga0495674_0476998 | 3300047319 | Bacteria | 1000 |
| 856 | Ga0495674_0534482 | 3300047319 | Bacteria | 935 |
| 857 | Ga0495674_0543750 | 3300047319 | Bacteria | 925 |
| 858 | Ga0495674_1152092 | 3300047319 | Bacteria | 588 |
| 859 | Ga0495676_0057213 | 3300047321 | Bacteria | 3078 |
| 860 | Ga0495676_0065217 | 3300047321 | Bacteria | 2828 |
| 861 | Ga0495676_0077090 | 3300047321 | Bacteria | 2542 |
| 862 | Ga0495676_0101835 | 3300047321 | Bacteria | 2123 |
| 863 | Ga0495676_0276125 | 3300047321 | Bacteria | 1139 |
| 864 | Ga0495676_0295326 | 3300047321 | Bacteria | 1094 |
| 865 | Ga0495676_0397929 | 3300047321 | Bacteria | 914 |
| 866 | Ga0495680_0004189 | 3300047322 | Bacteria | 13854 |
| 867 | Ga0495680_0008963 | 3300047322 | Bacteria | 9041 |
| 868 | Ga0495680_0207610 | 3300047322 | Bacteria | 1403 |
| 869 | Ga0495680_0242936 | 3300047322 | Bacteria | 1278 |
| 870 | Ga0495680_0304550 | 3300047322 | Bacteria | 1118 |
| 871 | Ga0495680_1102723 | 3300047322 | Bacteria | 501 |
| 872 | Ga0495683_0260941 | 3300047323 | Bacteria | 757 |
| 873 | Ga0495675_0068857 | 3300047444 | Bacteria | 2235 |
| 874 | Ga0495677_0066988 | 3300047445 | Bacteria | 1336 |
| 875 | Ga0495673_0164950 | 3300047469 | Bacteria | 848 |
| 876 | Ga0495684_0054111 | 3300047471 | Bacteria | 3062 |
| 877 | Ga0495684_0080311 | 3300047471 | Bacteria | 2476 |
| 878 | Ga0495684_0565179 | 3300047471 | Bacteria | 772 |
| 879 | Ga0495684_0605218 | 3300047471 | Bacteria | 739 |
| 880 | Ga0495593_0001673 | 3300047673 | Bacteria | 13132 |
| 881 | Ga0495593_0160764 | 3300047673 | Bacteria | 1134 |
| 882 | Ga0495602_0076237 | 3300048088 | Bacteria | 2842 |
| 883 | Ga0495602_0565901 | 3300048088 | Bacteria | 786 |
| 884 | Ga0495614_0155100 | 3300048089 | Bacteria | 1023 |
| 885 | Ga0495614_0191338 | 3300048089 | Bacteria | 923 |
| 886 | Ga0495614_0340489 | 3300048089 | Bacteria | 698 |
| 887 | Ga0495615_0202840 | 3300048090 | Bacteria | 613 |
| 888 | Ga0496100_0041895 | 3300048903 | Bacteria | 2921 |
| 889 | Ga0496100_0057169 | 3300048903 | Bacteria | 2554 |
| 890 | Ga0496100_0270774 | 3300048903 | Bacteria | 1263 |
| 891 | Ga0496100_0780368 | 3300048903 | Bacteria | 748 |
| 892 | Ga0496100_1486514 | 3300048903 | Bacteria | 535 |
| 893 | Ga0496100_1635770 | 3300048903 | Bacteria | 509 |
| 894 | Ga0496101_0025291 | 3300048904 | Bacteria | 4117 |
| 895 | Ga0496101_0149994 | 3300048904 | Bacteria | 1783 |
| 896 | Ga0496101_0432977 | 3300048904 | Bacteria | 1037 |
| 897 | Ga0496101_0576568 | 3300048904 | Bacteria | 890 |
| 898 | Ga0496101_0714647 | 3300048904 | Bacteria | 791 |
| 899 | Ga0496102_0018527 | 3300048905 | Bacteria | 6119 |
| 900 | Ga0496102_0234599 | 3300048905 | Bacteria | 1729 |
| 901 | Ga0496102_0331214 | 3300048905 | Bacteria | 1434 |
| 902 | Ga0496102_0480328 | 3300048905 | Bacteria | 1164 |
| 903 | Ga0496102_0480795 | 3300048905 | Bacteria | 1163 |
| 904 | Ga0496102_0742734 | 3300048905 | Bacteria | 904 |
| 905 | Ga0496102_1238289 | 3300048905 | Bacteria | 666 |
| 906 | Ga0496103_0102296 | 3300048906 | Bacteria | 1814 |
| 907 | Ga0496103_0229384 | 3300048906 | Bacteria | 1194 |
| 908 | Ga0496103_0250916 | 3300048906 | Bacteria | 1139 |
| 909 | Ga0496103_0705985 | 3300048906 | Bacteria | 639 |
| 910 | Ga0496103_0812326 | 3300048906 | Bacteria | 589 |
| 911 | Ga0496104_0080130 | 3300048907 | Bacteria | 3113 |
| 912 | Ga0496104_0107421 | 3300048907 | Bacteria | 2674 |
| 913 | Ga0496104_0205874 | 3300048907 | Bacteria | 1879 |
| 914 | Ga0496104_0220462 | 3300048907 | Bacteria | 1809 |
| 915 | Ga0496104_0520764 | 3300048907 | Bacteria | 1100 |
| 916 | Ga0496105_0054938 | 3300048908 | Bacteria | 3288 |
| 917 | Ga0496105_0056610 | 3300048908 | Bacteria | 3236 |
| 918 | Ga0496105_0163527 | 3300048908 | Bacteria | 1827 |
| 919 | Ga0496105_0187178 | 3300048908 | Bacteria | 1694 |
| 920 | Ga0496105_0327281 | 3300048908 | Bacteria | 1227 |
| 921 | Ga0496106_0008125 | 3300048909 | Bacteria | 7749 |
| 922 | Ga0496106_0195471 | 3300048909 | Bacteria | 1609 |
| 923 | Ga0496106_0525198 | 3300048909 | Bacteria | 950 |
| 924 | Ga0496106_0774926 | 3300048909 | Bacteria | 762 |
| 925 | Ga0496107_0006741 | 3300048910 | Bacteria | 7904 |
| 926 | Ga0496107_0043569 | 3300048910 | Bacteria | 3224 |
| 927 | Ga0496107_0275344 | 3300048910 | Bacteria | 1253 |
| 928 | Ga0496107_0463841 | 3300048910 | Bacteria | 940 |
| 929 | Ga0496107_0500860 | 3300048910 | Bacteria | 901 |
| 930 | Ga0496108_0016189 | 3300048911 | Bacteria | 6081 |
| 931 | Ga0496108_0023793 | 3300048911 | Bacteria | 5040 |
| 932 | Ga0496108_0034475 | 3300048911 | Bacteria | 4206 |
| 933 | Ga0496108_0060328 | 3300048911 | Bacteria | 3192 |
| 934 | Ga0496108_0079575 | 3300048911 | Bacteria | 2775 |
| 935 | Ga0496108_0593180 | 3300048911 | Bacteria | 966 |
| 936 | Ga0496109_0002583 | 3300048912 | Bacteria | 15165 |
| 937 | Ga0496109_0004660 | 3300048912 | Bacteria | 11447 |
| 938 | Ga0496109_0004877 | 3300048912 | Bacteria | 11204 |
| 939 | Ga0496109_0026262 | 3300048912 | Bacteria | 5193 |
| 940 | Ga0496109_0184417 | 3300048912 | Bacteria | 1961 |
| 941 | Ga0496109_0234895 | 3300048912 | Bacteria | 1725 |
| 942 | Ga0496109_0602136 | 3300048912 | Bacteria | 1035 |
| 943 | Ga0496109_0624980 | 3300048912 | Bacteria | 1014 |
| 944 | Ga0496109_0627537 | 3300048912 | Bacteria | 1011 |
| 945 | Ga0496109_0675396 | 3300048912 | Bacteria | 970 |
| 946 | Ga0496109_1326514 | 3300048912 | Bacteria | 655 |
| 947 | Ga0496109_1809704 | 3300048912 | Bacteria | 544 |
| 948 | Ga0496110_0004643 | 3300048913 | Bacteria | 10677 |
| 949 | Ga0496110_0027911 | 3300048913 | Bacteria | 4842 |
| 950 | Ga0496110_0089463 | 3300048913 | Bacteria | 2752 |
| 951 | Ga0496110_0091123 | 3300048913 | Bacteria | 2727 |
| 952 | Ga0496110_0170208 | 3300048913 | Bacteria | 1976 |
| 953 | Ga0496110_0961526 | 3300048913 | Bacteria | 761 |
| 954 | Ga0496110_1161634 | 3300048913 | Bacteria | 681 |
| 955 | Ga0496110_1829298 | 3300048913 | Bacteria | 517 |
| 956 | Ga0496111_0010628 | 3300048914 | Bacteria | 6186 |
| 957 | Ga0496111_0027483 | 3300048914 | Bacteria | 4025 |
| 958 | Ga0496111_0032586 | 3300048914 | Bacteria | 3715 |
| 959 | Ga0496111_0078099 | 3300048914 | Bacteria | 2414 |
| 960 | Ga0496111_0874062 | 3300048914 | Bacteria | 648 |
| 961 | Ga0496112_0002114 | 3300048915 | Bacteria | 15764 |
| 962 | Ga0496112_0003519 | 3300048915 | Bacteria | 12986 |
| 963 | Ga0496112_0013302 | 3300048915 | Bacteria | 7598 |
| 964 | Ga0496112_0049244 | 3300048915 | Bacteria | 4130 |
| 965 | Ga0496112_0291808 | 3300048915 | Bacteria | 1577 |
| 966 | Ga0496112_0427348 | 3300048915 | Bacteria | 1263 |
| 967 | Ga0496112_1286805 | 3300048915 | Bacteria | 647 |
| 968 | Ga0496113_0077648 | 3300048916 | Bacteria | 2539 |
| 969 | Ga0496113_0149600 | 3300048916 | Bacteria | 1841 |
| 970 | Ga0496113_0153627 | 3300048916 | Bacteria | 1817 |
| 971 | Ga0496113_0273407 | 3300048916 | Bacteria | 1350 |
| 972 | Ga0496113_0306589 | 3300048916 | Bacteria | 1272 |
| 973 | Ga0496113_0410932 | 3300048916 | Bacteria | 1087 |
| 974 | Ga0496113_0478416 | 3300048916 | Bacteria | 1000 |
| 975 | Ga0496113_1610159 | 3300048916 | Bacteria | 500 |
| 976 | Ga0496114_0004194 | 3300048917 | Bacteria | 11164 |
| 977 | Ga0496114_0012594 | 3300048917 | Bacteria | 6775 |
| 978 | Ga0496114_0066061 | 3300048917 | Bacteria | 3032 |
| 979 | Ga0496114_0100423 | 3300048917 | Bacteria | 2469 |
| 980 | Ga0496114_0187946 | 3300048917 | Bacteria | 1806 |
| 981 | Ga0496114_0220275 | 3300048917 | Bacteria | 1666 |
| 982 | Ga0496114_0508810 | 3300048917 | Bacteria | 1065 |
| 983 | Ga0496114_0936756 | 3300048917 | Bacteria | 748 |
| 984 | Ga0496114_1518317 | 3300048917 | Bacteria | 558 |
| 985 | Ga0496115_0069392 | 3300048918 | Bacteria | 2855 |
| 986 | Ga0496115_0298175 | 3300048918 | Bacteria | 1321 |
| 987 | Ga0496115_0315454 | 3300048918 | Bacteria | 1280 |
| 988 | Ga0496115_0479967 | 3300048918 | Bacteria | 1001 |
| 989 | Ga0496115_0694149 | 3300048918 | Bacteria | 801 |
| 990 | Ga0496115_0995662 | 3300048918 | Bacteria | 641 |
| 991 | Ga0496119_0286724 | 3300048922 | Bacteria | 817 |
| 992 | Ga0496119_0540121 | 3300048922 | Bacteria | 537 |
| 993 | Ga0501307_056665 | 3300049162 | Bacteria | 600 |
| 994 | Ga0501311_053539 | 3300049527 | Bacteria | 638 |
| 995 | Ga0501031_0214433 | 3300049568 | Bacteria | 1254 |
| 996 | Ga0501031_0721495 | 3300049568 | Bacteria | 640 |
| 997 | Ga0501033_0000586 | 3300049570 | Bacteria | 33688 |
| 998 | Ga0501033_0501159 | 3300049570 | Bacteria | 840 |
| 999 | Ga0501034_0009423 | 3300049571 | Bacteria | 10220 |
| 1000 | Ga0501036_0045609 | 3300049572 | Bacteria | 3713 |
| 1001 | Ga0501036_0056989 | 3300049572 | Bacteria | 3310 |
| 1002 | Ga0501036_0194170 | 3300049572 | Bacteria | 1708 |
| 1003 | Ga0501036_0243147 | 3300049572 | Bacteria | 1509 |
| 1004 | Ga0501036_0459935 | 3300049572 | Bacteria | 1060 |
| 1005 | Ga0501036_0475806 | 3300049572 | Bacteria | 1040 |
| 1006 | Ga0501036_0959563 | 3300049572 | Bacteria | 701 |
| 1007 | Ga0501038_0105410 | 3300049574 | Bacteria | 2342 |
| 1008 | Ga0501038_0159909 | 3300049574 | Bacteria | 1831 |
| 1009 | Ga0501038_1371529 | 3300049574 | Bacteria | 509 |
| 1010 | Ga0501039_0114246 | 3300049575 | Bacteria | 2112 |
| 1011 | Ga0501039_1331379 | 3300049575 | Bacteria | 554 |
| 1012 | Ga0501040_0013186 | 3300049576 | Bacteria | 5437 |
| 1013 | Ga0501040_0469841 | 3300049576 | Bacteria | 906 |
| 1014 | Ga0501040_0534645 | 3300049576 | Bacteria | 846 |
| 1015 | Ga0501040_0646003 | 3300049576 | Bacteria | 765 |
| 1016 | Ga0501040_0751493 | 3300049576 | Bacteria | 705 |
| 1017 | Ga0501040_1010240 | 3300049576 | Bacteria | 603 |
| 1018 | Ga0501041_0039470 | 3300049577 | Bacteria | 2865 |
| 1019 | Ga0501042_0147634 | 3300049578 | Bacteria | 1695 |
| 1020 | Ga0501042_0334483 | 3300049578 | Bacteria | 1095 |
| 1021 | Ga0501042_0555026 | 3300049578 | Bacteria | 835 |
| 1022 | Ga0501042_0799643 | 3300049578 | Bacteria | 686 |
| 1023 | Ga0501046_0454593 | 3300049580 | Bacteria | 921 |
| 1024 | Ga0501047_0390651 | 3300049581 | Bacteria | 1225 |
| 1025 | Ga0501048_0009882 | 3300049582 | Bacteria | 7153 |
| 1026 | Ga0501048_0998142 | 3300049582 | Bacteria | 602 |
| 1027 | Ga0501048_1179221 | 3300049582 | Bacteria | 551 |
| 1028 | Ga0501067_0561673 | 3300049583 | Bacteria | 639 |
| 1029 | Ga0501068_0263687 | 3300049584 | Bacteria | 1099 |
| 1030 | Ga0501068_0639683 | 3300049584 | Bacteria | 694 |
| 1031 | Ga0501069_0102362 | 3300049585 | Bacteria | 1626 |
| 1032 | Ga0501069_0118008 | 3300049585 | Bacteria | 1514 |
| 1033 | Ga0501070_0871175 | 3300049586 | Bacteria | 704 |
| 1034 | Ga0501071_0130118 | 3300049587 | Bacteria | 1869 |
| 1035 | Ga0501071_1105905 | 3300049587 | Bacteria | 612 |
| 1036 | Ga0501072_0004460 | 3300049588 | Bacteria | 10637 |
| 1037 | Ga0501072_0125602 | 3300049588 | Bacteria | 2044 |
| 1038 | Ga0501072_0421551 | 3300049588 | Bacteria | 1058 |
| 1039 | Ga0501072_0541374 | 3300049588 | Bacteria | 920 |
| 1040 | Ga0501072_1571552 | 3300049588 | Bacteria | 507 |
| 1041 | Ga0501073_0034729 | 3300049589 | Bacteria | 3587 |
| 1042 | Ga0501073_1085202 | 3300049589 | Bacteria | 550 |
| 1043 | Ga0501074_0091842 | 3300049590 | Bacteria | 2174 |
| 1044 | Ga0501074_0468695 | 3300049590 | Bacteria | 893 |
| 1045 | Ga0501074_1052978 | 3300049590 | Bacteria | 572 |
| 1046 | Ga0501075_0073190 | 3300049591 | Bacteria | 2591 |
| 1047 | Ga0501075_0194521 | 3300049591 | Bacteria | 1547 |
| 1048 | Ga0501075_0334097 | 3300049591 | Bacteria | 1155 |
| 1049 | Ga0501075_1016701 | 3300049591 | Bacteria | 630 |
| 1050 | Ga0501076_0029561 | 3300049592 | Bacteria | 4262 |
| 1051 | Ga0501076_0274419 | 3300049592 | Bacteria | 1381 |
| 1052 | Ga0501076_0444788 | 3300049592 | Bacteria | 1067 |
| 1053 | Ga0501076_0583041 | 3300049592 | Bacteria | 922 |
| 1054 | Ga0501076_0965988 | 3300049592 | Bacteria | 702 |
| 1055 | Ga0501076_1241924 | 3300049592 | Bacteria | 613 |
| 1056 | Ga0501077_0040119 | 3300049593 | Bacteria | 2983 |
| 1057 | Ga0501077_0058942 | 3300049593 | Bacteria | 2437 |
| 1058 | Ga0501077_0388293 | 3300049593 | Bacteria | 892 |
| 1059 | Ga0501077_0915839 | 3300049593 | Bacteria | 564 |
| 1060 | Ga0501079_0027551 | 3300049741 | Bacteria | 4358 |
| 1061 | Ga0501080_0278615 | 3300049742 | Bacteria | 1521 |
| 1062 | Ga0501080_0338523 | 3300049742 | Bacteria | 1360 |
| 1063 | Ga0501080_1882703 | 3300049742 | Bacteria | 501 |
| 1064 | Ga0501081_0018885 | 3300049743 | Bacteria | 4581 |
| 1065 | Ga0501081_0331403 | 3300049743 | Bacteria | 1120 |
| 1066 | Ga0501081_0459930 | 3300049743 | Bacteria | 946 |
| 1067 | Ga0501081_0655760 | 3300049743 | Bacteria | 787 |
| 1068 | Ga0501083_0944640 | 3300049744 | Bacteria | 561 |
| 1069 | Ga0501035_0543018 | 3300049822 | Bacteria | 953 |
| 1070 | Ga0501035_0715118 | 3300049822 | Bacteria | 807 |
| 1071 | Ga0501044_0003799 | 3300049823 | Bacteria | 16954 |
| 1072 | Ga0501045_0020878 | 3300049824 | Bacteria | 4682 |
| 1073 | Ga0501045_0184575 | 3300049824 | Bacteria | 1554 |
| 1074 | Ga0501045_0384405 | 3300049824 | Bacteria | 1045 |
| 1075 | Ga0501045_0867072 | 3300049824 | Bacteria | 664 |
| 1076 | nmdc:mga03n38_30805_c1 | 3300050490 | Bacteria | 2259 |
| 1077 | nmdc:mga03n38_445852_c1 | 3300050490 | Bacteria | 719 |
| 1078 | nmdc:mga00v17_15891_c1 | 3300050491 | Bacteria | 4235 |
| 1079 | nmdc:mga0yw44_1060720_c1 | 3300050492 | Bacteria | 548 |
| 1080 | nmdc:mga0yw44_138029_c1 | 3300050492 | Bacteria | 1583 |
| 1081 | nmdc:mga0yw44_15898_c1 | 3300050492 | Bacteria | 4048 |
| 1082 | nmdc:mga0yw44_175904_c1 | 3300050492 | Bacteria | 1407 |
| 1083 | nmdc:mga0yw44_611903_c1 | 3300050492 | Bacteria | 740 |
| 1084 | nmdc:mga0k408_305633_c1 | 3300050493 | Bacteria | 539 |
| 1085 | nmdc:mga06z11_174222_c1 | 3300050494 | Bacteria | 1237 |
| 1086 | nmdc:mga06z11_40797_c1 | 3300050494 | Bacteria | 2319 |
| 1087 | nmdc:mga06z11_84327_c1 | 3300050494 | Bacteria | 1712 |
| 1088 | nmdc:mga07m45_100310_c1 | 3300050496 | Bacteria | 1662 |
| 1089 | nmdc:mga05p37_10502_c1 | 3300050507 | Bacteria | 10983 |
| 1090 | nmdc:mga05p37_1223129_c1 | 3300050507 | Bacteria | 774 |
| 1091 | nmdc:mga05p37_242254_c1 | 3300050507 | Bacteria | 2167 |
| 1092 | nmdc:mga05p37_330960_c1 | 3300050507 | Bacteria | 1799 |
| 1093 | nmdc:mga05p37_81637_c1 | 3300050507 | Bacteria | 3982 |
| 1094 | nmdc:mga09592_258024_c1 | 3300050508 | Bacteria | 1511 |
| 1095 | nmdc:mga0qj67_49532_c1 | 3300050509 | Bacteria | 3320 |
| 1096 | nmdc:mga08y16_1539241_c1 | 3300050511 | Bacteria | 624 |
| 1097 | nmdc:mga08y16_209788_c1 | 3300050511 | Bacteria | 2017 |
| 1098 | nmdc:mga0n895_1217359_c1 | 3300050512 | Bacteria | 726 |
| 1099 | nmdc:mga0n895_266406_c1 | 3300050512 | Bacteria | 1738 |
| 1100 | nmdc:mga0n895_271050_c1 | 3300050512 | Bacteria | 1722 |
| 1101 | nmdc:mga0n895_37338_c1 | 3300050512 | Bacteria | 4699 |
| 1102 | nmdc:mga0rr50_1357325_c1 | 3300050513 | Bacteria | 602 |
| 1103 | nmdc:mga0rr50_294370_c1 | 3300050513 | Bacteria | 1357 |
| 1104 | nmdc:mga0rr50_643440_c1 | 3300050513 | Bacteria | 905 |
| 1105 | nmdc:mga08x19_506806_c1 | 3300050514 | Bacteria | 852 |
| 1106 | nmdc:mga08x19_79672_c1 | 3300050514 | Bacteria | 2148 |
| 1107 | nmdc:mga0a205_1011_c1 | 3300050515 | Bacteria | 23356 |
| 1108 | nmdc:mga0sz30_37512_c1 | 3300050516 | Bacteria | 2028 |
| 1109 | Ga0495601_0147738 | 3300053077 | Bacteria | 1534 |
| 1110 | Ga0495601_0161174 | 3300053077 | Bacteria | 1466 |
| 1111 | Ga0495601_0287279 | 3300053077 | Bacteria | 1072 |
| 1112 | Ga0495601_0333152 | 3300053077 | Bacteria | 988 |
| 1113 | Ga0495601_0377352 | 3300053077 | Bacteria | 920 |
| 1114 | Ga0495601_0790304 | 3300053077 | Bacteria | 603 |
| 1115 | Ga0495601_0935447 | 3300053077 | Bacteria | 547 |
| 1116 | Ga0495612_0580716 | 3300053078 | Bacteria | 517 |
| 1117 | Ga0495655_0022559 | 3300053083 | Bacteria | 1440 |
| 1118 | Ga0495655_0044071 | 3300053083 | Bacteria | 1153 |
| 1119 | Ga0495655_0103579 | 3300053083 | Bacteria | 846 |
| 1120 | Ga0495595_0064354 | 3300053084 | Bacteria | 1723 |
| 1121 | Ga0495595_0094688 | 3300053084 | Bacteria | 1436 |
| 1122 | Ga0495595_0127575 | 3300053084 | Bacteria | 1242 |
| 1123 | Ga0495595_0133979 | 3300053084 | Bacteria | 1213 |
| 1124 | Ga0495619_0030323 | 3300053085 | Bacteria | 3500 |
| 1125 | Ga0495619_0049221 | 3300053085 | Bacteria | 2779 |
| 1126 | Ga0495619_0057521 | 3300053085 | Bacteria | 2580 |
| 1127 | Ga0495619_0120735 | 3300053085 | Bacteria | 1797 |
| 1128 | Ga0495619_0138483 | 3300053085 | Bacteria | 1675 |
| 1129 | Ga0495619_0241086 | 3300053085 | Bacteria | 1253 |
| 1130 | Ga0495619_0307443 | 3300053085 | Bacteria | 1098 |
| 1131 | Ga0495619_1153412 | 3300053085 | Bacteria | 514 |
| 1132 | Ga0500646_0084380 | 3300053090 | Bacteria | 974 |
| 1133 | Ga0500646_0108258 | 3300053090 | Bacteria | 881 |
| 1134 | Ga0500566_0000391 | 3300053094 | Bacteria | 24277 |
| 1135 | Ga0500641_0007941 | 3300053096 | Bacteria | 3784 |
| 1136 | Ga0500577_0488842 | 3300053142 | Bacteria | 538 |
| 1137 | Ga0500616_0000816 | 3300053153 | Bacteria | 35390 |
| 1138 | Ga0500616_0003439 | 3300053153 | Bacteria | 12093 |
| 1139 | Ga0500616_0141118 | 3300053153 | Bacteria | 1126 |
| 1140 | Ga0500616_0168022 | 3300053153 | Bacteria | 999 |
| 1141 | Ga0500620_200098 | 3300053155 | Bacteria | 682 |
| 1142 | Ga0501084_0000241 | 3300054114 | Bacteria | 41258 |
| 1143 | Ga0501084_0017951 | 3300054114 | Bacteria | 5892 |
| 1144 | Ga0501084_0605061 | 3300054114 | Bacteria | 926 |
| 1145 | Ga0501084_0907842 | 3300054114 | Bacteria | 741 |
| 1146 | Ga0501084_1314946 | 3300054114 | Bacteria | 606 |
| 1147 | Ga0590075_081463 | 3300059424 | Bacteria | 839 |
| 1148 | Ga0587073_0108672 | 3300059492 | Bacteria | 732 |
| 1149 | Ga0587090_127763 | 3300059510 | Bacteria | 557 |
| 1150 | Ga0587117_080537 | 3300059627 | Bacteria | 592 |
| 1151 | Ga0587128_059009 | 3300059630 | Bacteria | 720 |
| 1152 | Ga0587128_095601 | 3300059630 | Bacteria | 616 |
| 1153 | Ga0587072_020414 | 3300059643 | Bacteria | 1167 |
| 1154 | Ga0587079_161957 | 3300059647 | Bacteria | 586 |
| 1155 | Ga0501082_0024808 | 3300060353 | Bacteria | 5168 |
| 1156 | Ga0501082_0610613 | 3300060353 | Bacteria | 954 |
| 1157 | Ga0501082_0671005 | 3300060353 | Bacteria | 907 |
| 1158 | Ga0501082_0974926 | 3300060353 | Bacteria | 741 |
| 1159 | Ga0501082_1436838 | 3300060353 | Bacteria | 602 |
| 1160 | Ga0501082_1527490 | 3300060353 | Bacteria | 583 |
| 1161 | Ga0501082_1933548 | 3300060353 | Bacteria | 514 |
| 1162 | Ga0466962_0404773 | 3300061719 | Bacteria | 683 |
| 1163 | Ga0530510_0031838 | 3300061734 | Bacteria | 3792 |
| 1164 | Ga0530510_0304989 | 3300061734 | Bacteria | 1192 |
| 1165 | Ga0530510_0499378 | 3300061734 | Bacteria | 922 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10485627 | Ga0065707_104856271 | 119 |
| 2 | 3300039453 | Ga0436362_1116774 | Ga0436362_1116774_278_679 | 120 |
| 3 | 3300046535 | Ga0495586_0524644 | Ga0495586_0524644_62_460 | 120 |
| 4 | 3300046473 | Ga0495582_0437119 | Ga0495582_0437119_89_481 | 123 |
| 5 | 3300020080 | Ga0206350_10920527 | Ga0206350_109205273 | 127 |
| 6 | 3300014326 | Ga0157380_10304111 | Ga0157380_103041111 | 128 |
| 7 | 3300048912 | Ga0496109_0602136 | Ga0496109_0602136_503_895 | 128 |
| 8 | 3300005353 | Ga0070669_101456492 | Ga0070669_1014564921 | 129 |
| 9 | 3300025961 | Ga0207712_11288300 | Ga0207712_112883002 | 129 |
| 10 | 3300026075 | Ga0207708_11465389 | Ga0207708_114653892 | 129 |
| 11 | 3300030877 | Ga0265777_109454 | Ga0265777_1094542 | 129 |
| 12 | 3300031090 | Ga0265760_10017276 | Ga0265760_100172764 | 129 |
| 13 | 3300044712 | Ga0453684_0964314 | Ga0453684_0964314_502_894 | 129 |
| 14 | 3300046516 | Ga0495628_0914114 | Ga0495628_0914114_49_444 | 129 |
| 15 | 3300002073 | JGI24745J21846_1001877 | JGI24745J21846_10018775 | 130 |
| 16 | 3300004799 | Ga0058863_11918246 | Ga0058863_119182461 | 130 |
| 17 | 3300004799 | Ga0058863_11957316 | Ga0058863_119573163 | 130 |
| 18 | 3300005290 | Ga0065712_10113701 | Ga0065712_101137012 | 130 |
| 19 | 3300005293 | Ga0065715_10063152 | Ga0065715_100631522 | 130 |
| 20 | 3300005329 | Ga0070683_100363808 | Ga0070683_1003638082 | 130 |
| 21 | 3300005329 | Ga0070683_101340454 | Ga0070683_1013404542 | 130 |
| 22 | 3300005330 | Ga0070690_100048896 | Ga0070690_1000488964 | 130 |
| 23 | 3300005330 | Ga0070690_100334046 | Ga0070690_1003340461 | 130 |
| 24 | 3300005330 | Ga0070690_101584607 | Ga0070690_1015846071 | 130 |
| 25 | 3300005331 | Ga0070670_100751242 | Ga0070670_1007512422 | 130 |
| 26 | 3300005331 | Ga0070670_101121483 | Ga0070670_1011214832 | 130 |
| 27 | 3300005334 | Ga0068869_102125525 | Ga0068869_1021255251 | 130 |
| 28 | 3300005335 | Ga0070666_10781288 | Ga0070666_107812882 | 130 |
| 29 | 3300005336 | Ga0070680_100373398 | Ga0070680_1003733982 | 130 |
| 30 | 3300005336 | Ga0070680_101020262 | Ga0070680_1010202622 | 130 |
| 31 | 3300005338 | Ga0068868_100151741 | Ga0068868_1001517414 | 130 |
| 32 | 3300005338 | Ga0068868_100403634 | Ga0068868_1004036341 | 130 |
| 33 | 3300005339 | Ga0070660_100123948 | Ga0070660_1001239484 | 130 |
| 34 | 3300005339 | Ga0070660_100261615 | Ga0070660_1002616152 | 130 |
| 35 | 3300005339 | Ga0070660_100593135 | Ga0070660_1005931352 | 130 |
| 36 | 3300005339 | Ga0070660_101068235 | Ga0070660_1010682351 | 130 |
| 37 | 3300005340 | Ga0070689_100804299 | Ga0070689_1008042991 | 130 |
| 38 | 3300005341 | Ga0070691_10023408 | Ga0070691_100234085 | 130 |
| 39 | 3300005341 | Ga0070691_10189233 | Ga0070691_101892332 | 130 |
| 40 | 3300005341 | Ga0070691_10717507 | Ga0070691_107175071 | 130 |
| 41 | 3300005343 | Ga0070687_100356924 | Ga0070687_1003569241 | 130 |
| 42 | 3300005344 | Ga0070661_100778634 | Ga0070661_1007786342 | 130 |
| 43 | 3300005344 | Ga0070661_101452217 | Ga0070661_1014522171 | 130 |
| 44 | 3300005345 | Ga0070692_10225988 | Ga0070692_102259882 | 130 |
| 45 | 3300005345 | Ga0070692_10527502 | Ga0070692_105275022 | 130 |
| 46 | 3300005347 | Ga0070668_100254737 | Ga0070668_1002547372 | 130 |
| 47 | 3300005347 | Ga0070668_100793922 | Ga0070668_1007939221 | 130 |
| 48 | 3300005353 | Ga0070669_100078134 | Ga0070669_1000781343 | 130 |
| 49 | 3300005353 | Ga0070669_101298822 | Ga0070669_1012988221 | 130 |
| 50 | 3300005354 | Ga0070675_100041662 | Ga0070675_1000416622 | 130 |
| 51 | 3300005354 | Ga0070675_100418939 | Ga0070675_1004189393 | 130 |
| 52 | 3300005354 | Ga0070675_101189689 | Ga0070675_1011896892 | 130 |
| 53 | 3300005354 | Ga0070675_101392756 | Ga0070675_1013927561 | 130 |
| 54 | 3300005355 | Ga0070671_101524059 | Ga0070671_1015240591 | 130 |
| 55 | 3300005356 | Ga0070674_100026741 | Ga0070674_1000267415 | 130 |
| 56 | 3300005356 | Ga0070674_100064122 | Ga0070674_1000641224 | 130 |
| 57 | 3300005356 | Ga0070674_100125926 | Ga0070674_1001259262 | 130 |
| 58 | 3300005356 | Ga0070674_100160059 | Ga0070674_1001600591 | 130 |
| 59 | 3300005364 | Ga0070673_100177821 | Ga0070673_1001778213 | 130 |
| 60 | 3300005364 | Ga0070673_100439083 | Ga0070673_1004390831 | 130 |
| 61 | 3300005364 | Ga0070673_100664790 | Ga0070673_1006647902 | 130 |
| 62 | 3300005365 | Ga0070688_100946637 | Ga0070688_1009466372 | 130 |
| 63 | 3300005365 | Ga0070688_101109780 | Ga0070688_1011097802 | 130 |
| 64 | 3300005366 | Ga0070659_100345404 | Ga0070659_1003454043 | 130 |
| 65 | 3300005366 | Ga0070659_100560527 | Ga0070659_1005605272 | 130 |
| 66 | 3300005367 | Ga0070667_100349742 | Ga0070667_1003497423 | 130 |
| 67 | 3300005367 | Ga0070667_100656317 | Ga0070667_1006563172 | 130 |
| 68 | 3300005406 | Ga0070703_10006895 | Ga0070703_100068955 | 130 |
| 69 | 3300005435 | Ga0070714_100542434 | Ga0070714_1005424342 | 130 |
| 70 | 3300005436 | Ga0070713_100234062 | Ga0070713_1002340623 | 130 |
| 71 | 3300005436 | Ga0070713_101081728 | Ga0070713_1010817282 | 130 |
| 72 | 3300005436 | Ga0070713_101976119 | Ga0070713_1019761191 | 130 |
| 73 | 3300005436 | Ga0070713_102267855 | Ga0070713_1022678551 | 130 |
| 74 | 3300005437 | Ga0070710_11149834 | Ga0070710_111498341 | 130 |
| 75 | 3300005438 | Ga0070701_10004277 | Ga0070701_100042774 | 130 |
| 76 | 3300005438 | Ga0070701_10284544 | Ga0070701_102845441 | 130 |
| 77 | 3300005438 | Ga0070701_10576572 | Ga0070701_105765721 | 130 |
| 78 | 3300005439 | Ga0070711_100048282 | Ga0070711_1000482824 | 130 |
| 79 | 3300005440 | Ga0070705_100008111 | Ga0070705_1000081111 | 130 |
| 80 | 3300005440 | Ga0070705_100045233 | Ga0070705_1000452334 | 130 |
| 81 | 3300005440 | Ga0070705_100061337 | Ga0070705_1000613374 | 130 |
| 82 | 3300005440 | Ga0070705_100114960 | Ga0070705_1001149602 | 130 |
| 83 | 3300005440 | Ga0070705_101007065 | Ga0070705_1010070652 | 130 |
| 84 | 3300005440 | Ga0070705_101662880 | Ga0070705_1016628801 | 130 |
| 85 | 3300005441 | Ga0070700_100013216 | Ga0070700_1000132166 | 130 |
| 86 | 3300005441 | Ga0070700_100622564 | Ga0070700_1006225642 | 130 |
| 87 | 3300005444 | Ga0070694_100285083 | Ga0070694_1002850832 | 130 |
| 88 | 3300005444 | Ga0070694_100317209 | Ga0070694_1003172092 | 130 |
| 89 | 3300005445 | Ga0070708_100002882 | Ga0070708_1000028829 | 130 |
| 90 | 3300005445 | Ga0070708_100014721 | Ga0070708_1000147217 | 130 |
| 91 | 3300005445 | Ga0070708_100051650 | Ga0070708_1000516503 | 130 |
| 92 | 3300005445 | Ga0070708_100114650 | Ga0070708_1001146503 | 130 |
| 93 | 3300005445 | Ga0070708_100175853 | Ga0070708_1001758532 | 130 |
| 94 | 3300005445 | Ga0070708_101667802 | Ga0070708_1016678021 | 130 |
| 95 | 3300005456 | Ga0070678_100055745 | Ga0070678_1000557454 | 130 |
| 96 | 3300005456 | Ga0070678_100070399 | Ga0070678_1000703991 | 130 |
| 97 | 3300005456 | Ga0070678_100484892 | Ga0070678_1004848922 | 130 |
| 98 | 3300005456 | Ga0070678_100667602 | Ga0070678_1006676022 | 130 |
| 99 | 3300005456 | Ga0070678_100738527 | Ga0070678_1007385272 | 130 |
| 100 | 3300005456 | Ga0070678_101498867 | Ga0070678_1014988671 | 130 |
| 101 | 3300005457 | Ga0070662_101119680 | Ga0070662_1011196801 | 130 |
| 102 | 3300005458 | Ga0070681_10162793 | Ga0070681_101627933 | 130 |
| 103 | 3300005458 | Ga0070681_10302860 | Ga0070681_103028603 | 130 |
| 104 | 3300005458 | Ga0070681_10551492 | Ga0070681_105514922 | 130 |
| 105 | 3300005458 | Ga0070681_10622920 | Ga0070681_106229202 | 130 |
| 106 | 3300005458 | Ga0070681_11597320 | Ga0070681_115973202 | 130 |
| 107 | 3300005459 | Ga0068867_100034170 | Ga0068867_1000341704 | 130 |
| 108 | 3300005459 | Ga0068867_100043147 | Ga0068867_1000431475 | 130 |
| 109 | 3300005459 | Ga0068867_100065006 | Ga0068867_1000650064 | 130 |
| 110 | 3300005459 | Ga0068867_100316760 | Ga0068867_1003167601 | 130 |
| 111 | 3300005459 | Ga0068867_100491185 | Ga0068867_1004911851 | 130 |
| 112 | 3300005467 | Ga0070706_100012452 | Ga0070706_1000124524 | 130 |
| 113 | 3300005467 | Ga0070706_100229885 | Ga0070706_1002298853 | 130 |
| 114 | 3300005467 | Ga0070706_100830639 | Ga0070706_1008306392 | 130 |
| 115 | 3300005468 | Ga0070707_100086130 | Ga0070707_1000861304 | 130 |
| 116 | 3300005471 | Ga0070698_100007643 | Ga0070698_1000076436 | 130 |
| 117 | 3300005471 | Ga0070698_101171535 | Ga0070698_1011715352 | 130 |
| 118 | 3300005518 | Ga0070699_100715826 | Ga0070699_1007158262 | 130 |
| 119 | 3300005518 | Ga0070699_100864895 | Ga0070699_1008648952 | 130 |
| 120 | 3300005535 | Ga0070684_101005174 | Ga0070684_1010051741 | 130 |
| 121 | 3300005536 | Ga0070697_100586951 | Ga0070697_1005869512 | 130 |
| 122 | 3300005536 | Ga0070697_100686513 | Ga0070697_1006865131 | 130 |
| 123 | 3300005543 | Ga0070672_100285086 | Ga0070672_1002850864 | 130 |
| 124 | 3300005543 | Ga0070672_100362166 | Ga0070672_1003621662 | 130 |
| 125 | 3300005544 | Ga0070686_100043668 | Ga0070686_1000436682 | 130 |
| 126 | 3300005544 | Ga0070686_100638962 | Ga0070686_1006389621 | 130 |
| 127 | 3300005544 | Ga0070686_101293685 | Ga0070686_1012936851 | 130 |
| 128 | 3300005545 | Ga0070695_100004664 | Ga0070695_1000046645 | 130 |
| 129 | 3300005545 | Ga0070695_100384825 | Ga0070695_1003848252 | 130 |
| 130 | 3300005545 | Ga0070695_100915954 | Ga0070695_1009159541 | 130 |
| 131 | 3300005546 | Ga0070696_100005392 | Ga0070696_1000053923 | 130 |
| 132 | 3300005546 | Ga0070696_100034118 | Ga0070696_1000341184 | 130 |
| 133 | 3300005546 | Ga0070696_100072784 | Ga0070696_1000727844 | 130 |
| 134 | 3300005546 | Ga0070696_101507314 | Ga0070696_1015073142 | 130 |
| 135 | 3300005547 | Ga0070693_100136617 | Ga0070693_1001366172 | 130 |
| 136 | 3300005547 | Ga0070693_100726481 | Ga0070693_1007264811 | 130 |
| 137 | 3300005548 | Ga0070665_100494877 | Ga0070665_1004948772 | 130 |
| 138 | 3300005548 | Ga0070665_100898040 | Ga0070665_1008980402 | 130 |
| 139 | 3300005548 | Ga0070665_101499362 | Ga0070665_1014993622 | 130 |
| 140 | 3300005549 | Ga0070704_100190204 | Ga0070704_1001902041 | 130 |
| 141 | 3300005549 | Ga0070704_100199142 | Ga0070704_1001991422 | 130 |
| 142 | 3300005549 | Ga0070704_100272886 | Ga0070704_1002728862 | 130 |
| 143 | 3300005549 | Ga0070704_100287871 | Ga0070704_1002878713 | 130 |
| 144 | 3300005549 | Ga0070704_100312409 | Ga0070704_1003124092 | 130 |
| 145 | 3300005549 | Ga0070704_100466094 | Ga0070704_1004660942 | 130 |
| 146 | 3300005549 | Ga0070704_101696730 | Ga0070704_1016967301 | 130 |
| 147 | 3300005563 | Ga0068855_100535872 | Ga0068855_1005358722 | 130 |
| 148 | 3300005564 | Ga0070664_100178694 | Ga0070664_1001786942 | 130 |
| 149 | 3300005564 | Ga0070664_100411456 | Ga0070664_1004114563 | 130 |
| 150 | 3300005564 | Ga0070664_100625012 | Ga0070664_1006250122 | 130 |
| 151 | 3300005564 | Ga0070664_100936687 | Ga0070664_1009366872 | 130 |
| 152 | 3300005578 | Ga0068854_100914679 | Ga0068854_1009146792 | 130 |
| 153 | 3300005578 | Ga0068854_100938550 | Ga0068854_1009385501 | 130 |
| 154 | 3300005614 | Ga0068856_100316577 | Ga0068856_1003165772 | 130 |
| 155 | 3300005614 | Ga0068856_101090923 | Ga0068856_1010909232 | 130 |
| 156 | 3300005614 | Ga0068856_102303174 | Ga0068856_1023031741 | 130 |
| 157 | 3300005615 | Ga0070702_100070055 | Ga0070702_1000700551 | 130 |
| 158 | 3300005615 | Ga0070702_100203069 | Ga0070702_1002030692 | 130 |
| 159 | 3300005615 | Ga0070702_100267871 | Ga0070702_1002678713 | 130 |
| 160 | 3300005615 | Ga0070702_100273695 | Ga0070702_1002736952 | 130 |
| 161 | 3300005616 | Ga0068852_100063116 | Ga0068852_1000631162 | 130 |
| 162 | 3300005616 | Ga0068852_102255945 | Ga0068852_1022559451 | 130 |
| 163 | 3300005617 | Ga0068859_100265412 | Ga0068859_1002654122 | 130 |
| 164 | 3300005617 | Ga0068859_102896517 | Ga0068859_1028965171 | 130 |
| 165 | 3300005618 | Ga0068864_100024465 | Ga0068864_1000244652 | 130 |
| 166 | 3300005618 | Ga0068864_100551791 | Ga0068864_1005517912 | 130 |
| 167 | 3300005718 | Ga0068866_10165170 | Ga0068866_101651702 | 130 |
| 168 | 3300005719 | Ga0068861_100269045 | Ga0068861_1002690452 | 130 |
| 169 | 3300005719 | Ga0068861_100383439 | Ga0068861_1003834393 | 130 |
| 170 | 3300005719 | Ga0068861_101190162 | Ga0068861_1011901622 | 130 |
| 171 | 3300005719 | Ga0068861_101196440 | Ga0068861_1011964402 | 130 |
| 172 | 3300005719 | Ga0068861_101233368 | Ga0068861_1012333682 | 130 |
| 173 | 3300005834 | Ga0068851_10768583 | Ga0068851_107685831 | 130 |
| 174 | 3300005840 | Ga0068870_10169134 | Ga0068870_101691343 | 130 |
| 175 | 3300005841 | Ga0068863_100163339 | Ga0068863_1001633393 | 130 |
| 176 | 3300005841 | Ga0068863_100425701 | Ga0068863_1004257012 | 130 |
| 177 | 3300005842 | Ga0068858_100230507 | Ga0068858_1002305073 | 130 |
| 178 | 3300005842 | Ga0068858_100660742 | Ga0068858_1006607422 | 130 |
| 179 | 3300005843 | Ga0068860_100190707 | Ga0068860_1001907072 | 130 |
| 180 | 3300005843 | Ga0068860_100354464 | Ga0068860_1003544642 | 130 |
| 181 | 3300005843 | Ga0068860_100451668 | Ga0068860_1004516682 | 130 |
| 182 | 3300005843 | Ga0068860_100527037 | Ga0068860_1005270372 | 130 |
| 183 | 3300005844 | Ga0068862_101266403 | Ga0068862_1012664031 | 130 |
| 184 | 3300005844 | Ga0068862_102533836 | Ga0068862_1025338361 | 130 |
| 185 | 3300005937 | Ga0081455_10166672 | Ga0081455_101666722 | 130 |
| 186 | 3300005985 | Ga0081539_10008891 | Ga0081539_1000889118 | 130 |
| 187 | 3300005985 | Ga0081539_10011391 | Ga0081539_100113918 | 130 |
| 188 | 3300006038 | Ga0075365_10128755 | Ga0075365_101287553 | 130 |
| 189 | 3300006038 | Ga0075365_10436419 | Ga0075365_104364192 | 130 |
| 190 | 3300006038 | Ga0075365_10438268 | Ga0075365_104382682 | 130 |
| 191 | 3300006038 | Ga0075365_10782487 | Ga0075365_107824872 | 130 |
| 192 | 3300006048 | Ga0075363_100037884 | Ga0075363_1000378845 | 130 |
| 193 | 3300006051 | Ga0075364_10123739 | Ga0075364_101237394 | 130 |
| 194 | 3300006051 | Ga0075364_10421099 | Ga0075364_104210992 | 130 |
| 195 | 3300006175 | Ga0070712_100332471 | Ga0070712_1003324712 | 130 |
| 196 | 3300006175 | Ga0070712_100589458 | Ga0070712_1005894582 | 130 |
| 197 | 3300006175 | Ga0070712_100837696 | Ga0070712_1008376961 | 130 |
| 198 | 3300006178 | Ga0075367_10044620 | Ga0075367_100446203 | 130 |
| 199 | 3300006178 | Ga0075367_10220586 | Ga0075367_102205862 | 130 |
| 200 | 3300006237 | Ga0097621_100214381 | Ga0097621_1002143815 | 130 |
| 201 | 3300006353 | Ga0075370_10352225 | Ga0075370_103522252 | 130 |
| 202 | 3300006358 | Ga0068871_100450337 | Ga0068871_1004503371 | 130 |
| 203 | 3300006358 | Ga0068871_102431149 | Ga0068871_1024311492 | 130 |
| 204 | 3300006844 | Ga0075428_100000238 | Ga0075428_10000023824 | 130 |
| 205 | 3300006844 | Ga0075428_102135036 | Ga0075428_1021350362 | 130 |
| 206 | 3300006846 | Ga0075430_100029304 | Ga0075430_1000293046 | 130 |
| 207 | 3300006846 | Ga0075430_100368645 | Ga0075430_1003686452 | 130 |
| 208 | 3300006846 | Ga0075430_100691089 | Ga0075430_1006910892 | 130 |
| 209 | 3300006852 | Ga0075433_10433733 | Ga0075433_104337334 | 130 |
| 210 | 3300006852 | Ga0075433_11892593 | Ga0075433_118925931 | 130 |
| 211 | 3300006871 | Ga0075434_100004540 | Ga0075434_10000454011 | 130 |
| 212 | 3300006871 | Ga0075434_100283026 | Ga0075434_1002830264 | 130 |
| 213 | 3300006871 | Ga0075434_100534892 | Ga0075434_1005348922 | 130 |
| 214 | 3300006871 | Ga0075434_101926987 | Ga0075434_1019269871 | 130 |
| 215 | 3300006881 | Ga0068865_100170866 | Ga0068865_1001708661 | 130 |
| 216 | 3300006881 | Ga0068865_100292548 | Ga0068865_1002925482 | 130 |
| 217 | 3300006881 | Ga0068865_101007708 | Ga0068865_1010077082 | 130 |
| 218 | 3300006914 | Ga0075436_100441394 | Ga0075436_1004413942 | 130 |
| 219 | 3300006931 | Ga0097620_100265432 | Ga0097620_1002654324 | 130 |
| 220 | 3300006931 | Ga0097620_102896492 | Ga0097620_1028964921 | 130 |
| 221 | 3300007076 | Ga0075435_100304394 | Ga0075435_1003043942 | 130 |
| 222 | 3300007076 | Ga0075435_100436464 | Ga0075435_1004364644 | 130 |
| 223 | 3300007076 | Ga0075435_100735764 | Ga0075435_1007357641 | 130 |
| 224 | 3300007076 | Ga0075435_101449258 | Ga0075435_1014492581 | 130 |
| 225 | 3300009011 | Ga0105251_10150715 | Ga0105251_101507152 | 130 |
| 226 | 3300009011 | Ga0105251_10156309 | Ga0105251_101563092 | 130 |
| 227 | 3300009093 | Ga0105240_11571517 | Ga0105240_115715172 | 130 |
| 228 | 3300009093 | Ga0105240_11595821 | Ga0105240_115958212 | 130 |
| 229 | 3300009093 | Ga0105240_12017406 | Ga0105240_120174062 | 130 |
| 230 | 3300009094 | Ga0111539_11173410 | Ga0111539_111734101 | 130 |
| 231 | 3300009098 | Ga0105245_10010831 | Ga0105245_100108316 | 130 |
| 232 | 3300009098 | Ga0105245_10107113 | Ga0105245_101071132 | 130 |
| 233 | 3300009098 | Ga0105245_10182636 | Ga0105245_101826361 | 130 |
| 234 | 3300009098 | Ga0105245_10395950 | Ga0105245_103959502 | 130 |
| 235 | 3300009098 | Ga0105245_10614923 | Ga0105245_106149233 | 130 |
| 236 | 3300009098 | Ga0105245_10711509 | Ga0105245_107115092 | 130 |
| 237 | 3300009098 | Ga0105245_12587692 | Ga0105245_125876921 | 130 |
| 238 | 3300009101 | Ga0105247_10048269 | Ga0105247_100482694 | 130 |
| 239 | 3300009101 | Ga0105247_10157730 | Ga0105247_101577302 | 130 |
| 240 | 3300009101 | Ga0105247_10787307 | Ga0105247_107873071 | 130 |
| 241 | 3300009101 | Ga0105247_11124999 | Ga0105247_111249991 | 130 |
| 242 | 3300009147 | Ga0114129_10013928 | Ga0114129_100139289 | 130 |
| 243 | 3300009147 | Ga0114129_10095509 | Ga0114129_100955096 | 130 |
| 244 | 3300009147 | Ga0114129_10306806 | Ga0114129_103068061 | 130 |
| 245 | 3300009147 | Ga0114129_11533637 | Ga0114129_115336371 | 130 |
| 246 | 3300009147 | Ga0114129_12077752 | Ga0114129_120777521 | 130 |
| 247 | 3300009148 | Ga0105243_10010219 | Ga0105243_100102196 | 130 |
| 248 | 3300009148 | Ga0105243_10117905 | Ga0105243_101179051 | 130 |
| 249 | 3300009148 | Ga0105243_10184492 | Ga0105243_101844923 | 130 |
| 250 | 3300009148 | Ga0105243_10381517 | Ga0105243_103815172 | 130 |
| 251 | 3300009148 | Ga0105243_10517779 | Ga0105243_105177791 | 130 |
| 252 | 3300009148 | Ga0105243_11100438 | Ga0105243_111004382 | 130 |
| 253 | 3300009148 | Ga0105243_11136870 | Ga0105243_111368702 | 130 |
| 254 | 3300009174 | Ga0105241_11183774 | Ga0105241_111837742 | 130 |
| 255 | 3300009176 | Ga0105242_10014288 | Ga0105242_100142884 | 130 |
| 256 | 3300009176 | Ga0105242_10048621 | Ga0105242_100486214 | 130 |
| 257 | 3300009176 | Ga0105242_10141150 | Ga0105242_101411505 | 130 |
| 258 | 3300009176 | Ga0105242_10162792 | Ga0105242_101627923 | 130 |
| 259 | 3300009176 | Ga0105242_11035059 | Ga0105242_110350591 | 130 |
| 260 | 3300009176 | Ga0105242_11425123 | Ga0105242_114251231 | 130 |
| 261 | 3300009176 | Ga0105242_12932557 | Ga0105242_129325571 | 130 |
| 262 | 3300009177 | Ga0105248_10029357 | Ga0105248_100293572 | 130 |
| 263 | 3300009177 | Ga0105248_11251043 | Ga0105248_112510432 | 130 |
| 264 | 3300009177 | Ga0105248_11410131 | Ga0105248_114101312 | 130 |
| 265 | 3300009177 | Ga0105248_11961100 | Ga0105248_119611001 | 130 |
| 266 | 3300009551 | Ga0105238_10151244 | Ga0105238_101512442 | 130 |
| 267 | 3300009551 | Ga0105238_10189405 | Ga0105238_101894052 | 130 |
| 268 | 3300009551 | Ga0105238_10252118 | Ga0105238_102521183 | 130 |
| 269 | 3300009551 | Ga0105238_10766213 | Ga0105238_107662132 | 130 |
| 270 | 3300009551 | Ga0105238_11066666 | Ga0105238_110666662 | 130 |
| 271 | 3300009551 | Ga0105238_11231728 | Ga0105238_112317281 | 130 |
| 272 | 3300009551 | Ga0105238_11302686 | Ga0105238_113026861 | 130 |
| 273 | 3300009553 | Ga0105249_10180331 | Ga0105249_101803311 | 130 |
| 274 | 3300009553 | Ga0105249_10474493 | Ga0105249_104744932 | 130 |
| 275 | 3300009553 | Ga0105249_10839747 | Ga0105249_108397472 | 130 |
| 276 | 3300009553 | Ga0105249_11076305 | Ga0105249_110763052 | 130 |
| 277 | 3300010375 | Ga0105239_10102797 | Ga0105239_101027972 | 130 |
| 278 | 3300010375 | Ga0105239_10109180 | Ga0105239_101091802 | 130 |
| 279 | 3300010375 | Ga0105239_10882087 | Ga0105239_108820872 | 130 |
| 280 | 3300010375 | Ga0105239_13580572 | Ga0105239_135805721 | 130 |
| 281 | 3300011119 | Ga0105246_10460966 | Ga0105246_104609661 | 130 |
| 282 | 3300012494 | Ga0157341_1010957 | Ga0157341_10109572 | 130 |
| 283 | 3300012494 | Ga0157341_1014538 | Ga0157341_10145381 | 130 |
| 284 | 3300013044 | Ga0154019_138530 | Ga0154019_1385301 | 130 |
| 285 | 3300013102 | Ga0157371_10413641 | Ga0157371_104136412 | 130 |
| 286 | 3300013104 | Ga0157370_10993703 | Ga0157370_109937032 | 130 |
| 287 | 3300013105 | Ga0157369_10404394 | Ga0157369_104043943 | 130 |
| 288 | 3300013296 | Ga0157374_10128946 | Ga0157374_101289463 | 130 |
| 289 | 3300013296 | Ga0157374_11419756 | Ga0157374_114197561 | 130 |
| 290 | 3300013296 | Ga0157374_12567545 | Ga0157374_125675451 | 130 |
| 291 | 3300013297 | Ga0157378_10011509 | Ga0157378_100115092 | 130 |
| 292 | 3300013297 | Ga0157378_10114709 | Ga0157378_101147093 | 130 |
| 293 | 3300013297 | Ga0157378_10200215 | Ga0157378_102002153 | 130 |
| 294 | 3300013297 | Ga0157378_10245590 | Ga0157378_102455902 | 130 |
| 295 | 3300013297 | Ga0157378_10291057 | Ga0157378_102910572 | 130 |
| 296 | 3300013297 | Ga0157378_10474056 | Ga0157378_104740562 | 130 |
| 297 | 3300013297 | Ga0157378_10490338 | Ga0157378_104903384 | 130 |
| 298 | 3300013297 | Ga0157378_11859649 | Ga0157378_118596492 | 130 |
| 299 | 3300013297 | Ga0157378_13176213 | Ga0157378_131762131 | 130 |
| 300 | 3300013306 | Ga0163162_10157494 | Ga0163162_101574942 | 130 |
| 301 | 3300013306 | Ga0163162_10317375 | Ga0163162_103173752 | 130 |
| 302 | 3300013306 | Ga0163162_10912293 | Ga0163162_109122931 | 130 |
| 303 | 3300013307 | Ga0157372_11397127 | Ga0157372_113971271 | 130 |
| 304 | 3300013307 | Ga0157372_11728799 | Ga0157372_117287991 | 130 |
| 305 | 3300013307 | Ga0157372_12194534 | Ga0157372_121945342 | 130 |
| 306 | 3300013307 | Ga0157372_12695434 | Ga0157372_126954341 | 130 |
| 307 | 3300013307 | Ga0157372_13364805 | Ga0157372_133648051 | 130 |
| 308 | 3300013308 | Ga0157375_11141309 | Ga0157375_111413092 | 130 |
| 309 | 3300013308 | Ga0157375_11405038 | Ga0157375_114050382 | 130 |
| 310 | 3300013308 | Ga0157375_11779705 | Ga0157375_117797052 | 130 |
| 311 | 3300014325 | Ga0163163_10050944 | Ga0163163_100509442 | 130 |
| 312 | 3300014325 | Ga0163163_10110359 | Ga0163163_101103594 | 130 |
| 313 | 3300014325 | Ga0163163_10709971 | Ga0163163_107099711 | 130 |
| 314 | 3300014325 | Ga0163163_11132635 | Ga0163163_111326351 | 130 |
| 315 | 3300014325 | Ga0163163_11479394 | Ga0163163_114793942 | 130 |
| 316 | 3300014326 | Ga0157380_10341821 | Ga0157380_103418212 | 130 |
| 317 | 3300014326 | Ga0157380_10900440 | Ga0157380_109004402 | 130 |
| 318 | 3300014326 | Ga0157380_11071261 | Ga0157380_110712612 | 130 |
| 319 | 3300014497 | Ga0182008_10015863 | Ga0182008_100158635 | 130 |
| 320 | 3300014745 | Ga0157377_10978391 | Ga0157377_109783912 | 130 |
| 321 | 3300014968 | Ga0157379_10294062 | Ga0157379_102940624 | 130 |
| 322 | 3300014968 | Ga0157379_10378122 | Ga0157379_103781222 | 130 |
| 323 | 3300014968 | Ga0157379_10524474 | Ga0157379_105244742 | 130 |
| 324 | 3300014968 | Ga0157379_11222197 | Ga0157379_112221972 | 130 |
| 325 | 3300014968 | Ga0157379_11447265 | Ga0157379_114472652 | 130 |
| 326 | 3300014968 | Ga0157379_11859297 | Ga0157379_118592972 | 130 |
| 327 | 3300014969 | Ga0157376_10562994 | Ga0157376_105629942 | 130 |
| 328 | 3300014969 | Ga0157376_11402738 | Ga0157376_114027381 | 130 |
| 329 | 3300017792 | Ga0163161_10224975 | Ga0163161_102249753 | 130 |
| 330 | 3300017792 | Ga0163161_10635450 | Ga0163161_106354501 | 130 |
| 331 | 3300017792 | Ga0163161_10988827 | Ga0163161_109888272 | 130 |
| 332 | 3300020069 | Ga0197907_10066917 | Ga0197907_100669172 | 130 |
| 333 | 3300020069 | Ga0197907_10138522 | Ga0197907_101385223 | 130 |
| 334 | 3300020069 | Ga0197907_10234640 | Ga0197907_102346402 | 130 |
| 335 | 3300020069 | Ga0197907_10258355 | Ga0197907_102583556 | 130 |
| 336 | 3300020069 | Ga0197907_10620110 | Ga0197907_106201104 | 130 |
| 337 | 3300020069 | Ga0197907_10658576 | Ga0197907_106585761 | 130 |
| 338 | 3300020070 | Ga0206356_11448412 | Ga0206356_114484123 | 130 |
| 339 | 3300020070 | Ga0206356_11662501 | Ga0206356_116625012 | 130 |
| 340 | 3300020070 | Ga0206356_11884025 | Ga0206356_118840253 | 130 |
| 341 | 3300020075 | Ga0206349_1416863 | Ga0206349_14168632 | 130 |
| 342 | 3300020075 | Ga0206349_1666946 | Ga0206349_16669462 | 130 |
| 343 | 3300020077 | Ga0206351_10988002 | Ga0206351_109880022 | 130 |
| 344 | 3300020078 | Ga0206352_10352027 | Ga0206352_103520272 | 130 |
| 345 | 3300020078 | Ga0206352_10877631 | Ga0206352_108776311 | 130 |
| 346 | 3300020080 | Ga0206350_10761397 | Ga0206350_107613973 | 130 |
| 347 | 3300020081 | Ga0206354_11473189 | Ga0206354_114731891 | 130 |
| 348 | 3300020081 | Ga0206354_11626811 | Ga0206354_116268115 | 130 |
| 349 | 3300020082 | Ga0206353_11486044 | Ga0206353_114860441 | 130 |
| 350 | 3300020082 | Ga0206353_11522619 | Ga0206353_115226192 | 130 |
| 351 | 3300020082 | Ga0206353_11601702 | Ga0206353_116017022 | 130 |
| 352 | 3300020082 | Ga0206353_11684874 | Ga0206353_116848742 | 130 |
| 353 | 3300020082 | Ga0206353_11971528 | Ga0206353_119715283 | 130 |
| 354 | 3300020610 | Ga0154015_1336961 | Ga0154015_13369612 | 130 |
| 355 | 3300021358 | Ga0213873_10004180 | Ga0213873_100041804 | 130 |
| 356 | 3300021384 | Ga0213876_10102352 | Ga0213876_101023524 | 130 |
| 357 | 3300021384 | Ga0213876_10324749 | Ga0213876_103247492 | 130 |
| 358 | 3300021388 | Ga0213875_10169515 | Ga0213875_101695151 | 130 |
| 359 | 3300021441 | Ga0213871_10121533 | Ga0213871_101215332 | 130 |
| 360 | 3300022467 | Ga0224712_10019428 | Ga0224712_100194283 | 130 |
| 361 | 3300022467 | Ga0224712_10028710 | Ga0224712_100287104 | 130 |
| 362 | 3300022467 | Ga0224712_10227980 | Ga0224712_102279802 | 130 |
| 363 | 3300022467 | Ga0224712_10228245 | Ga0224712_102282452 | 130 |
| 364 | 3300024225 | Ga0224572_1004275 | Ga0224572_10042753 | 130 |
| 365 | 3300025321 | Ga0207656_10665156 | Ga0207656_106651561 | 130 |
| 366 | 3300025885 | Ga0207653_10000045 | Ga0207653_1000004518 | 130 |
| 367 | 3300025893 | Ga0207682_10267410 | Ga0207682_102674102 | 130 |
| 368 | 3300025898 | Ga0207692_10587399 | Ga0207692_105873992 | 130 |
| 369 | 3300025898 | Ga0207692_10681883 | Ga0207692_106818831 | 130 |
| 370 | 3300025899 | Ga0207642_10068032 | Ga0207642_100680322 | 130 |
| 371 | 3300025899 | Ga0207642_10219840 | Ga0207642_102198402 | 130 |
| 372 | 3300025899 | Ga0207642_10608802 | Ga0207642_106088022 | 130 |
| 373 | 3300025899 | Ga0207642_10643848 | Ga0207642_106438482 | 130 |
| 374 | 3300025899 | Ga0207642_10689118 | Ga0207642_106891182 | 130 |
| 375 | 3300025899 | Ga0207642_10743450 | Ga0207642_107434502 | 130 |
| 376 | 3300025899 | Ga0207642_10900498 | Ga0207642_109004981 | 130 |
| 377 | 3300025900 | Ga0207710_10168589 | Ga0207710_101685893 | 130 |
| 378 | 3300025900 | Ga0207710_10246278 | Ga0207710_102462782 | 130 |
| 379 | 3300025903 | Ga0207680_10114063 | Ga0207680_101140633 | 130 |
| 380 | 3300025903 | Ga0207680_10904093 | Ga0207680_109040931 | 130 |
| 381 | 3300025903 | Ga0207680_11068818 | Ga0207680_110688181 | 130 |
| 382 | 3300025905 | Ga0207685_10020610 | Ga0207685_100206103 | 130 |
| 383 | 3300025907 | Ga0207645_10044165 | Ga0207645_100441654 | 130 |
| 384 | 3300025907 | Ga0207645_10538690 | Ga0207645_105386902 | 130 |
| 385 | 3300025908 | Ga0207643_10116730 | Ga0207643_101167302 | 130 |
| 386 | 3300025910 | Ga0207684_10016123 | Ga0207684_100161234 | 130 |
| 387 | 3300025910 | Ga0207684_10017792 | Ga0207684_100177927 | 130 |
| 388 | 3300025910 | Ga0207684_10211663 | Ga0207684_102116632 | 130 |
| 389 | 3300025910 | Ga0207684_10492400 | Ga0207684_104924001 | 130 |
| 390 | 3300025910 | Ga0207684_11021094 | Ga0207684_110210941 | 130 |
| 391 | 3300025911 | Ga0207654_10189935 | Ga0207654_101899352 | 130 |
| 392 | 3300025911 | Ga0207654_10842662 | Ga0207654_108426622 | 130 |
| 393 | 3300025912 | Ga0207707_10135393 | Ga0207707_101353933 | 130 |
| 394 | 3300025912 | Ga0207707_10250725 | Ga0207707_102507252 | 130 |
| 395 | 3300025912 | Ga0207707_10563986 | Ga0207707_105639861 | 130 |
| 396 | 3300025915 | Ga0207693_10009145 | Ga0207693_100091457 | 130 |
| 397 | 3300025917 | Ga0207660_10430911 | Ga0207660_104309112 | 130 |
| 398 | 3300025917 | Ga0207660_10719411 | Ga0207660_107194112 | 130 |
| 399 | 3300025918 | Ga0207662_10336092 | Ga0207662_103360922 | 130 |
| 400 | 3300025919 | Ga0207657_10308237 | Ga0207657_103082373 | 130 |
| 401 | 3300025919 | Ga0207657_10573879 | Ga0207657_105738791 | 130 |
| 402 | 3300025919 | Ga0207657_10930695 | Ga0207657_109306952 | 130 |
| 403 | 3300025921 | Ga0207652_11664138 | Ga0207652_116641382 | 130 |
| 404 | 3300025922 | Ga0207646_10363971 | Ga0207646_103639712 | 130 |
| 405 | 3300025922 | Ga0207646_11265922 | Ga0207646_112659221 | 130 |
| 406 | 3300025923 | Ga0207681_10166888 | Ga0207681_101668882 | 130 |
| 407 | 3300025924 | Ga0207694_10083233 | Ga0207694_100832335 | 130 |
| 408 | 3300025924 | Ga0207694_10083865 | Ga0207694_100838652 | 130 |
| 409 | 3300025924 | Ga0207694_10540638 | Ga0207694_105406382 | 130 |
| 410 | 3300025924 | Ga0207694_10880160 | Ga0207694_108801602 | 130 |
| 411 | 3300025925 | Ga0207650_11199540 | Ga0207650_111995401 | 130 |
| 412 | 3300025926 | Ga0207659_10222511 | Ga0207659_102225112 | 130 |
| 413 | 3300025926 | Ga0207659_10276540 | Ga0207659_102765401 | 130 |
| 414 | 3300025926 | Ga0207659_10504945 | Ga0207659_105049452 | 130 |
| 415 | 3300025926 | Ga0207659_10763910 | Ga0207659_107639102 | 130 |
| 416 | 3300025927 | Ga0207687_10004768 | Ga0207687_100047688 | 130 |
| 417 | 3300025927 | Ga0207687_10052063 | Ga0207687_100520632 | 130 |
| 418 | 3300025927 | Ga0207687_10075251 | Ga0207687_100752515 | 130 |
| 419 | 3300025927 | Ga0207687_10078661 | Ga0207687_100786612 | 130 |
| 420 | 3300025927 | Ga0207687_10354080 | Ga0207687_103540802 | 130 |
| 421 | 3300025927 | Ga0207687_10491070 | Ga0207687_104910701 | 130 |
| 422 | 3300025927 | Ga0207687_11282036 | Ga0207687_112820362 | 130 |
| 423 | 3300025928 | Ga0207700_10156599 | Ga0207700_101565992 | 130 |
| 424 | 3300025928 | Ga0207700_10941816 | Ga0207700_109418162 | 130 |
| 425 | 3300025929 | Ga0207664_10180339 | Ga0207664_101803392 | 130 |
| 426 | 3300025931 | Ga0207644_10024696 | Ga0207644_100246962 | 130 |
| 427 | 3300025931 | Ga0207644_10378813 | Ga0207644_103788133 | 130 |
| 428 | 3300025931 | Ga0207644_10755044 | Ga0207644_107550442 | 130 |
| 429 | 3300025931 | Ga0207644_10906082 | Ga0207644_109060821 | 130 |
| 430 | 3300025932 | Ga0207690_10251186 | Ga0207690_102511862 | 130 |
| 431 | 3300025932 | Ga0207690_10625782 | Ga0207690_106257822 | 130 |
| 432 | 3300025932 | Ga0207690_11094134 | Ga0207690_110941342 | 130 |
| 433 | 3300025933 | Ga0207706_10352156 | Ga0207706_103521562 | 130 |
| 434 | 3300025934 | Ga0207686_10034275 | Ga0207686_100342754 | 130 |
| 435 | 3300025934 | Ga0207686_10077774 | Ga0207686_100777742 | 130 |
| 436 | 3300025934 | Ga0207686_10169437 | Ga0207686_101694373 | 130 |
| 437 | 3300025934 | Ga0207686_10602952 | Ga0207686_106029522 | 130 |
| 438 | 3300025934 | Ga0207686_10658265 | Ga0207686_106582652 | 130 |
| 439 | 3300025934 | Ga0207686_10712261 | Ga0207686_107122612 | 130 |
| 440 | 3300025935 | Ga0207709_10041719 | Ga0207709_100417194 | 130 |
| 441 | 3300025935 | Ga0207709_10063111 | Ga0207709_100631114 | 130 |
| 442 | 3300025935 | Ga0207709_10096836 | Ga0207709_100968362 | 130 |
| 443 | 3300025935 | Ga0207709_10185438 | Ga0207709_101854382 | 130 |
| 444 | 3300025935 | Ga0207709_10333144 | Ga0207709_103331441 | 130 |
| 445 | 3300025935 | Ga0207709_11224895 | Ga0207709_112248952 | 130 |
| 446 | 3300025936 | Ga0207670_10838529 | Ga0207670_108385292 | 130 |
| 447 | 3300025936 | Ga0207670_11715960 | Ga0207670_117159601 | 130 |
| 448 | 3300025937 | Ga0207669_10181517 | Ga0207669_101815171 | 130 |
| 449 | 3300025937 | Ga0207669_10197025 | Ga0207669_101970252 | 130 |
| 450 | 3300025937 | Ga0207669_10265581 | Ga0207669_102655813 | 130 |
| 451 | 3300025937 | Ga0207669_10287396 | Ga0207669_102873962 | 130 |
| 452 | 3300025938 | Ga0207704_10060997 | Ga0207704_100609972 | 130 |
| 453 | 3300025938 | Ga0207704_10209774 | Ga0207704_102097742 | 130 |
| 454 | 3300025938 | Ga0207704_10748357 | Ga0207704_107483572 | 130 |
| 455 | 3300025938 | Ga0207704_11564044 | Ga0207704_115640441 | 130 |
| 456 | 3300025940 | Ga0207691_11003204 | Ga0207691_110032041 | 130 |
| 457 | 3300025941 | Ga0207711_10121179 | Ga0207711_101211794 | 130 |
| 458 | 3300025942 | Ga0207689_10042243 | Ga0207689_100422434 | 130 |
| 459 | 3300025942 | Ga0207689_10159946 | Ga0207689_101599463 | 130 |
| 460 | 3300025942 | Ga0207689_10193029 | Ga0207689_101930292 | 130 |
| 461 | 3300025942 | Ga0207689_10512650 | Ga0207689_105126502 | 130 |
| 462 | 3300025942 | Ga0207689_10624354 | Ga0207689_106243542 | 130 |
| 463 | 3300025944 | Ga0207661_10111867 | Ga0207661_101118673 | 130 |
| 464 | 3300025944 | Ga0207661_10381523 | Ga0207661_103815232 | 130 |
| 465 | 3300025944 | Ga0207661_10695409 | Ga0207661_106954092 | 130 |
| 466 | 3300025944 | Ga0207661_11004067 | Ga0207661_110040672 | 130 |
| 467 | 3300025945 | Ga0207679_10326778 | Ga0207679_103267783 | 130 |
| 468 | 3300025945 | Ga0207679_10596116 | Ga0207679_105961162 | 130 |
| 469 | 3300025945 | Ga0207679_10670452 | Ga0207679_106704521 | 130 |
| 470 | 3300025945 | Ga0207679_10860936 | Ga0207679_108609362 | 130 |
| 471 | 3300025960 | Ga0207651_10219243 | Ga0207651_102192432 | 130 |
| 472 | 3300025960 | Ga0207651_10315054 | Ga0207651_103150542 | 130 |
| 473 | 3300025960 | Ga0207651_10962973 | Ga0207651_109629731 | 130 |
| 474 | 3300025961 | Ga0207712_10169521 | Ga0207712_101695212 | 130 |
| 475 | 3300025961 | Ga0207712_10265400 | Ga0207712_102654003 | 130 |
| 476 | 3300025961 | Ga0207712_10343007 | Ga0207712_103430072 | 130 |
| 477 | 3300025972 | Ga0207668_10337680 | Ga0207668_103376802 | 130 |
| 478 | 3300025972 | Ga0207668_10580989 | Ga0207668_105809892 | 130 |
| 479 | 3300025981 | Ga0207640_10060121 | Ga0207640_100601212 | 130 |
| 480 | 3300025981 | Ga0207640_10367029 | Ga0207640_103670292 | 130 |
| 481 | 3300025981 | Ga0207640_10752220 | Ga0207640_107522202 | 130 |
| 482 | 3300025981 | Ga0207640_12059043 | Ga0207640_120590431 | 130 |
| 483 | 3300026023 | Ga0207677_10006919 | Ga0207677_100069192 | 130 |
| 484 | 3300026023 | Ga0207677_10381996 | Ga0207677_103819961 | 130 |
| 485 | 3300026023 | Ga0207677_11326933 | Ga0207677_113269332 | 130 |
| 486 | 3300026035 | Ga0207703_10031625 | Ga0207703_100316255 | 130 |
| 487 | 3300026035 | Ga0207703_10063898 | Ga0207703_100638985 | 130 |
| 488 | 3300026041 | Ga0207639_10877692 | Ga0207639_108776922 | 130 |
| 489 | 3300026067 | Ga0207678_10505220 | Ga0207678_105052202 | 130 |
| 490 | 3300026075 | Ga0207708_10104624 | Ga0207708_101046242 | 130 |
| 491 | 3300026075 | Ga0207708_10215765 | Ga0207708_102157652 | 130 |
| 492 | 3300026075 | Ga0207708_10272688 | Ga0207708_102726884 | 130 |
| 493 | 3300026075 | Ga0207708_10876864 | Ga0207708_108768642 | 130 |
| 494 | 3300026075 | Ga0207708_11655153 | Ga0207708_116551532 | 130 |
| 495 | 3300026078 | Ga0207702_10380229 | Ga0207702_103802292 | 130 |
| 496 | 3300026078 | Ga0207702_10722817 | Ga0207702_107228172 | 130 |
| 497 | 3300026078 | Ga0207702_12045325 | Ga0207702_120453251 | 130 |
| 498 | 3300026088 | Ga0207641_10271992 | Ga0207641_102719922 | 130 |
| 499 | 3300026088 | Ga0207641_10283867 | Ga0207641_102838672 | 130 |
| 500 | 3300026089 | Ga0207648_10004913 | Ga0207648_100049137 | 130 |
| 501 | 3300026089 | Ga0207648_10066187 | Ga0207648_100661875 | 130 |
| 502 | 3300026089 | Ga0207648_10213891 | Ga0207648_102138912 | 130 |
| 503 | 3300026089 | Ga0207648_10563249 | Ga0207648_105632492 | 130 |
| 504 | 3300026089 | Ga0207648_10927662 | Ga0207648_109276622 | 130 |
| 505 | 3300026095 | Ga0207676_10154279 | Ga0207676_101542794 | 130 |
| 506 | 3300026118 | Ga0207675_100061154 | Ga0207675_1000611542 | 130 |
| 507 | 3300026118 | Ga0207675_100165622 | Ga0207675_1001656221 | 130 |
| 508 | 3300026118 | Ga0207675_100226152 | Ga0207675_1002261523 | 130 |
| 509 | 3300026118 | Ga0207675_100459885 | Ga0207675_1004598852 | 130 |
| 510 | 3300026118 | Ga0207675_101140219 | Ga0207675_1011402192 | 130 |
| 511 | 3300026121 | Ga0207683_10015626 | Ga0207683_100156265 | 130 |
| 512 | 3300026121 | Ga0207683_10032516 | Ga0207683_100325166 | 130 |
| 513 | 3300026121 | Ga0207683_10058103 | Ga0207683_100581036 | 130 |
| 514 | 3300026121 | Ga0207683_11218865 | Ga0207683_112188651 | 130 |
| 515 | 3300026142 | Ga0207698_10328741 | Ga0207698_103287413 | 130 |
| 516 | 3300026142 | Ga0207698_10475130 | Ga0207698_104751302 | 130 |
| 517 | 3300027695 | Ga0209966_1022750 | Ga0209966_10227502 | 130 |
| 518 | 3300028379 | Ga0268266_10653763 | Ga0268266_106537632 | 130 |
| 519 | 3300028379 | Ga0268266_11759336 | Ga0268266_117593362 | 130 |
| 520 | 3300028379 | Ga0268266_11944939 | Ga0268266_119449392 | 130 |
| 521 | 3300028380 | Ga0268265_10990808 | Ga0268265_109908082 | 130 |
| 522 | 3300028380 | Ga0268265_12342304 | Ga0268265_123423042 | 130 |
| 523 | 3300028381 | Ga0268264_10089199 | Ga0268264_100891994 | 130 |
| 524 | 3300028381 | Ga0268264_10226672 | Ga0268264_102266723 | 130 |
| 525 | 3300028381 | Ga0268264_10379671 | Ga0268264_103796712 | 130 |
| 526 | 3300028573 | Ga0265334_10260162 | Ga0265334_102601621 | 130 |
| 527 | 3300028800 | Ga0265338_10038787 | Ga0265338_100387876 | 130 |
| 528 | 3300028800 | Ga0265338_10070877 | Ga0265338_100708773 | 130 |
| 529 | 3300028800 | Ga0265338_10571913 | Ga0265338_105719132 | 130 |
| 530 | 3300028800 | Ga0265338_10785825 | Ga0265338_107858252 | 130 |
| 531 | 3300030733 | Ga0314311_1025355 | Ga0314311_10253552 | 130 |
| 532 | 3300030742 | Ga0316183_1183600 | Ga0316183_11836001 | 130 |
| 533 | 3300030744 | Ga0316181_1287649 | Ga0316181_12876492 | 130 |
| 534 | 3300030745 | Ga0316182_1245851 | Ga0316182_12458511 | 130 |
| 535 | 3300030760 | Ga0265762_1049059 | Ga0265762_10490591 | 130 |
| 536 | 3300030760 | Ga0265762_1074873 | Ga0265762_10748731 | 130 |
| 537 | 3300030762 | Ga0265775_108444 | Ga0265775_1084442 | 130 |
| 538 | 3300031010 | Ga0265771_1005386 | Ga0265771_10053862 | 130 |
| 539 | 3300031238 | Ga0265332_10294011 | Ga0265332_102940113 | 130 |
| 540 | 3300031247 | Ga0265340_10291174 | Ga0265340_102911741 | 130 |
| 541 | 3300031251 | Ga0265327_10001686 | Ga0265327_1000168627 | 130 |
| 542 | 3300031251 | Ga0265327_10002304 | Ga0265327_1000230412 | 130 |
| 543 | 3300031251 | Ga0265327_10007639 | Ga0265327_100076398 | 130 |
| 544 | 3300031251 | Ga0265327_10100083 | Ga0265327_101000832 | 130 |
| 545 | 3300031344 | Ga0265316_10296449 | Ga0265316_102964492 | 130 |
| 546 | 3300031344 | Ga0265316_10672727 | Ga0265316_106727271 | 130 |
| 547 | 3300031548 | Ga0307408_100340117 | Ga0307408_1003401172 | 130 |
| 548 | 3300031548 | Ga0307408_100518884 | Ga0307408_1005188842 | 130 |
| 549 | 3300031727 | Ga0316576_10326085 | Ga0316576_103260852 | 130 |
| 550 | 3300031728 | Ga0316578_10049797 | Ga0316578_100497973 | 130 |
| 551 | 3300031824 | Ga0307413_12058897 | Ga0307413_120588971 | 130 |
| 552 | 3300031852 | Ga0307410_10094631 | Ga0307410_100946312 | 130 |
| 553 | 3300031911 | Ga0307412_10630648 | Ga0307412_106306482 | 130 |
| 554 | 3300031995 | Ga0307409_100018566 | Ga0307409_1000185667 | 130 |
| 555 | 3300031995 | Ga0307409_100078408 | Ga0307409_1000784083 | 130 |
| 556 | 3300032002 | Ga0307416_101200879 | Ga0307416_1012008792 | 130 |
| 557 | 3300032002 | Ga0307416_101484776 | Ga0307416_1014847762 | 130 |
| 558 | 3300032002 | Ga0307416_101994034 | Ga0307416_1019940342 | 130 |
| 559 | 3300032002 | Ga0307416_102940131 | Ga0307416_1029401312 | 130 |
| 560 | 3300032004 | Ga0307414_10027589 | Ga0307414_100275893 | 130 |
| 561 | 3300032005 | Ga0307411_10229688 | Ga0307411_102296882 | 130 |
| 562 | 3300034816 | Ga0373930_0001122 | Ga0373930_0001122_2137_2535 | 130 |
| 563 | 3300034817 | Ga0373948_0001464 | Ga0373948_0001464_858_1256 | 130 |
| 564 | 3300034820 | Ga0373959_0116446 | Ga0373959_0116446_200_598 | 130 |
| 565 | 3300035083 | Ga0373926_0002170 | Ga0373926_0002170_4638_5030 | 130 |
| 566 | 3300035084 | Ga0373928_0007240 | Ga0373928_0007240_544_942 | 130 |
| 567 | 3300035085 | Ga0373929_0100420 | Ga0373929_0100420_92_490 | 130 |
| 568 | 3300035086 | Ga0373934_0177926 | Ga0373934_0177926_122_520 | 130 |
| 569 | 3300035086 | Ga0373934_0380024 | Ga0373934_0380024_108_500 | 130 |
| 570 | 3300035089 | Ga0373944_0001156 | Ga0373944_0001156_1102_1494 | 130 |
| 571 | 3300035091 | Ga0373951_0007578 | Ga0373951_0007578_454_852 | 130 |
| 572 | 3300035111 | Ga0373923_0385662 | Ga0373923_0385662_110_508 | 130 |
| 573 | 3300035112 | Ga0373932_0000128 | Ga0373932_0000128_17044_17442 | 130 |
| 574 | 3300035112 | Ga0373932_0035608 | Ga0373932_0035608_313_711 | 130 |
| 575 | 3300035112 | Ga0373932_0439123 | Ga0373932_0439123_28_420 | 130 |
| 576 | 3300035113 | Ga0373936_0009500 | Ga0373936_0009500_1214_1606 | 130 |
| 577 | 3300035114 | Ga0373939_0261088 | Ga0373939_0261088_155_553 | 130 |
| 578 | 3300035116 | Ga0373945_0004843 | Ga0373945_0004843_2685_3077 | 130 |
| 579 | 3300035117 | Ga0373953_0120121 | Ga0373953_0120121_702_1100 | 130 |
| 580 | 3300035118 | Ga0373954_0280577 | Ga0373954_0280577_333_731 | 130 |
| 581 | 3300035121 | Ga0373960_0123381 | Ga0373960_0123381_168_566 | 130 |
| 582 | 3300035170 | Ga0373943_0011049 | Ga0373943_0011049_1934_2326 | 130 |
| 583 | 3300035170 | Ga0373943_0142890 | Ga0373943_0142890_745_1143 | 130 |
| 584 | 3300035170 | Ga0373943_0460647 | Ga0373943_0460647_226_624 | 130 |
| 585 | 3300035171 | Ga0373946_0002234 | Ga0373946_0002234_5219_5611 | 130 |
| 586 | 3300035172 | Ga0373955_0104717 | Ga0373955_0104717_574_972 | 130 |
| 587 | 3300035241 | Ga0373961_0011680 | Ga0373961_0011680_906_1304 | 130 |
| 588 | 3300035241 | Ga0373961_0110361 | Ga0373961_0110361_31_429 | 130 |
| 589 | 3300035410 | Ga0373924_0253362 | Ga0373924_0253362_339_731 | 130 |
| 590 | 3300035691 | Ga0373931_0000003 | Ga0373931_0000003_380756_381154 | 130 |
| 591 | 3300035691 | Ga0373931_0000106 | Ga0373931_0000106_16214_16612 | 130 |
| 592 | 3300035691 | Ga0373931_0304222 | Ga0373931_0304222_260_658 | 130 |
| 593 | 3300035692 | Ga0373935_0022388 | Ga0373935_0022388_2831_3223 | 130 |
| 594 | 3300035692 | Ga0373935_1076332 | Ga0373935_1076332_81_479 | 130 |
| 595 | 3300035695 | Ga0373927_0011849 | Ga0373927_0011849_417_809 | 130 |
| 596 | 3300035695 | Ga0373927_0884676 | Ga0373927_0884676_92_490 | 130 |
| 597 | 3300035724 | Ga0373933_0089488 | Ga0373933_0089488_1461_1859 | 130 |
| 598 | 3300035725 | Ga0373947_0002057 | Ga0373947_0002057_6321_6713 | 130 |
| 599 | 3300035725 | Ga0373947_0733849 | Ga0373947_0733849_215_613 | 130 |
| 600 | 3300036401 | Ga0373937_0334807 | Ga0373937_0334807_704_1102 | 130 |
| 601 | 3300036401 | Ga0373937_1393493 | Ga0373937_1393493_88_486 | 130 |
| 602 | 3300036459 | Ga0372808_047244 | Ga0372808_047244_106_507 | 130 |
| 603 | 3300036712 | Ga0316584_0264961 | Ga0316584_0264961_610_1008 | 130 |
| 604 | 3300037068 | Ga0373925_0021904 | Ga0373925_0021904_3689_4081 | 130 |
| 605 | 3300037068 | Ga0373925_1128285 | Ga0373925_1128285_81_479 | 130 |
| 606 | 3300037418 | Ga0395900_0373303 | Ga0395900_0373303_157_555 | 130 |
| 607 | 3300037466 | Ga0395898_0059374 | Ga0395898_0059374_1549_1956 | 130 |
| 608 | 3300037853 | Ga0436364_0866303 | Ga0436364_0866303_20_418 | 130 |
| 609 | 3300037853 | Ga0436364_1329927 | Ga0436364_1329927_1113_1511 | 130 |
| 610 | 3300037853 | Ga0436364_1381779 | Ga0436364_1381779_28_432 | 130 |
| 611 | 3300038443 | Ga0395901_0017551 | Ga0395901_0017551_2135_2542 | 130 |
| 612 | 3300038443 | Ga0395901_0444755 | Ga0395901_0444755_490_882 | 130 |
| 613 | 3300039437 | Ga0436365_0757378 | Ga0436365_0757378_421_819 | 130 |
| 614 | 3300039437 | Ga0436365_0825774 | Ga0436365_0825774_234_632 | 130 |
| 615 | 3300039437 | Ga0436365_1123200 | Ga0436365_1123200_2291_2689 | 130 |
| 616 | 3300039437 | Ga0436365_1153046 | Ga0436365_1153046_141_539 | 130 |
| 617 | 3300039437 | Ga0436365_1306079 | Ga0436365_1306079_469_867 | 130 |
| 618 | 3300039437 | Ga0436365_1432336 | Ga0436365_1432336_19_417 | 130 |
| 619 | 3300039437 | Ga0436365_1761886 | Ga0436365_1761886_1065_1463 | 130 |
| 620 | 3300039437 | Ga0436365_1808656 | Ga0436365_1808656_2802_3200 | 130 |
| 621 | 3300039437 | Ga0436365_1894830 | Ga0436365_1894830_254_652 | 130 |
| 622 | 3300039438 | Ga0436360_0096903 | Ga0436360_0096903_3109_3507 | 130 |
| 623 | 3300039438 | Ga0436360_0376719 | Ga0436360_0376719_359_760 | 130 |
| 624 | 3300039438 | Ga0436360_0496509 | Ga0436360_0496509_73_474 | 130 |
| 625 | 3300039438 | Ga0436360_0828962 | Ga0436360_0828962_1181_1588 | 130 |
| 626 | 3300039447 | Ga0436361_0130315 | Ga0436361_0130315_896_1294 | 130 |
| 627 | 3300039447 | Ga0436361_0749762 | Ga0436361_0749762_217_618 | 130 |
| 628 | 3300039450 | Ga0436363_0601662 | Ga0436363_0601662_190_588 | 130 |
| 629 | 3300039450 | Ga0436363_1014237 | Ga0436363_1014237_244_651 | 130 |
| 630 | 3300039450 | Ga0436363_1406155 | Ga0436363_1406155_312_710 | 130 |
| 631 | 3300039450 | Ga0436363_1682249 | Ga0436363_1682249_10_408 | 130 |
| 632 | 3300039453 | Ga0436362_0151148 | Ga0436362_0151148_6807_7205 | 130 |
| 633 | 3300039453 | Ga0436362_0209718 | Ga0436362_0209718_1618_2016 | 130 |
| 634 | 3300039453 | Ga0436362_0667111 | Ga0436362_0667111_162_560 | 130 |
| 635 | 3300039453 | Ga0436362_0750007 | Ga0436362_0750007_842_1240 | 130 |
| 636 | 3300039453 | Ga0436362_0953726 | Ga0436362_0953726_137_535 | 130 |
| 637 | 3300039453 | Ga0436362_1076925 | Ga0436362_1076925_444_851 | 130 |
| 638 | 3300039453 | Ga0436362_1153288 | Ga0436362_1153288_148_546 | 130 |
| 639 | 3300041404 | Ga0439436_0021096 | Ga0439436_0021096_943_1341 | 130 |
| 640 | 3300041405 | Ga0439438_143844 | Ga0439438_143844_68_466 | 130 |
| 641 | 3300041410 | Ga0439461_0037616 | Ga0439461_0037616_604_1002 | 130 |
| 642 | 3300041411 | Ga0439466_0168151 | Ga0439466_0168151_190_582 | 130 |
| 643 | 3300041443 | Ga0451789_0615416 | Ga0451789_0615416_53_451 | 130 |
| 644 | 3300041460 | Ga0451802_0378443 | Ga0451802_0378443_63_461 | 130 |
| 645 | 3300041463 | Ga0451804_0819133 | Ga0451804_0819133_31_429 | 130 |
| 646 | 3300041509 | Ga0451843_0706509 | Ga0451843_0706509_33_431 | 130 |
| 647 | 3300041511 | Ga0451855_0509808 | Ga0451855_0509808_18_416 | 130 |
| 648 | 3300042006 | Ga0439432_117955 | Ga0439432_117955_168_566 | 130 |
| 649 | 3300042008 | Ga0439450_109521 | Ga0439450_109521_115_513 | 130 |
| 650 | 3300042015 | Ga0439462_0157511 | Ga0439462_0157511_19_417 | 130 |
| 651 | 3300042145 | Ga0450906_056126 | Ga0450906_056126_161_559 | 130 |
| 652 | 3300042156 | Ga0439446_0047733 | Ga0439446_0047733_652_1050 | 130 |
| 653 | 3300042435 | Ga0439434_0038838 | Ga0439434_0038838_564_962 | 130 |
| 654 | 3300042876 | Ga0451577_0273721 | Ga0451577_0273721_441_839 | 130 |
| 655 | 3300044656 | Ga0466969_0039743 | Ga0466969_0039743_104_502 | 130 |
| 656 | 3300044683 | Ga0466965_0798825 | Ga0466965_0798825_115_513 | 130 |
| 657 | 3300044684 | Ga0466966_0022847 | Ga0466966_0022847_816_1214 | 130 |
| 658 | 3300044684 | Ga0466966_0270913 | Ga0466966_0270913_480_878 | 130 |
| 659 | 3300044693 | Ga0466961_0042005 | Ga0466961_0042005_1622_2020 | 130 |
| 660 | 3300044693 | Ga0466961_0388681 | Ga0466961_0388681_337_735 | 130 |
| 661 | 3300044693 | Ga0466961_0444558 | Ga0466961_0444558_261_659 | 130 |
| 662 | 3300044693 | Ga0466961_0555323 | Ga0466961_0555323_214_612 | 130 |
| 663 | 3300044694 | Ga0466963_0112526 | Ga0466963_0112526_879_1277 | 130 |
| 664 | 3300044694 | Ga0466963_0163117 | Ga0466963_0163117_679_1077 | 130 |
| 665 | 3300044694 | Ga0466963_1235637 | Ga0466963_1235637_71_469 | 130 |
| 666 | 3300044719 | Ga0466971_0157586 | Ga0466971_0157586_339_737 | 130 |
| 667 | 3300044735 | Ga0466968_0088330 | Ga0466968_0088330_553_951 | 130 |
| 668 | 3300044735 | Ga0466968_0215113 | Ga0466968_0215113_400_798 | 130 |
| 669 | 3300044842 | Ga0466957_0139873 | Ga0466957_0139873_724_1122 | 130 |
| 670 | 3300044842 | Ga0466957_0605704 | Ga0466957_0605704_343_741 | 130 |
| 671 | 3300044901 | Ga0466960_0580737 | Ga0466960_0580737_29_427 | 130 |
| 672 | 3300045049 | Ga0466959_0039379 | Ga0466959_0039379_2717_3115 | 130 |
| 673 | 3300045049 | Ga0466959_0232887 | Ga0466959_0232887_789_1187 | 130 |
| 674 | 3300045049 | Ga0466959_0268900 | Ga0466959_0268900_367_765 | 130 |
| 675 | 3300045836 | Ga0466958_0130537 | Ga0466958_0130537_930_1328 | 130 |
| 676 | 3300045836 | Ga0466958_0392114 | Ga0466958_0392114_117_515 | 130 |
| 677 | 3300045976 | Ga0466967_0919189 | Ga0466967_0919189_224_622 | 130 |
| 678 | 3300046454 | Ga0495592_0175635 | Ga0495592_0175635_134_532 | 130 |
| 679 | 3300046454 | Ga0495592_0211815 | Ga0495592_0211815_147_545 | 130 |
| 680 | 3300046454 | Ga0495592_0306989 | Ga0495592_0306989_344_742 | 130 |
| 681 | 3300046454 | Ga0495592_0533700 | Ga0495592_0533700_231_632 | 130 |
| 682 | 3300046454 | Ga0495592_0620301 | Ga0495592_0620301_109_507 | 130 |
| 683 | 3300046455 | Ga0495603_0098014 | Ga0495603_0098014_675_1067 | 130 |
| 684 | 3300046455 | Ga0495603_0174579 | Ga0495603_0174579_132_524 | 130 |
| 685 | 3300046455 | Ga0495603_0181383 | Ga0495603_0181383_557_949 | 130 |
| 686 | 3300046455 | Ga0495603_0256707 | Ga0495603_0256707_441_839 | 130 |
| 687 | 3300046455 | Ga0495603_0306954 | Ga0495603_0306954_208_606 | 130 |
| 688 | 3300046455 | Ga0495603_0346216 | Ga0495603_0346216_285_683 | 130 |
| 689 | 3300046458 | Ga0495591_114037 | Ga0495591_114037_184_576 | 130 |
| 690 | 3300046459 | Ga0495629_0049329 | Ga0495629_0049329_1313_1705 | 130 |
| 691 | 3300046459 | Ga0495629_0287369 | Ga0495629_0287369_58_456 | 130 |
| 692 | 3300046459 | Ga0495629_0396659 | Ga0495629_0396659_516_914 | 130 |
| 693 | 3300046459 | Ga0495629_0523889 | Ga0495629_0523889_380_778 | 130 |
| 694 | 3300046459 | Ga0495629_1116261 | Ga0495629_1116261_48_446 | 130 |
| 695 | 3300046460 | Ga0495638_0296999 | Ga0495638_0296999_244_642 | 130 |
| 696 | 3300046461 | Ga0495641_0001712 | Ga0495641_0001712_12559_12951 | 130 |
| 697 | 3300046461 | Ga0495641_0373576 | Ga0495641_0373576_204_602 | 130 |
| 698 | 3300046461 | Ga0495641_0523479 | Ga0495641_0523479_37_435 | 130 |
| 699 | 3300046462 | Ga0495651_0004813 | Ga0495651_0004813_8776_9174 | 130 |
| 700 | 3300046462 | Ga0495651_0470299 | Ga0495651_0470299_379_780 | 130 |
| 701 | 3300046463 | Ga0495653_0052427 | Ga0495653_0052427_1099_1497 | 130 |
| 702 | 3300046463 | Ga0495653_0129192 | Ga0495653_0129192_1095_1496 | 130 |
| 703 | 3300046463 | Ga0495653_0129403 | Ga0495653_0129403_1062_1460 | 130 |
| 704 | 3300046463 | Ga0495653_0319390 | Ga0495653_0319390_192_584 | 130 |
| 705 | 3300046463 | Ga0495653_0329509 | Ga0495653_0329509_102_500 | 130 |
| 706 | 3300046463 | Ga0495653_0477938 | Ga0495653_0477938_170_568 | 130 |
| 707 | 3300046463 | Ga0495653_0919635 | Ga0495653_0919635_32_430 | 130 |
| 708 | 3300046472 | Ga0495580_0064765 | Ga0495580_0064765_1116_1508 | 130 |
| 709 | 3300046472 | Ga0495580_0125895 | Ga0495580_0125895_577_969 | 130 |
| 710 | 3300046472 | Ga0495580_0829919 | Ga0495580_0829919_70_468 | 130 |
| 711 | 3300046473 | Ga0495582_0064566 | Ga0495582_0064566_511_903 | 130 |
| 712 | 3300046473 | Ga0495582_0130630 | Ga0495582_0130630_929_1327 | 130 |
| 713 | 3300046473 | Ga0495582_0242871 | Ga0495582_0242871_413_811 | 130 |
| 714 | 3300046475 | Ga0495639_0001433 | Ga0495639_0001433_1219_1611 | 130 |
| 715 | 3300046475 | Ga0495639_0065791 | Ga0495639_0065791_595_993 | 130 |
| 716 | 3300046475 | Ga0495639_0407039 | Ga0495639_0407039_10_408 | 130 |
| 717 | 3300046476 | Ga0495662_0004361 | Ga0495662_0004361_5727_6119 | 130 |
| 718 | 3300046476 | Ga0495662_0083082 | Ga0495662_0083082_886_1278 | 130 |
| 719 | 3300046476 | Ga0495662_0089132 | Ga0495662_0089132_384_782 | 130 |
| 720 | 3300046476 | Ga0495662_0595722 | Ga0495662_0595722_55_453 | 130 |
| 721 | 3300046477 | Ga0495664_0223462 | Ga0495664_0223462_54_455 | 130 |
| 722 | 3300046477 | Ga0495664_0303524 | Ga0495664_0303524_338_736 | 130 |
| 723 | 3300046477 | Ga0495664_0658153 | Ga0495664_0658153_159_557 | 130 |
| 724 | 3300046477 | Ga0495664_0672770 | Ga0495664_0672770_18_416 | 130 |
| 725 | 3300046491 | Ga0495584_0071852 | Ga0495584_0071852_1029_1421 | 130 |
| 726 | 3300046491 | Ga0495584_0101981 | Ga0495584_0101981_966_1358 | 130 |
| 727 | 3300046492 | Ga0495585_0295661 | Ga0495585_0295661_348_740 | 130 |
| 728 | 3300046492 | Ga0495585_0428036 | Ga0495585_0428036_68_460 | 130 |
| 729 | 3300046499 | Ga0495594_0170210 | Ga0495594_0170210_646_1038 | 130 |
| 730 | 3300046499 | Ga0495594_0269142 | Ga0495594_0269142_221_619 | 130 |
| 731 | 3300046499 | Ga0495594_0519080 | Ga0495594_0519080_105_497 | 130 |
| 732 | 3300046500 | Ga0495596_0098321 | Ga0495596_0098321_711_1103 | 130 |
| 733 | 3300046501 | Ga0495607_0115970 | Ga0495607_0115970_894_1286 | 130 |
| 734 | 3300046511 | Ga0495608_0063614 | Ga0495608_0063614_1029_1427 | 130 |
| 735 | 3300046511 | Ga0495608_0448939 | Ga0495608_0448939_33_431 | 130 |
| 736 | 3300046514 | Ga0495618_0329707 | Ga0495618_0329707_123_521 | 130 |
| 737 | 3300046514 | Ga0495618_0457013 | Ga0495618_0457013_184_585 | 130 |
| 738 | 3300046516 | Ga0495628_0246680 | Ga0495628_0246680_103_501 | 130 |
| 739 | 3300046516 | Ga0495628_0403711 | Ga0495628_0403711_180_578 | 130 |
| 740 | 3300046516 | Ga0495628_0474187 | Ga0495628_0474187_413_811 | 130 |
| 741 | 3300046516 | Ga0495628_0550138 | Ga0495628_0550138_368_766 | 130 |
| 742 | 3300046517 | Ga0495630_0012230 | Ga0495630_0012230_5285_5677 | 130 |
| 743 | 3300046517 | Ga0495630_0134424 | Ga0495630_0134424_60_458 | 130 |
| 744 | 3300046517 | Ga0495630_0193432 | Ga0495630_0193432_932_1330 | 130 |
| 745 | 3300046517 | Ga0495630_0350345 | Ga0495630_0350345_116_514 | 130 |
| 746 | 3300046517 | Ga0495630_0420574 | Ga0495630_0420574_11_409 | 130 |
| 747 | 3300046517 | Ga0495630_0850758 | Ga0495630_0850758_39_437 | 130 |
| 748 | 3300046518 | Ga0495631_0211312 | Ga0495631_0211312_271_663 | 130 |
| 749 | 3300046520 | Ga0495637_0054933 | Ga0495637_0054933_149_541 | 130 |
| 750 | 3300046520 | Ga0495637_0316467 | Ga0495637_0316467_75_473 | 130 |
| 751 | 3300046523 | Ga0495644_0014236 | Ga0495644_0014236_1408_1800 | 130 |
| 752 | 3300046523 | Ga0495644_0127936 | Ga0495644_0127936_287_679 | 130 |
| 753 | 3300046525 | Ga0495663_0005126 | Ga0495663_0005126_2717_3109 | 130 |
| 754 | 3300046525 | Ga0495663_0029820 | Ga0495663_0029820_782_1174 | 130 |
| 755 | 3300046525 | Ga0495663_0268874 | Ga0495663_0268874_186_578 | 130 |
| 756 | 3300046526 | Ga0495666_0003428 | Ga0495666_0003428_3528_3920 | 130 |
| 757 | 3300046528 | Ga0495642_0038020 | Ga0495642_0038020_855_1247 | 130 |
| 758 | 3300046528 | Ga0495642_0104889 | Ga0495642_0104889_618_1016 | 130 |
| 759 | 3300046528 | Ga0495642_0310884 | Ga0495642_0310884_256_648 | 130 |
| 760 | 3300046529 | Ga0495652_0116165 | Ga0495652_0116165_1260_1658 | 130 |
| 761 | 3300046529 | Ga0495652_0209714 | Ga0495652_0209714_841_1239 | 130 |
| 762 | 3300046529 | Ga0495652_0332407 | Ga0495652_0332407_329_727 | 130 |
| 763 | 3300046531 | Ga0495665_0005734 | Ga0495665_0005734_511_903 | 130 |
| 764 | 3300046533 | Ga0495640_0015599 | Ga0495640_0015599_2709_3101 | 130 |
| 765 | 3300046533 | Ga0495640_0209461 | Ga0495640_0209461_505_903 | 130 |
| 766 | 3300046533 | Ga0495640_0225883 | Ga0495640_0225883_257_655 | 130 |
| 767 | 3300046533 | Ga0495640_0320046 | Ga0495640_0320046_332_730 | 130 |
| 768 | 3300046535 | Ga0495586_0015388 | Ga0495586_0015388_2389_2781 | 130 |
| 769 | 3300046535 | Ga0495586_0043241 | Ga0495586_0043241_1512_1904 | 130 |
| 770 | 3300046535 | Ga0495586_0093561 | Ga0495586_0093561_593_991 | 130 |
| 771 | 3300046535 | Ga0495586_0334000 | Ga0495586_0334000_34_432 | 130 |
| 772 | 3300046535 | Ga0495586_0427597 | Ga0495586_0427597_208_606 | 130 |
| 773 | 3300046535 | Ga0495586_0511832 | Ga0495586_0511832_134_532 | 130 |
| 774 | 3300046535 | Ga0495586_0546978 | Ga0495586_0546978_119_520 | 130 |
| 775 | 3300046535 | Ga0495586_0678352 | Ga0495586_0678352_113_511 | 130 |
| 776 | 3300046536 | Ga0495587_0041055 | Ga0495587_0041055_576_974 | 130 |
| 777 | 3300046536 | Ga0495587_0119085 | Ga0495587_0119085_825_1223 | 130 |
| 778 | 3300046536 | Ga0495587_0449872 | Ga0495587_0449872_148_549 | 130 |
| 779 | 3300046538 | Ga0495609_0094319 | Ga0495609_0094319_700_1092 | 130 |
| 780 | 3300046538 | Ga0495609_0212526 | Ga0495609_0212526_365_757 | 130 |
| 781 | 3300046538 | Ga0495609_0249713 | Ga0495609_0249713_166_564 | 130 |
| 782 | 3300046539 | Ga0495621_0001746 | Ga0495621_0001746_3629_4027 | 130 |
| 783 | 3300046539 | Ga0495621_0166753 | Ga0495621_0166753_61_453 | 130 |
| 784 | 3300046542 | Ga0495597_0260280 | Ga0495597_0260280_200_598 | 130 |
| 785 | 3300046558 | Ga0495633_0176020 | Ga0495633_0176020_186_578 | 130 |
| 786 | 3300046559 | Ga0495667_0002578 | Ga0495667_0002578_9120_9518 | 130 |
| 787 | 3300046559 | Ga0495667_0294658 | Ga0495667_0294658_446_844 | 130 |
| 788 | 3300046615 | Ga0495656_0007219 | Ga0495656_0007219_3099_3491 | 130 |
| 789 | 3300046615 | Ga0495656_0121523 | Ga0495656_0121523_674_1066 | 130 |
| 790 | 3300046615 | Ga0495656_0265427 | Ga0495656_0265427_161_553 | 130 |
| 791 | 3300046615 | Ga0495656_0293476 | Ga0495656_0293476_307_705 | 130 |
| 792 | 3300046615 | Ga0495656_0403630 | Ga0495656_0403630_255_647 | 130 |
| 793 | 3300046616 | Ga0495668_0860042 | Ga0495668_0860042_34_432 | 130 |
| 794 | 3300046642 | Ga0495634_0006384 | Ga0495634_0006384_4381_4779 | 130 |
| 795 | 3300046642 | Ga0495634_0016753 | Ga0495634_0016753_4505_4897 | 130 |
| 796 | 3300046642 | Ga0495634_0103357 | Ga0495634_0103357_1126_1524 | 130 |
| 797 | 3300046642 | Ga0495634_0195702 | Ga0495634_0195702_547_945 | 130 |
| 798 | 3300046642 | Ga0495634_0800061 | Ga0495634_0800061_90_488 | 130 |
| 799 | 3300046648 | Ga0495611_0071036 | Ga0495611_0071036_269_661 | 130 |
| 800 | 3300046648 | Ga0495611_0114256 | Ga0495611_0114256_149_541 | 130 |
| 801 | 3300046663 | Ga0495635_0016528 | Ga0495635_0016528_1195_1593 | 130 |
| 802 | 3300046663 | Ga0495635_0060316 | Ga0495635_0060316_1204_1596 | 130 |
| 803 | 3300046663 | Ga0495635_0393325 | Ga0495635_0393325_211_609 | 130 |
| 804 | 3300046664 | Ga0495659_0024672 | Ga0495659_0024672_829_1221 | 130 |
| 805 | 3300046665 | Ga0495661_0418739 | Ga0495661_0418739_16_408 | 130 |
| 806 | 3300046665 | Ga0495661_0459535 | Ga0495661_0459535_134_526 | 130 |
| 807 | 3300046674 | Ga0495588_0002482 | Ga0495588_0002482_6184_6576 | 130 |
| 808 | 3300046674 | Ga0495588_0025412 | Ga0495588_0025412_1704_2096 | 130 |
| 809 | 3300046675 | Ga0495657_0001765 | Ga0495657_0001765_5362_5760 | 130 |
| 810 | 3300046675 | Ga0495657_0132814 | Ga0495657_0132814_921_1322 | 130 |
| 811 | 3300046675 | Ga0495657_0222169 | Ga0495657_0222169_183_581 | 130 |
| 812 | 3300046675 | Ga0495657_0266021 | Ga0495657_0266021_146_544 | 130 |
| 813 | 3300046678 | Ga0495599_0132192 | Ga0495599_0132192_451_849 | 130 |
| 814 | 3300046678 | Ga0495599_0425316 | Ga0495599_0425316_49_447 | 130 |
| 815 | 3300046678 | Ga0495599_0593196 | Ga0495599_0593196_29_430 | 130 |
| 816 | 3300046678 | Ga0495599_0613017 | Ga0495599_0613017_86_484 | 130 |
| 817 | 3300046679 | Ga0495623_0027040 | Ga0495623_0027040_2291_2689 | 130 |
| 818 | 3300046679 | Ga0495623_0257910 | Ga0495623_0257910_198_596 | 130 |
| 819 | 3300046681 | Ga0495647_0000723 | Ga0495647_0000723_1934_2326 | 130 |
| 820 | 3300046681 | Ga0495647_0292930 | Ga0495647_0292930_183_581 | 130 |
| 821 | 3300046681 | Ga0495647_0568150 | Ga0495647_0568150_26_424 | 130 |
| 822 | 3300046683 | Ga0495658_0008640 | Ga0495658_0008640_2784_3176 | 130 |
| 823 | 3300046683 | Ga0495658_0193648 | Ga0495658_0193648_307_705 | 130 |
| 824 | 3300046683 | Ga0495658_0312022 | Ga0495658_0312022_493_885 | 130 |
| 825 | 3300046684 | Ga0495669_0074928 | Ga0495669_0074928_465_857 | 130 |
| 826 | 3300046684 | Ga0495669_0577258 | Ga0495669_0577258_88_486 | 130 |
| 827 | 3300046689 | Ga0495613_0001106 | Ga0495613_0001106_16881_17279 | 130 |
| 828 | 3300046689 | Ga0495613_0203568 | Ga0495613_0203568_759_1157 | 130 |
| 829 | 3300046689 | Ga0495613_0645102 | Ga0495613_0645102_20_418 | 130 |
| 830 | 3300046689 | Ga0495613_0954439 | Ga0495613_0954439_27_425 | 130 |
| 831 | 3300046689 | Ga0495613_1036532 | Ga0495613_1036532_50_448 | 130 |
| 832 | 3300046690 | Ga0495624_0006221 | Ga0495624_0006221_828_1220 | 130 |
| 833 | 3300046690 | Ga0495624_0326939 | Ga0495624_0326939_238_636 | 130 |
| 834 | 3300046690 | Ga0495624_0359395 | Ga0495624_0359395_339_737 | 130 |
| 835 | 3300046691 | Ga0495670_0031381 | Ga0495670_0031381_1487_1879 | 130 |
| 836 | 3300046691 | Ga0495670_0052710 | Ga0495670_0052710_591_983 | 130 |
| 837 | 3300046691 | Ga0495670_0077233 | Ga0495670_0077233_976_1368 | 130 |
| 838 | 3300046691 | Ga0495670_0825047 | Ga0495670_0825047_84_476 | 130 |
| 839 | 3300046694 | Ga0495649_0369232 | Ga0495649_0369232_43_435 | 130 |
| 840 | 3300046794 | Ga0495589_0030296 | Ga0495589_0030296_870_1268 | 130 |
| 841 | 3300046794 | Ga0495589_0117837 | Ga0495589_0117837_874_1266 | 130 |
| 842 | 3300046794 | Ga0495589_0200885 | Ga0495589_0200885_180_572 | 130 |
| 843 | 3300046794 | Ga0495589_0271282 | Ga0495589_0271282_152_544 | 130 |
| 844 | 3300046809 | Ga0495600_0016031 | Ga0495600_0016031_557_955 | 130 |
| 845 | 3300046809 | Ga0495600_0234419 | Ga0495600_0234419_185_586 | 130 |
| 846 | 3300046809 | Ga0495600_0312840 | Ga0495600_0312840_576_974 | 130 |
| 847 | 3300046809 | Ga0495600_0783302 | Ga0495600_0783302_77_475 | 130 |
| 848 | 3300047315 | Ga0495581_0036306 | Ga0495581_0036306_1898_2290 | 130 |
| 849 | 3300047317 | Ga0495604_0512673 | Ga0495604_0512673_58_456 | 130 |
| 850 | 3300047317 | Ga0495604_0818509 | Ga0495604_0818509_21_419 | 130 |
| 851 | 3300047317 | Ga0495604_0842200 | Ga0495604_0842200_38_436 | 130 |
| 852 | 3300047318 | Ga0495636_0445267 | Ga0495636_0445267_217_609 | 130 |
| 853 | 3300047319 | Ga0495674_0021479 | Ga0495674_0021479_5199_5591 | 130 |
| 854 | 3300047319 | Ga0495674_0173897 | Ga0495674_0173897_1097_1495 | 130 |
| 855 | 3300047319 | Ga0495674_0201212 | Ga0495674_0201212_154_552 | 130 |
| 856 | 3300047319 | Ga0495674_0476998 | Ga0495674_0476998_531_929 | 130 |
| 857 | 3300047319 | Ga0495674_0534482 | Ga0495674_0534482_345_737 | 130 |
| 858 | 3300047319 | Ga0495674_0543750 | Ga0495674_0543750_497_895 | 130 |
| 859 | 3300047319 | Ga0495674_1152092 | Ga0495674_1152092_67_465 | 130 |
| 860 | 3300047321 | Ga0495676_0057213 | Ga0495676_0057213_876_1274 | 130 |
| 861 | 3300047321 | Ga0495676_0065217 | Ga0495676_0065217_1617_2015 | 130 |
| 862 | 3300047321 | Ga0495676_0077090 | Ga0495676_0077090_1063_1455 | 130 |
| 863 | 3300047321 | Ga0495676_0101835 | Ga0495676_0101835_1597_1989 | 130 |
| 864 | 3300047321 | Ga0495676_0276125 | Ga0495676_0276125_126_524 | 130 |
| 865 | 3300047321 | Ga0495676_0295326 | Ga0495676_0295326_343_741 | 130 |
| 866 | 3300047321 | Ga0495676_0397929 | Ga0495676_0397929_398_790 | 130 |
| 867 | 3300047322 | Ga0495680_0004189 | Ga0495680_0004189_9301_9699 | 130 |
| 868 | 3300047322 | Ga0495680_0008963 | Ga0495680_0008963_5961_6353 | 130 |
| 869 | 3300047322 | Ga0495680_0207610 | Ga0495680_0207610_839_1237 | 130 |
| 870 | 3300047322 | Ga0495680_0242936 | Ga0495680_0242936_44_442 | 130 |
| 871 | 3300047322 | Ga0495680_0304550 | Ga0495680_0304550_702_1100 | 130 |
| 872 | 3300047322 | Ga0495680_1102723 | Ga0495680_1102723_81_473 | 130 |
| 873 | 3300047323 | Ga0495683_0260941 | Ga0495683_0260941_140_532 | 130 |
| 874 | 3300047444 | Ga0495675_0068857 | Ga0495675_0068857_934_1332 | 130 |
| 875 | 3300047445 | Ga0495677_0066988 | Ga0495677_0066988_849_1241 | 130 |
| 876 | 3300047469 | Ga0495673_0164950 | Ga0495673_0164950_153_551 | 130 |
| 877 | 3300047471 | Ga0495684_0054111 | Ga0495684_0054111_121_522 | 130 |
| 878 | 3300047471 | Ga0495684_0080311 | Ga0495684_0080311_1345_1743 | 130 |
| 879 | 3300047471 | Ga0495684_0565179 | Ga0495684_0565179_190_588 | 130 |
| 880 | 3300047471 | Ga0495684_0605218 | Ga0495684_0605218_191_589 | 130 |
| 881 | 3300047673 | Ga0495593_0001673 | Ga0495593_0001673_10683_11075 | 130 |
| 882 | 3300047673 | Ga0495593_0160764 | Ga0495593_0160764_560_958 | 130 |
| 883 | 3300048088 | Ga0495602_0076237 | Ga0495602_0076237_249_647 | 130 |
| 884 | 3300048088 | Ga0495602_0565901 | Ga0495602_0565901_313_711 | 130 |
| 885 | 3300048089 | Ga0495614_0155100 | Ga0495614_0155100_404_802 | 130 |
| 886 | 3300048089 | Ga0495614_0191338 | Ga0495614_0191338_336_734 | 130 |
| 887 | 3300048089 | Ga0495614_0340489 | Ga0495614_0340489_44_442 | 130 |
| 888 | 3300048090 | Ga0495615_0202840 | Ga0495615_0202840_203_601 | 130 |
| 889 | 3300048903 | Ga0496100_0041895 | Ga0496100_0041895_1807_2199 | 130 |
| 890 | 3300048903 | Ga0496100_0057169 | Ga0496100_0057169_35_427 | 130 |
| 891 | 3300048903 | Ga0496100_0270774 | Ga0496100_0270774_76_474 | 130 |
| 892 | 3300048903 | Ga0496100_0780368 | Ga0496100_0780368_145_543 | 130 |
| 893 | 3300048903 | Ga0496100_1486514 | Ga0496100_1486514_10_408 | 130 |
| 894 | 3300048903 | Ga0496100_1635770 | Ga0496100_1635770_55_453 | 130 |
| 895 | 3300048904 | Ga0496101_0025291 | Ga0496101_0025291_1956_2348 | 130 |
| 896 | 3300048904 | Ga0496101_0149994 | Ga0496101_0149994_1083_1481 | 130 |
| 897 | 3300048904 | Ga0496101_0432977 | Ga0496101_0432977_126_518 | 130 |
| 898 | 3300048904 | Ga0496101_0576568 | Ga0496101_0576568_21_419 | 130 |
| 899 | 3300048904 | Ga0496101_0714647 | Ga0496101_0714647_182_580 | 130 |
| 900 | 3300048905 | Ga0496102_0018527 | Ga0496102_0018527_2698_3090 | 130 |
| 901 | 3300048905 | Ga0496102_0234599 | Ga0496102_0234599_392_784 | 130 |
| 902 | 3300048905 | Ga0496102_0331214 | Ga0496102_0331214_177_575 | 130 |
| 903 | 3300048905 | Ga0496102_0480328 | Ga0496102_0480328_684_1076 | 130 |
| 904 | 3300048905 | Ga0496102_0480795 | Ga0496102_0480795_648_1046 | 130 |
| 905 | 3300048905 | Ga0496102_0742734 | Ga0496102_0742734_205_603 | 130 |
| 906 | 3300048905 | Ga0496102_1238289 | Ga0496102_1238289_139_531 | 130 |
| 907 | 3300048906 | Ga0496103_0102296 | Ga0496103_0102296_820_1212 | 130 |
| 908 | 3300048906 | Ga0496103_0229384 | Ga0496103_0229384_515_907 | 130 |
| 909 | 3300048906 | Ga0496103_0250916 | Ga0496103_0250916_524_922 | 130 |
| 910 | 3300048906 | Ga0496103_0705985 | Ga0496103_0705985_61_459 | 130 |
| 911 | 3300048906 | Ga0496103_0812326 | Ga0496103_0812326_167_559 | 130 |
| 912 | 3300048907 | Ga0496104_0080130 | Ga0496104_0080130_67_465 | 130 |
| 913 | 3300048907 | Ga0496104_0107421 | Ga0496104_0107421_2140_2538 | 130 |
| 914 | 3300048907 | Ga0496104_0205874 | Ga0496104_0205874_867_1259 | 130 |
| 915 | 3300048907 | Ga0496104_0220462 | Ga0496104_0220462_274_672 | 130 |
| 916 | 3300048907 | Ga0496104_0520764 | Ga0496104_0520764_169_567 | 130 |
| 917 | 3300048908 | Ga0496105_0054938 | Ga0496105_0054938_2241_2639 | 130 |
| 918 | 3300048908 | Ga0496105_0056610 | Ga0496105_0056610_2256_2654 | 130 |
| 919 | 3300048908 | Ga0496105_0163527 | Ga0496105_0163527_734_1132 | 130 |
| 920 | 3300048908 | Ga0496105_0187178 | Ga0496105_0187178_786_1178 | 130 |
| 921 | 3300048908 | Ga0496105_0327281 | Ga0496105_0327281_770_1168 | 130 |
| 922 | 3300048909 | Ga0496106_0008125 | Ga0496106_0008125_4490_4882 | 130 |
| 923 | 3300048909 | Ga0496106_0195471 | Ga0496106_0195471_632_1030 | 130 |
| 924 | 3300048909 | Ga0496106_0525198 | Ga0496106_0525198_358_750 | 130 |
| 925 | 3300048909 | Ga0496106_0774926 | Ga0496106_0774926_338_736 | 130 |
| 926 | 3300048910 | Ga0496107_0006741 | Ga0496107_0006741_2745_3137 | 130 |
| 927 | 3300048910 | Ga0496107_0043569 | Ga0496107_0043569_1897_2289 | 130 |
| 928 | 3300048910 | Ga0496107_0275344 | Ga0496107_0275344_782_1180 | 130 |
| 929 | 3300048910 | Ga0496107_0463841 | Ga0496107_0463841_156_548 | 130 |
| 930 | 3300048910 | Ga0496107_0500860 | Ga0496107_0500860_460_858 | 130 |
| 931 | 3300048911 | Ga0496108_0016189 | Ga0496108_0016189_4287_4679 | 130 |
| 932 | 3300048911 | Ga0496108_0023793 | Ga0496108_0023793_3136_3528 | 130 |
| 933 | 3300048911 | Ga0496108_0034475 | Ga0496108_0034475_2814_3212 | 130 |
| 934 | 3300048911 | Ga0496108_0060328 | Ga0496108_0060328_2747_3145 | 130 |
| 935 | 3300048911 | Ga0496108_0079575 | Ga0496108_0079575_791_1189 | 130 |
| 936 | 3300048911 | Ga0496108_0593180 | Ga0496108_0593180_275_673 | 130 |
| 937 | 3300048912 | Ga0496109_0002583 | Ga0496109_0002583_1956_2348 | 130 |
| 938 | 3300048912 | Ga0496109_0004660 | Ga0496109_0004660_6813_7211 | 130 |
| 939 | 3300048912 | Ga0496109_0004877 | Ga0496109_0004877_5853_6251 | 130 |
| 940 | 3300048912 | Ga0496109_0026262 | Ga0496109_0026262_736_1128 | 130 |
| 941 | 3300048912 | Ga0496109_0184417 | Ga0496109_0184417_1033_1431 | 130 |
| 942 | 3300048912 | Ga0496109_0234895 | Ga0496109_0234895_223_621 | 130 |
| 943 | 3300048912 | Ga0496109_0624980 | Ga0496109_0624980_248_646 | 130 |
| 944 | 3300048912 | Ga0496109_0627537 | Ga0496109_0627537_55_453 | 130 |
| 945 | 3300048912 | Ga0496109_0675396 | Ga0496109_0675396_232_630 | 130 |
| 946 | 3300048912 | Ga0496109_1326514 | Ga0496109_1326514_196_588 | 130 |
| 947 | 3300048912 | Ga0496109_1809704 | Ga0496109_1809704_64_462 | 130 |
| 948 | 3300048913 | Ga0496110_0004643 | Ga0496110_0004643_2854_3252 | 130 |
| 949 | 3300048913 | Ga0496110_0027911 | Ga0496110_0027911_1897_2289 | 130 |
| 950 | 3300048913 | Ga0496110_0089463 | Ga0496110_0089463_1864_2262 | 130 |
| 951 | 3300048913 | Ga0496110_0091123 | Ga0496110_0091123_980_1378 | 130 |
| 952 | 3300048913 | Ga0496110_0170208 | Ga0496110_0170208_1013_1411 | 130 |
| 953 | 3300048913 | Ga0496110_0961526 | Ga0496110_0961526_11_409 | 130 |
| 954 | 3300048913 | Ga0496110_1161634 | Ga0496110_1161634_168_566 | 130 |
| 955 | 3300048913 | Ga0496110_1829298 | Ga0496110_1829298_58_456 | 130 |
| 956 | 3300048914 | Ga0496111_0010628 | Ga0496111_0010628_3415_3813 | 130 |
| 957 | 3300048914 | Ga0496111_0027483 | Ga0496111_0027483_1582_1980 | 130 |
| 958 | 3300048914 | Ga0496111_0032586 | Ga0496111_0032586_978_1370 | 130 |
| 959 | 3300048914 | Ga0496111_0078099 | Ga0496111_0078099_908_1306 | 130 |
| 960 | 3300048914 | Ga0496111_0874062 | Ga0496111_0874062_68_466 | 130 |
| 961 | 3300048915 | Ga0496112_0002114 | Ga0496112_0002114_7614_8012 | 130 |
| 962 | 3300048915 | Ga0496112_0003519 | Ga0496112_0003519_6461_6859 | 130 |
| 963 | 3300048915 | Ga0496112_0013302 | Ga0496112_0013302_5550_5948 | 130 |
| 964 | 3300048915 | Ga0496112_0049244 | Ga0496112_0049244_872_1264 | 130 |
| 965 | 3300048915 | Ga0496112_0291808 | Ga0496112_0291808_467_865 | 130 |
| 966 | 3300048915 | Ga0496112_0427348 | Ga0496112_0427348_337_735 | 130 |
| 967 | 3300048915 | Ga0496112_1286805 | Ga0496112_1286805_95_493 | 130 |
| 968 | 3300048916 | Ga0496113_0077648 | Ga0496113_0077648_414_806 | 130 |
| 969 | 3300048916 | Ga0496113_0149600 | Ga0496113_0149600_981_1379 | 130 |
| 970 | 3300048916 | Ga0496113_0153627 | Ga0496113_0153627_598_996 | 130 |
| 971 | 3300048916 | Ga0496113_0273407 | Ga0496113_0273407_366_764 | 130 |
| 972 | 3300048916 | Ga0496113_0306589 | Ga0496113_0306589_549_947 | 130 |
| 973 | 3300048916 | Ga0496113_0410932 | Ga0496113_0410932_321_719 | 130 |
| 974 | 3300048916 | Ga0496113_0478416 | Ga0496113_0478416_428_820 | 130 |
| 975 | 3300048916 | Ga0496113_1610159 | Ga0496113_1610159_29_427 | 130 |
| 976 | 3300048917 | Ga0496114_0004194 | Ga0496114_0004194_9677_10075 | 130 |
| 977 | 3300048917 | Ga0496114_0012594 | Ga0496114_0012594_886_1278 | 130 |
| 978 | 3300048917 | Ga0496114_0066061 | Ga0496114_0066061_182_580 | 130 |
| 979 | 3300048917 | Ga0496114_0100423 | Ga0496114_0100423_1577_1975 | 130 |
| 980 | 3300048917 | Ga0496114_0187946 | Ga0496114_0187946_508_906 | 130 |
| 981 | 3300048917 | Ga0496114_0220275 | Ga0496114_0220275_515_907 | 130 |
| 982 | 3300048917 | Ga0496114_0508810 | Ga0496114_0508810_623_1021 | 130 |
| 983 | 3300048917 | Ga0496114_0936756 | Ga0496114_0936756_290_688 | 130 |
| 984 | 3300048917 | Ga0496114_1518317 | Ga0496114_1518317_100_498 | 130 |
| 985 | 3300048918 | Ga0496115_0069392 | Ga0496115_0069392_834_1232 | 130 |
| 986 | 3300048918 | Ga0496115_0298175 | Ga0496115_0298175_70_462 | 130 |
| 987 | 3300048918 | Ga0496115_0315454 | Ga0496115_0315454_11_403 | 130 |
| 988 | 3300048918 | Ga0496115_0479967 | Ga0496115_0479967_303_701 | 130 |
| 989 | 3300048918 | Ga0496115_0694149 | Ga0496115_0694149_132_530 | 130 |
| 990 | 3300048918 | Ga0496115_0995662 | Ga0496115_0995662_194_592 | 130 |
| 991 | 3300048922 | Ga0496119_0286724 | Ga0496119_0286724_145_543 | 130 |
| 992 | 3300048922 | Ga0496119_0540121 | Ga0496119_0540121_58_456 | 130 |
| 993 | 3300049162 | Ga0501307_056665 | Ga0501307_056665_32_430 | 130 |
| 994 | 3300049527 | Ga0501311_053539 | Ga0501311_053539_73_471 | 130 |
| 995 | 3300049568 | Ga0501031_0214433 | Ga0501031_0214433_304_702 | 130 |
| 996 | 3300049568 | Ga0501031_0721495 | Ga0501031_0721495_217_615 | 130 |
| 997 | 3300049570 | Ga0501033_0000586 | Ga0501033_0000586_25639_26037 | 130 |
| 998 | 3300049570 | Ga0501033_0501159 | Ga0501033_0501159_356_754 | 130 |
| 999 | 3300049571 | Ga0501034_0009423 | Ga0501034_0009423_9392_9790 | 130 |
| 1000 | 3300049572 | Ga0501036_0045609 | Ga0501036_0045609_1285_1683 | 130 |
| 1001 | 3300049572 | Ga0501036_0056989 | Ga0501036_0056989_2739_3137 | 130 |
| 1002 | 3300049572 | Ga0501036_0194170 | Ga0501036_0194170_427_825 | 130 |
| 1003 | 3300049572 | Ga0501036_0243147 | Ga0501036_0243147_401_799 | 130 |
| 1004 | 3300049572 | Ga0501036_0459935 | Ga0501036_0459935_296_691 | 130 |
| 1005 | 3300049572 | Ga0501036_0475806 | Ga0501036_0475806_248_646 | 130 |
| 1006 | 3300049572 | Ga0501036_0959563 | Ga0501036_0959563_45_443 | 130 |
| 1007 | 3300049574 | Ga0501038_0105410 | Ga0501038_0105410_1059_1457 | 130 |
| 1008 | 3300049574 | Ga0501038_0159909 | Ga0501038_0159909_918_1316 | 130 |
| 1009 | 3300049574 | Ga0501038_1371529 | Ga0501038_1371529_73_471 | 130 |
| 1010 | 3300049575 | Ga0501039_0114246 | Ga0501039_0114246_805_1203 | 130 |
| 1011 | 3300049575 | Ga0501039_1331379 | Ga0501039_1331379_142_540 | 130 |
| 1012 | 3300049576 | Ga0501040_0013186 | Ga0501040_0013186_3211_3609 | 130 |
| 1013 | 3300049576 | Ga0501040_0469841 | Ga0501040_0469841_369_767 | 130 |
| 1014 | 3300049576 | Ga0501040_0534645 | Ga0501040_0534645_98_496 | 130 |
| 1015 | 3300049576 | Ga0501040_0646003 | Ga0501040_0646003_301_699 | 130 |
| 1016 | 3300049576 | Ga0501040_0751493 | Ga0501040_0751493_268_660 | 130 |
| 1017 | 3300049576 | Ga0501040_1010240 | Ga0501040_1010240_52_450 | 130 |
| 1018 | 3300049577 | Ga0501041_0039470 | Ga0501041_0039470_685_1083 | 130 |
| 1019 | 3300049578 | Ga0501042_0147634 | Ga0501042_0147634_464_862 | 130 |
| 1020 | 3300049578 | Ga0501042_0334483 | Ga0501042_0334483_29_427 | 130 |
| 1021 | 3300049578 | Ga0501042_0555026 | Ga0501042_0555026_247_645 | 130 |
| 1022 | 3300049578 | Ga0501042_0799643 | Ga0501042_0799643_217_615 | 130 |
| 1023 | 3300049580 | Ga0501046_0454593 | Ga0501046_0454593_221_619 | 130 |
| 1024 | 3300049581 | Ga0501047_0390651 | Ga0501047_0390651_543_941 | 130 |
| 1025 | 3300049582 | Ga0501048_0009882 | Ga0501048_0009882_6515_6913 | 130 |
| 1026 | 3300049582 | Ga0501048_0998142 | Ga0501048_0998142_122_520 | 130 |
| 1027 | 3300049582 | Ga0501048_1179221 | Ga0501048_1179221_47_445 | 130 |
| 1028 | 3300049583 | Ga0501067_0561673 | Ga0501067_0561673_148_546 | 130 |
| 1029 | 3300049584 | Ga0501068_0263687 | Ga0501068_0263687_663_1061 | 130 |
| 1030 | 3300049584 | Ga0501068_0639683 | Ga0501068_0639683_37_435 | 130 |
| 1031 | 3300049585 | Ga0501069_0102362 | Ga0501069_0102362_311_709 | 130 |
| 1032 | 3300049585 | Ga0501069_0118008 | Ga0501069_0118008_503_895 | 130 |
| 1033 | 3300049586 | Ga0501070_0871175 | Ga0501070_0871175_52_450 | 130 |
| 1034 | 3300049587 | Ga0501071_0130118 | Ga0501071_0130118_106_504 | 130 |
| 1035 | 3300049587 | Ga0501071_1105905 | Ga0501071_1105905_115_513 | 130 |
| 1036 | 3300049588 | Ga0501072_0004460 | Ga0501072_0004460_60_458 | 130 |
| 1037 | 3300049588 | Ga0501072_0125602 | Ga0501072_0125602_1066_1464 | 130 |
| 1038 | 3300049588 | Ga0501072_0421551 | Ga0501072_0421551_493_891 | 130 |
| 1039 | 3300049588 | Ga0501072_0541374 | Ga0501072_0541374_45_443 | 130 |
| 1040 | 3300049588 | Ga0501072_1571552 | Ga0501072_1571552_28_426 | 130 |
| 1041 | 3300049589 | Ga0501073_0034729 | Ga0501073_0034729_566_964 | 130 |
| 1042 | 3300049589 | Ga0501073_1085202 | Ga0501073_1085202_139_537 | 130 |
| 1043 | 3300049590 | Ga0501074_0091842 | Ga0501074_0091842_785_1183 | 130 |
| 1044 | 3300049590 | Ga0501074_0468695 | Ga0501074_0468695_29_427 | 130 |
| 1045 | 3300049590 | Ga0501074_1052978 | Ga0501074_1052978_70_468 | 130 |
| 1046 | 3300049591 | Ga0501075_0073190 | Ga0501075_0073190_816_1214 | 130 |
| 1047 | 3300049591 | Ga0501075_0194521 | Ga0501075_0194521_495_890 | 130 |
| 1048 | 3300049591 | Ga0501075_0334097 | Ga0501075_0334097_133_525 | 130 |
| 1049 | 3300049591 | Ga0501075_1016701 | Ga0501075_1016701_131_529 | 130 |
| 1050 | 3300049592 | Ga0501076_0029561 | Ga0501076_0029561_544_942 | 130 |
| 1051 | 3300049592 | Ga0501076_0274419 | Ga0501076_0274419_49_447 | 130 |
| 1052 | 3300049592 | Ga0501076_0444788 | Ga0501076_0444788_68_466 | 130 |
| 1053 | 3300049592 | Ga0501076_0583041 | Ga0501076_0583041_340_738 | 130 |
| 1054 | 3300049592 | Ga0501076_0965988 | Ga0501076_0965988_102_497 | 130 |
| 1055 | 3300049592 | Ga0501076_1241924 | Ga0501076_1241924_107_505 | 130 |
| 1056 | 3300049593 | Ga0501077_0040119 | Ga0501077_0040119_1995_2387 | 130 |
| 1057 | 3300049593 | Ga0501077_0058942 | Ga0501077_0058942_1759_2157 | 130 |
| 1058 | 3300049593 | Ga0501077_0388293 | Ga0501077_0388293_266_664 | 130 |
| 1059 | 3300049593 | Ga0501077_0915839 | Ga0501077_0915839_102_500 | 130 |
| 1060 | 3300049741 | Ga0501079_0027551 | Ga0501079_0027551_2059_2457 | 130 |
| 1061 | 3300049742 | Ga0501080_0278615 | Ga0501080_0278615_96_494 | 130 |
| 1062 | 3300049742 | Ga0501080_0338523 | Ga0501080_0338523_721_1119 | 130 |
| 1063 | 3300049742 | Ga0501080_1882703 | Ga0501080_1882703_49_441 | 130 |
| 1064 | 3300049743 | Ga0501081_0018885 | Ga0501081_0018885_912_1310 | 130 |
| 1065 | 3300049743 | Ga0501081_0331403 | Ga0501081_0331403_66_461 | 130 |
| 1066 | 3300049743 | Ga0501081_0459930 | Ga0501081_0459930_172_564 | 130 |
| 1067 | 3300049743 | Ga0501081_0655760 | Ga0501081_0655760_283_681 | 130 |
| 1068 | 3300049744 | Ga0501083_0944640 | Ga0501083_0944640_10_408 | 130 |
| 1069 | 3300049822 | Ga0501035_0543018 | Ga0501035_0543018_61_459 | 130 |
| 1070 | 3300049822 | Ga0501035_0715118 | Ga0501035_0715118_377_769 | 130 |
| 1071 | 3300049823 | Ga0501044_0003799 | Ga0501044_0003799_8374_8772 | 130 |
| 1072 | 3300049824 | Ga0501045_0020878 | Ga0501045_0020878_2134_2532 | 130 |
| 1073 | 3300049824 | Ga0501045_0184575 | Ga0501045_0184575_108_506 | 130 |
| 1074 | 3300049824 | Ga0501045_0384405 | Ga0501045_0384405_425_823 | 130 |
| 1075 | 3300049824 | Ga0501045_0867072 | Ga0501045_0867072_151_543 | 130 |
| 1076 | 3300050490 | nmdc:mga03n38_30805_c1 | nmdc:mga03n38_30805_c1_1127_1525 | 130 |
| 1077 | 3300050490 | nmdc:mga03n38_445852_c1 | nmdc:mga03n38_445852_c1_64_462 | 130 |
| 1078 | 3300050491 | nmdc:mga00v17_15891_c1 | nmdc:mga00v17_15891_c1_2382_2780 | 130 |
| 1079 | 3300050492 | nmdc:mga0yw44_1060720_c1 | nmdc:mga0yw44_1060720_c1_58_456 | 130 |
| 1080 | 3300050492 | nmdc:mga0yw44_138029_c1 | nmdc:mga0yw44_138029_c1_70_468 | 130 |
| 1081 | 3300050492 | nmdc:mga0yw44_15898_c1 | nmdc:mga0yw44_15898_c1_2980_3378 | 130 |
| 1082 | 3300050492 | nmdc:mga0yw44_175904_c1 | nmdc:mga0yw44_175904_c1_843_1241 | 130 |
| 1083 | 3300050492 | nmdc:mga0yw44_611903_c1 | nmdc:mga0yw44_611903_c1_175_573 | 130 |
| 1084 | 3300050493 | nmdc:mga0k408_305633_c1 | nmdc:mga0k408_305633_c1_57_455 | 130 |
| 1085 | 3300050494 | nmdc:mga06z11_174222_c1 | nmdc:mga06z11_174222_c1_357_755 | 130 |
| 1086 | 3300050494 | nmdc:mga06z11_40797_c1 | nmdc:mga06z11_40797_c1_1301_1699 | 130 |
| 1087 | 3300050494 | nmdc:mga06z11_84327_c1 | nmdc:mga06z11_84327_c1_620_1018 | 130 |
| 1088 | 3300050496 | nmdc:mga07m45_100310_c1 | nmdc:mga07m45_100310_c1_169_567 | 130 |
| 1089 | 3300050507 | nmdc:mga05p37_10502_c1 | nmdc:mga05p37_10502_c1_1512_1904 | 130 |
| 1090 | 3300050507 | nmdc:mga05p37_1223129_c1 | nmdc:mga05p37_1223129_c1_128_526 | 130 |
| 1091 | 3300050507 | nmdc:mga05p37_242254_c1 | nmdc:mga05p37_242254_c1_750_1148 | 130 |
| 1092 | 3300050507 | nmdc:mga05p37_330960_c1 | nmdc:mga05p37_330960_c1_77_475 | 130 |
| 1093 | 3300050507 | nmdc:mga05p37_81637_c1 | nmdc:mga05p37_81637_c1_685_1083 | 130 |
| 1094 | 3300050508 | nmdc:mga09592_258024_c1 | nmdc:mga09592_258024_c1_685_1092 | 130 |
| 1095 | 3300050509 | nmdc:mga0qj67_49532_c1 | nmdc:mga0qj67_49532_c1_837_1235 | 130 |
| 1096 | 3300050511 | nmdc:mga08y16_1539241_c1 | nmdc:mga08y16_1539241_c1_157_555 | 130 |
| 1097 | 3300050511 | nmdc:mga08y16_209788_c1 | nmdc:mga08y16_209788_c1_1449_1865 | 130 |
| 1098 | 3300050512 | nmdc:mga0n895_1217359_c1 | nmdc:mga0n895_1217359_c1_60_458 | 130 |
| 1099 | 3300050512 | nmdc:mga0n895_266406_c1 | nmdc:mga0n895_266406_c1_177_569 | 130 |
| 1100 | 3300050512 | nmdc:mga0n895_271050_c1 | nmdc:mga0n895_271050_c1_1193_1585 | 130 |
| 1101 | 3300050512 | nmdc:mga0n895_37338_c1 | nmdc:mga0n895_37338_c1_2531_2923 | 130 |
| 1102 | 3300050513 | nmdc:mga0rr50_1357325_c1 | nmdc:mga0rr50_1357325_c1_148_546 | 130 |
| 1103 | 3300050513 | nmdc:mga0rr50_294370_c1 | nmdc:mga0rr50_294370_c1_671_1069 | 130 |
| 1104 | 3300050513 | nmdc:mga0rr50_643440_c1 | nmdc:mga0rr50_643440_c1_218_610 | 130 |
| 1105 | 3300050514 | nmdc:mga08x19_506806_c1 | nmdc:mga08x19_506806_c1_279_677 | 130 |
| 1106 | 3300050514 | nmdc:mga08x19_79672_c1 | nmdc:mga08x19_79672_c1_53_445 | 130 |
| 1107 | 3300050515 | nmdc:mga0a205_1011_c1 | nmdc:mga0a205_1011_c1_11830_12222 | 130 |
| 1108 | 3300050516 | nmdc:mga0sz30_37512_c1 | nmdc:mga0sz30_37512_c1_639_1037 | 130 |
| 1109 | 3300053077 | Ga0495601_0147738 | Ga0495601_0147738_574_972 | 130 |
| 1110 | 3300053077 | Ga0495601_0161174 | Ga0495601_0161174_1047_1445 | 130 |
| 1111 | 3300053077 | Ga0495601_0287279 | Ga0495601_0287279_487_885 | 130 |
| 1112 | 3300053077 | Ga0495601_0333152 | Ga0495601_0333152_555_953 | 130 |
| 1113 | 3300053077 | Ga0495601_0377352 | Ga0495601_0377352_154_552 | 130 |
| 1114 | 3300053077 | Ga0495601_0790304 | Ga0495601_0790304_61_468 | 130 |
| 1115 | 3300053077 | Ga0495601_0935447 | Ga0495601_0935447_44_442 | 130 |
| 1116 | 3300053078 | Ga0495612_0580716 | Ga0495612_0580716_63_461 | 130 |
| 1117 | 3300053083 | Ga0495655_0022559 | Ga0495655_0022559_118_510 | 130 |
| 1118 | 3300053083 | Ga0495655_0044071 | Ga0495655_0044071_19_411 | 130 |
| 1119 | 3300053083 | Ga0495655_0103579 | Ga0495655_0103579_272_664 | 130 |
| 1120 | 3300053084 | Ga0495595_0064354 | Ga0495595_0064354_1296_1694 | 130 |
| 1121 | 3300053084 | Ga0495595_0094688 | Ga0495595_0094688_257_658 | 130 |
| 1122 | 3300053084 | Ga0495595_0127575 | Ga0495595_0127575_225_623 | 130 |
| 1123 | 3300053084 | Ga0495595_0133979 | Ga0495595_0133979_288_686 | 130 |
| 1124 | 3300053085 | Ga0495619_0030323 | Ga0495619_0030323_2729_3121 | 130 |
| 1125 | 3300053085 | Ga0495619_0049221 | Ga0495619_0049221_1686_2084 | 130 |
| 1126 | 3300053085 | Ga0495619_0057521 | Ga0495619_0057521_1151_1549 | 130 |
| 1127 | 3300053085 | Ga0495619_0120735 | Ga0495619_0120735_574_972 | 130 |
| 1128 | 3300053085 | Ga0495619_0138483 | Ga0495619_0138483_1126_1524 | 130 |
| 1129 | 3300053085 | Ga0495619_0241086 | Ga0495619_0241086_383_790 | 130 |
| 1130 | 3300053085 | Ga0495619_0307443 | Ga0495619_0307443_596_994 | 130 |
| 1131 | 3300053085 | Ga0495619_1153412 | Ga0495619_1153412_88_486 | 130 |
| 1132 | 3300053090 | Ga0500646_0084380 | Ga0500646_0084380_87_485 | 130 |
| 1133 | 3300053090 | Ga0500646_0108258 | Ga0500646_0108258_281_679 | 130 |
| 1134 | 3300053094 | Ga0500566_0000391 | Ga0500566_0000391_2143_2541 | 130 |
| 1135 | 3300053096 | Ga0500641_0007941 | Ga0500641_0007941_1450_1848 | 130 |
| 1136 | 3300053142 | Ga0500577_0488842 | Ga0500577_0488842_61_459 | 130 |
| 1137 | 3300053153 | Ga0500616_0000816 | Ga0500616_0000816_12996_13394 | 130 |
| 1138 | 3300053153 | Ga0500616_0003439 | Ga0500616_0003439_6106_6504 | 130 |
| 1139 | 3300053153 | Ga0500616_0141118 | Ga0500616_0141118_138_536 | 130 |
| 1140 | 3300053153 | Ga0500616_0168022 | Ga0500616_0168022_413_811 | 130 |
| 1141 | 3300053155 | Ga0500620_200098 | Ga0500620_200098_115_513 | 130 |
| 1142 | 3300054114 | Ga0501084_0000241 | Ga0501084_0000241_19679_20077 | 130 |
| 1143 | 3300054114 | Ga0501084_0017951 | Ga0501084_0017951_3541_3939 | 130 |
| 1144 | 3300054114 | Ga0501084_0605061 | Ga0501084_0605061_61_456 | 130 |
| 1145 | 3300054114 | Ga0501084_0907842 | Ga0501084_0907842_286_684 | 130 |
| 1146 | 3300054114 | Ga0501084_1314946 | Ga0501084_1314946_117_515 | 130 |
| 1147 | 3300059424 | Ga0590075_081463 | Ga0590075_081463_221_619 | 130 |
| 1148 | 3300059492 | Ga0587073_0108672 | Ga0587073_0108672_224_622 | 130 |
| 1149 | 3300059510 | Ga0587090_127763 | Ga0587090_127763_55_447 | 130 |
| 1150 | 3300059627 | Ga0587117_080537 | Ga0587117_080537_118_516 | 130 |
| 1151 | 3300059630 | Ga0587128_059009 | Ga0587128_059009_255_653 | 130 |
| 1152 | 3300059630 | Ga0587128_095601 | Ga0587128_095601_108_506 | 130 |
| 1153 | 3300059643 | Ga0587072_020414 | Ga0587072_020414_668_1066 | 130 |
| 1154 | 3300059647 | Ga0587079_161957 | Ga0587079_161957_26_424 | 130 |
| 1155 | 3300060353 | Ga0501082_0024808 | Ga0501082_0024808_2643_3041 | 130 |
| 1156 | 3300060353 | Ga0501082_0610613 | Ga0501082_0610613_254_652 | 130 |
| 1157 | 3300060353 | Ga0501082_0671005 | Ga0501082_0671005_440_838 | 130 |
| 1158 | 3300060353 | Ga0501082_0974926 | Ga0501082_0974926_240_638 | 130 |
| 1159 | 3300060353 | Ga0501082_1436838 | Ga0501082_1436838_91_486 | 130 |
| 1160 | 3300060353 | Ga0501082_1527490 | Ga0501082_1527490_30_428 | 130 |
| 1161 | 3300060353 | Ga0501082_1933548 | Ga0501082_1933548_105_497 | 130 |
| 1162 | 3300061719 | Ga0466962_0404773 | Ga0466962_0404773_48_446 | 130 |
| 1163 | 3300061734 | Ga0530510_0031838 | Ga0530510_0031838_364_762 | 130 |
| 1164 | 3300061734 | Ga0530510_0304989 | Ga0530510_0304989_585_980 | 130 |
| 1165 | 3300061734 | Ga0530510_0499378 | Ga0530510_0499378_422_820 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9381 | 16 | 116 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9292 | 17 | 108 |
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9292 | 16 | 116 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9196 | 17 | 108 |
| 4v48-assembly1.cif.gz_BK | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9169 | 15 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6L052_103_280_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9294 | 20 | 47 | 3.60.21.10 |
| 4qs2K00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8765 | 15 | 126 | 3.30.420.80 |
| af_A0A1D6DWZ1_6_279_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8714 | 20 | 47 | 3.30.420.40 |
| 6nf8K00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8609 | 15 | 130 | 3.30.420.80 |
| af_Q23155_77_208_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.856 | 20 | 130 | 3.30.420.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9256 | 21 | 108 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2E0GRJ6-F1-model_v4 | 30S ribosomal protein S11 | 0.9186 | 8 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7Y5LCP1-F1-model_v4 | Small ribosomal subunit protein uS11 | 0.9169 | 4 | 130 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7R9AEE6-F1-model_v4 | Ribosomal protein | 0.9169 | 8 | 123 |
GO:0003735
GO:0006412 GO:0015031 GO:0015934 GO:0015935 GO:0016020 GO:0019843 |
| AF-A0A1A9X6B6-F1-model_v4 | deleted | 0.9155 | 17 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar