F491016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1161 | 460 | 1158 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300053736|Ga0500599_005642|Ga0500599_005642_837_1349 |
| Length | 170 |
| Sequence | MVFRQSSSRSGSSGAAEEGEKENTIMRFMMLMIPKGYEQSAPGTMPDAKAVAAMMKYNESLQKAGVLLALDGLHPPSMGARVSFSGGKPTVTDGPFTEVKEVLGGYWMIQVKSKEEAIEWASRCPGSDNEVIEIRQVQELADFPADIQAIAEKYPEMQPQARTTSGGSGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 2 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 3 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 143 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 269 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 274 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 275 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 381 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 382 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 387 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 445 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 449 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 450 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 452 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 456 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.52 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.08 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 89.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001694 | 3300000546 | Bacteria | 2982 |
| 2 | JGI24739J22299_10019000 | 3300001989 | Bacteria | 2465 |
| 3 | JGI24737J22298_10026702 | 3300001990 | Bacteria | 1823 |
| 4 | JGI24735J21928_10006056 | 3300002067 | Bacteria | 3996 |
| 5 | JGI25160J50197_1046072 | 3300003354 | Bacteria | 960 |
| 6 | Ga0065707_10087064 | 3300005295 | Bacteria | 5183 |
| 7 | Ga0065707_10575343 | 3300005295 | Bacteria | 705 |
| 8 | Ga0070658_10081234 | 3300005327 | Bacteria | 2662 |
| 9 | Ga0070676_10459387 | 3300005328 | Bacteria | 897 |
| 10 | Ga0070683_100014532 | 3300005329 | Bacteria | 6891 |
| 11 | Ga0070683_100326919 | 3300005329 | Bacteria | 1460 |
| 12 | Ga0070690_100022915 | 3300005330 | Bacteria | 3825 |
| 13 | Ga0070677_10034532 | 3300005333 | Bacteria | 1955 |
| 14 | Ga0070666_10011547 | 3300005335 | Bacteria | 5546 |
| 15 | Ga0070680_100056302 | 3300005336 | Bacteria | 3214 |
| 16 | Ga0070680_100135952 | 3300005336 | Bacteria | 2059 |
| 17 | Ga0070680_100526542 | 3300005336 | Bacteria | 1012 |
| 18 | Ga0070680_100879287 | 3300005336 | Bacteria | 773 |
| 19 | Ga0070682_100051634 | 3300005337 | Bacteria | 2570 |
| 20 | Ga0070682_100299680 | 3300005337 | Bacteria | 1179 |
| 21 | Ga0070682_100440813 | 3300005337 | Bacteria | 995 |
| 22 | Ga0068868_100439036 | 3300005338 | Bacteria | 1133 |
| 23 | Ga0068868_100663348 | 3300005338 | Bacteria | 930 |
| 24 | Ga0068868_101558113 | 3300005338 | Bacteria | 620 |
| 25 | Ga0070660_100006936 | 3300005339 | Bacteria | 7856 |
| 26 | Ga0070660_100079672 | 3300005339 | Bacteria | 2570 |
| 27 | Ga0070660_100606388 | 3300005339 | Bacteria | 916 |
| 28 | Ga0070660_101179924 | 3300005339 | Bacteria | 649 |
| 29 | Ga0070689_100074231 | 3300005340 | Bacteria | 2661 |
| 30 | Ga0070689_100093389 | 3300005340 | Bacteria | 2375 |
| 31 | Ga0070689_100286455 | 3300005340 | Bacteria | 1368 |
| 32 | Ga0070661_100204512 | 3300005344 | Bacteria | 1510 |
| 33 | Ga0070668_100138606 | 3300005347 | Bacteria | 1959 |
| 34 | Ga0070668_100380698 | 3300005347 | Bacteria | 1201 |
| 35 | Ga0070668_100616941 | 3300005347 | Bacteria | 950 |
| 36 | Ga0070669_100537399 | 3300005353 | Bacteria | 973 |
| 37 | Ga0070675_100084124 | 3300005354 | Bacteria | 2657 |
| 38 | Ga0070675_100086621 | 3300005354 | Bacteria | 2618 |
| 39 | Ga0070675_100970290 | 3300005354 | Bacteria | 780 |
| 40 | Ga0070671_100014275 | 3300005355 | Bacteria | 6413 |
| 41 | Ga0070671_100905581 | 3300005355 | Bacteria | 771 |
| 42 | Ga0070674_100430873 | 3300005356 | Bacteria | 1084 |
| 43 | Ga0070673_100021234 | 3300005364 | Bacteria | 4701 |
| 44 | Ga0070673_100082825 | 3300005364 | Bacteria | 2605 |
| 45 | Ga0070673_100092788 | 3300005364 | Bacteria | 2471 |
| 46 | Ga0070673_101414275 | 3300005364 | Bacteria | 655 |
| 47 | Ga0070673_101490652 | 3300005364 | Bacteria | 638 |
| 48 | Ga0070688_100006642 | 3300005365 | Bacteria | 6197 |
| 49 | Ga0070688_100137146 | 3300005365 | Bacteria | 1658 |
| 50 | Ga0070688_100346586 | 3300005365 | Bacteria | 1086 |
| 51 | Ga0070688_100626785 | 3300005365 | Bacteria | 826 |
| 52 | Ga0070659_100028575 | 3300005366 | Bacteria | 4308 |
| 53 | Ga0070659_101526033 | 3300005366 | Bacteria | 596 |
| 54 | Ga0070667_100013597 | 3300005367 | Bacteria | 6725 |
| 55 | Ga0070667_100119570 | 3300005367 | Bacteria | 2291 |
| 56 | Ga0070703_10159295 | 3300005406 | Bacteria | 855 |
| 57 | Ga0070709_10047283 | 3300005434 | Bacteria | 2680 |
| 58 | Ga0070709_11167343 | 3300005434 | Bacteria | 618 |
| 59 | Ga0070714_100065164 | 3300005435 | Bacteria | 3138 |
| 60 | Ga0070714_100230448 | 3300005435 | Bacteria | 1706 |
| 61 | Ga0070714_100844896 | 3300005435 | Bacteria | 888 |
| 62 | Ga0070713_100016796 | 3300005436 | Bacteria | 5512 |
| 63 | Ga0070713_100077999 | 3300005436 | Bacteria | 2819 |
| 64 | Ga0070713_100619879 | 3300005436 | Bacteria | 1029 |
| 65 | Ga0070710_10883365 | 3300005437 | Bacteria | 644 |
| 66 | Ga0070701_10768998 | 3300005438 | Bacteria | 654 |
| 67 | Ga0070711_100076147 | 3300005439 | Bacteria | 2378 |
| 68 | Ga0070711_100240552 | 3300005439 | Bacteria | 1415 |
| 69 | Ga0070711_100468072 | 3300005439 | Bacteria | 1034 |
| 70 | Ga0070705_100064876 | 3300005440 | Bacteria | 2184 |
| 71 | Ga0070705_100083029 | 3300005440 | Bacteria | 1973 |
| 72 | Ga0070705_100715728 | 3300005440 | Bacteria | 788 |
| 73 | Ga0070705_100865791 | 3300005440 | Bacteria | 724 |
| 74 | Ga0070694_100249952 | 3300005444 | Bacteria | 1341 |
| 75 | Ga0070694_100354882 | 3300005444 | Bacteria | 1137 |
| 76 | Ga0070694_100480046 | 3300005444 | Bacteria | 986 |
| 77 | Ga0070694_101154765 | 3300005444 | Bacteria | 648 |
| 78 | Ga0070708_100496865 | 3300005445 | Bacteria | 1151 |
| 79 | Ga0070708_100530987 | 3300005445 | Bacteria | 1110 |
| 80 | Ga0070708_100765806 | 3300005445 | Bacteria | 908 |
| 81 | Ga0070663_100034280 | 3300005455 | Bacteria | 3515 |
| 82 | Ga0070678_100638025 | 3300005456 | Bacteria | 954 |
| 83 | Ga0070662_101122274 | 3300005457 | Bacteria | 675 |
| 84 | Ga0070681_10001821 | 3300005458 | Bacteria | 19202 |
| 85 | Ga0070681_10017662 | 3300005458 | Bacteria | 7129 |
| 86 | Ga0070681_10021112 | 3300005458 | Bacteria | 6524 |
| 87 | Ga0070681_10039710 | 3300005458 | Bacteria | 4716 |
| 88 | Ga0070681_10066337 | 3300005458 | Bacteria | 3578 |
| 89 | Ga0070681_10138993 | 3300005458 | Bacteria | 2359 |
| 90 | Ga0070681_10850242 | 3300005458 | Bacteria | 830 |
| 91 | Ga0070681_11512293 | 3300005458 | Bacteria | 596 |
| 92 | Ga0068867_100136666 | 3300005459 | Bacteria | 1911 |
| 93 | Ga0068867_100141508 | 3300005459 | Bacteria | 1881 |
| 94 | Ga0068867_100196068 | 3300005459 | Bacteria | 1614 |
| 95 | Ga0070707_100854486 | 3300005468 | Bacteria | 874 |
| 96 | Ga0070707_101631829 | 3300005468 | Bacteria | 612 |
| 97 | Ga0070698_100013880 | 3300005471 | Bacteria | 8520 |
| 98 | Ga0070698_100176063 | 3300005471 | Bacteria | 2078 |
| 99 | Ga0070698_100429553 | 3300005471 | Bacteria | 1256 |
| 100 | Ga0070698_100933693 | 3300005471 | Bacteria | 814 |
| 101 | Ga0070699_100000756 | 3300005518 | Bacteria | 29876 |
| 102 | Ga0070699_100008827 | 3300005518 | Bacteria | 8727 |
| 103 | Ga0070699_100278110 | 3300005518 | Bacteria | 1499 |
| 104 | Ga0070699_100395736 | 3300005518 | Bacteria | 1249 |
| 105 | Ga0070699_100480935 | 3300005518 | Bacteria | 1127 |
| 106 | Ga0070699_100620095 | 3300005518 | Bacteria | 987 |
| 107 | Ga0070679_100027556 | 3300005530 | Bacteria | 5593 |
| 108 | Ga0070679_100194069 | 3300005530 | Bacteria | 1998 |
| 109 | Ga0070679_100235244 | 3300005530 | Bacteria | 1791 |
| 110 | Ga0070679_100356404 | 3300005530 | Bacteria | 1410 |
| 111 | Ga0070684_100001913 | 3300005535 | Bacteria | 15266 |
| 112 | Ga0070684_100078687 | 3300005535 | Bacteria | 2913 |
| 113 | Ga0070684_101460439 | 3300005535 | Bacteria | 644 |
| 114 | Ga0070684_102150412 | 3300005535 | Bacteria | 527 |
| 115 | Ga0070697_100346871 | 3300005536 | Bacteria | 1282 |
| 116 | Ga0070697_100568418 | 3300005536 | Bacteria | 995 |
| 117 | Ga0068853_100003590 | 3300005539 | Bacteria | 11880 |
| 118 | Ga0068853_100095948 | 3300005539 | Bacteria | 2616 |
| 119 | Ga0068853_100146863 | 3300005539 | Bacteria | 2120 |
| 120 | Ga0068853_100523009 | 3300005539 | Bacteria | 1122 |
| 121 | Ga0070672_100021117 | 3300005543 | Bacteria | 4761 |
| 122 | Ga0070672_100022820 | 3300005543 | Bacteria | 4603 |
| 123 | Ga0070672_100138629 | 3300005543 | Bacteria | 2005 |
| 124 | Ga0070672_100350342 | 3300005543 | Bacteria | 1259 |
| 125 | Ga0070672_101746040 | 3300005543 | Unclassified | 559 |
| 126 | Ga0070686_100094766 | 3300005544 | Bacteria | 2004 |
| 127 | Ga0070695_100174256 | 3300005545 | Bacteria | 1520 |
| 128 | Ga0070695_100179658 | 3300005545 | Bacteria | 1499 |
| 129 | Ga0070695_100353799 | 3300005545 | Bacteria | 1101 |
| 130 | Ga0070696_100003969 | 3300005546 | Bacteria | 9870 |
| 131 | Ga0070696_100035553 | 3300005546 | Bacteria | 3431 |
| 132 | Ga0070696_100210891 | 3300005546 | Bacteria | 1454 |
| 133 | Ga0070696_100671626 | 3300005546 | Bacteria | 842 |
| 134 | Ga0070696_100986611 | 3300005546 | Bacteria | 703 |
| 135 | Ga0070693_100757297 | 3300005547 | Bacteria | 716 |
| 136 | Ga0070665_100000472 | 3300005548 | Bacteria | 58087 |
| 137 | Ga0070665_100001250 | 3300005548 | Bacteria | 30697 |
| 138 | Ga0070665_100148555 | 3300005548 | Bacteria | 2346 |
| 139 | Ga0070665_100175362 | 3300005548 | Bacteria | 2144 |
| 140 | Ga0070665_100289883 | 3300005548 | Bacteria | 1639 |
| 141 | Ga0070665_100542734 | 3300005548 | Bacteria | 1175 |
| 142 | Ga0070665_100571624 | 3300005548 | Bacteria | 1143 |
| 143 | Ga0070665_100579380 | 3300005548 | Bacteria | 1135 |
| 144 | Ga0070665_100629658 | 3300005548 | Bacteria | 1086 |
| 145 | Ga0070665_100956055 | 3300005548 | Bacteria | 869 |
| 146 | Ga0070665_101475643 | 3300005548 | Bacteria | 689 |
| 147 | Ga0070665_102506467 | 3300005548 | Bacteria | 517 |
| 148 | Ga0070704_100283865 | 3300005549 | Bacteria | 1373 |
| 149 | Ga0070704_100293290 | 3300005549 | Bacteria | 1352 |
| 150 | Ga0068855_100211256 | 3300005563 | Bacteria | 2180 |
| 151 | Ga0068855_100366352 | 3300005563 | Bacteria | 1585 |
| 152 | Ga0068855_100460714 | 3300005563 | Bacteria | 1386 |
| 153 | Ga0068855_100865936 | 3300005563 | Bacteria | 956 |
| 154 | Ga0070664_100329660 | 3300005564 | Bacteria | 1384 |
| 155 | Ga0070664_100763180 | 3300005564 | Bacteria | 903 |
| 156 | Ga0070664_100845185 | 3300005564 | Bacteria | 857 |
| 157 | Ga0068857_100034685 | 3300005577 | Bacteria | 4462 |
| 158 | Ga0068857_100046709 | 3300005577 | Bacteria | 3843 |
| 159 | Ga0068857_100061523 | 3300005577 | Bacteria | 3336 |
| 160 | Ga0068854_100000738 | 3300005578 | Bacteria | 19378 |
| 161 | Ga0068854_101139866 | 3300005578 | Bacteria | 696 |
| 162 | Ga0068856_100052369 | 3300005614 | Bacteria | 4025 |
| 163 | Ga0068856_100257540 | 3300005614 | Bacteria | 1760 |
| 164 | Ga0068856_101925927 | 3300005614 | Bacteria | 602 |
| 165 | Ga0070702_100001060 | 3300005615 | Bacteria | 10966 |
| 166 | Ga0070702_100534428 | 3300005615 | Bacteria | 867 |
| 167 | Ga0068852_100351640 | 3300005616 | Bacteria | 1439 |
| 168 | Ga0068859_100066701 | 3300005617 | Bacteria | 3634 |
| 169 | Ga0068859_100403632 | 3300005617 | Bacteria | 1463 |
| 170 | Ga0068859_100534772 | 3300005617 | Bacteria | 1267 |
| 171 | Ga0068859_100538753 | 3300005617 | Bacteria | 1262 |
| 172 | Ga0068859_100818545 | 3300005617 | Bacteria | 1018 |
| 173 | Ga0068864_100039880 | 3300005618 | Bacteria | 4014 |
| 174 | Ga0068864_100097308 | 3300005618 | Bacteria | 2605 |
| 175 | Ga0068864_100486535 | 3300005618 | Bacteria | 1185 |
| 176 | Ga0068864_100642702 | 3300005618 | Bacteria | 1032 |
| 177 | Ga0068866_10514857 | 3300005718 | Bacteria | 794 |
| 178 | Ga0068861_100097989 | 3300005719 | Bacteria | 2327 |
| 179 | Ga0068861_101069962 | 3300005719 | Bacteria | 774 |
| 180 | Ga0068870_10026613 | 3300005840 | Bacteria | 2885 |
| 181 | Ga0068870_11376633 | 3300005840 | Bacteria | 516 |
| 182 | Ga0068863_100028857 | 3300005841 | Bacteria | 5298 |
| 183 | Ga0068863_100066187 | 3300005841 | Bacteria | 3418 |
| 184 | Ga0068863_100265640 | 3300005841 | Bacteria | 1660 |
| 185 | Ga0068863_100448543 | 3300005841 | Bacteria | 1266 |
| 186 | Ga0068863_102407628 | 3300005841 | Bacteria | 536 |
| 187 | Ga0068863_102469689 | 3300005841 | Bacteria | 529 |
| 188 | Ga0068858_100037359 | 3300005842 | Bacteria | 4504 |
| 189 | Ga0068858_100089336 | 3300005842 | Bacteria | 2867 |
| 190 | Ga0068858_100405422 | 3300005842 | Bacteria | 1310 |
| 191 | Ga0068858_100736569 | 3300005842 | Bacteria | 960 |
| 192 | Ga0068858_101979493 | 3300005842 | Bacteria | 576 |
| 193 | Ga0068860_100048607 | 3300005843 | Bacteria | 4043 |
| 194 | Ga0068860_100113101 | 3300005843 | Bacteria | 2595 |
| 195 | Ga0068860_100676303 | 3300005843 | Bacteria | 1041 |
| 196 | Ga0068862_100891676 | 3300005844 | Bacteria | 874 |
| 197 | Ga0081455_10182342 | 3300005937 | Bacteria | 1588 |
| 198 | Ga0070717_11102651 | 3300006028 | Bacteria | 723 |
| 199 | Ga0075365_10005044 | 3300006038 | Bacteria | 7082 |
| 200 | Ga0075365_10032431 | 3300006038 | Bacteria | 3358 |
| 201 | Ga0075365_10464713 | 3300006038 | Bacteria | 894 |
| 202 | Ga0075365_10520135 | 3300006038 | Bacteria | 841 |
| 203 | Ga0075368_10001652 | 3300006042 | Bacteria | 7157 |
| 204 | Ga0075363_100020335 | 3300006048 | Bacteria | 3328 |
| 205 | Ga0075363_100021961 | 3300006048 | Bacteria | 3222 |
| 206 | Ga0075364_10050476 | 3300006051 | Bacteria | 2715 |
| 207 | Ga0070715_10789991 | 3300006163 | Bacteria | 575 |
| 208 | Ga0075362_10562147 | 3300006177 | Bacteria | 587 |
| 209 | Ga0075367_10012711 | 3300006178 | Bacteria | 4502 |
| 210 | Ga0075367_10033438 | 3300006178 | Bacteria | 2963 |
| 211 | Ga0075367_10861693 | 3300006178 | Bacteria | 577 |
| 212 | Ga0075369_10022838 | 3300006186 | Bacteria | 2583 |
| 213 | Ga0075366_10009517 | 3300006195 | Bacteria | 5425 |
| 214 | Ga0075366_10044419 | 3300006195 | Bacteria | 2633 |
| 215 | Ga0075366_10071689 | 3300006195 | Bacteria | 2064 |
| 216 | Ga0075366_10212787 | 3300006195 | Bacteria | 1177 |
| 217 | Ga0075366_10219408 | 3300006195 | Bacteria | 1158 |
| 218 | Ga0097621_100052360 | 3300006237 | Bacteria | 3326 |
| 219 | Ga0097621_100106910 | 3300006237 | Bacteria | 2361 |
| 220 | Ga0097621_100197454 | 3300006237 | Bacteria | 1745 |
| 221 | Ga0097621_101457386 | 3300006237 | Bacteria | 649 |
| 222 | Ga0097621_101720706 | 3300006237 | Bacteria | 597 |
| 223 | Ga0097621_102214406 | 3300006237 | Bacteria | 526 |
| 224 | Ga0075370_10007354 | 3300006353 | Bacteria | 5605 |
| 225 | Ga0075370_10052249 | 3300006353 | Bacteria | 2318 |
| 226 | Ga0068871_100069385 | 3300006358 | Bacteria | 2894 |
| 227 | Ga0068871_100276616 | 3300006358 | Bacteria | 1467 |
| 228 | Ga0075428_100011868 | 3300006844 | Bacteria | 9690 |
| 229 | Ga0075428_100157992 | 3300006844 | Bacteria | 2461 |
| 230 | Ga0075428_100560944 | 3300006844 | Bacteria | 1221 |
| 231 | Ga0075428_100564736 | 3300006844 | Bacteria | 1216 |
| 232 | Ga0075430_100091478 | 3300006846 | Bacteria | 2544 |
| 233 | Ga0075430_100184282 | 3300006846 | Bacteria | 1736 |
| 234 | Ga0075430_100216580 | 3300006846 | Bacteria | 1589 |
| 235 | Ga0075430_100383311 | 3300006846 | Bacteria | 1160 |
| 236 | Ga0075430_100557577 | 3300006846 | Bacteria | 945 |
| 237 | Ga0075431_100031779 | 3300006847 | Bacteria | 5438 |
| 238 | Ga0075431_100587205 | 3300006847 | Bacteria | 1099 |
| 239 | Ga0075431_100831958 | 3300006847 | Bacteria | 895 |
| 240 | Ga0075431_101931563 | 3300006847 | Bacteria | 546 |
| 241 | Ga0075433_10520957 | 3300006852 | Bacteria | 1046 |
| 242 | Ga0075434_100670316 | 3300006871 | Bacteria | 1055 |
| 243 | Ga0075429_100003374 | 3300006880 | Bacteria | 13618 |
| 244 | Ga0075429_100115648 | 3300006880 | Bacteria | 2345 |
| 245 | Ga0075429_100496951 | 3300006880 | Bacteria | 1069 |
| 246 | Ga0068865_100189215 | 3300006881 | Bacteria | 1590 |
| 247 | Ga0068865_100791942 | 3300006881 | Bacteria | 817 |
| 248 | Ga0075436_100180074 | 3300006914 | Bacteria | 1493 |
| 249 | Ga0075436_100190447 | 3300006914 | Bacteria | 1451 |
| 250 | Ga0097620_100066701 | 3300006931 | Bacteria | 3634 |
| 251 | Ga0097620_100403628 | 3300006931 | Bacteria | 1463 |
| 252 | Ga0097620_100534787 | 3300006931 | Bacteria | 1267 |
| 253 | Ga0097620_100538650 | 3300006931 | Bacteria | 1262 |
| 254 | Ga0097620_100818687 | 3300006931 | Bacteria | 1018 |
| 255 | Ga0075435_100230454 | 3300007076 | Bacteria | 1574 |
| 256 | Ga0075435_100558190 | 3300007076 | Bacteria | 992 |
| 257 | Ga0075435_101797919 | 3300007076 | Bacteria | 538 |
| 258 | Ga0099794_10004791 | 3300007265 | Bacteria | 5367 |
| 259 | Ga0099794_10108908 | 3300007265 | Bacteria | 1387 |
| 260 | Ga0099794_10187155 | 3300007265 | Bacteria | 1058 |
| 261 | Ga0099794_10322534 | 3300007265 | Bacteria | 801 |
| 262 | Ga0099795_10164169 | 3300007788 | Bacteria | 919 |
| 263 | Ga0099795_10421334 | 3300007788 | Bacteria | 610 |
| 264 | Ga0105251_10001178 | 3300009011 | Bacteria | 22690 |
| 265 | Ga0105250_10086139 | 3300009092 | Bacteria | 1275 |
| 266 | Ga0105240_10003289 | 3300009093 | Bacteria | 25278 |
| 267 | Ga0105240_10010109 | 3300009093 | Bacteria | 13278 |
| 268 | Ga0105240_10150608 | 3300009093 | Bacteria | 2771 |
| 269 | Ga0105240_10251676 | 3300009093 | Bacteria | 2043 |
| 270 | Ga0105240_10558181 | 3300009093 | Bacteria | 1266 |
| 271 | Ga0105240_10609204 | 3300009093 | Bacteria | 1201 |
| 272 | Ga0105240_11252382 | 3300009093 | Bacteria | 784 |
| 273 | Ga0111539_10000077 | 3300009094 | Bacteria | 98027 |
| 274 | Ga0111539_10003306 | 3300009094 | Bacteria | 21295 |
| 275 | Ga0111539_10021894 | 3300009094 | Bacteria | 7859 |
| 276 | Ga0111539_11173545 | 3300009094 | Bacteria | 892 |
| 277 | Ga0111539_11240637 | 3300009094 | Bacteria | 866 |
| 278 | Ga0111539_11797714 | 3300009094 | Bacteria | 711 |
| 279 | Ga0105245_10199591 | 3300009098 | Bacteria | 1920 |
| 280 | Ga0105245_11160707 | 3300009098 | Bacteria | 820 |
| 281 | Ga0105247_10657978 | 3300009101 | Bacteria | 783 |
| 282 | Ga0105247_10948890 | 3300009101 | Bacteria | 668 |
| 283 | Ga0114129_10007794 | 3300009147 | Bacteria | 15234 |
| 284 | Ga0114129_10008984 | 3300009147 | Bacteria | 14252 |
| 285 | Ga0114129_10118916 | 3300009147 | Bacteria | 3640 |
| 286 | Ga0114129_12831810 | 3300009147 | Bacteria | 576 |
| 287 | Ga0105243_10197677 | 3300009148 | Bacteria | 1761 |
| 288 | Ga0105241_10335901 | 3300009174 | Bacteria | 1307 |
| 289 | Ga0105241_10402256 | 3300009174 | Bacteria | 1201 |
| 290 | Ga0105242_10006977 | 3300009176 | Bacteria | 8717 |
| 291 | Ga0105242_10485534 | 3300009176 | Bacteria | 1172 |
| 292 | Ga0105242_11779335 | 3300009176 | Bacteria | 654 |
| 293 | Ga0105248_10046020 | 3300009177 | Bacteria | 4891 |
| 294 | Ga0105248_10047231 | 3300009177 | Bacteria | 4828 |
| 295 | Ga0105248_10053383 | 3300009177 | Bacteria | 4536 |
| 296 | Ga0105248_11142571 | 3300009177 | Bacteria | 880 |
| 297 | Ga0105248_11825797 | 3300009177 | Bacteria | 689 |
| 298 | Ga0105237_10026579 | 3300009545 | Bacteria | 5916 |
| 299 | Ga0105237_10276157 | 3300009545 | Bacteria | 1683 |
| 300 | Ga0105237_10306741 | 3300009545 | Bacteria | 1590 |
| 301 | Ga0105237_10650425 | 3300009545 | Bacteria | 1061 |
| 302 | Ga0105237_10721395 | 3300009545 | Bacteria | 1003 |
| 303 | Ga0105237_11907759 | 3300009545 | Bacteria | 602 |
| 304 | Ga0105238_10001743 | 3300009551 | Bacteria | 21842 |
| 305 | Ga0105238_10012194 | 3300009551 | Bacteria | 8664 |
| 306 | Ga0105238_10018637 | 3300009551 | Bacteria | 7067 |
| 307 | Ga0105238_10023731 | 3300009551 | Bacteria | 6251 |
| 308 | Ga0105238_10544751 | 3300009551 | Bacteria | 1164 |
| 309 | Ga0105238_10940318 | 3300009551 | Bacteria | 884 |
| 310 | Ga0105238_11754103 | 3300009551 | Bacteria | 652 |
| 311 | Ga0105249_10118923 | 3300009553 | Bacteria | 2509 |
| 312 | Ga0105249_13323060 | 3300009553 | Bacteria | 517 |
| 313 | Ga0099796_10356104 | 3300010159 | Bacteria | 632 |
| 314 | Ga0105239_10232066 | 3300010375 | Bacteria | 2070 |
| 315 | Ga0105239_11608684 | 3300010375 | Bacteria | 751 |
| 316 | Ga0105239_12096390 | 3300010375 | Bacteria | 657 |
| 317 | Ga0105246_10199278 | 3300011119 | Bacteria | 1555 |
| 318 | Ga0105246_10523385 | 3300011119 | Bacteria | 1011 |
| 319 | Ga0105246_11773288 | 3300011119 | Bacteria | 589 |
| 320 | Ga0157371_10164182 | 3300013102 | Bacteria | 1586 |
| 321 | Ga0157370_10853125 | 3300013104 | Bacteria | 828 |
| 322 | Ga0157370_10884638 | 3300013104 | Bacteria | 811 |
| 323 | Ga0157369_10020019 | 3300013105 | Bacteria | 7484 |
| 324 | Ga0157369_10086636 | 3300013105 | Bacteria | 3345 |
| 325 | Ga0157369_10285994 | 3300013105 | Bacteria | 1717 |
| 326 | Ga0157369_10693705 | 3300013105 | Bacteria | 1049 |
| 327 | Ga0157369_10730943 | 3300013105 | Bacteria | 1019 |
| 328 | Ga0157374_10023456 | 3300013296 | Bacteria | 5519 |
| 329 | Ga0157374_10438900 | 3300013296 | Bacteria | 1306 |
| 330 | Ga0157374_10565413 | 3300013296 | Bacteria | 1145 |
| 331 | Ga0157374_11087640 | 3300013296 | Bacteria | 820 |
| 332 | Ga0157378_10227301 | 3300013297 | Bacteria | 1776 |
| 333 | Ga0157378_11243708 | 3300013297 | Bacteria | 785 |
| 334 | Ga0157378_11255824 | 3300013297 | Bacteria | 781 |
| 335 | Ga0163162_10001419 | 3300013306 | Bacteria | 22265 |
| 336 | Ga0163162_10018269 | 3300013306 | Bacteria | 6868 |
| 337 | Ga0163162_10226937 | 3300013306 | Bacteria | 1997 |
| 338 | Ga0163162_10306837 | 3300013306 | Bacteria | 1719 |
| 339 | Ga0163162_10474129 | 3300013306 | Bacteria | 1383 |
| 340 | Ga0163162_10640982 | 3300013306 | Bacteria | 1187 |
| 341 | Ga0163162_12986097 | 3300013306 | Bacteria | 544 |
| 342 | Ga0157372_10693317 | 3300013307 | Bacteria | 1185 |
| 343 | Ga0157372_11655181 | 3300013307 | Bacteria | 737 |
| 344 | Ga0157375_10017976 | 3300013308 | Bacteria | 6401 |
| 345 | Ga0157375_10091058 | 3300013308 | Bacteria | 3110 |
| 346 | Ga0157375_10117523 | 3300013308 | Bacteria | 2765 |
| 347 | Ga0157375_10277014 | 3300013308 | Bacteria | 1840 |
| 348 | Ga0157375_10341682 | 3300013308 | Bacteria | 1662 |
| 349 | Ga0163163_10001175 | 3300014325 | Bacteria | 22194 |
| 350 | Ga0163163_10034053 | 3300014325 | Bacteria | 4931 |
| 351 | Ga0163163_10061204 | 3300014325 | Bacteria | 3730 |
| 352 | Ga0163163_10164600 | 3300014325 | Bacteria | 2263 |
| 353 | Ga0163163_10574153 | 3300014325 | Bacteria | 1191 |
| 354 | Ga0163163_11603745 | 3300014325 | Bacteria | 712 |
| 355 | Ga0163163_11720362 | 3300014325 | Bacteria | 688 |
| 356 | Ga0157380_10003757 | 3300014326 | Bacteria | 10442 |
| 357 | Ga0157380_10050020 | 3300014326 | Bacteria | 3299 |
| 358 | Ga0157380_10055292 | 3300014326 | Bacteria | 3152 |
| 359 | Ga0157380_10096266 | 3300014326 | Bacteria | 2454 |
| 360 | Ga0157380_10428354 | 3300014326 | Bacteria | 1264 |
| 361 | Ga0157380_10474033 | 3300014326 | Bacteria | 1209 |
| 362 | Ga0157380_10619663 | 3300014326 | Bacteria | 1074 |
| 363 | Ga0157380_10631083 | 3300014326 | Bacteria | 1065 |
| 364 | Ga0157380_11508418 | 3300014326 | Bacteria | 725 |
| 365 | Ga0157380_11905634 | 3300014326 | Bacteria | 655 |
| 366 | Ga0157377_10058956 | 3300014745 | Bacteria | 2186 |
| 367 | Ga0157377_10488276 | 3300014745 | Unclassified | 858 |
| 368 | Ga0157379_10055424 | 3300014968 | Bacteria | 3542 |
| 369 | Ga0157379_10186132 | 3300014968 | Unclassified | 1876 |
| 370 | Ga0157379_10240962 | 3300014968 | Bacteria | 1640 |
| 371 | Ga0157376_10012730 | 3300014969 | Bacteria | 6255 |
| 372 | Ga0157376_10022851 | 3300014969 | Bacteria | 4883 |
| 373 | Ga0157376_10039680 | 3300014969 | Bacteria | 3842 |
| 374 | Ga0157376_10095961 | 3300014969 | Bacteria | 2580 |
| 375 | Ga0157376_10276599 | 3300014969 | Bacteria | 1579 |
| 376 | Ga0157376_10834667 | 3300014969 | Bacteria | 936 |
| 377 | Ga0157376_12421888 | 3300014969 | Bacteria | 564 |
| 378 | Ga0182005_1190655 | 3300015265 | Bacteria | 612 |
| 379 | Ga0163161_10491754 | 3300017792 | Bacteria | 998 |
| 380 | Ga0163161_11865395 | 3300017792 | Bacteria | 535 |
| 381 | Ga0163161_11893057 | 3300017792 | Bacteria | 531 |
| 382 | Ga0206356_10603777 | 3300020070 | Bacteria | 1039 |
| 383 | Ga0206355_1350711 | 3300020076 | Bacteria | 561 |
| 384 | Ga0206350_11423293 | 3300020080 | Bacteria | 2324 |
| 385 | Ga0213873_10001286 | 3300021358 | Bacteria | 4127 |
| 386 | Ga0213873_10119193 | 3300021358 | Bacteria | 773 |
| 387 | Ga0213872_10000410 | 3300021361 | Bacteria | 35191 |
| 388 | Ga0213872_10227148 | 3300021361 | Bacteria | 793 |
| 389 | Ga0213876_10001491 | 3300021384 | Bacteria | 14550 |
| 390 | Ga0213875_10053858 | 3300021388 | Bacteria | 1884 |
| 391 | Ga0224712_10057505 | 3300022467 | Bacteria | 1537 |
| 392 | Ga0224712_10368195 | 3300022467 | Bacteria | 681 |
| 393 | Ga0224712_10589097 | 3300022467 | Bacteria | 542 |
| 394 | Ga0224569_101138 | 3300022732 | Bacteria | 2256 |
| 395 | Ga0224571_100306 | 3300022734 | Bacteria | 2538 |
| 396 | Ga0224572_1089281 | 3300024225 | Bacteria | 569 |
| 397 | Ga0228598_1013328 | 3300024227 | Bacteria | 1628 |
| 398 | Ga0207426_1003370 | 3300025302 | Bacteria | 8772 |
| 399 | Ga0207653_10069419 | 3300025885 | Bacteria | 1202 |
| 400 | Ga0207682_10034274 | 3300025893 | Bacteria | 2046 |
| 401 | Ga0207682_10079387 | 3300025893 | Bacteria | 1403 |
| 402 | Ga0207642_10337504 | 3300025899 | Bacteria | 885 |
| 403 | Ga0207710_10010195 | 3300025900 | Bacteria | 3953 |
| 404 | Ga0207688_10243153 | 3300025901 | Bacteria | 1089 |
| 405 | Ga0207680_10008344 | 3300025903 | Bacteria | 5079 |
| 406 | Ga0207680_10164256 | 3300025903 | Bacteria | 1491 |
| 407 | Ga0207647_10053824 | 3300025904 | Bacteria | 2478 |
| 408 | Ga0207647_10329459 | 3300025904 | Bacteria | 866 |
| 409 | Ga0207699_10020124 | 3300025906 | Bacteria | 3571 |
| 410 | Ga0207699_10072594 | 3300025906 | Bacteria | 2108 |
| 411 | Ga0207699_10968332 | 3300025906 | Bacteria | 629 |
| 412 | Ga0207645_10050255 | 3300025907 | Bacteria | 2662 |
| 413 | Ga0207643_10396497 | 3300025908 | Bacteria | 872 |
| 414 | Ga0207705_10084861 | 3300025909 | Bacteria | 2313 |
| 415 | Ga0207705_10154448 | 3300025909 | Bacteria | 1721 |
| 416 | Ga0207684_10140711 | 3300025910 | Bacteria | 2074 |
| 417 | Ga0207684_11116058 | 3300025910 | Bacteria | 656 |
| 418 | Ga0207684_11727026 | 3300025910 | Bacteria | 504 |
| 419 | Ga0207654_10138583 | 3300025911 | Bacteria | 1549 |
| 420 | Ga0207654_11380980 | 3300025911 | Bacteria | 514 |
| 421 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 422 | Ga0207707_10021849 | 3300025912 | Bacteria | 5592 |
| 423 | Ga0207707_10074899 | 3300025912 | Bacteria | 2953 |
| 424 | Ga0207707_10499899 | 3300025912 | Bacteria | 1037 |
| 425 | Ga0207707_11184262 | 3300025912 | Bacteria | 619 |
| 426 | Ga0207695_10043515 | 3300025913 | Bacteria | 4785 |
| 427 | Ga0207695_10067471 | 3300025913 | Bacteria | 3669 |
| 428 | Ga0207695_10075299 | 3300025913 | Bacteria | 3435 |
| 429 | Ga0207695_10356085 | 3300025913 | Bacteria | 1350 |
| 430 | Ga0207695_10419478 | 3300025913 | Bacteria | 1222 |
| 431 | Ga0207671_10000278 | 3300025914 | Bacteria | 76457 |
| 432 | Ga0207671_10031884 | 3300025914 | Bacteria | 3924 |
| 433 | Ga0207671_10034743 | 3300025914 | Bacteria | 3745 |
| 434 | Ga0207671_11099040 | 3300025914 | Bacteria | 625 |
| 435 | Ga0207693_10506859 | 3300025915 | Bacteria | 942 |
| 436 | Ga0207693_10568868 | 3300025915 | Bacteria | 883 |
| 437 | Ga0207693_10826340 | 3300025915 | Bacteria | 713 |
| 438 | Ga0207663_10660754 | 3300025916 | Bacteria | 825 |
| 439 | Ga0207663_10963947 | 3300025916 | Bacteria | 683 |
| 440 | Ga0207660_10000924 | 3300025917 | Bacteria | 19378 |
| 441 | Ga0207660_10227525 | 3300025917 | Bacteria | 1465 |
| 442 | Ga0207660_11272732 | 3300025917 | Bacteria | 598 |
| 443 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 444 | Ga0207657_10070294 | 3300025919 | Bacteria | 2968 |
| 445 | Ga0207657_10340465 | 3300025919 | Bacteria | 1184 |
| 446 | Ga0207652_10003893 | 3300025921 | Bacteria | 12209 |
| 447 | Ga0207652_10147705 | 3300025921 | Bacteria | 2104 |
| 448 | Ga0207652_10201676 | 3300025921 | Bacteria | 1790 |
| 449 | Ga0207652_10798153 | 3300025921 | Bacteria | 838 |
| 450 | Ga0207652_11295060 | 3300025921 | Bacteria | 631 |
| 451 | Ga0207646_10774558 | 3300025922 | Bacteria | 855 |
| 452 | Ga0207646_11157247 | 3300025922 | Bacteria | 679 |
| 453 | Ga0207694_10009430 | 3300025924 | Bacteria | 7358 |
| 454 | Ga0207694_10013532 | 3300025924 | Bacteria | 6147 |
| 455 | Ga0207694_10030192 | 3300025924 | Bacteria | 4139 |
| 456 | Ga0207694_10143281 | 3300025924 | Bacteria | 1922 |
| 457 | Ga0207694_10249457 | 3300025924 | Bacteria | 1452 |
| 458 | Ga0207694_10574736 | 3300025924 | Bacteria | 947 |
| 459 | Ga0207694_10633808 | 3300025924 | Bacteria | 900 |
| 460 | Ga0207694_10949253 | 3300025924 | Bacteria | 727 |
| 461 | Ga0207650_10038847 | 3300025925 | Bacteria | 3478 |
| 462 | Ga0207650_10181560 | 3300025925 | Bacteria | 1677 |
| 463 | Ga0207650_10206935 | 3300025925 | Bacteria | 1574 |
| 464 | Ga0207650_10481726 | 3300025925 | Bacteria | 1035 |
| 465 | Ga0207650_10655671 | 3300025925 | Bacteria | 885 |
| 466 | Ga0207659_10057006 | 3300025926 | Bacteria | 2799 |
| 467 | Ga0207659_10102224 | 3300025926 | Bacteria | 2163 |
| 468 | Ga0207659_10110349 | 3300025926 | Bacteria | 2090 |
| 469 | Ga0207659_10379219 | 3300025926 | Bacteria | 1179 |
| 470 | Ga0207687_10005541 | 3300025927 | Bacteria | 8347 |
| 471 | Ga0207687_10049830 | 3300025927 | Bacteria | 2913 |
| 472 | Ga0207687_10356207 | 3300025927 | Bacteria | 1193 |
| 473 | Ga0207700_10036339 | 3300025928 | Bacteria | 3556 |
| 474 | Ga0207700_10365144 | 3300025928 | Unclassified | 1259 |
| 475 | Ga0207664_10776520 | 3300025929 | Bacteria | 862 |
| 476 | Ga0207644_10006671 | 3300025931 | Bacteria | 7523 |
| 477 | Ga0207690_10164702 | 3300025932 | Bacteria | 1656 |
| 478 | Ga0207690_10680536 | 3300025932 | Bacteria | 845 |
| 479 | Ga0207706_10179825 | 3300025933 | Bacteria | 1857 |
| 480 | Ga0207706_10437078 | 3300025933 | Bacteria | 1133 |
| 481 | Ga0207706_10988563 | 3300025933 | Bacteria | 707 |
| 482 | Ga0207686_10089059 | 3300025934 | Bacteria | 2033 |
| 483 | Ga0207686_10161618 | 3300025934 | Bacteria | 1570 |
| 484 | Ga0207670_10008916 | 3300025936 | Bacteria | 5689 |
| 485 | Ga0207670_10126979 | 3300025936 | Bacteria | 1862 |
| 486 | Ga0207670_10140794 | 3300025936 | Bacteria | 1779 |
| 487 | Ga0207669_10001908 | 3300025937 | Bacteria | 8846 |
| 488 | Ga0207704_10940631 | 3300025938 | Bacteria | 728 |
| 489 | Ga0207704_11377986 | 3300025938 | Bacteria | 604 |
| 490 | Ga0207665_10091265 | 3300025939 | Bacteria | 2112 |
| 491 | Ga0207691_10014131 | 3300025940 | Bacteria | 7616 |
| 492 | Ga0207691_10051753 | 3300025940 | Bacteria | 3753 |
| 493 | Ga0207691_10260613 | 3300025940 | Bacteria | 1495 |
| 494 | Ga0207691_10409061 | 3300025940 | Bacteria | 1157 |
| 495 | Ga0207711_10058789 | 3300025941 | Bacteria | 3310 |
| 496 | Ga0207711_10085535 | 3300025941 | Bacteria | 2763 |
| 497 | Ga0207711_10097152 | 3300025941 | Bacteria | 2601 |
| 498 | Ga0207711_10110236 | 3300025941 | Bacteria | 2447 |
| 499 | Ga0207711_10140536 | 3300025941 | Bacteria | 2172 |
| 500 | Ga0207711_10156220 | 3300025941 | Bacteria | 2062 |
| 501 | Ga0207689_10272279 | 3300025942 | Bacteria | 1402 |
| 502 | Ga0207661_10000421 | 3300025944 | Bacteria | 27342 |
| 503 | Ga0207661_10122912 | 3300025944 | Bacteria | 2213 |
| 504 | Ga0207661_10939226 | 3300025944 | Bacteria | 797 |
| 505 | Ga0207661_11177703 | 3300025944 | Bacteria | 705 |
| 506 | Ga0207679_10471259 | 3300025945 | Bacteria | 1116 |
| 507 | Ga0207679_10683442 | 3300025945 | Bacteria | 930 |
| 508 | Ga0207679_10898183 | 3300025945 | Bacteria | 810 |
| 509 | Ga0207667_10011614 | 3300025949 | Bacteria | 10225 |
| 510 | Ga0207667_10116617 | 3300025949 | Bacteria | 2752 |
| 511 | Ga0207667_10169338 | 3300025949 | Bacteria | 2245 |
| 512 | Ga0207667_10320269 | 3300025949 | Bacteria | 1584 |
| 513 | Ga0207667_10952451 | 3300025949 | Bacteria | 848 |
| 514 | Ga0207651_10112117 | 3300025960 | Bacteria | 2050 |
| 515 | Ga0207651_10146645 | 3300025960 | Bacteria | 1831 |
| 516 | Ga0207651_10632119 | 3300025960 | Bacteria | 938 |
| 517 | Ga0207712_11248941 | 3300025961 | Bacteria | 663 |
| 518 | Ga0207668_10994622 | 3300025972 | Bacteria | 749 |
| 519 | Ga0207668_11249376 | 3300025972 | Bacteria | 668 |
| 520 | Ga0207668_12014458 | 3300025972 | Bacteria | 520 |
| 521 | Ga0207640_10737658 | 3300025981 | Bacteria | 848 |
| 522 | Ga0207658_10021461 | 3300025986 | Bacteria | 4484 |
| 523 | Ga0207658_10055159 | 3300025986 | Bacteria | 2944 |
| 524 | Ga0207658_10156750 | 3300025986 | Bacteria | 1862 |
| 525 | Ga0207658_10399430 | 3300025986 | Bacteria | 1208 |
| 526 | Ga0207658_11179460 | 3300025986 | Bacteria | 700 |
| 527 | Ga0207677_10656406 | 3300026023 | Bacteria | 926 |
| 528 | Ga0207677_10814953 | 3300026023 | Bacteria | 836 |
| 529 | Ga0207703_10004120 | 3300026035 | Bacteria | 12003 |
| 530 | Ga0207703_10310417 | 3300026035 | Bacteria | 1441 |
| 531 | Ga0207703_11229680 | 3300026035 | Bacteria | 720 |
| 532 | Ga0207703_12287443 | 3300026035 | Bacteria | 516 |
| 533 | Ga0207639_10246814 | 3300026041 | Bacteria | 1555 |
| 534 | Ga0207639_10756008 | 3300026041 | Bacteria | 904 |
| 535 | Ga0207678_10031631 | 3300026067 | Bacteria | 4615 |
| 536 | Ga0207678_10253431 | 3300026067 | Bacteria | 1508 |
| 537 | Ga0207678_11335151 | 3300026067 | Bacteria | 634 |
| 538 | Ga0207708_10054534 | 3300026075 | Bacteria | 3048 |
| 539 | Ga0207708_10177217 | 3300026075 | Bacteria | 1691 |
| 540 | Ga0207708_10390124 | 3300026075 | Bacteria | 1149 |
| 541 | Ga0207702_10317238 | 3300026078 | Bacteria | 1483 |
| 542 | Ga0207702_10377290 | 3300026078 | Bacteria | 1363 |
| 543 | Ga0207702_10985232 | 3300026078 | Bacteria | 836 |
| 544 | Ga0207641_10015592 | 3300026088 | Bacteria | 6228 |
| 545 | Ga0207641_10834384 | 3300026088 | Bacteria | 913 |
| 546 | Ga0207648_10050207 | 3300026089 | Bacteria | 3648 |
| 547 | Ga0207648_10268012 | 3300026089 | Bacteria | 1525 |
| 548 | Ga0207648_10327339 | 3300026089 | Bacteria | 1378 |
| 549 | Ga0207648_10453217 | 3300026089 | Bacteria | 1168 |
| 550 | Ga0207676_10085302 | 3300026095 | Bacteria | 2577 |
| 551 | Ga0207676_10096720 | 3300026095 | Bacteria | 2438 |
| 552 | Ga0207676_10111922 | 3300026095 | Bacteria | 2286 |
| 553 | Ga0207676_10127786 | 3300026095 | Bacteria | 2156 |
| 554 | Ga0207676_10445685 | 3300026095 | Bacteria | 1219 |
| 555 | Ga0207676_10519004 | 3300026095 | Bacteria | 1134 |
| 556 | Ga0207676_10843971 | 3300026095 | Bacteria | 896 |
| 557 | Ga0207674_10012767 | 3300026116 | Bacteria | 9383 |
| 558 | Ga0207674_10077186 | 3300026116 | Bacteria | 3337 |
| 559 | Ga0207675_101293395 | 3300026118 | Bacteria | 750 |
| 560 | Ga0207683_10026846 | 3300026121 | Bacteria | 4974 |
| 561 | Ga0207683_10249194 | 3300026121 | Bacteria | 1621 |
| 562 | Ga0207698_10159960 | 3300026142 | Bacteria | 1968 |
| 563 | Ga0207698_10630498 | 3300026142 | Bacteria | 1060 |
| 564 | Ga0209588_1000591 | 3300027671 | Bacteria | 9230 |
| 565 | Ga0209588_1012966 | 3300027671 | Bacteria | 2537 |
| 566 | Ga0209813_10044519 | 3300027866 | Bacteria | 1364 |
| 567 | Ga0207428_10013101 | 3300027907 | Bacteria | 7260 |
| 568 | Ga0207428_10130579 | 3300027907 | Bacteria | 1922 |
| 569 | Ga0207428_10672915 | 3300027907 | Bacteria | 742 |
| 570 | Ga0268266_10000556 | 3300028379 | Bacteria | 52036 |
| 571 | Ga0268266_10039341 | 3300028379 | Bacteria | 4027 |
| 572 | Ga0268266_10048311 | 3300028379 | Bacteria | 3647 |
| 573 | Ga0268266_10126210 | 3300028379 | Bacteria | 2284 |
| 574 | Ga0268266_10326531 | 3300028379 | Bacteria | 1437 |
| 575 | Ga0268266_10397223 | 3300028379 | Bacteria | 1303 |
| 576 | Ga0268266_10467159 | 3300028379 | Bacteria | 1201 |
| 577 | Ga0268266_10940450 | 3300028379 | Bacteria | 836 |
| 578 | Ga0268265_10012154 | 3300028380 | Bacteria | 5831 |
| 579 | Ga0268264_10189353 | 3300028381 | Bacteria | 1874 |
| 580 | Ga0268264_10223039 | 3300028381 | Bacteria | 1736 |
| 581 | Ga0268264_10420862 | 3300028381 | Bacteria | 1288 |
| 582 | Ga0268264_10793565 | 3300028381 | Bacteria | 946 |
| 583 | Ga0265334_10118299 | 3300028573 | Bacteria | 948 |
| 584 | Ga0265318_10000160 | 3300028577 | Bacteria | 59769 |
| 585 | Ga0265338_10336515 | 3300028800 | Bacteria | 1089 |
| 586 | Ga0307511_10000022 | 3300030521 | Bacteria | 116875 |
| 587 | Ga0265330_10000084 | 3300031235 | Bacteria | 79237 |
| 588 | Ga0265330_10068245 | 3300031235 | Bacteria | 1540 |
| 589 | Ga0265330_10328184 | 3300031235 | Bacteria | 646 |
| 590 | Ga0265332_10000518 | 3300031238 | Bacteria | 26331 |
| 591 | Ga0265332_10078877 | 3300031238 | Bacteria | 1398 |
| 592 | Ga0265332_10113667 | 3300031238 | Bacteria | 1139 |
| 593 | Ga0265328_10004449 | 3300031239 | Bacteria | 6087 |
| 594 | Ga0265328_10401206 | 3300031239 | Bacteria | 538 |
| 595 | Ga0265320_10000144 | 3300031240 | Bacteria | 59885 |
| 596 | Ga0265320_10231262 | 3300031240 | Bacteria | 822 |
| 597 | Ga0265320_10390794 | 3300031240 | Bacteria | 614 |
| 598 | Ga0265325_10321592 | 3300031241 | Bacteria | 687 |
| 599 | Ga0265329_10006155 | 3300031242 | Bacteria | 4780 |
| 600 | Ga0265329_10237003 | 3300031242 | Bacteria | 606 |
| 601 | Ga0265340_10059333 | 3300031247 | Bacteria | 1835 |
| 602 | Ga0265339_10209776 | 3300031249 | Bacteria | 957 |
| 603 | Ga0265331_10000264 | 3300031250 | Bacteria | 59763 |
| 604 | Ga0265331_10113290 | 3300031250 | Bacteria | 1243 |
| 605 | Ga0265331_10221813 | 3300031250 | Bacteria | 850 |
| 606 | Ga0265316_10014879 | 3300031344 | Bacteria | 6824 |
| 607 | Ga0265316_10327442 | 3300031344 | Bacteria | 1112 |
| 608 | Ga0265316_10332619 | 3300031344 | Bacteria | 1102 |
| 609 | Ga0307509_10043196 | 3300031507 | Bacteria | 4879 |
| 610 | Ga0307509_10123960 | 3300031507 | Bacteria | 2554 |
| 611 | Ga0307408_100605884 | 3300031548 | Bacteria | 974 |
| 612 | Ga0307408_100675332 | 3300031548 | Bacteria | 926 |
| 613 | Ga0265313_10000404 | 3300031595 | Bacteria | 46486 |
| 614 | Ga0265313_10020862 | 3300031595 | Bacteria | 3600 |
| 615 | Ga0265313_10101121 | 3300031595 | Bacteria | 1280 |
| 616 | Ga0265314_10000385 | 3300031711 | Bacteria | 59807 |
| 617 | Ga0265342_10063487 | 3300031712 | Bacteria | 2171 |
| 618 | Ga0265342_10115041 | 3300031712 | Bacteria | 1519 |
| 619 | Ga0265342_10137397 | 3300031712 | Bacteria | 1365 |
| 620 | Ga0307405_10060792 | 3300031731 | Bacteria | 2385 |
| 621 | Ga0307405_10216190 | 3300031731 | Bacteria | 1403 |
| 622 | Ga0307413_10014216 | 3300031824 | Bacteria | 4033 |
| 623 | Ga0307410_10139331 | 3300031852 | Bacteria | 1792 |
| 624 | Ga0307410_10832262 | 3300031852 | Bacteria | 787 |
| 625 | Ga0307407_10116439 | 3300031903 | Bacteria | 1686 |
| 626 | Ga0307407_10335684 | 3300031903 | Bacteria | 1065 |
| 627 | Ga0307412_10022402 | 3300031911 | Bacteria | 3872 |
| 628 | Ga0307412_10112122 | 3300031911 | Bacteria | 1949 |
| 629 | Ga0307412_10790530 | 3300031911 | Bacteria | 823 |
| 630 | Ga0307409_100001098 | 3300031995 | Bacteria | 12796 |
| 631 | Ga0307409_100146109 | 3300031995 | Bacteria | 2045 |
| 632 | Ga0307409_100520326 | 3300031995 | Bacteria | 1162 |
| 633 | Ga0307416_100025448 | 3300032002 | Bacteria | 4338 |
| 634 | Ga0307416_101073577 | 3300032002 | Bacteria | 909 |
| 635 | Ga0307414_10010424 | 3300032004 | Bacteria | 5391 |
| 636 | Ga0307414_11206243 | 3300032004 | Bacteria | 701 |
| 637 | Ga0307411_10022213 | 3300032005 | Bacteria | 3730 |
| 638 | Ga0307411_10039290 | 3300032005 | Bacteria | 2992 |
| 639 | Ga0307411_10088639 | 3300032005 | Bacteria | 2153 |
| 640 | Ga0307415_100661300 | 3300032126 | Bacteria | 938 |
| 641 | Ga0307507_10192176 | 3300033179 | Bacteria | 1432 |
| 642 | Ga0373934_0059885 | 3300035086 | Bacteria | 1516 |
| 643 | Ga0373944_0039280 | 3300035089 | Bacteria | 1457 |
| 644 | Ga0373923_0070190 | 3300035111 | Bacteria | 1503 |
| 645 | Ga0373936_0201340 | 3300035113 | Bacteria | 879 |
| 646 | Ga0373953_0004518 | 3300035117 | Bacteria | 4445 |
| 647 | Ga0373953_0274254 | 3300035117 | Bacteria | 735 |
| 648 | Ga0373954_0003164 | 3300035118 | Bacteria | 6955 |
| 649 | Ga0373954_0006861 | 3300035118 | Bacteria | 4971 |
| 650 | Ga0373956_0325313 | 3300035119 | Bacteria | 733 |
| 651 | Ga0373957_0015715 | 3300035120 | Bacteria | 2610 |
| 652 | Ga0373957_0150730 | 3300035120 | Bacteria | 954 |
| 653 | Ga0373943_0174919 | 3300035170 | Bacteria | 1177 |
| 654 | Ga0373955_0012729 | 3300035172 | Bacteria | 4051 |
| 655 | Ga0373961_0000747 | 3300035241 | Bacteria | 11220 |
| 656 | Ga0373935_0065045 | 3300035692 | Bacteria | 2339 |
| 657 | Ga0373935_0762880 | 3300035692 | Bacteria | 713 |
| 658 | Ga0373935_1277448 | 3300035692 | Bacteria | 548 |
| 659 | Ga0373933_0028682 | 3300035724 | Bacteria | 3212 |
| 660 | Ga0373947_0163710 | 3300035725 | Bacteria | 1440 |
| 661 | Ga0373947_0386003 | 3300035725 | Bacteria | 943 |
| 662 | Ga0373947_0408879 | 3300035725 | Bacteria | 916 |
| 663 | Ga0373937_0016441 | 3300036401 | Bacteria | 6572 |
| 664 | Ga0373937_0278614 | 3300036401 | Bacteria | 1579 |
| 665 | Ga0373937_1287209 | 3300036401 | Bacteria | 679 |
| 666 | Ga0373925_0073627 | 3300037068 | Bacteria | 2586 |
| 667 | Ga0373925_0210856 | 3300037068 | Bacteria | 1547 |
| 668 | Ga0373925_0903496 | 3300037068 | Bacteria | 728 |
| 669 | Ga0395899_0190097 | 3300037312 | Bacteria | 1437 |
| 670 | Ga0395900_0777820 | 3300037418 | Bacteria | 886 |
| 671 | Ga0395898_0035872 | 3300037466 | Bacteria | 4928 |
| 672 | Ga0395905_1630589 | 3300037471 | Bacteria | 550 |
| 673 | Ga0436364_0090800 | 3300037853 | Bacteria | 991 |
| 674 | Ga0436364_0816778 | 3300037853 | Bacteria | 950 |
| 675 | Ga0436364_1386291 | 3300037853 | Bacteria | 20302 |
| 676 | Ga0395901_1117206 | 3300038443 | Bacteria | 758 |
| 677 | Ga0436365_0921625 | 3300039437 | Bacteria | 24575 |
| 678 | Ga0436361_0381832 | 3300039447 | Bacteria | 88698 |
| 679 | Ga0436361_0536137 | 3300039447 | Bacteria | 4868 |
| 680 | Ga0436361_1199929 | 3300039447 | Bacteria | 899 |
| 681 | Ga0436363_0113419 | 3300039450 | Bacteria | 554 |
| 682 | Ga0436363_0974932 | 3300039450 | Bacteria | 966 |
| 683 | Ga0436362_0741099 | 3300039453 | Bacteria | 4353 |
| 684 | Ga0436362_0830499 | 3300039453 | Bacteria | 3978 |
| 685 | Ga0451793_0564301 | 3300041452 | Bacteria | 872 |
| 686 | Ga0451795_0020277 | 3300041456 | Bacteria | 935 |
| 687 | Ga0451806_486766 | 3300041462 | Bacteria | 530 |
| 688 | Ga0451807_0761906 | 3300041486 | Bacteria | 1001 |
| 689 | Ga0451837_1384319 | 3300041494 | Bacteria | 584 |
| 690 | Ga0451849_0877464 | 3300041505 | Bacteria | 670 |
| 691 | Ga0451851_0309592 | 3300041507 | Bacteria | 528 |
| 692 | Ga0451853_0720400 | 3300041512 | Bacteria | 581 |
| 693 | Ga0439464_0281481 | 3300042439 | Bacteria | 541 |
| 694 | Ga0450918_050400 | 3300042531 | Bacteria | 758 |
| 695 | Ga0451577_0006711 | 3300042876 | Bacteria | 11423 |
| 696 | Ga0451577_0057187 | 3300042876 | Bacteria | 3478 |
| 697 | Ga0453683_0066699 | 3300044673 | Bacteria | 2249 |
| 698 | Ga0453683_0186671 | 3300044673 | Bacteria | 1315 |
| 699 | Ga0466966_0551906 | 3300044684 | Bacteria | 693 |
| 700 | Ga0466963_0677440 | 3300044694 | Bacteria | 728 |
| 701 | Ga0453684_0169318 | 3300044712 | Bacteria | 2576 |
| 702 | Ga0466959_0018159 | 3300045049 | Bacteria | 5162 |
| 703 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 704 | Ga0451576_0017314 | 3300045051 | Bacteria | 7929 |
| 705 | Ga0451576_1389516 | 3300045051 | Bacteria | 731 |
| 706 | Ga0495592_0101071 | 3300046454 | Bacteria | 2055 |
| 707 | Ga0495592_0531970 | 3300046454 | Bacteria | 725 |
| 708 | Ga0495603_0019546 | 3300046455 | Bacteria | 4100 |
| 709 | Ga0495629_0054375 | 3300046459 | Bacteria | 2800 |
| 710 | Ga0495629_0177700 | 3300046459 | Bacteria | 1476 |
| 711 | Ga0495638_0021351 | 3300046460 | Bacteria | 4270 |
| 712 | Ga0495638_0043419 | 3300046460 | Bacteria | 2836 |
| 713 | Ga0495638_0186081 | 3300046460 | Bacteria | 1181 |
| 714 | Ga0495651_0015643 | 3300046462 | Bacteria | 5873 |
| 715 | Ga0495651_0376347 | 3300046462 | Bacteria | 932 |
| 716 | Ga0495651_0520233 | 3300046462 | Bacteria | 759 |
| 717 | Ga0495653_0065346 | 3300046463 | Bacteria | 2738 |
| 718 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 719 | Ga0495580_0174662 | 3300046472 | Bacteria | 1484 |
| 720 | Ga0495582_0004969 | 3300046473 | Bacteria | 7452 |
| 721 | Ga0495582_0024664 | 3300046473 | Bacteria | 3291 |
| 722 | Ga0495605_0002109 | 3300046474 | Bacteria | 12468 |
| 723 | Ga0495639_0044514 | 3300046475 | Bacteria | 2006 |
| 724 | Ga0495662_0330298 | 3300046476 | Bacteria | 750 |
| 725 | Ga0495664_0063179 | 3300046477 | Bacteria | 2206 |
| 726 | Ga0495664_0811403 | 3300046477 | Bacteria | 550 |
| 727 | Ga0495584_0030290 | 3300046491 | Bacteria | 2741 |
| 728 | Ga0495585_0034383 | 3300046492 | Bacteria | 2865 |
| 729 | Ga0495585_0048682 | 3300046492 | Bacteria | 2356 |
| 730 | Ga0495594_0002702 | 3300046499 | Bacteria | 9208 |
| 731 | Ga0495594_0059763 | 3300046499 | Bacteria | 2108 |
| 732 | Ga0495596_0187731 | 3300046500 | Bacteria | 804 |
| 733 | Ga0495583_0035602 | 3300046506 | Bacteria | 2375 |
| 734 | Ga0495583_0041057 | 3300046506 | Bacteria | 2169 |
| 735 | Ga0495606_0599829 | 3300046507 | Bacteria | 540 |
| 736 | Ga0495608_0060188 | 3300046511 | Bacteria | 2499 |
| 737 | Ga0495610_0314430 | 3300046512 | Bacteria | 600 |
| 738 | Ga0495616_0222149 | 3300046513 | Bacteria | 822 |
| 739 | Ga0495628_0033413 | 3300046516 | Bacteria | 4147 |
| 740 | Ga0495628_0292103 | 3300046516 | Bacteria | 1208 |
| 741 | Ga0495630_0035014 | 3300046517 | Bacteria | 3752 |
| 742 | Ga0495631_0138051 | 3300046518 | Bacteria | 1047 |
| 743 | Ga0495632_0072993 | 3300046519 | Bacteria | 1646 |
| 744 | Ga0495644_0000085 | 3300046523 | Bacteria | 46343 |
| 745 | Ga0495648_0145420 | 3300046524 | Bacteria | 1243 |
| 746 | Ga0495648_0158956 | 3300046524 | Bacteria | 1170 |
| 747 | Ga0495666_0021121 | 3300046526 | Bacteria | 3223 |
| 748 | Ga0495642_0055733 | 3300046528 | Bacteria | 1632 |
| 749 | Ga0495642_0183382 | 3300046528 | Bacteria | 911 |
| 750 | Ga0495652_0054846 | 3300046529 | Bacteria | 3392 |
| 751 | Ga0495652_0136578 | 3300046529 | Bacteria | 1934 |
| 752 | Ga0495652_0140682 | 3300046529 | Bacteria | 1898 |
| 753 | Ga0495665_0085444 | 3300046531 | Bacteria | 1658 |
| 754 | Ga0495640_0100517 | 3300046533 | Bacteria | 1899 |
| 755 | Ga0495586_0037182 | 3300046535 | Bacteria | 2613 |
| 756 | Ga0495586_0080798 | 3300046535 | Bacteria | 1786 |
| 757 | Ga0495586_0521954 | 3300046535 | Bacteria | 685 |
| 758 | Ga0495587_0070475 | 3300046536 | Bacteria | 2034 |
| 759 | Ga0495598_0041459 | 3300046537 | Bacteria | 1347 |
| 760 | Ga0495609_0005078 | 3300046538 | Bacteria | 7016 |
| 761 | Ga0495621_0254838 | 3300046539 | Bacteria | 718 |
| 762 | Ga0495645_0053112 | 3300046543 | Bacteria | 2946 |
| 763 | Ga0495645_0461961 | 3300046543 | Bacteria | 799 |
| 764 | Ga0495633_0151428 | 3300046558 | Bacteria | 1071 |
| 765 | Ga0495633_0358235 | 3300046558 | Bacteria | 661 |
| 766 | Ga0495667_0015927 | 3300046559 | Bacteria | 5081 |
| 767 | Ga0495667_0076083 | 3300046559 | Bacteria | 2184 |
| 768 | Ga0495667_0135062 | 3300046559 | Bacteria | 1590 |
| 769 | Ga0495656_0667933 | 3300046615 | Bacteria | 558 |
| 770 | Ga0495668_0129752 | 3300046616 | Bacteria | 1380 |
| 771 | Ga0495634_0018650 | 3300046642 | Bacteria | 4935 |
| 772 | Ga0495634_0027571 | 3300046642 | Bacteria | 3951 |
| 773 | Ga0495634_0182482 | 3300046642 | Bacteria | 1313 |
| 774 | Ga0495625_0000276 | 3300046660 | Bacteria | 79774 |
| 775 | Ga0495625_0019550 | 3300046660 | Bacteria | 5249 |
| 776 | Ga0495625_0035398 | 3300046660 | Bacteria | 3681 |
| 777 | Ga0495625_0450166 | 3300046660 | Bacteria | 796 |
| 778 | Ga0495635_0021252 | 3300046663 | Bacteria | 4524 |
| 779 | Ga0495659_0528218 | 3300046664 | Bacteria | 519 |
| 780 | Ga0495661_0350616 | 3300046665 | Bacteria | 727 |
| 781 | Ga0495588_0214034 | 3300046674 | Bacteria | 1017 |
| 782 | Ga0495657_0007196 | 3300046675 | Bacteria | 8628 |
| 783 | Ga0495657_0107056 | 3300046675 | Bacteria | 1775 |
| 784 | Ga0495599_0004838 | 3300046678 | Bacteria | 8011 |
| 785 | Ga0495599_0117533 | 3300046678 | Bacteria | 1654 |
| 786 | Ga0495599_0133273 | 3300046678 | Bacteria | 1543 |
| 787 | Ga0495599_0448102 | 3300046678 | Bacteria | 764 |
| 788 | Ga0495623_0035399 | 3300046679 | Bacteria | 3201 |
| 789 | Ga0495623_0492223 | 3300046679 | Bacteria | 648 |
| 790 | Ga0495646_0020107 | 3300046680 | Bacteria | 4221 |
| 791 | Ga0495646_0057461 | 3300046680 | Bacteria | 2328 |
| 792 | Ga0495646_0188504 | 3300046680 | Bacteria | 1128 |
| 793 | Ga0495646_0381091 | 3300046680 | Bacteria | 735 |
| 794 | Ga0495658_0303121 | 3300046683 | Bacteria | 1011 |
| 795 | Ga0495669_0002518 | 3300046684 | Bacteria | 7482 |
| 796 | Ga0495669_0496228 | 3300046684 | Bacteria | 594 |
| 797 | Ga0495613_0071465 | 3300046689 | Bacteria | 2529 |
| 798 | Ga0495613_0089821 | 3300046689 | Bacteria | 2225 |
| 799 | Ga0495613_0114323 | 3300046689 | Bacteria | 1943 |
| 800 | Ga0495624_0170813 | 3300046690 | Bacteria | 1326 |
| 801 | Ga0495624_0193503 | 3300046690 | Bacteria | 1237 |
| 802 | Ga0495624_0513014 | 3300046690 | Bacteria | 717 |
| 803 | Ga0495670_0004905 | 3300046691 | Bacteria | 6573 |
| 804 | Ga0495670_0053026 | 3300046691 | Bacteria | 2031 |
| 805 | Ga0495671_0063960 | 3300046692 | Bacteria | 1812 |
| 806 | Ga0495649_0013003 | 3300046694 | Bacteria | 4817 |
| 807 | Ga0495649_0170434 | 3300046694 | Bacteria | 1139 |
| 808 | Ga0495589_0204728 | 3300046794 | Bacteria | 930 |
| 809 | Ga0495600_0035461 | 3300046809 | Bacteria | 3240 |
| 810 | Ga0495600_0035500 | 3300046809 | Bacteria | 3238 |
| 811 | Ga0495600_0077553 | 3300046809 | Bacteria | 2170 |
| 812 | Ga0495660_0043762 | 3300046810 | Bacteria | 2467 |
| 813 | Ga0495581_0004471 | 3300047315 | Bacteria | 8084 |
| 814 | Ga0495604_0090026 | 3300047317 | Bacteria | 2279 |
| 815 | Ga0495604_0204016 | 3300047317 | Bacteria | 1370 |
| 816 | Ga0495604_0221717 | 3300047317 | Bacteria | 1301 |
| 817 | Ga0495636_0270770 | 3300047318 | Bacteria | 789 |
| 818 | Ga0495636_0278288 | 3300047318 | Bacteria | 779 |
| 819 | Ga0495636_0372469 | 3300047318 | Bacteria | 677 |
| 820 | Ga0495674_0033102 | 3300047319 | Bacteria | 4685 |
| 821 | Ga0495674_0147877 | 3300047319 | Bacteria | 1971 |
| 822 | Ga0495674_0249057 | 3300047319 | Bacteria | 1462 |
| 823 | Ga0495674_0843822 | 3300047319 | Bacteria | 710 |
| 824 | Ga0495672_0001069 | 3300047320 | Bacteria | 27899 |
| 825 | Ga0495672_0003551 | 3300047320 | Bacteria | 13278 |
| 826 | Ga0495672_0061509 | 3300047320 | Bacteria | 2164 |
| 827 | Ga0495672_0192404 | 3300047320 | Bacteria | 1025 |
| 828 | Ga0495676_0010423 | 3300047321 | Bacteria | 8431 |
| 829 | Ga0495680_0003456 | 3300047322 | Bacteria | 15551 |
| 830 | Ga0495680_0323792 | 3300047322 | Bacteria | 1078 |
| 831 | Ga0495683_0041743 | 3300047323 | Bacteria | 2314 |
| 832 | Ga0495675_0025788 | 3300047444 | Bacteria | 3745 |
| 833 | Ga0495675_0235857 | 3300047444 | Bacteria | 1103 |
| 834 | Ga0495675_0436784 | 3300047444 | Bacteria | 759 |
| 835 | Ga0495677_0192506 | 3300047445 | Bacteria | 792 |
| 836 | Ga0495679_044976 | 3300047446 | Bacteria | 1350 |
| 837 | Ga0495673_0058235 | 3300047469 | Bacteria | 1666 |
| 838 | Ga0495684_0301087 | 3300047471 | Bacteria | 1152 |
| 839 | Ga0495684_0402057 | 3300047471 | Bacteria | 961 |
| 840 | Ga0495686_0223310 | 3300047472 | Bacteria | 1070 |
| 841 | Ga0495686_0582242 | 3300047472 | Bacteria | 581 |
| 842 | Ga0495593_0045311 | 3300047673 | Bacteria | 2348 |
| 843 | Ga0495602_0085112 | 3300048088 | Bacteria | 2643 |
| 844 | Ga0495626_0209040 | 3300048091 | Bacteria | 797 |
| 845 | Ga0496100_0327758 | 3300048903 | Bacteria | 1152 |
| 846 | Ga0496101_0002922 | 3300048904 | Bacteria | 10507 |
| 847 | Ga0496101_0269061 | 3300048904 | Bacteria | 1330 |
| 848 | Ga0496103_0114305 | 3300048906 | Bacteria | 1716 |
| 849 | Ga0496104_0055263 | 3300048907 | Bacteria | 3754 |
| 850 | Ga0496104_0119674 | 3300048907 | Bacteria | 2528 |
| 851 | Ga0496104_0209473 | 3300048907 | Bacteria | 1861 |
| 852 | Ga0496104_0362043 | 3300048907 | Bacteria | 1363 |
| 853 | Ga0496105_0079528 | 3300048908 | Bacteria | 2707 |
| 854 | Ga0496105_0129938 | 3300048908 | Bacteria | 2077 |
| 855 | Ga0496106_0044716 | 3300048909 | Bacteria | 3325 |
| 856 | Ga0496107_0007817 | 3300048910 | Bacteria | 7380 |
| 857 | Ga0496107_0502392 | 3300048910 | Bacteria | 899 |
| 858 | Ga0496109_0352817 | 3300048912 | Bacteria | 1389 |
| 859 | Ga0496110_0075456 | 3300048913 | Bacteria | 2996 |
| 860 | Ga0496111_0314263 | 3300048914 | Bacteria | 1161 |
| 861 | Ga0496112_0025641 | 3300048915 | Bacteria | 5663 |
| 862 | Ga0496112_0029852 | 3300048915 | Bacteria | 5274 |
| 863 | Ga0496112_1502347 | 3300048915 | Bacteria | 587 |
| 864 | Ga0496113_0101821 | 3300048916 | Bacteria | 2227 |
| 865 | Ga0496113_0234321 | 3300048916 | Bacteria | 1464 |
| 866 | Ga0496113_0577017 | 3300048916 | Bacteria | 901 |
| 867 | Ga0496113_1311620 | 3300048916 | Bacteria | 563 |
| 868 | Ga0496114_0697222 | 3300048917 | Bacteria | 891 |
| 869 | Ga0496114_0814778 | 3300048917 | Bacteria | 813 |
| 870 | Ga0496115_0104467 | 3300048918 | Bacteria | 2325 |
| 871 | Ga0496115_0662255 | 3300048918 | Bacteria | 824 |
| 872 | Ga0496115_0961324 | 3300048918 | Bacteria | 655 |
| 873 | Ga0496116_0002045 | 3300048919 | Bacteria | 21613 |
| 874 | Ga0496117_0003643 | 3300048920 | Bacteria | 17745 |
| 875 | Ga0496118_0006911 | 3300048921 | Bacteria | 12277 |
| 876 | Ga0496120_0184646 | 3300048923 | Bacteria | 1021 |
| 877 | Ga0496121_0001997 | 3300048924 | Bacteria | 32409 |
| 878 | Ga0496121_0054026 | 3300048924 | Bacteria | 3360 |
| 879 | Ga0496121_0121929 | 3300048924 | Bacteria | 1967 |
| 880 | Ga0496123_0020557 | 3300048926 | Bacteria | 5161 |
| 881 | Ga0496126_0000245 | 3300048929 | Bacteria | 116888 |
| 882 | Ga0496126_0002541 | 3300048929 | Bacteria | 24417 |
| 883 | Ga0496126_0019943 | 3300048929 | Bacteria | 6589 |
| 884 | Ga0496126_0042857 | 3300048929 | Bacteria | 4178 |
| 885 | Ga0496126_0120816 | 3300048929 | Bacteria | 2272 |
| 886 | Ga0496126_0136221 | 3300048929 | Bacteria | 2118 |
| 887 | Ga0496126_0240126 | 3300048929 | Bacteria | 1514 |
| 888 | Ga0496126_0553417 | 3300048929 | Bacteria | 912 |
| 889 | Ga0495678_023400 | 3300049459 | Bacteria | 2685 |
| 890 | Ga0501291_082556 | 3300049514 | Bacteria | 642 |
| 891 | Ga0501031_0001415 | 3300049568 | Bacteria | 14850 |
| 892 | Ga0501031_0016517 | 3300049568 | Bacteria | 4795 |
| 893 | Ga0501032_0000283 | 3300049569 | Bacteria | 42856 |
| 894 | Ga0501032_0003300 | 3300049569 | Bacteria | 12404 |
| 895 | Ga0501032_0010264 | 3300049569 | Bacteria | 6756 |
| 896 | Ga0501032_0017169 | 3300049569 | Bacteria | 5085 |
| 897 | Ga0501032_0083823 | 3300049569 | Bacteria | 2119 |
| 898 | Ga0501032_0272266 | 3300049569 | Bacteria | 1097 |
| 899 | Ga0501032_0513398 | 3300049569 | Bacteria | 765 |
| 900 | Ga0501033_0000175 | 3300049570 | Bacteria | 60845 |
| 901 | Ga0501033_0002596 | 3300049570 | Bacteria | 15232 |
| 902 | Ga0501033_0010273 | 3300049570 | Bacteria | 7184 |
| 903 | Ga0501033_0170236 | 3300049570 | Bacteria | 1564 |
| 904 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 905 | Ga0501034_0003011 | 3300049571 | Bacteria | 19483 |
| 906 | Ga0501034_0023442 | 3300049571 | Bacteria | 6289 |
| 907 | Ga0501034_0036158 | 3300049571 | Bacteria | 5004 |
| 908 | Ga0501034_0040008 | 3300049571 | Bacteria | 4747 |
| 909 | Ga0501034_0625182 | 3300049571 | Bacteria | 980 |
| 910 | Ga0501036_0000042 | 3300049572 | Bacteria | 79876 |
| 911 | Ga0501036_0000429 | 3300049572 | Bacteria | 29860 |
| 912 | Ga0501036_0009069 | 3300049572 | Bacteria | 8181 |
| 913 | Ga0501036_0015599 | 3300049572 | Bacteria | 6347 |
| 914 | Ga0501036_0069084 | 3300049572 | Bacteria | 2989 |
| 915 | Ga0501036_0073428 | 3300049572 | Bacteria | 2892 |
| 916 | Ga0501036_0140323 | 3300049572 | Bacteria | 2039 |
| 917 | Ga0501036_0585066 | 3300049572 | Bacteria | 927 |
| 918 | Ga0501037_0000100 | 3300049573 | Bacteria | 81013 |
| 919 | Ga0501037_0021307 | 3300049573 | Bacteria | 4789 |
| 920 | Ga0501038_0000157 | 3300049574 | Bacteria | 58169 |
| 921 | Ga0501038_0001559 | 3300049574 | Bacteria | 21197 |
| 922 | Ga0501038_0001785 | 3300049574 | Bacteria | 19959 |
| 923 | Ga0501038_0007361 | 3300049574 | Bacteria | 10155 |
| 924 | Ga0501038_0009652 | 3300049574 | Bacteria | 8853 |
| 925 | Ga0501038_0039833 | 3300049574 | Bacteria | 4109 |
| 926 | Ga0501038_0119559 | 3300049574 | Bacteria | 2175 |
| 927 | Ga0501038_0186576 | 3300049574 | Bacteria | 1671 |
| 928 | Ga0501039_0000216 | 3300049575 | Bacteria | 42349 |
| 929 | Ga0501039_0002846 | 3300049575 | Bacteria | 12932 |
| 930 | Ga0501039_0037679 | 3300049575 | Bacteria | 3733 |
| 931 | Ga0501039_0060540 | 3300049575 | Bacteria | 2933 |
| 932 | Ga0501039_0157722 | 3300049575 | Bacteria | 1783 |
| 933 | Ga0501039_0333285 | 3300049575 | Bacteria | 1192 |
| 934 | Ga0501039_1048704 | 3300049575 | Bacteria | 633 |
| 935 | Ga0501040_0039344 | 3300049576 | Bacteria | 3216 |
| 936 | Ga0501041_0273730 | 3300049577 | Bacteria | 1062 |
| 937 | Ga0501042_0044070 | 3300049578 | Bacteria | 3178 |
| 938 | Ga0501042_0083958 | 3300049578 | Bacteria | 2283 |
| 939 | Ga0501042_0341662 | 3300049578 | Bacteria | 1082 |
| 940 | Ga0501042_0344741 | 3300049578 | Bacteria | 1077 |
| 941 | Ga0501042_0905269 | 3300049578 | Bacteria | 642 |
| 942 | Ga0501043_0001316 | 3300049579 | Bacteria | 21701 |
| 943 | Ga0501043_0001633 | 3300049579 | Bacteria | 19499 |
| 944 | Ga0501043_0003155 | 3300049579 | Bacteria | 13640 |
| 945 | Ga0501043_0008209 | 3300049579 | Bacteria | 8228 |
| 946 | Ga0501043_0136348 | 3300049579 | Bacteria | 1922 |
| 947 | Ga0501043_0168155 | 3300049579 | Bacteria | 1711 |
| 948 | Ga0501043_0168463 | 3300049579 | Bacteria | 1709 |
| 949 | Ga0501043_0296168 | 3300049579 | Bacteria | 1237 |
| 950 | Ga0501043_0336716 | 3300049579 | Bacteria | 1148 |
| 951 | Ga0501046_0000387 | 3300049580 | Bacteria | 44269 |
| 952 | Ga0501046_0000448 | 3300049580 | Bacteria | 41389 |
| 953 | Ga0501046_0000815 | 3300049580 | Bacteria | 30371 |
| 954 | Ga0501046_0035091 | 3300049580 | Bacteria | 4042 |
| 955 | Ga0501046_0316381 | 3300049580 | Bacteria | 1138 |
| 956 | Ga0501047_0000159 | 3300049581 | Bacteria | 82106 |
| 957 | Ga0501047_0000517 | 3300049581 | Bacteria | 41739 |
| 958 | Ga0501047_0000662 | 3300049581 | Bacteria | 35973 |
| 959 | Ga0501047_0001472 | 3300049581 | Bacteria | 22950 |
| 960 | Ga0501047_0002554 | 3300049581 | Bacteria | 17351 |
| 961 | Ga0501047_0039979 | 3300049581 | Bacteria | 4535 |
| 962 | Ga0501047_0161197 | 3300049581 | Bacteria | 2114 |
| 963 | Ga0501047_0173014 | 3300049581 | Bacteria | 2028 |
| 964 | Ga0501047_0511003 | 3300049581 | Bacteria | 1028 |
| 965 | Ga0501047_0619979 | 3300049581 | Bacteria | 902 |
| 966 | Ga0501048_0000655 | 3300049582 | Bacteria | 24936 |
| 967 | Ga0501048_0000726 | 3300049582 | Bacteria | 24134 |
| 968 | Ga0501048_0059248 | 3300049582 | Bacteria | 2713 |
| 969 | Ga0501048_0075906 | 3300049582 | Bacteria | 2372 |
| 970 | Ga0501067_0008361 | 3300049583 | Bacteria | 5745 |
| 971 | Ga0501067_0011823 | 3300049583 | Bacteria | 4836 |
| 972 | Ga0501067_0022683 | 3300049583 | Bacteria | 3473 |
| 973 | Ga0501067_0042271 | 3300049583 | Bacteria | 2530 |
| 974 | Ga0501067_0069488 | 3300049583 | Bacteria | 1950 |
| 975 | Ga0501067_0085853 | 3300049583 | Bacteria | 1746 |
| 976 | Ga0501067_0193025 | 3300049583 | Bacteria | 1134 |
| 977 | Ga0501068_0000168 | 3300049584 | Bacteria | 30562 |
| 978 | Ga0501068_0009657 | 3300049584 | Bacteria | 5401 |
| 979 | Ga0501068_0012207 | 3300049584 | Bacteria | 4860 |
| 980 | Ga0501068_0104456 | 3300049584 | Bacteria | 1758 |
| 981 | Ga0501068_0254886 | 3300049584 | Bacteria | 1119 |
| 982 | Ga0501068_0501064 | 3300049584 | Bacteria | 788 |
| 983 | Ga0501069_0001651 | 3300049585 | Bacteria | 11084 |
| 984 | Ga0501069_0002689 | 3300049585 | Bacteria | 9073 |
| 985 | Ga0501069_0025378 | 3300049585 | Bacteria | 3239 |
| 986 | Ga0501069_0031583 | 3300049585 | Bacteria | 2914 |
| 987 | Ga0501069_0068053 | 3300049585 | Bacteria | 1993 |
| 988 | Ga0501069_0162680 | 3300049585 | Bacteria | 1285 |
| 989 | Ga0501070_0002236 | 3300049586 | Bacteria | 17009 |
| 990 | Ga0501070_0036050 | 3300049586 | Bacteria | 4130 |
| 991 | Ga0501070_0089085 | 3300049586 | Bacteria | 2554 |
| 992 | Ga0501070_0173575 | 3300049586 | Bacteria | 1775 |
| 993 | Ga0501070_0390018 | 3300049586 | Bacteria | 1127 |
| 994 | Ga0501070_0436350 | 3300049586 | Bacteria | 1057 |
| 995 | Ga0501070_0530874 | 3300049586 | Bacteria | 943 |
| 996 | Ga0501070_0566401 | 3300049586 | Bacteria | 908 |
| 997 | Ga0501070_1288770 | 3300049586 | Bacteria | 558 |
| 998 | Ga0501071_0054879 | 3300049587 | Bacteria | 2875 |
| 999 | Ga0501071_0214082 | 3300049587 | Bacteria | 1449 |
| 1000 | Ga0501071_0391584 | 3300049587 | Bacteria | 1060 |
| 1001 | Ga0501072_0000003 | 3300049588 | Bacteria | 298632 |
| 1002 | Ga0501072_0000475 | 3300049588 | Bacteria | 28798 |
| 1003 | Ga0501072_0007057 | 3300049588 | Bacteria | 8529 |
| 1004 | Ga0501072_0141690 | 3300049588 | Bacteria | 1917 |
| 1005 | Ga0501072_0193413 | 3300049588 | Bacteria | 1622 |
| 1006 | Ga0501072_0571474 | 3300049588 | Bacteria | 892 |
| 1007 | Ga0501072_0581566 | 3300049588 | Bacteria | 883 |
| 1008 | Ga0501073_0000678 | 3300049589 | Bacteria | 23931 |
| 1009 | Ga0501073_0009782 | 3300049589 | Bacteria | 7057 |
| 1010 | Ga0501073_0044288 | 3300049589 | Bacteria | 3136 |
| 1011 | Ga0501073_0086560 | 3300049589 | Bacteria | 2179 |
| 1012 | Ga0501073_0122986 | 3300049589 | Bacteria | 1798 |
| 1013 | Ga0501073_0243568 | 3300049589 | Bacteria | 1241 |
| 1014 | Ga0501073_0496636 | 3300049589 | Bacteria | 844 |
| 1015 | Ga0501073_0621219 | 3300049589 | Bacteria | 746 |
| 1016 | Ga0501074_0001904 | 3300049590 | Bacteria | 14331 |
| 1017 | Ga0501074_0004788 | 3300049590 | Bacteria | 9702 |
| 1018 | Ga0501074_0007337 | 3300049590 | Bacteria | 7970 |
| 1019 | Ga0501074_0031818 | 3300049590 | Bacteria | 3822 |
| 1020 | Ga0501074_0050292 | 3300049590 | Bacteria | 3009 |
| 1021 | Ga0501074_0451679 | 3300049590 | Bacteria | 911 |
| 1022 | Ga0501075_0000346 | 3300049591 | Bacteria | 26327 |
| 1023 | Ga0501075_0030713 | 3300049591 | Bacteria | 3981 |
| 1024 | Ga0501076_0024992 | 3300049592 | Bacteria | 4621 |
| 1025 | Ga0501076_0041535 | 3300049592 | Bacteria | 3619 |
| 1026 | Ga0501076_0137368 | 3300049592 | Bacteria | 1985 |
| 1027 | Ga0501076_0271977 | 3300049592 | Bacteria | 1387 |
| 1028 | Ga0501076_0486070 | 3300049592 | Bacteria | 1017 |
| 1029 | Ga0501076_0711201 | 3300049592 | Bacteria | 829 |
| 1030 | Ga0501077_0000509 | 3300049593 | Bacteria | 23725 |
| 1031 | Ga0501077_0052836 | 3300049593 | Bacteria | 2580 |
| 1032 | Ga0501077_0111681 | 3300049593 | Bacteria | 1732 |
| 1033 | Ga0501079_0006064 | 3300049741 | Bacteria | 9059 |
| 1034 | Ga0501079_0006855 | 3300049741 | Bacteria | 8580 |
| 1035 | Ga0501079_0013419 | 3300049741 | Bacteria | 6248 |
| 1036 | Ga0501079_0047364 | 3300049741 | Bacteria | 3316 |
| 1037 | Ga0501079_0071226 | 3300049741 | Bacteria | 2685 |
| 1038 | Ga0501079_0565241 | 3300049741 | Bacteria | 895 |
| 1039 | Ga0501080_0004275 | 3300049742 | Bacteria | 12675 |
| 1040 | Ga0501080_0004449 | 3300049742 | Bacteria | 12471 |
| 1041 | Ga0501080_0027460 | 3300049742 | Bacteria | 5292 |
| 1042 | Ga0501080_0039623 | 3300049742 | Bacteria | 4398 |
| 1043 | Ga0501080_0047355 | 3300049742 | Bacteria | 4002 |
| 1044 | Ga0501080_0053498 | 3300049742 | Bacteria | 3759 |
| 1045 | Ga0501080_0072909 | 3300049742 | Bacteria | 3194 |
| 1046 | Ga0501080_0105408 | 3300049742 | Bacteria | 2614 |
| 1047 | Ga0501080_0163259 | 3300049742 | Bacteria | 2056 |
| 1048 | Ga0501080_0806817 | 3300049742 | Bacteria | 823 |
| 1049 | Ga0501080_1418234 | 3300049742 | Bacteria | 592 |
| 1050 | Ga0501080_1802687 | 3300049742 | Bacteria | 514 |
| 1051 | Ga0501081_0373781 | 3300049743 | Bacteria | 1052 |
| 1052 | Ga0501083_0001555 | 3300049744 | Bacteria | 15682 |
| 1053 | Ga0501083_0006723 | 3300049744 | Bacteria | 8157 |
| 1054 | Ga0501083_0012456 | 3300049744 | Bacteria | 5947 |
| 1055 | Ga0501083_0015606 | 3300049744 | Bacteria | 5319 |
| 1056 | Ga0501083_0024439 | 3300049744 | Bacteria | 4185 |
| 1057 | Ga0501083_0027627 | 3300049744 | Bacteria | 3914 |
| 1058 | Ga0501083_0048909 | 3300049744 | Bacteria | 2852 |
| 1059 | Ga0501083_0145560 | 3300049744 | Bacteria | 1551 |
| 1060 | Ga0501035_0000172 | 3300049822 | Bacteria | 79203 |
| 1061 | Ga0501035_0002828 | 3300049822 | Bacteria | 16789 |
| 1062 | Ga0501035_0027104 | 3300049822 | Bacteria | 5238 |
| 1063 | Ga0501035_0147241 | 3300049822 | Bacteria | 2044 |
| 1064 | Ga0501035_0276813 | 3300049822 | Bacteria | 1419 |
| 1065 | Ga0501035_0911809 | 3300049822 | Bacteria | 695 |
| 1066 | Ga0501044_0000282 | 3300049823 | Bacteria | 64640 |
| 1067 | Ga0501044_0001507 | 3300049823 | Bacteria | 27295 |
| 1068 | Ga0501044_0008603 | 3300049823 | Bacteria | 11176 |
| 1069 | Ga0501044_0022656 | 3300049823 | Bacteria | 6689 |
| 1070 | Ga0501044_0192181 | 3300049823 | Bacteria | 2003 |
| 1071 | Ga0501044_0256082 | 3300049823 | Bacteria | 1689 |
| 1072 | Ga0501044_0356408 | 3300049823 | Bacteria | 1381 |
| 1073 | Ga0501044_0420692 | 3300049823 | Bacteria | 1246 |
| 1074 | Ga0501044_0434616 | 3300049823 | Bacteria | 1221 |
| 1075 | Ga0501045_0019340 | 3300049824 | Bacteria | 4854 |
| 1076 | Ga0501045_0076109 | 3300049824 | Bacteria | 2472 |
| 1077 | Ga0501045_0311726 | 3300049824 | Bacteria | 1171 |
| 1078 | nmdc:mga03683_106687_c1 | 3300050489 | Bacteria | 1235 |
| 1079 | nmdc:mga03683_478216_c1 | 3300050489 | Bacteria | 601 |
| 1080 | nmdc:mga03n38_52095_c1 | 3300050490 | Bacteria | 1830 |
| 1081 | nmdc:mga03n38_73719_c1 | 3300050490 | Bacteria | 1586 |
| 1082 | nmdc:mga0yw44_21119_c1 | 3300050492 | Bacteria | 3627 |
| 1083 | nmdc:mga0yw44_3171_c1 | 3300050492 | Bacteria | 7223 |
| 1084 | nmdc:mga0k408_102419_c1 | 3300050493 | Bacteria | 1689 |
| 1085 | nmdc:mga0k408_133482_c1 | 3300050493 | Bacteria | 1474 |
| 1086 | nmdc:mga0k408_269530_c1 | 3300050493 | Bacteria | 1016 |
| 1087 | nmdc:mga0k408_312026_c1 | 3300050493 | Bacteria | 939 |
| 1088 | nmdc:mga0k408_7616_c1 | 3300050493 | Bacteria | 5783 |
| 1089 | nmdc:mga06z11_137944_c1 | 3300050494 | Bacteria | 1376 |
| 1090 | nmdc:mga06z11_150671_c1 | 3300050494 | Bacteria | 1322 |
| 1091 | nmdc:mga06z11_155863_c1 | 3300050494 | Bacteria | 1302 |
| 1092 | nmdc:mga06z11_281339_c1 | 3300050494 | Bacteria | 985 |
| 1093 | nmdc:mga04h51_63377_c1 | 3300050495 | Bacteria | 1273 |
| 1094 | nmdc:mga07m45_137022_c1 | 3300050496 | Bacteria | 1417 |
| 1095 | nmdc:mga07m45_8009_c1 | 3300050496 | Bacteria | 5417 |
| 1096 | nmdc:mga05p37_366228_c1 | 3300050507 | Bacteria | 1693 |
| 1097 | nmdc:mga05p37_40532_c1 | 3300050507 | Bacteria | 5719 |
| 1098 | nmdc:mga09592_104591_c1 | 3300050508 | Bacteria | 2426 |
| 1099 | nmdc:mga09592_11287_c1 | 3300050508 | Bacteria | 7270 |
| 1100 | nmdc:mga09592_1315941_c1 | 3300050508 | Bacteria | 593 |
| 1101 | nmdc:mga09592_710664_c1 | 3300050508 | Bacteria | 855 |
| 1102 | nmdc:mga0qj67_35688_c1 | 3300050509 | Bacteria | 3888 |
| 1103 | nmdc:mga0qj67_74728_c1 | 3300050509 | Bacteria | 2708 |
| 1104 | nmdc:mga0qj67_751281_c1 | 3300050509 | Bacteria | 774 |
| 1105 | nmdc:mga0qj67_796210_c1 | 3300050509 | Bacteria | 748 |
| 1106 | nmdc:mga0qj67_82208_c1 | 3300050509 | Bacteria | 2583 |
| 1107 | nmdc:mga0qj67_899214_c1 | 3300050509 | Bacteria | 698 |
| 1108 | nmdc:mga06r32_493125_c1 | 3300050510 | Bacteria | 1202 |
| 1109 | nmdc:mga06r32_627763_c1 | 3300050510 | Bacteria | 1044 |
| 1110 | nmdc:mga06r32_86434_c1 | 3300050510 | Bacteria | 3058 |
| 1111 | nmdc:mga08y16_1186920_c1 | 3300050511 | Bacteria | 734 |
| 1112 | nmdc:mga08y16_121251_c1 | 3300050511 | Bacteria | 2721 |
| 1113 | nmdc:mga08y16_129122_c1 | 3300050511 | Bacteria | 2629 |
| 1114 | nmdc:mga08y16_3101_c1 | 3300050511 | Bacteria | 17200 |
| 1115 | nmdc:mga08y16_788423_c1 | 3300050511 | Bacteria | 944 |
| 1116 | nmdc:mga08y16_799409_c1 | 3300050511 | Bacteria | 936 |
| 1117 | nmdc:mga08y16_88723_c1 | 3300050511 | Bacteria | 3223 |
| 1118 | nmdc:mga0n895_1415980_c1 | 3300050512 | Bacteria | 663 |
| 1119 | nmdc:mga0n895_248667_c1 | 3300050512 | Bacteria | 1804 |
| 1120 | nmdc:mga0n895_526687_c1 | 3300050512 | Bacteria | 1189 |
| 1121 | nmdc:mga08x19_11855_c1 | 3300050514 | Bacteria | 5242 |
| 1122 | Ga0495601_0037678 | 3300053077 | Bacteria | 3023 |
| 1123 | Ga0495601_0106010 | 3300053077 | Bacteria | 1817 |
| 1124 | Ga0495612_0022244 | 3300053078 | Bacteria | 2542 |
| 1125 | Ga0495595_0194461 | 3300053084 | Bacteria | 1008 |
| 1126 | Ga0495619_0405228 | 3300053085 | Bacteria | 941 |
| 1127 | Ga0495619_0405231 | 3300053085 | Bacteria | 941 |
| 1128 | Ga0500643_012947 | 3300053087 | Bacteria | 2969 |
| 1129 | Ga0500646_0000925 | 3300053090 | Bacteria | 8090 |
| 1130 | Ga0500583_0008247 | 3300053092 | Bacteria | 3726 |
| 1131 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 1132 | Ga0500651_0000299 | 3300053093 | Bacteria | 28598 |
| 1133 | Ga0500650_0003454 | 3300053098 | Bacteria | 5500 |
| 1134 | Ga0500555_074593 | 3300053103 | Bacteria | 890 |
| 1135 | Ga0500556_0136229 | 3300053104 | Bacteria | 964 |
| 1136 | Ga0500572_000533 | 3300053111 | Bacteria | 12931 |
| 1137 | Ga0500595_023318 | 3300053119 | Bacteria | 2177 |
| 1138 | Ga0500655_019811 | 3300053133 | Bacteria | 1254 |
| 1139 | Ga0500559_0009452 | 3300053136 | Bacteria | 4218 |
| 1140 | Ga0500568_0290552 | 3300053139 | Bacteria | 593 |
| 1141 | Ga0500604_0006069 | 3300053151 | Bacteria | 3189 |
| 1142 | Ga0500619_000014 | 3300053154 | Bacteria | 55951 |
| 1143 | Ga0500639_097955 | 3300053163 | Bacteria | 1449 |
| 1144 | Ga0500637_0108892 | 3300053178 | Bacteria | 1607 |
| 1145 | Ga0500599_005642 | 3300053736 | Bacteria | 1579 |
| 1146 | Ga0501084_0000278 | 3300054114 | Bacteria | 38673 |
| 1147 | Ga0501084_0023457 | 3300054114 | Bacteria | 5148 |
| 1148 | Ga0501084_0152138 | 3300054114 | Bacteria | 1950 |
| 1149 | Ga0501084_0360234 | 3300054114 | Bacteria | 1229 |
| 1150 | Ga0501084_1027720 | 3300054114 | Bacteria | 692 |
| 1151 | Ga0501082_0005465 | 3300060353 | Bacteria | 11036 |
| 1152 | Ga0501082_0005775 | 3300060353 | Bacteria | 10739 |
| 1153 | Ga0501082_0038642 | 3300060353 | Bacteria | 4117 |
| 1154 | Ga0501082_0044917 | 3300060353 | Bacteria | 3811 |
| 1155 | Ga0501082_0416753 | 3300060353 | Bacteria | 1173 |
| 1156 | Ga0501082_0950329 | 3300060353 | Bacteria | 751 |
| 1157 | Ga0466962_0107632 | 3300061719 | Bacteria | 1341 |
| 1158 | Ga0530510_0043557 | 3300061734 | Bacteria | 3242 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_0564301 | Ga0451793_0564301_428_850 | 127 |
| 2 | 3300013306 | Ga0163162_12986097 | Ga0163162_129860971 | 129 |
| 3 | 3300039450 | Ga0436363_0113419 | Ga0436363_0113419_76_504 | 129 |
| 4 | 3300049569 | Ga0501032_0083823 | Ga0501032_0083823_444_926 | 129 |
| 5 | 3300049570 | Ga0501033_0010273 | Ga0501033_0010273_6506_6988 | 129 |
| 6 | 3300049571 | Ga0501034_0040008 | Ga0501034_0040008_2128_2610 | 129 |
| 7 | 3300049572 | Ga0501036_0000429 | Ga0501036_0000429_16644_17126 | 129 |
| 8 | 3300049574 | Ga0501038_0009652 | Ga0501038_0009652_1282_1764 | 129 |
| 9 | 3300049575 | Ga0501039_0157722 | Ga0501039_0157722_947_1429 | 129 |
| 10 | 3300049579 | Ga0501043_0008209 | Ga0501043_0008209_4114_4596 | 129 |
| 11 | 3300049581 | Ga0501047_0039979 | Ga0501047_0039979_414_896 | 129 |
| 12 | 3300049582 | Ga0501048_0000726 | Ga0501048_0000726_15599_16081 | 129 |
| 13 | 3300049583 | Ga0501067_0008361 | Ga0501067_0008361_1004_1486 | 129 |
| 14 | 3300049585 | Ga0501069_0031583 | Ga0501069_0031583_276_758 | 129 |
| 15 | 3300049586 | Ga0501070_0036050 | Ga0501070_0036050_1468_1950 | 129 |
| 16 | 3300049587 | Ga0501071_0214082 | Ga0501071_0214082_466_948 | 129 |
| 17 | 3300049590 | Ga0501074_0007337 | Ga0501074_0007337_4161_4643 | 129 |
| 18 | 3300049741 | Ga0501079_0006855 | Ga0501079_0006855_1436_1918 | 129 |
| 19 | 3300049742 | Ga0501080_0004275 | Ga0501080_0004275_10402_10884 | 129 |
| 20 | 3300049744 | Ga0501083_0024439 | Ga0501083_0024439_1982_2464 | 129 |
| 21 | 3300049824 | Ga0501045_0076109 | Ga0501045_0076109_819_1301 | 129 |
| 22 | 3300009101 | Ga0105247_10948890 | Ga0105247_109488902 | 131 |
| 23 | 3300013297 | Ga0157378_10227301 | Ga0157378_102273013 | 131 |
| 24 | 3300013306 | Ga0163162_10001419 | Ga0163162_1000141922 | 131 |
| 25 | 3300013306 | Ga0163162_10640982 | Ga0163162_106409822 | 131 |
| 26 | 3300046455 | Ga0495603_0019546 | Ga0495603_0019546_913_1329 | 131 |
| 27 | 3300046476 | Ga0495662_0330298 | Ga0495662_0330298_241_651 | 131 |
| 28 | 3300046492 | Ga0495585_0048682 | Ga0495585_0048682_527_943 | 131 |
| 29 | 3300046499 | Ga0495594_0002702 | Ga0495594_0002702_7016_7432 | 131 |
| 30 | 3300046506 | Ga0495583_0035602 | Ga0495583_0035602_1808_2224 | 131 |
| 31 | 3300046513 | Ga0495616_0222149 | Ga0495616_0222149_305_721 | 131 |
| 32 | 3300046523 | Ga0495644_0000085 | Ga0495644_0000085_70_486 | 131 |
| 33 | 3300046524 | Ga0495648_0145420 | Ga0495648_0145420_753_1169 | 131 |
| 34 | 3300046528 | Ga0495642_0055733 | Ga0495642_0055733_1028_1444 | 131 |
| 35 | 3300046538 | Ga0495609_0005078 | Ga0495609_0005078_139_555 | 131 |
| 36 | 3300046558 | Ga0495633_0151428 | Ga0495633_0151428_629_1045 | 131 |
| 37 | 3300046615 | Ga0495656_0667933 | Ga0495656_0667933_126_542 | 131 |
| 38 | 3300046616 | Ga0495668_0129752 | Ga0495668_0129752_747_1157 | 131 |
| 39 | 3300046660 | Ga0495625_0019550 | Ga0495625_0019550_229_645 | 131 |
| 40 | 3300046674 | Ga0495588_0214034 | Ga0495588_0214034_286_702 | 131 |
| 41 | 3300046678 | Ga0495599_0117533 | Ga0495599_0117533_367_777 | 131 |
| 42 | 3300046680 | Ga0495646_0381091 | Ga0495646_0381091_268_678 | 131 |
| 43 | 3300046691 | Ga0495670_0053026 | Ga0495670_0053026_712_1128 | 131 |
| 44 | 3300046809 | Ga0495600_0077553 | Ga0495600_0077553_580_990 | 131 |
| 45 | 3300047317 | Ga0495604_0204016 | Ga0495604_0204016_696_1106 | 131 |
| 46 | 3300047318 | Ga0495636_0278288 | Ga0495636_0278288_122_538 | 131 |
| 47 | 3300047319 | Ga0495674_0033102 | Ga0495674_0033102_1786_2196 | 131 |
| 48 | 3300047323 | Ga0495683_0041743 | Ga0495683_0041743_1308_1724 | 131 |
| 49 | 3300047444 | Ga0495675_0235857 | Ga0495675_0235857_587_997 | 131 |
| 50 | 3300047469 | Ga0495673_0058235 | Ga0495673_0058235_592_1008 | 131 |
| 51 | 3300048907 | Ga0496104_0209473 | Ga0496104_0209473_454_864 | 131 |
| 52 | 3300048918 | Ga0496115_0104467 | Ga0496115_0104467_669_1079 | 131 |
| 53 | 3300005458 | Ga0070681_10021112 | Ga0070681_100211122 | 133 |
| 54 | 3300006177 | Ga0075362_10562147 | Ga0075362_105621471 | 133 |
| 55 | 3300006195 | Ga0075366_10009517 | Ga0075366_100095173 | 133 |
| 56 | 3300006237 | Ga0097621_101457386 | Ga0097621_1014573861 | 133 |
| 57 | 3300006353 | Ga0075370_10052249 | Ga0075370_100522493 | 133 |
| 58 | 3300009011 | Ga0105251_10001178 | Ga0105251_1000117819 | 133 |
| 59 | 3300009092 | Ga0105250_10086139 | Ga0105250_100861392 | 133 |
| 60 | 3300009093 | Ga0105240_10010109 | Ga0105240_100101096 | 133 |
| 61 | 3300009147 | Ga0114129_10118916 | Ga0114129_101189163 | 133 |
| 62 | 3300009148 | Ga0105243_10197677 | Ga0105243_101976772 | 133 |
| 63 | 3300011119 | Ga0105246_10199278 | Ga0105246_101992782 | 133 |
| 64 | 3300025912 | Ga0207707_10021849 | Ga0207707_100218494 | 133 |
| 65 | 3300035692 | Ga0373935_1277448 | Ga0373935_1277448_25_444 | 133 |
| 66 | 3300036401 | Ga0373937_1287209 | Ga0373937_1287209_135_554 | 133 |
| 67 | 3300046558 | Ga0495633_0358235 | Ga0495633_0358235_31_450 | 133 |
| 68 | 3300046683 | Ga0495658_0303121 | Ga0495658_0303121_133_552 | 133 |
| 69 | 3300048904 | Ga0496101_0269061 | Ga0496101_0269061_50_469 | 133 |
| 70 | 3300048907 | Ga0496104_0119674 | Ga0496104_0119674_941_1360 | 133 |
| 71 | 3300048908 | Ga0496105_0129938 | Ga0496105_0129938_791_1210 | 133 |
| 72 | 3300050493 | nmdc:mga0k408_7616_c1 | nmdc:mga0k408_7616_c1_5063_5485 | 133 |
| 73 | 3300050496 | nmdc:mga07m45_137022_c1 | nmdc:mga07m45_137022_c1_442_864 | 133 |
| 74 | iso_pu_bacteria | 2643221573 | 2643878639 | 133 |
| 75 | iso_pu_bacteria | 2643221728 | 2644697258 | 133 |
| 76 | iso_pu_bacteria | 2884215851 | 2884216172 | 133 |
| 77 | 3300005444 | Ga0070694_100249952 | Ga0070694_1002499522 | 134 |
| 78 | 3300005937 | Ga0081455_10182342 | Ga0081455_101823422 | 134 |
| 79 | 3300007265 | Ga0099794_10004791 | Ga0099794_100047913 | 134 |
| 80 | 3300007265 | Ga0099794_10187155 | Ga0099794_101871552 | 134 |
| 81 | 3300007265 | Ga0099794_10322534 | Ga0099794_103225341 | 134 |
| 82 | 3300007788 | Ga0099795_10164169 | Ga0099795_101641692 | 134 |
| 83 | 3300007788 | Ga0099795_10421334 | Ga0099795_104213341 | 134 |
| 84 | 3300009093 | Ga0105240_10558181 | Ga0105240_105581811 | 134 |
| 85 | 3300009093 | Ga0105240_10609204 | Ga0105240_106092042 | 134 |
| 86 | 3300009098 | Ga0105245_10199591 | Ga0105245_101995912 | 134 |
| 87 | 3300009147 | Ga0114129_10007794 | Ga0114129_100077948 | 134 |
| 88 | 3300009174 | Ga0105241_10335901 | Ga0105241_103359013 | 134 |
| 89 | 3300009174 | Ga0105241_10402256 | Ga0105241_104022562 | 134 |
| 90 | 3300009176 | Ga0105242_10485534 | Ga0105242_104855342 | 134 |
| 91 | 3300009176 | Ga0105242_11779335 | Ga0105242_117793351 | 134 |
| 92 | 3300009177 | Ga0105248_10047231 | Ga0105248_100472313 | 134 |
| 93 | 3300009177 | Ga0105248_10053383 | Ga0105248_100533837 | 134 |
| 94 | 3300009177 | Ga0105248_11142571 | Ga0105248_111425712 | 134 |
| 95 | 3300009545 | Ga0105237_10650425 | Ga0105237_106504252 | 134 |
| 96 | 3300009553 | Ga0105249_10118923 | Ga0105249_101189234 | 134 |
| 97 | 3300010159 | Ga0099796_10356104 | Ga0099796_103561042 | 134 |
| 98 | 3300010375 | Ga0105239_11608684 | Ga0105239_116086842 | 134 |
| 99 | 3300013296 | Ga0157374_10023456 | Ga0157374_100234569 | 134 |
| 100 | 3300013296 | Ga0157374_10565413 | Ga0157374_105654132 | 134 |
| 101 | 3300013306 | Ga0163162_10474129 | Ga0163162_104741293 | 134 |
| 102 | 3300013308 | Ga0157375_10091058 | Ga0157375_100910583 | 134 |
| 103 | 3300013308 | Ga0157375_10117523 | Ga0157375_101175234 | 134 |
| 104 | 3300013308 | Ga0157375_10341682 | Ga0157375_103416823 | 134 |
| 105 | 3300014325 | Ga0163163_10061204 | Ga0163163_100612044 | 134 |
| 106 | 3300014325 | Ga0163163_10164600 | Ga0163163_101646004 | 134 |
| 107 | 3300014968 | Ga0157379_10055424 | Ga0157379_100554243 | 134 |
| 108 | 3300014969 | Ga0157376_10022851 | Ga0157376_100228514 | 134 |
| 109 | 3300014969 | Ga0157376_10039680 | Ga0157376_100396805 | 134 |
| 110 | 3300014969 | Ga0157376_10276599 | Ga0157376_102765992 | 134 |
| 111 | 3300015265 | Ga0182005_1190655 | Ga0182005_11906551 | 134 |
| 112 | 3300025961 | Ga0207712_11248941 | Ga0207712_112489411 | 134 |
| 113 | 3300035089 | Ga0373944_0039280 | Ga0373944_0039280_273_686 | 134 |
| 114 | 3300035119 | Ga0373956_0325313 | Ga0373956_0325313_74_493 | 134 |
| 115 | 3300035120 | Ga0373957_0150730 | Ga0373957_0150730_155_583 | 134 |
| 116 | 3300035725 | Ga0373947_0163710 | Ga0373947_0163710_528_947 | 134 |
| 117 | 3300035725 | Ga0373947_0386003 | Ga0373947_0386003_409_825 | 134 |
| 118 | 3300035725 | Ga0373947_0408879 | Ga0373947_0408879_251_664 | 134 |
| 119 | 3300037068 | Ga0373925_0903496 | Ga0373925_0903496_77_496 | 134 |
| 120 | 3300037418 | Ga0395900_0777820 | Ga0395900_0777820_238_651 | 134 |
| 121 | 3300037853 | Ga0436364_0816778 | Ga0436364_0816778_137_556 | 134 |
| 122 | 3300037853 | Ga0436364_1386291 | Ga0436364_1386291_15973_16392 | 134 |
| 123 | 3300039450 | Ga0436363_0974932 | Ga0436363_0974932_519_935 | 134 |
| 124 | 3300041456 | Ga0451795_0020277 | Ga0451795_0020277_34_453 | 134 |
| 125 | 3300041486 | Ga0451807_0761906 | Ga0451807_0761906_536_946 | 134 |
| 126 | 3300042439 | Ga0439464_0281481 | Ga0439464_0281481_31_447 | 134 |
| 127 | 3300042531 | Ga0450918_050400 | Ga0450918_050400_145_567 | 134 |
| 128 | 3300044673 | Ga0453683_0186671 | Ga0453683_0186671_877_1296 | 134 |
| 129 | 3300046454 | Ga0495592_0531970 | Ga0495592_0531970_210_629 | 134 |
| 130 | 3300046459 | Ga0495629_0054375 | Ga0495629_0054375_1964_2383 | 134 |
| 131 | 3300046459 | Ga0495629_0177700 | Ga0495629_0177700_121_534 | 134 |
| 132 | 3300046473 | Ga0495582_0004969 | Ga0495582_0004969_6059_6472 | 134 |
| 133 | 3300046473 | Ga0495582_0024664 | Ga0495582_0024664_319_738 | 134 |
| 134 | 3300046475 | Ga0495639_0044514 | Ga0495639_0044514_1020_1439 | 134 |
| 135 | 3300046477 | Ga0495664_0811403 | Ga0495664_0811403_35_454 | 134 |
| 136 | 3300046499 | Ga0495594_0059763 | Ga0495594_0059763_991_1410 | 134 |
| 137 | 3300046500 | Ga0495596_0187731 | Ga0495596_0187731_83_502 | 134 |
| 138 | 3300046507 | Ga0495606_0599829 | Ga0495606_0599829_34_453 | 134 |
| 139 | 3300046519 | Ga0495632_0072993 | Ga0495632_0072993_1206_1625 | 134 |
| 140 | 3300046526 | Ga0495666_0021121 | Ga0495666_0021121_872_1291 | 134 |
| 141 | 3300046529 | Ga0495652_0136578 | Ga0495652_0136578_1313_1741 | 134 |
| 142 | 3300046529 | Ga0495652_0140682 | Ga0495652_0140682_48_467 | 134 |
| 143 | 3300046531 | Ga0495665_0085444 | Ga0495665_0085444_673_1092 | 134 |
| 144 | 3300046535 | Ga0495586_0080798 | Ga0495586_0080798_520_933 | 134 |
| 145 | 3300046539 | Ga0495621_0254838 | Ga0495621_0254838_171_590 | 134 |
| 146 | 3300046559 | Ga0495667_0015927 | Ga0495667_0015927_121_549 | 134 |
| 147 | 3300046559 | Ga0495667_0076083 | Ga0495667_0076083_242_661 | 134 |
| 148 | 3300046642 | Ga0495634_0182482 | Ga0495634_0182482_877_1290 | 134 |
| 149 | 3300046660 | Ga0495625_0450166 | Ga0495625_0450166_22_441 | 134 |
| 150 | 3300046664 | Ga0495659_0528218 | Ga0495659_0528218_79_498 | 134 |
| 151 | 3300046678 | Ga0495599_0133273 | Ga0495599_0133273_673_1092 | 134 |
| 152 | 3300046680 | Ga0495646_0057461 | Ga0495646_0057461_683_1102 | 134 |
| 153 | 3300046689 | Ga0495613_0089821 | Ga0495613_0089821_724_1143 | 134 |
| 154 | 3300046690 | Ga0495624_0170813 | Ga0495624_0170813_92_511 | 134 |
| 155 | 3300047315 | Ga0495581_0004471 | Ga0495581_0004471_6122_6541 | 134 |
| 156 | 3300047317 | Ga0495604_0221717 | Ga0495604_0221717_592_1011 | 134 |
| 157 | 3300047318 | Ga0495636_0270770 | Ga0495636_0270770_216_635 | 134 |
| 158 | 3300047319 | Ga0495674_0147877 | Ga0495674_0147877_807_1226 | 134 |
| 159 | 3300047320 | Ga0495672_0003551 | Ga0495672_0003551_5324_5737 | 134 |
| 160 | 3300047320 | Ga0495672_0192404 | Ga0495672_0192404_156_575 | 134 |
| 161 | 3300047321 | Ga0495676_0010423 | Ga0495676_0010423_3873_4292 | 134 |
| 162 | 3300047322 | Ga0495680_0323792 | Ga0495680_0323792_129_548 | 134 |
| 163 | 3300047445 | Ga0495677_0192506 | Ga0495677_0192506_55_474 | 134 |
| 164 | 3300047471 | Ga0495684_0402057 | Ga0495684_0402057_110_529 | 134 |
| 165 | 3300048929 | Ga0496126_0240126 | Ga0496126_0240126_25_522 | 134 |
| 166 | 3300049569 | Ga0501032_0000283 | Ga0501032_0000283_16402_16812 | 134 |
| 167 | 3300049569 | Ga0501032_0017169 | Ga0501032_0017169_1213_1623 | 134 |
| 168 | 3300049571 | Ga0501034_0003011 | Ga0501034_0003011_3512_3922 | 134 |
| 169 | 3300049572 | Ga0501036_0015599 | Ga0501036_0015599_5774_6184 | 134 |
| 170 | 3300049572 | Ga0501036_0069084 | Ga0501036_0069084_1333_1743 | 134 |
| 171 | 3300049574 | Ga0501038_0001559 | Ga0501038_0001559_19917_20327 | 134 |
| 172 | 3300049574 | Ga0501038_0001785 | Ga0501038_0001785_16479_16889 | 134 |
| 173 | 3300049575 | Ga0501039_0002846 | Ga0501039_0002846_3284_3694 | 134 |
| 174 | 3300049575 | Ga0501039_0037679 | Ga0501039_0037679_19_429 | 134 |
| 175 | 3300049579 | Ga0501043_0336716 | Ga0501043_0336716_284_694 | 134 |
| 176 | 3300049580 | Ga0501046_0000815 | Ga0501046_0000815_25456_25866 | 134 |
| 177 | 3300049580 | Ga0501046_0035091 | Ga0501046_0035091_1306_1716 | 134 |
| 178 | 3300049581 | Ga0501047_0001472 | Ga0501047_0001472_4507_4917 | 134 |
| 179 | 3300049583 | Ga0501067_0193025 | Ga0501067_0193025_198_608 | 134 |
| 180 | 3300049584 | Ga0501068_0012207 | Ga0501068_0012207_3169_3579 | 134 |
| 181 | 3300049585 | Ga0501069_0068053 | Ga0501069_0068053_996_1406 | 134 |
| 182 | 3300049585 | Ga0501069_0162680 | Ga0501069_0162680_679_1089 | 134 |
| 183 | 3300049586 | Ga0501070_0566401 | Ga0501070_0566401_412_822 | 134 |
| 184 | 3300049588 | Ga0501072_0571474 | Ga0501072_0571474_375_785 | 134 |
| 185 | 3300049588 | Ga0501072_0581566 | Ga0501072_0581566_81_491 | 134 |
| 186 | 3300049589 | Ga0501073_0122986 | Ga0501073_0122986_1243_1653 | 134 |
| 187 | 3300049592 | Ga0501076_0137368 | Ga0501076_0137368_910_1320 | 134 |
| 188 | 3300049592 | Ga0501076_0486070 | Ga0501076_0486070_83_493 | 134 |
| 189 | 3300049741 | Ga0501079_0565241 | Ga0501079_0565241_434_847 | 134 |
| 190 | 3300049742 | Ga0501080_0027460 | Ga0501080_0027460_4507_4917 | 134 |
| 191 | 3300049742 | Ga0501080_0806817 | Ga0501080_0806817_26_445 | 134 |
| 192 | 3300049744 | Ga0501083_0027627 | Ga0501083_0027627_647_1057 | 134 |
| 193 | 3300049744 | Ga0501083_0145560 | Ga0501083_0145560_1047_1457 | 134 |
| 194 | 3300049822 | Ga0501035_0027104 | Ga0501035_0027104_4207_4617 | 134 |
| 195 | 3300049823 | Ga0501044_0001507 | Ga0501044_0001507_25838_26248 | 134 |
| 196 | 3300049823 | Ga0501044_0420692 | Ga0501044_0420692_190_600 | 134 |
| 197 | 3300050508 | nmdc:mga09592_104591_c1 | nmdc:mga09592_104591_c1_549_959 | 134 |
| 198 | 3300050509 | nmdc:mga0qj67_35688_c1 | nmdc:mga0qj67_35688_c1_2463_2873 | 134 |
| 199 | 3300050510 | nmdc:mga06r32_627763_c1 | nmdc:mga06r32_627763_c1_599_1009 | 134 |
| 200 | 3300050510 | nmdc:mga06r32_86434_c1 | nmdc:mga06r32_86434_c1_986_1399 | 134 |
| 201 | 3300050511 | nmdc:mga08y16_1186920_c1 | nmdc:mga08y16_1186920_c1_58_477 | 134 |
| 202 | 3300050511 | nmdc:mga08y16_129122_c1 | nmdc:mga08y16_129122_c1_1337_1753 | 134 |
| 203 | 3300053077 | Ga0495601_0037678 | Ga0495601_0037678_1321_1731 | 134 |
| 204 | 3300060353 | Ga0501082_0038642 | Ga0501082_0038642_196_606 | 134 |
| 205 | 3300005295 | Ga0065707_10087064 | Ga0065707_100870647 | 135 |
| 206 | 3300005327 | Ga0070658_10081234 | Ga0070658_100812343 | 135 |
| 207 | 3300005337 | Ga0070682_100051634 | Ga0070682_1000516344 | 135 |
| 208 | 3300005339 | Ga0070660_100079672 | Ga0070660_1000796722 | 135 |
| 209 | 3300005347 | Ga0070668_100616941 | Ga0070668_1006169412 | 135 |
| 210 | 3300005458 | Ga0070681_10001821 | Ga0070681_1000182115 | 135 |
| 211 | 3300005459 | Ga0068867_100141508 | Ga0068867_1001415082 | 135 |
| 212 | 3300005530 | Ga0070679_100194069 | Ga0070679_1001940692 | 135 |
| 213 | 3300005530 | Ga0070679_100356404 | Ga0070679_1003564044 | 135 |
| 214 | 3300005543 | Ga0070672_101746040 | Ga0070672_1017460401 | 135 |
| 215 | 3300005545 | Ga0070695_100174256 | Ga0070695_1001742562 | 135 |
| 216 | 3300005548 | Ga0070665_102506467 | Ga0070665_1025064671 | 135 |
| 217 | 3300005563 | Ga0068855_100211256 | Ga0068855_1002112562 | 135 |
| 218 | 3300005564 | Ga0070664_100763180 | Ga0070664_1007631801 | 135 |
| 219 | 3300005577 | Ga0068857_100034685 | Ga0068857_1000346854 | 135 |
| 220 | 3300005614 | Ga0068856_100052369 | Ga0068856_1000523692 | 135 |
| 221 | 3300005719 | Ga0068861_101069962 | Ga0068861_1010699622 | 135 |
| 222 | 3300005841 | Ga0068863_102407628 | Ga0068863_1024076281 | 135 |
| 223 | 3300007076 | Ga0075435_101797919 | Ga0075435_1017979191 | 135 |
| 224 | 3300009093 | Ga0105240_10003289 | Ga0105240_100032894 | 135 |
| 225 | 3300009093 | Ga0105240_10251676 | Ga0105240_102516763 | 135 |
| 226 | 3300009094 | Ga0111539_11173545 | Ga0111539_111735451 | 135 |
| 227 | 3300009551 | Ga0105238_10012194 | Ga0105238_100121942 | 135 |
| 228 | 3300014325 | Ga0163163_10001175 | Ga0163163_1000117525 | 135 |
| 229 | 3300014326 | Ga0157380_10055292 | Ga0157380_100552922 | 135 |
| 230 | 3300014326 | Ga0157380_10631083 | Ga0157380_106310831 | 135 |
| 231 | 3300014326 | Ga0157380_11508418 | Ga0157380_115084182 | 135 |
| 232 | 3300021358 | Ga0213873_10119193 | Ga0213873_101191932 | 135 |
| 233 | 3300025885 | Ga0207653_10069419 | Ga0207653_100694192 | 135 |
| 234 | 3300025909 | Ga0207705_10154448 | Ga0207705_101544482 | 135 |
| 235 | 3300025913 | Ga0207695_10043515 | Ga0207695_100435154 | 135 |
| 236 | 3300025914 | Ga0207671_10000278 | Ga0207671_100002784 | 135 |
| 237 | 3300025919 | Ga0207657_10340465 | Ga0207657_103404651 | 135 |
| 238 | 3300025921 | Ga0207652_10147705 | Ga0207652_101477052 | 135 |
| 239 | 3300025924 | Ga0207694_10013532 | Ga0207694_100135326 | 135 |
| 240 | 3300025925 | Ga0207650_10181560 | Ga0207650_101815602 | 135 |
| 241 | 3300025925 | Ga0207650_10206935 | Ga0207650_102069351 | 135 |
| 242 | 3300025926 | Ga0207659_10110349 | Ga0207659_101103492 | 135 |
| 243 | 3300025932 | Ga0207690_10680536 | Ga0207690_106805361 | 135 |
| 244 | 3300025942 | Ga0207689_10272279 | Ga0207689_102722792 | 135 |
| 245 | 3300025945 | Ga0207679_10683442 | Ga0207679_106834421 | 135 |
| 246 | 3300025949 | Ga0207667_10116617 | Ga0207667_101166173 | 135 |
| 247 | 3300025960 | Ga0207651_10112117 | Ga0207651_101121172 | 135 |
| 248 | 3300028573 | Ga0265334_10118299 | Ga0265334_101182992 | 135 |
| 249 | 3300028577 | Ga0265318_10000160 | Ga0265318_1000016043 | 135 |
| 250 | 3300028800 | Ga0265338_10336515 | Ga0265338_103365152 | 135 |
| 251 | 3300031235 | Ga0265330_10000084 | Ga0265330_1000008413 | 135 |
| 252 | 3300031238 | Ga0265332_10000518 | Ga0265332_100005188 | 135 |
| 253 | 3300031239 | Ga0265328_10004449 | Ga0265328_100044493 | 135 |
| 254 | 3300031240 | Ga0265320_10000144 | Ga0265320_1000014443 | 135 |
| 255 | 3300031240 | Ga0265320_10231262 | Ga0265320_102312621 | 135 |
| 256 | 3300031241 | Ga0265325_10321592 | Ga0265325_103215921 | 135 |
| 257 | 3300031242 | Ga0265329_10006155 | Ga0265329_100061552 | 135 |
| 258 | 3300031250 | Ga0265331_10000264 | Ga0265331_1000026443 | 135 |
| 259 | 3300031344 | Ga0265316_10014879 | Ga0265316_100148792 | 135 |
| 260 | 3300031595 | Ga0265313_10000404 | Ga0265313_1000040413 | 135 |
| 261 | 3300031595 | Ga0265313_10020862 | Ga0265313_100208624 | 135 |
| 262 | 3300031711 | Ga0265314_10000385 | Ga0265314_1000038543 | 135 |
| 263 | 3300031712 | Ga0265342_10063487 | Ga0265342_100634875 | 135 |
| 264 | 3300031712 | Ga0265342_10137397 | Ga0265342_101373971 | 135 |
| 265 | 3300039453 | Ga0436362_0830499 | Ga0436362_0830499_3435_3854 | 135 |
| 266 | 3300041462 | Ga0451806_486766 | Ga0451806_486766_15_437 | 135 |
| 267 | 3300046460 | Ga0495638_0043419 | Ga0495638_0043419_297_728 | 135 |
| 268 | 3300001989 | JGI24739J22299_10019000 | JGI24739J22299_100190002 | 136 |
| 269 | 3300001990 | JGI24737J22298_10026702 | JGI24737J22298_100267022 | 136 |
| 270 | 3300002067 | JGI24735J21928_10006056 | JGI24735J21928_100060562 | 136 |
| 271 | 3300003354 | JGI25160J50197_1046072 | JGI25160J50197_10460722 | 136 |
| 272 | 3300005329 | Ga0070683_100326919 | Ga0070683_1003269193 | 136 |
| 273 | 3300005335 | Ga0070666_10011547 | Ga0070666_100115475 | 136 |
| 274 | 3300005337 | Ga0070682_100299680 | Ga0070682_1002996803 | 136 |
| 275 | 3300005338 | Ga0068868_100439036 | Ga0068868_1004390362 | 136 |
| 276 | 3300005356 | Ga0070674_100430873 | Ga0070674_1004308732 | 136 |
| 277 | 3300005367 | Ga0070667_100013597 | Ga0070667_1000135973 | 136 |
| 278 | 3300005445 | Ga0070708_100496865 | Ga0070708_1004968652 | 136 |
| 279 | 3300005455 | Ga0070663_100034280 | Ga0070663_1000342803 | 136 |
| 280 | 3300005458 | Ga0070681_10066337 | Ga0070681_100663371 | 136 |
| 281 | 3300005458 | Ga0070681_11512293 | Ga0070681_115122931 | 136 |
| 282 | 3300005459 | Ga0068867_100136666 | Ga0068867_1001366662 | 136 |
| 283 | 3300005535 | Ga0070684_101460439 | Ga0070684_1014604391 | 136 |
| 284 | 3300005539 | Ga0068853_100146863 | Ga0068853_1001468633 | 136 |
| 285 | 3300005545 | Ga0070695_100353799 | Ga0070695_1003537991 | 136 |
| 286 | 3300005546 | Ga0070696_100671626 | Ga0070696_1006716262 | 136 |
| 287 | 3300005548 | Ga0070665_100175362 | Ga0070665_1001753623 | 136 |
| 288 | 3300005548 | Ga0070665_100289883 | Ga0070665_1002898832 | 136 |
| 289 | 3300005548 | Ga0070665_101475643 | Ga0070665_1014756432 | 136 |
| 290 | 3300005563 | Ga0068855_100366352 | Ga0068855_1003663523 | 136 |
| 291 | 3300005563 | Ga0068855_100865936 | Ga0068855_1008659361 | 136 |
| 292 | 3300005564 | Ga0070664_100845185 | Ga0070664_1008451852 | 136 |
| 293 | 3300005577 | Ga0068857_100061523 | Ga0068857_1000615234 | 136 |
| 294 | 3300005617 | Ga0068859_100403632 | Ga0068859_1004036321 | 136 |
| 295 | 3300005718 | Ga0068866_10514857 | Ga0068866_105148572 | 136 |
| 296 | 3300005841 | Ga0068863_100265640 | Ga0068863_1002656401 | 136 |
| 297 | 3300005842 | Ga0068858_100037359 | Ga0068858_1000373596 | 136 |
| 298 | 3300005842 | Ga0068858_101979493 | Ga0068858_1019794931 | 136 |
| 299 | 3300005843 | Ga0068860_100113101 | Ga0068860_1001131013 | 136 |
| 300 | 3300006048 | Ga0075363_100021961 | Ga0075363_1000219613 | 136 |
| 301 | 3300006195 | Ga0075366_10071689 | Ga0075366_100716892 | 136 |
| 302 | 3300006237 | Ga0097621_100052360 | Ga0097621_1000523605 | 136 |
| 303 | 3300006237 | Ga0097621_100106910 | Ga0097621_1001069102 | 136 |
| 304 | 3300006237 | Ga0097621_101720706 | Ga0097621_1017207061 | 136 |
| 305 | 3300006358 | Ga0068871_100069385 | Ga0068871_1000693853 | 136 |
| 306 | 3300006358 | Ga0068871_100276616 | Ga0068871_1002766162 | 136 |
| 307 | 3300006844 | Ga0075428_100564736 | Ga0075428_1005647362 | 136 |
| 308 | 3300006847 | Ga0075431_100587205 | Ga0075431_1005872052 | 136 |
| 309 | 3300006847 | Ga0075431_100831958 | Ga0075431_1008319582 | 136 |
| 310 | 3300006880 | Ga0075429_100003374 | Ga0075429_10000337411 | 136 |
| 311 | 3300006880 | Ga0075429_100496951 | Ga0075429_1004969513 | 136 |
| 312 | 3300006881 | Ga0068865_100189215 | Ga0068865_1001892153 | 136 |
| 313 | 3300006931 | Ga0097620_100403628 | Ga0097620_1004036283 | 136 |
| 314 | 3300007076 | Ga0075435_100558190 | Ga0075435_1005581902 | 136 |
| 315 | 3300007265 | Ga0099794_10108908 | Ga0099794_101089081 | 136 |
| 316 | 3300009094 | Ga0111539_10003306 | Ga0111539_1000330621 | 136 |
| 317 | 3300009094 | Ga0111539_10021894 | Ga0111539_100218949 | 136 |
| 318 | 3300009094 | Ga0111539_11240637 | Ga0111539_112406371 | 136 |
| 319 | 3300009094 | Ga0111539_11797714 | Ga0111539_117977142 | 136 |
| 320 | 3300009147 | Ga0114129_10008984 | Ga0114129_1000898413 | 136 |
| 321 | 3300009176 | Ga0105242_10006977 | Ga0105242_100069773 | 136 |
| 322 | 3300009177 | Ga0105248_10046020 | Ga0105248_100460204 | 136 |
| 323 | 3300009545 | Ga0105237_11907759 | Ga0105237_119077591 | 136 |
| 324 | 3300009551 | Ga0105238_10940318 | Ga0105238_109403182 | 136 |
| 325 | 3300011119 | Ga0105246_10523385 | Ga0105246_105233852 | 136 |
| 326 | 3300011119 | Ga0105246_11773288 | Ga0105246_117732881 | 136 |
| 327 | 3300013105 | Ga0157369_10730943 | Ga0157369_107309431 | 136 |
| 328 | 3300013297 | Ga0157378_11243708 | Ga0157378_112437082 | 136 |
| 329 | 3300013306 | Ga0163162_10226937 | Ga0163162_102269372 | 136 |
| 330 | 3300013306 | Ga0163162_10306837 | Ga0163162_103068373 | 136 |
| 331 | 3300013308 | Ga0157375_10277014 | Ga0157375_102770141 | 136 |
| 332 | 3300014325 | Ga0163163_10034053 | Ga0163163_100340533 | 136 |
| 333 | 3300014969 | Ga0157376_10012730 | Ga0157376_100127304 | 136 |
| 334 | 3300014969 | Ga0157376_12421888 | Ga0157376_124218882 | 136 |
| 335 | 3300017792 | Ga0163161_11893057 | Ga0163161_118930571 | 136 |
| 336 | 3300020076 | Ga0206355_1350711 | Ga0206355_13507111 | 136 |
| 337 | 3300020080 | Ga0206350_11423293 | Ga0206350_114232932 | 136 |
| 338 | 3300022467 | Ga0224712_10057505 | Ga0224712_100575053 | 136 |
| 339 | 3300025302 | Ga0207426_1003370 | Ga0207426_10033702 | 136 |
| 340 | 3300025899 | Ga0207642_10337504 | Ga0207642_103375041 | 136 |
| 341 | 3300025903 | Ga0207680_10008344 | Ga0207680_100083444 | 136 |
| 342 | 3300025904 | Ga0207647_10329459 | Ga0207647_103294592 | 136 |
| 343 | 3300025906 | Ga0207699_10968332 | Ga0207699_109683321 | 136 |
| 344 | 3300025911 | Ga0207654_11380980 | Ga0207654_113809801 | 136 |
| 345 | 3300025912 | Ga0207707_10499899 | Ga0207707_104998992 | 136 |
| 346 | 3300025913 | Ga0207695_10075299 | Ga0207695_100752994 | 136 |
| 347 | 3300025913 | Ga0207695_10419478 | Ga0207695_104194782 | 136 |
| 348 | 3300025924 | Ga0207694_10009430 | Ga0207694_100094302 | 136 |
| 349 | 3300025924 | Ga0207694_10633808 | Ga0207694_106338081 | 136 |
| 350 | 3300025927 | Ga0207687_10005541 | Ga0207687_100055414 | 136 |
| 351 | 3300025927 | Ga0207687_10049830 | Ga0207687_100498305 | 136 |
| 352 | 3300025933 | Ga0207706_10179825 | Ga0207706_101798252 | 136 |
| 353 | 3300025934 | Ga0207686_10089059 | Ga0207686_100890592 | 136 |
| 354 | 3300025934 | Ga0207686_10161618 | Ga0207686_101616182 | 136 |
| 355 | 3300025938 | Ga0207704_11377986 | Ga0207704_113779861 | 136 |
| 356 | 3300025941 | Ga0207711_10085535 | Ga0207711_100855353 | 136 |
| 357 | 3300025941 | Ga0207711_10097152 | Ga0207711_100971523 | 136 |
| 358 | 3300025941 | Ga0207711_10156220 | Ga0207711_101562202 | 136 |
| 359 | 3300025944 | Ga0207661_10122912 | Ga0207661_101229123 | 136 |
| 360 | 3300025949 | Ga0207667_10169338 | Ga0207667_101693383 | 136 |
| 361 | 3300025986 | Ga0207658_10021461 | Ga0207658_100214613 | 136 |
| 362 | 3300026023 | Ga0207677_10814953 | Ga0207677_108149531 | 136 |
| 363 | 3300026035 | Ga0207703_10004120 | Ga0207703_1000412011 | 136 |
| 364 | 3300026041 | Ga0207639_10756008 | Ga0207639_107560082 | 136 |
| 365 | 3300026067 | Ga0207678_10031631 | Ga0207678_100316312 | 136 |
| 366 | 3300026078 | Ga0207702_10317238 | Ga0207702_103172382 | 136 |
| 367 | 3300026089 | Ga0207648_10268012 | Ga0207648_102680122 | 136 |
| 368 | 3300026089 | Ga0207648_10453217 | Ga0207648_104532171 | 136 |
| 369 | 3300026095 | Ga0207676_10843971 | Ga0207676_108439712 | 136 |
| 370 | 3300026116 | Ga0207674_10077186 | Ga0207674_100771864 | 136 |
| 371 | 3300027671 | Ga0209588_1000591 | Ga0209588_10005913 | 136 |
| 372 | 3300027907 | Ga0207428_10130579 | Ga0207428_101305792 | 136 |
| 373 | 3300028379 | Ga0268266_10126210 | Ga0268266_101262103 | 136 |
| 374 | 3300028379 | Ga0268266_10467159 | Ga0268266_104671592 | 136 |
| 375 | 3300028379 | Ga0268266_10940450 | Ga0268266_109404501 | 136 |
| 376 | 3300028381 | Ga0268264_10189353 | Ga0268264_101893533 | 136 |
| 377 | 3300031548 | Ga0307408_100675332 | Ga0307408_1006753321 | 136 |
| 378 | 3300031731 | Ga0307405_10216190 | Ga0307405_102161902 | 136 |
| 379 | 3300031903 | Ga0307407_10335684 | Ga0307407_103356842 | 136 |
| 380 | 3300031911 | Ga0307412_10112122 | Ga0307412_101121222 | 136 |
| 381 | 3300031995 | Ga0307409_100001098 | Ga0307409_1000010985 | 136 |
| 382 | 3300031995 | Ga0307409_100520326 | Ga0307409_1005203262 | 136 |
| 383 | 3300032005 | Ga0307411_10039290 | Ga0307411_100392904 | 136 |
| 384 | 3300032005 | Ga0307411_10088639 | Ga0307411_100886392 | 136 |
| 385 | 3300032126 | Ga0307415_100661300 | Ga0307415_1006613002 | 136 |
| 386 | 3300044694 | Ga0466963_0677440 | Ga0466963_0677440_82_492 | 136 |
| 387 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_96003_96413 | 136 |
| 388 | 3300046460 | Ga0495638_0021351 | Ga0495638_0021351_3561_3983 | 136 |
| 389 | 3300046460 | Ga0495638_0186081 | Ga0495638_0186081_87_512 | 136 |
| 390 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_105711_106136 | 136 |
| 391 | 3300046474 | Ga0495605_0002109 | Ga0495605_0002109_6973_7389 | 136 |
| 392 | 3300046491 | Ga0495584_0030290 | Ga0495584_0030290_1482_1907 | 136 |
| 393 | 3300046492 | Ga0495585_0034383 | Ga0495585_0034383_56_472 | 136 |
| 394 | 3300046512 | Ga0495610_0314430 | Ga0495610_0314430_156_572 | 136 |
| 395 | 3300046684 | Ga0495669_0002518 | Ga0495669_0002518_7016_7432 | 136 |
| 396 | 3300046691 | Ga0495670_0004905 | Ga0495670_0004905_43_459 | 136 |
| 397 | 3300046692 | Ga0495671_0063960 | Ga0495671_0063960_1040_1456 | 136 |
| 398 | 3300046694 | Ga0495649_0013003 | Ga0495649_0013003_3460_3876 | 136 |
| 399 | 3300046794 | Ga0495589_0204728 | Ga0495589_0204728_61_477 | 136 |
| 400 | 3300046810 | Ga0495660_0043762 | Ga0495660_0043762_26_442 | 136 |
| 401 | 3300047446 | Ga0495679_044976 | Ga0495679_044976_29_445 | 136 |
| 402 | 3300048091 | Ga0495626_0209040 | Ga0495626_0209040_271_687 | 136 |
| 403 | 3300048904 | Ga0496101_0002922 | Ga0496101_0002922_1916_2332 | 136 |
| 404 | 3300048906 | Ga0496103_0114305 | Ga0496103_0114305_214_633 | 136 |
| 405 | 3300048907 | Ga0496104_0055263 | Ga0496104_0055263_3292_3708 | 136 |
| 406 | 3300048908 | Ga0496105_0079528 | Ga0496105_0079528_329_745 | 136 |
| 407 | 3300048909 | Ga0496106_0044716 | Ga0496106_0044716_428_847 | 136 |
| 408 | 3300048910 | Ga0496107_0007817 | Ga0496107_0007817_2980_3396 | 136 |
| 409 | 3300048912 | Ga0496109_0352817 | Ga0496109_0352817_563_982 | 136 |
| 410 | 3300048913 | Ga0496110_0075456 | Ga0496110_0075456_1937_2356 | 136 |
| 411 | 3300048915 | Ga0496112_0025641 | Ga0496112_0025641_2490_2909 | 136 |
| 412 | 3300048916 | Ga0496113_0234321 | Ga0496113_0234321_624_1043 | 136 |
| 413 | 3300048917 | Ga0496114_0697222 | Ga0496114_0697222_427_843 | 136 |
| 414 | 3300048919 | Ga0496116_0002045 | Ga0496116_0002045_18199_18615 | 136 |
| 415 | 3300048920 | Ga0496117_0003643 | Ga0496117_0003643_9707_10123 | 136 |
| 416 | 3300048921 | Ga0496118_0006911 | Ga0496118_0006911_3000_3416 | 136 |
| 417 | 3300048924 | Ga0496121_0001997 | Ga0496121_0001997_21909_22325 | 136 |
| 418 | 3300048926 | Ga0496123_0020557 | Ga0496123_0020557_1416_1832 | 136 |
| 419 | 3300048929 | Ga0496126_0019943 | Ga0496126_0019943_719_1129 | 136 |
| 420 | 3300048929 | Ga0496126_0553417 | Ga0496126_0553417_365_784 | 136 |
| 421 | 3300049459 | Ga0495678_023400 | Ga0495678_023400_1398_1814 | 136 |
| 422 | 3300049514 | Ga0501291_082556 | Ga0501291_082556_202_612 | 136 |
| 423 | 3300049568 | Ga0501031_0016517 | Ga0501031_0016517_2617_3027 | 136 |
| 424 | 3300049569 | Ga0501032_0513398 | Ga0501032_0513398_141_551 | 136 |
| 425 | 3300049572 | Ga0501036_0073428 | Ga0501036_0073428_2025_2435 | 136 |
| 426 | 3300049574 | Ga0501038_0186576 | Ga0501038_0186576_404_814 | 136 |
| 427 | 3300049576 | Ga0501040_0039344 | Ga0501040_0039344_256_666 | 136 |
| 428 | 3300049577 | Ga0501041_0273730 | Ga0501041_0273730_146_556 | 136 |
| 429 | 3300049578 | Ga0501042_0344741 | Ga0501042_0344741_210_620 | 136 |
| 430 | 3300049580 | Ga0501046_0316381 | Ga0501046_0316381_493_903 | 136 |
| 431 | 3300049582 | Ga0501048_0075906 | Ga0501048_0075906_1096_1506 | 136 |
| 432 | 3300049584 | Ga0501068_0104456 | Ga0501068_0104456_1012_1422 | 136 |
| 433 | 3300049587 | Ga0501071_0054879 | Ga0501071_0054879_1162_1572 | 136 |
| 434 | 3300049588 | Ga0501072_0141690 | Ga0501072_0141690_166_576 | 136 |
| 435 | 3300049590 | Ga0501074_0050292 | Ga0501074_0050292_921_1331 | 136 |
| 436 | 3300049591 | Ga0501075_0030713 | Ga0501075_0030713_1522_1932 | 136 |
| 437 | 3300049592 | Ga0501076_0271977 | Ga0501076_0271977_581_991 | 136 |
| 438 | 3300049593 | Ga0501077_0052836 | Ga0501077_0052836_2013_2423 | 136 |
| 439 | 3300049741 | Ga0501079_0071226 | Ga0501079_0071226_1900_2310 | 136 |
| 440 | 3300049742 | Ga0501080_0105408 | Ga0501080_0105408_1412_1822 | 136 |
| 441 | 3300049743 | Ga0501081_0373781 | Ga0501081_0373781_325_735 | 136 |
| 442 | 3300049822 | Ga0501035_0276813 | Ga0501035_0276813_464_874 | 136 |
| 443 | 3300050490 | nmdc:mga03n38_52095_c1 | nmdc:mga03n38_52095_c1_462_890 | 136 |
| 444 | 3300050507 | nmdc:mga05p37_40532_c1 | nmdc:mga05p37_40532_c1_4724_5137 | 136 |
| 445 | 3300050508 | nmdc:mga09592_11287_c1 | nmdc:mga09592_11287_c1_5721_6134 | 136 |
| 446 | 3300050510 | nmdc:mga06r32_493125_c1 | nmdc:mga06r32_493125_c1_364_789 | 136 |
| 447 | 3300050511 | nmdc:mga08y16_121251_c1 | nmdc:mga08y16_121251_c1_259_669 | 136 |
| 448 | 3300050511 | nmdc:mga08y16_88723_c1 | nmdc:mga08y16_88723_c1_1546_1971 | 136 |
| 449 | 3300050512 | nmdc:mga0n895_1415980_c1 | nmdc:mga0n895_1415980_c1_33_452 | 136 |
| 450 | 3300053087 | Ga0500643_012947 | Ga0500643_012947_1490_1915 | 136 |
| 451 | 3300053103 | Ga0500555_074593 | Ga0500555_074593_56_466 | 136 |
| 452 | 3300000546 | LJNas_1001694 | LJNas_10016943 | 137 |
| 453 | 3300005295 | Ga0065707_10575343 | Ga0065707_105753431 | 137 |
| 454 | 3300005328 | Ga0070676_10459387 | Ga0070676_104593872 | 137 |
| 455 | 3300005329 | Ga0070683_100014532 | Ga0070683_1000145326 | 137 |
| 456 | 3300005330 | Ga0070690_100022915 | Ga0070690_1000229151 | 137 |
| 457 | 3300005333 | Ga0070677_10034532 | Ga0070677_100345323 | 137 |
| 458 | 3300005336 | Ga0070680_100056302 | Ga0070680_1000563025 | 137 |
| 459 | 3300005336 | Ga0070680_100135952 | Ga0070680_1001359522 | 137 |
| 460 | 3300005336 | Ga0070680_100526542 | Ga0070680_1005265421 | 137 |
| 461 | 3300005336 | Ga0070680_100879287 | Ga0070680_1008792872 | 137 |
| 462 | 3300005337 | Ga0070682_100440813 | Ga0070682_1004408131 | 137 |
| 463 | 3300005338 | Ga0068868_100663348 | Ga0068868_1006633481 | 137 |
| 464 | 3300005338 | Ga0068868_101558113 | Ga0068868_1015581131 | 137 |
| 465 | 3300005339 | Ga0070660_100006936 | Ga0070660_1000069362 | 137 |
| 466 | 3300005339 | Ga0070660_100606388 | Ga0070660_1006063882 | 137 |
| 467 | 3300005339 | Ga0070660_101179924 | Ga0070660_1011799242 | 137 |
| 468 | 3300005340 | Ga0070689_100074231 | Ga0070689_1000742312 | 137 |
| 469 | 3300005340 | Ga0070689_100093389 | Ga0070689_1000933892 | 137 |
| 470 | 3300005340 | Ga0070689_100286455 | Ga0070689_1002864553 | 137 |
| 471 | 3300005344 | Ga0070661_100204512 | Ga0070661_1002045122 | 137 |
| 472 | 3300005347 | Ga0070668_100138606 | Ga0070668_1001386063 | 137 |
| 473 | 3300005347 | Ga0070668_100380698 | Ga0070668_1003806982 | 137 |
| 474 | 3300005353 | Ga0070669_100537399 | Ga0070669_1005373992 | 137 |
| 475 | 3300005354 | Ga0070675_100084124 | Ga0070675_1000841244 | 137 |
| 476 | 3300005354 | Ga0070675_100086621 | Ga0070675_1000866212 | 137 |
| 477 | 3300005354 | Ga0070675_100970290 | Ga0070675_1009702901 | 137 |
| 478 | 3300005355 | Ga0070671_100014275 | Ga0070671_1000142756 | 137 |
| 479 | 3300005355 | Ga0070671_100905581 | Ga0070671_1009055812 | 137 |
| 480 | 3300005364 | Ga0070673_100021234 | Ga0070673_1000212342 | 137 |
| 481 | 3300005364 | Ga0070673_100082825 | Ga0070673_1000828254 | 137 |
| 482 | 3300005364 | Ga0070673_100092788 | Ga0070673_1000927881 | 137 |
| 483 | 3300005364 | Ga0070673_101414275 | Ga0070673_1014142752 | 137 |
| 484 | 3300005364 | Ga0070673_101490652 | Ga0070673_1014906521 | 137 |
| 485 | 3300005365 | Ga0070688_100006642 | Ga0070688_1000066422 | 137 |
| 486 | 3300005365 | Ga0070688_100137146 | Ga0070688_1001371463 | 137 |
| 487 | 3300005365 | Ga0070688_100346586 | Ga0070688_1003465862 | 137 |
| 488 | 3300005365 | Ga0070688_100626785 | Ga0070688_1006267852 | 137 |
| 489 | 3300005366 | Ga0070659_100028575 | Ga0070659_1000285755 | 137 |
| 490 | 3300005366 | Ga0070659_101526033 | Ga0070659_1015260331 | 137 |
| 491 | 3300005367 | Ga0070667_100119570 | Ga0070667_1001195703 | 137 |
| 492 | 3300005406 | Ga0070703_10159295 | Ga0070703_101592951 | 137 |
| 493 | 3300005434 | Ga0070709_10047283 | Ga0070709_100472832 | 137 |
| 494 | 3300005434 | Ga0070709_11167343 | Ga0070709_111673431 | 137 |
| 495 | 3300005435 | Ga0070714_100065164 | Ga0070714_1000651642 | 137 |
| 496 | 3300005435 | Ga0070714_100230448 | Ga0070714_1002304483 | 137 |
| 497 | 3300005435 | Ga0070714_100844896 | Ga0070714_1008448962 | 137 |
| 498 | 3300005436 | Ga0070713_100016796 | Ga0070713_1000167964 | 137 |
| 499 | 3300005436 | Ga0070713_100077999 | Ga0070713_1000779992 | 137 |
| 500 | 3300005436 | Ga0070713_100619879 | Ga0070713_1006198791 | 137 |
| 501 | 3300005437 | Ga0070710_10883365 | Ga0070710_108833651 | 137 |
| 502 | 3300005438 | Ga0070701_10768998 | Ga0070701_107689982 | 137 |
| 503 | 3300005439 | Ga0070711_100076147 | Ga0070711_1000761471 | 137 |
| 504 | 3300005439 | Ga0070711_100240552 | Ga0070711_1002405522 | 137 |
| 505 | 3300005439 | Ga0070711_100468072 | Ga0070711_1004680721 | 137 |
| 506 | 3300005440 | Ga0070705_100064876 | Ga0070705_1000648761 | 137 |
| 507 | 3300005440 | Ga0070705_100083029 | Ga0070705_1000830292 | 137 |
| 508 | 3300005440 | Ga0070705_100715728 | Ga0070705_1007157282 | 137 |
| 509 | 3300005440 | Ga0070705_100865791 | Ga0070705_1008657911 | 137 |
| 510 | 3300005444 | Ga0070694_100354882 | Ga0070694_1003548822 | 137 |
| 511 | 3300005444 | Ga0070694_100480046 | Ga0070694_1004800462 | 137 |
| 512 | 3300005444 | Ga0070694_101154765 | Ga0070694_1011547651 | 137 |
| 513 | 3300005445 | Ga0070708_100530987 | Ga0070708_1005309872 | 137 |
| 514 | 3300005445 | Ga0070708_100765806 | Ga0070708_1007658062 | 137 |
| 515 | 3300005456 | Ga0070678_100638025 | Ga0070678_1006380252 | 137 |
| 516 | 3300005457 | Ga0070662_101122274 | Ga0070662_1011222742 | 137 |
| 517 | 3300005458 | Ga0070681_10017662 | Ga0070681_100176629 | 137 |
| 518 | 3300005458 | Ga0070681_10039710 | Ga0070681_100397103 | 137 |
| 519 | 3300005458 | Ga0070681_10138993 | Ga0070681_101389932 | 137 |
| 520 | 3300005458 | Ga0070681_10850242 | Ga0070681_108502422 | 137 |
| 521 | 3300005459 | Ga0068867_100196068 | Ga0068867_1001960682 | 137 |
| 522 | 3300005468 | Ga0070707_100854486 | Ga0070707_1008544861 | 137 |
| 523 | 3300005468 | Ga0070707_101631829 | Ga0070707_1016318291 | 137 |
| 524 | 3300005471 | Ga0070698_100013880 | Ga0070698_10001388010 | 137 |
| 525 | 3300005471 | Ga0070698_100176063 | Ga0070698_1001760633 | 137 |
| 526 | 3300005471 | Ga0070698_100429553 | Ga0070698_1004295532 | 137 |
| 527 | 3300005471 | Ga0070698_100933693 | Ga0070698_1009336932 | 137 |
| 528 | 3300005518 | Ga0070699_100000756 | Ga0070699_10000075612 | 137 |
| 529 | 3300005518 | Ga0070699_100008827 | Ga0070699_1000088277 | 137 |
| 530 | 3300005518 | Ga0070699_100278110 | Ga0070699_1002781101 | 137 |
| 531 | 3300005518 | Ga0070699_100395736 | Ga0070699_1003957362 | 137 |
| 532 | 3300005518 | Ga0070699_100480935 | Ga0070699_1004809351 | 137 |
| 533 | 3300005518 | Ga0070699_100620095 | Ga0070699_1006200952 | 137 |
| 534 | 3300005530 | Ga0070679_100027556 | Ga0070679_1000275568 | 137 |
| 535 | 3300005530 | Ga0070679_100235244 | Ga0070679_1002352442 | 137 |
| 536 | 3300005535 | Ga0070684_100001913 | Ga0070684_1000019135 | 137 |
| 537 | 3300005535 | Ga0070684_100078687 | Ga0070684_1000786875 | 137 |
| 538 | 3300005535 | Ga0070684_102150412 | Ga0070684_1021504121 | 137 |
| 539 | 3300005536 | Ga0070697_100346871 | Ga0070697_1003468712 | 137 |
| 540 | 3300005536 | Ga0070697_100568418 | Ga0070697_1005684182 | 137 |
| 541 | 3300005539 | Ga0068853_100003590 | Ga0068853_10000359012 | 137 |
| 542 | 3300005539 | Ga0068853_100095948 | Ga0068853_1000959482 | 137 |
| 543 | 3300005539 | Ga0068853_100523009 | Ga0068853_1005230092 | 137 |
| 544 | 3300005543 | Ga0070672_100021117 | Ga0070672_1000211174 | 137 |
| 545 | 3300005543 | Ga0070672_100022820 | Ga0070672_1000228207 | 137 |
| 546 | 3300005543 | Ga0070672_100138629 | Ga0070672_1001386292 | 137 |
| 547 | 3300005543 | Ga0070672_100350342 | Ga0070672_1003503422 | 137 |
| 548 | 3300005544 | Ga0070686_100094766 | Ga0070686_1000947662 | 137 |
| 549 | 3300005545 | Ga0070695_100179658 | Ga0070695_1001796581 | 137 |
| 550 | 3300005546 | Ga0070696_100003969 | Ga0070696_1000039697 | 137 |
| 551 | 3300005546 | Ga0070696_100035553 | Ga0070696_1000355532 | 137 |
| 552 | 3300005546 | Ga0070696_100210891 | Ga0070696_1002108912 | 137 |
| 553 | 3300005546 | Ga0070696_100986611 | Ga0070696_1009866112 | 137 |
| 554 | 3300005547 | Ga0070693_100757297 | Ga0070693_1007572971 | 137 |
| 555 | 3300005548 | Ga0070665_100000472 | Ga0070665_10000047224 | 137 |
| 556 | 3300005548 | Ga0070665_100001250 | Ga0070665_1000012502 | 137 |
| 557 | 3300005548 | Ga0070665_100148555 | Ga0070665_1001485553 | 137 |
| 558 | 3300005548 | Ga0070665_100542734 | Ga0070665_1005427341 | 137 |
| 559 | 3300005548 | Ga0070665_100571624 | Ga0070665_1005716242 | 137 |
| 560 | 3300005548 | Ga0070665_100579380 | Ga0070665_1005793802 | 137 |
| 561 | 3300005548 | Ga0070665_100629658 | Ga0070665_1006296582 | 137 |
| 562 | 3300005548 | Ga0070665_100956055 | Ga0070665_1009560551 | 137 |
| 563 | 3300005549 | Ga0070704_100283865 | Ga0070704_1002838652 | 137 |
| 564 | 3300005549 | Ga0070704_100293290 | Ga0070704_1002932902 | 137 |
| 565 | 3300005563 | Ga0068855_100460714 | Ga0068855_1004607142 | 137 |
| 566 | 3300005564 | Ga0070664_100329660 | Ga0070664_1003296602 | 137 |
| 567 | 3300005577 | Ga0068857_100046709 | Ga0068857_1000467094 | 137 |
| 568 | 3300005578 | Ga0068854_100000738 | Ga0068854_10000073810 | 137 |
| 569 | 3300005578 | Ga0068854_101139866 | Ga0068854_1011398662 | 137 |
| 570 | 3300005614 | Ga0068856_100257540 | Ga0068856_1002575403 | 137 |
| 571 | 3300005614 | Ga0068856_101925927 | Ga0068856_1019259271 | 137 |
| 572 | 3300005615 | Ga0070702_100001060 | Ga0070702_1000010609 | 137 |
| 573 | 3300005615 | Ga0070702_100534428 | Ga0070702_1005344282 | 137 |
| 574 | 3300005616 | Ga0068852_100351640 | Ga0068852_1003516403 | 137 |
| 575 | 3300005617 | Ga0068859_100066701 | Ga0068859_1000667012 | 137 |
| 576 | 3300005617 | Ga0068859_100534772 | Ga0068859_1005347723 | 137 |
| 577 | 3300005617 | Ga0068859_100538753 | Ga0068859_1005387532 | 137 |
| 578 | 3300005617 | Ga0068859_100818545 | Ga0068859_1008185452 | 137 |
| 579 | 3300005618 | Ga0068864_100039880 | Ga0068864_1000398805 | 137 |
| 580 | 3300005618 | Ga0068864_100097308 | Ga0068864_1000973085 | 137 |
| 581 | 3300005618 | Ga0068864_100486535 | Ga0068864_1004865351 | 137 |
| 582 | 3300005618 | Ga0068864_100642702 | Ga0068864_1006427022 | 137 |
| 583 | 3300005719 | Ga0068861_100097989 | Ga0068861_1000979894 | 137 |
| 584 | 3300005840 | Ga0068870_10026613 | Ga0068870_100266132 | 137 |
| 585 | 3300005840 | Ga0068870_11376633 | Ga0068870_113766332 | 137 |
| 586 | 3300005841 | Ga0068863_100028857 | Ga0068863_1000288577 | 137 |
| 587 | 3300005841 | Ga0068863_100066187 | Ga0068863_1000661874 | 137 |
| 588 | 3300005841 | Ga0068863_100448543 | Ga0068863_1004485432 | 137 |
| 589 | 3300005841 | Ga0068863_102469689 | Ga0068863_1024696891 | 137 |
| 590 | 3300005842 | Ga0068858_100089336 | Ga0068858_1000893363 | 137 |
| 591 | 3300005842 | Ga0068858_100405422 | Ga0068858_1004054222 | 137 |
| 592 | 3300005842 | Ga0068858_100736569 | Ga0068858_1007365691 | 137 |
| 593 | 3300005843 | Ga0068860_100048607 | Ga0068860_1000486072 | 137 |
| 594 | 3300005843 | Ga0068860_100676303 | Ga0068860_1006763032 | 137 |
| 595 | 3300005844 | Ga0068862_100891676 | Ga0068862_1008916761 | 137 |
| 596 | 3300006028 | Ga0070717_11102651 | Ga0070717_111026512 | 137 |
| 597 | 3300006038 | Ga0075365_10005044 | Ga0075365_100050445 | 137 |
| 598 | 3300006038 | Ga0075365_10032431 | Ga0075365_100324314 | 137 |
| 599 | 3300006038 | Ga0075365_10464713 | Ga0075365_104647131 | 137 |
| 600 | 3300006038 | Ga0075365_10520135 | Ga0075365_105201351 | 137 |
| 601 | 3300006042 | Ga0075368_10001652 | Ga0075368_100016526 | 137 |
| 602 | 3300006048 | Ga0075363_100020335 | Ga0075363_1000203352 | 137 |
| 603 | 3300006051 | Ga0075364_10050476 | Ga0075364_100504763 | 137 |
| 604 | 3300006163 | Ga0070715_10789991 | Ga0070715_107899911 | 137 |
| 605 | 3300006178 | Ga0075367_10012711 | Ga0075367_100127114 | 137 |
| 606 | 3300006178 | Ga0075367_10033438 | Ga0075367_100334383 | 137 |
| 607 | 3300006178 | Ga0075367_10861693 | Ga0075367_108616932 | 137 |
| 608 | 3300006186 | Ga0075369_10022838 | Ga0075369_100228383 | 137 |
| 609 | 3300006195 | Ga0075366_10044419 | Ga0075366_100444193 | 137 |
| 610 | 3300006195 | Ga0075366_10212787 | Ga0075366_102127872 | 137 |
| 611 | 3300006195 | Ga0075366_10219408 | Ga0075366_102194082 | 137 |
| 612 | 3300006237 | Ga0097621_100197454 | Ga0097621_1001974542 | 137 |
| 613 | 3300006237 | Ga0097621_102214406 | Ga0097621_1022144061 | 137 |
| 614 | 3300006353 | Ga0075370_10007354 | Ga0075370_100073546 | 137 |
| 615 | 3300006844 | Ga0075428_100011868 | Ga0075428_1000118682 | 137 |
| 616 | 3300006844 | Ga0075428_100157992 | Ga0075428_1001579923 | 137 |
| 617 | 3300006844 | Ga0075428_100560944 | Ga0075428_1005609442 | 137 |
| 618 | 3300006846 | Ga0075430_100091478 | Ga0075430_1000914782 | 137 |
| 619 | 3300006846 | Ga0075430_100184282 | Ga0075430_1001842823 | 137 |
| 620 | 3300006846 | Ga0075430_100216580 | Ga0075430_1002165802 | 137 |
| 621 | 3300006846 | Ga0075430_100383311 | Ga0075430_1003833113 | 137 |
| 622 | 3300006846 | Ga0075430_100557577 | Ga0075430_1005575772 | 137 |
| 623 | 3300006847 | Ga0075431_100031779 | Ga0075431_1000317794 | 137 |
| 624 | 3300006847 | Ga0075431_101931563 | Ga0075431_1019315631 | 137 |
| 625 | 3300006852 | Ga0075433_10520957 | Ga0075433_105209571 | 137 |
| 626 | 3300006871 | Ga0075434_100670316 | Ga0075434_1006703162 | 137 |
| 627 | 3300006880 | Ga0075429_100115648 | Ga0075429_1001156482 | 137 |
| 628 | 3300006881 | Ga0068865_100791942 | Ga0068865_1007919422 | 137 |
| 629 | 3300006914 | Ga0075436_100180074 | Ga0075436_1001800742 | 137 |
| 630 | 3300006914 | Ga0075436_100190447 | Ga0075436_1001904472 | 137 |
| 631 | 3300006931 | Ga0097620_100066701 | Ga0097620_1000667012 | 137 |
| 632 | 3300006931 | Ga0097620_100534787 | Ga0097620_1005347872 | 137 |
| 633 | 3300006931 | Ga0097620_100538650 | Ga0097620_1005386502 | 137 |
| 634 | 3300006931 | Ga0097620_100818687 | Ga0097620_1008186871 | 137 |
| 635 | 3300007076 | Ga0075435_100230454 | Ga0075435_1002304542 | 137 |
| 636 | 3300009093 | Ga0105240_10150608 | Ga0105240_101506084 | 137 |
| 637 | 3300009093 | Ga0105240_11252382 | Ga0105240_112523822 | 137 |
| 638 | 3300009094 | Ga0111539_10000077 | Ga0111539_1000007730 | 137 |
| 639 | 3300009098 | Ga0105245_11160707 | Ga0105245_111607072 | 137 |
| 640 | 3300009101 | Ga0105247_10657978 | Ga0105247_106579782 | 137 |
| 641 | 3300009147 | Ga0114129_12831810 | Ga0114129_128318102 | 137 |
| 642 | 3300009177 | Ga0105248_11825797 | Ga0105248_118257972 | 137 |
| 643 | 3300009545 | Ga0105237_10026579 | Ga0105237_100265797 | 137 |
| 644 | 3300009545 | Ga0105237_10276157 | Ga0105237_102761573 | 137 |
| 645 | 3300009545 | Ga0105237_10306741 | Ga0105237_103067412 | 137 |
| 646 | 3300009545 | Ga0105237_10721395 | Ga0105237_107213951 | 137 |
| 647 | 3300009551 | Ga0105238_10001743 | Ga0105238_100017435 | 137 |
| 648 | 3300009551 | Ga0105238_10018637 | Ga0105238_100186374 | 137 |
| 649 | 3300009551 | Ga0105238_10023731 | Ga0105238_100237312 | 137 |
| 650 | 3300009551 | Ga0105238_10544751 | Ga0105238_105447512 | 137 |
| 651 | 3300009551 | Ga0105238_11754103 | Ga0105238_117541031 | 137 |
| 652 | 3300009553 | Ga0105249_13323060 | Ga0105249_133230601 | 137 |
| 653 | 3300010375 | Ga0105239_10232066 | Ga0105239_102320662 | 137 |
| 654 | 3300010375 | Ga0105239_12096390 | Ga0105239_120963902 | 137 |
| 655 | 3300013102 | Ga0157371_10164182 | Ga0157371_101641822 | 137 |
| 656 | 3300013104 | Ga0157370_10853125 | Ga0157370_108531252 | 137 |
| 657 | 3300013104 | Ga0157370_10884638 | Ga0157370_108846382 | 137 |
| 658 | 3300013105 | Ga0157369_10020019 | Ga0157369_100200193 | 137 |
| 659 | 3300013105 | Ga0157369_10086636 | Ga0157369_100866362 | 137 |
| 660 | 3300013105 | Ga0157369_10285994 | Ga0157369_102859943 | 137 |
| 661 | 3300013105 | Ga0157369_10693705 | Ga0157369_106937052 | 137 |
| 662 | 3300013296 | Ga0157374_10438900 | Ga0157374_104389002 | 137 |
| 663 | 3300013296 | Ga0157374_11087640 | Ga0157374_110876402 | 137 |
| 664 | 3300013297 | Ga0157378_11255824 | Ga0157378_112558241 | 137 |
| 665 | 3300013306 | Ga0163162_10018269 | Ga0163162_100182695 | 137 |
| 666 | 3300013307 | Ga0157372_10693317 | Ga0157372_106933172 | 137 |
| 667 | 3300013307 | Ga0157372_11655181 | Ga0157372_116551811 | 137 |
| 668 | 3300013308 | Ga0157375_10017976 | Ga0157375_100179762 | 137 |
| 669 | 3300014325 | Ga0163163_10574153 | Ga0163163_105741532 | 137 |
| 670 | 3300014325 | Ga0163163_11603745 | Ga0163163_116037451 | 137 |
| 671 | 3300014325 | Ga0163163_11720362 | Ga0163163_117203621 | 137 |
| 672 | 3300014326 | Ga0157380_10003757 | Ga0157380_100037575 | 137 |
| 673 | 3300014326 | Ga0157380_10050020 | Ga0157380_100500205 | 137 |
| 674 | 3300014326 | Ga0157380_10096266 | Ga0157380_100962662 | 137 |
| 675 | 3300014326 | Ga0157380_10428354 | Ga0157380_104283542 | 137 |
| 676 | 3300014326 | Ga0157380_10474033 | Ga0157380_104740332 | 137 |
| 677 | 3300014326 | Ga0157380_10619663 | Ga0157380_106196632 | 137 |
| 678 | 3300014326 | Ga0157380_11905634 | Ga0157380_119056342 | 137 |
| 679 | 3300014745 | Ga0157377_10058956 | Ga0157377_100589563 | 137 |
| 680 | 3300014745 | Ga0157377_10488276 | Ga0157377_104882762 | 137 |
| 681 | 3300014968 | Ga0157379_10186132 | Ga0157379_101861323 | 137 |
| 682 | 3300014968 | Ga0157379_10240962 | Ga0157379_102409623 | 137 |
| 683 | 3300014969 | Ga0157376_10095961 | Ga0157376_100959613 | 137 |
| 684 | 3300014969 | Ga0157376_10834667 | Ga0157376_108346672 | 137 |
| 685 | 3300017792 | Ga0163161_10491754 | Ga0163161_104917541 | 137 |
| 686 | 3300017792 | Ga0163161_11865395 | Ga0163161_118653951 | 137 |
| 687 | 3300020070 | Ga0206356_10603777 | Ga0206356_106037771 | 137 |
| 688 | 3300021358 | Ga0213873_10001286 | Ga0213873_100012863 | 137 |
| 689 | 3300021361 | Ga0213872_10000410 | Ga0213872_1000041017 | 137 |
| 690 | 3300021361 | Ga0213872_10227148 | Ga0213872_102271481 | 137 |
| 691 | 3300021384 | Ga0213876_10001491 | Ga0213876_1000149111 | 137 |
| 692 | 3300021388 | Ga0213875_10053858 | Ga0213875_100538584 | 137 |
| 693 | 3300022467 | Ga0224712_10368195 | Ga0224712_103681951 | 137 |
| 694 | 3300022467 | Ga0224712_10589097 | Ga0224712_105890971 | 137 |
| 695 | 3300022732 | Ga0224569_101138 | Ga0224569_1011382 | 137 |
| 696 | 3300022734 | Ga0224571_100306 | Ga0224571_1003063 | 137 |
| 697 | 3300024225 | Ga0224572_1089281 | Ga0224572_10892811 | 137 |
| 698 | 3300024227 | Ga0228598_1013328 | Ga0228598_10133282 | 137 |
| 699 | 3300025893 | Ga0207682_10034274 | Ga0207682_100342742 | 137 |
| 700 | 3300025893 | Ga0207682_10079387 | Ga0207682_100793872 | 137 |
| 701 | 3300025900 | Ga0207710_10010195 | Ga0207710_100101953 | 137 |
| 702 | 3300025901 | Ga0207688_10243153 | Ga0207688_102431532 | 137 |
| 703 | 3300025903 | Ga0207680_10164256 | Ga0207680_101642563 | 137 |
| 704 | 3300025904 | Ga0207647_10053824 | Ga0207647_100538243 | 137 |
| 705 | 3300025906 | Ga0207699_10020124 | Ga0207699_100201245 | 137 |
| 706 | 3300025906 | Ga0207699_10072594 | Ga0207699_100725944 | 137 |
| 707 | 3300025907 | Ga0207645_10050255 | Ga0207645_100502552 | 137 |
| 708 | 3300025908 | Ga0207643_10396497 | Ga0207643_103964972 | 137 |
| 709 | 3300025909 | Ga0207705_10084861 | Ga0207705_100848613 | 137 |
| 710 | 3300025910 | Ga0207684_10140711 | Ga0207684_101407112 | 137 |
| 711 | 3300025910 | Ga0207684_11116058 | Ga0207684_111160581 | 137 |
| 712 | 3300025910 | Ga0207684_11727026 | Ga0207684_117270261 | 137 |
| 713 | 3300025911 | Ga0207654_10138583 | Ga0207654_101385832 | 137 |
| 714 | 3300025912 | Ga0207707_10001016 | Ga0207707_1000101619 | 137 |
| 715 | 3300025912 | Ga0207707_10074899 | Ga0207707_100748993 | 137 |
| 716 | 3300025912 | Ga0207707_11184262 | Ga0207707_111842622 | 137 |
| 717 | 3300025913 | Ga0207695_10067471 | Ga0207695_100674711 | 137 |
| 718 | 3300025913 | Ga0207695_10356085 | Ga0207695_103560852 | 137 |
| 719 | 3300025914 | Ga0207671_10031884 | Ga0207671_100318842 | 137 |
| 720 | 3300025914 | Ga0207671_10034743 | Ga0207671_100347432 | 137 |
| 721 | 3300025914 | Ga0207671_11099040 | Ga0207671_110990402 | 137 |
| 722 | 3300025915 | Ga0207693_10506859 | Ga0207693_105068592 | 137 |
| 723 | 3300025915 | Ga0207693_10568868 | Ga0207693_105688682 | 137 |
| 724 | 3300025915 | Ga0207693_10826340 | Ga0207693_108263402 | 137 |
| 725 | 3300025916 | Ga0207663_10660754 | Ga0207663_106607541 | 137 |
| 726 | 3300025916 | Ga0207663_10963947 | Ga0207663_109639472 | 137 |
| 727 | 3300025917 | Ga0207660_10000924 | Ga0207660_1000092420 | 137 |
| 728 | 3300025917 | Ga0207660_10227525 | Ga0207660_102275251 | 137 |
| 729 | 3300025917 | Ga0207660_11272732 | Ga0207660_112727322 | 137 |
| 730 | 3300025919 | Ga0207657_10001391 | Ga0207657_1000139119 | 137 |
| 731 | 3300025919 | Ga0207657_10070294 | Ga0207657_100702941 | 137 |
| 732 | 3300025921 | Ga0207652_10003893 | Ga0207652_100038938 | 137 |
| 733 | 3300025921 | Ga0207652_10201676 | Ga0207652_102016762 | 137 |
| 734 | 3300025921 | Ga0207652_10798153 | Ga0207652_107981532 | 137 |
| 735 | 3300025921 | Ga0207652_11295060 | Ga0207652_112950601 | 137 |
| 736 | 3300025922 | Ga0207646_10774558 | Ga0207646_107745582 | 137 |
| 737 | 3300025922 | Ga0207646_11157247 | Ga0207646_111572472 | 137 |
| 738 | 3300025924 | Ga0207694_10030192 | Ga0207694_100301922 | 137 |
| 739 | 3300025924 | Ga0207694_10143281 | Ga0207694_101432812 | 137 |
| 740 | 3300025924 | Ga0207694_10249457 | Ga0207694_102494573 | 137 |
| 741 | 3300025924 | Ga0207694_10574736 | Ga0207694_105747362 | 137 |
| 742 | 3300025924 | Ga0207694_10949253 | Ga0207694_109492532 | 137 |
| 743 | 3300025925 | Ga0207650_10038847 | Ga0207650_100388473 | 137 |
| 744 | 3300025925 | Ga0207650_10481726 | Ga0207650_104817262 | 137 |
| 745 | 3300025925 | Ga0207650_10655671 | Ga0207650_106556712 | 137 |
| 746 | 3300025926 | Ga0207659_10057006 | Ga0207659_100570063 | 137 |
| 747 | 3300025926 | Ga0207659_10102224 | Ga0207659_101022244 | 137 |
| 748 | 3300025926 | Ga0207659_10379219 | Ga0207659_103792192 | 137 |
| 749 | 3300025927 | Ga0207687_10356207 | Ga0207687_103562072 | 137 |
| 750 | 3300025928 | Ga0207700_10036339 | Ga0207700_100363395 | 137 |
| 751 | 3300025928 | Ga0207700_10365144 | Ga0207700_103651441 | 137 |
| 752 | 3300025929 | Ga0207664_10776520 | Ga0207664_107765202 | 137 |
| 753 | 3300025931 | Ga0207644_10006671 | Ga0207644_100066714 | 137 |
| 754 | 3300025932 | Ga0207690_10164702 | Ga0207690_101647022 | 137 |
| 755 | 3300025933 | Ga0207706_10437078 | Ga0207706_104370782 | 137 |
| 756 | 3300025933 | Ga0207706_10988563 | Ga0207706_109885631 | 137 |
| 757 | 3300025936 | Ga0207670_10008916 | Ga0207670_100089162 | 137 |
| 758 | 3300025936 | Ga0207670_10126979 | Ga0207670_101269794 | 137 |
| 759 | 3300025936 | Ga0207670_10140794 | Ga0207670_101407942 | 137 |
| 760 | 3300025937 | Ga0207669_10001908 | Ga0207669_100019082 | 137 |
| 761 | 3300025938 | Ga0207704_10940631 | Ga0207704_109406312 | 137 |
| 762 | 3300025939 | Ga0207665_10091265 | Ga0207665_100912651 | 137 |
| 763 | 3300025940 | Ga0207691_10014131 | Ga0207691_100141317 | 137 |
| 764 | 3300025940 | Ga0207691_10051753 | Ga0207691_100517533 | 137 |
| 765 | 3300025940 | Ga0207691_10260613 | Ga0207691_102606132 | 137 |
| 766 | 3300025940 | Ga0207691_10409061 | Ga0207691_104090612 | 137 |
| 767 | 3300025941 | Ga0207711_10058789 | Ga0207711_100587895 | 137 |
| 768 | 3300025941 | Ga0207711_10110236 | Ga0207711_101102363 | 137 |
| 769 | 3300025941 | Ga0207711_10140536 | Ga0207711_101405362 | 137 |
| 770 | 3300025944 | Ga0207661_10000421 | Ga0207661_1000042113 | 137 |
| 771 | 3300025944 | Ga0207661_10939226 | Ga0207661_109392261 | 137 |
| 772 | 3300025944 | Ga0207661_11177703 | Ga0207661_111777032 | 137 |
| 773 | 3300025945 | Ga0207679_10471259 | Ga0207679_104712592 | 137 |
| 774 | 3300025945 | Ga0207679_10898183 | Ga0207679_108981832 | 137 |
| 775 | 3300025949 | Ga0207667_10011614 | Ga0207667_100116149 | 137 |
| 776 | 3300025949 | Ga0207667_10320269 | Ga0207667_103202692 | 137 |
| 777 | 3300025949 | Ga0207667_10952451 | Ga0207667_109524512 | 137 |
| 778 | 3300025960 | Ga0207651_10146645 | Ga0207651_101466452 | 137 |
| 779 | 3300025960 | Ga0207651_10632119 | Ga0207651_106321192 | 137 |
| 780 | 3300025972 | Ga0207668_10994622 | Ga0207668_109946221 | 137 |
| 781 | 3300025972 | Ga0207668_11249376 | Ga0207668_112493761 | 137 |
| 782 | 3300025972 | Ga0207668_12014458 | Ga0207668_120144581 | 137 |
| 783 | 3300025981 | Ga0207640_10737658 | Ga0207640_107376582 | 137 |
| 784 | 3300025986 | Ga0207658_10055159 | Ga0207658_100551594 | 137 |
| 785 | 3300025986 | Ga0207658_10156750 | Ga0207658_101567501 | 137 |
| 786 | 3300025986 | Ga0207658_10399430 | Ga0207658_103994302 | 137 |
| 787 | 3300025986 | Ga0207658_11179460 | Ga0207658_111794602 | 137 |
| 788 | 3300026023 | Ga0207677_10656406 | Ga0207677_106564061 | 137 |
| 789 | 3300026035 | Ga0207703_10310417 | Ga0207703_103104172 | 137 |
| 790 | 3300026035 | Ga0207703_11229680 | Ga0207703_112296801 | 137 |
| 791 | 3300026035 | Ga0207703_12287443 | Ga0207703_122874431 | 137 |
| 792 | 3300026041 | Ga0207639_10246814 | Ga0207639_102468142 | 137 |
| 793 | 3300026067 | Ga0207678_10253431 | Ga0207678_102534312 | 137 |
| 794 | 3300026067 | Ga0207678_11335151 | Ga0207678_113351512 | 137 |
| 795 | 3300026075 | Ga0207708_10054534 | Ga0207708_100545345 | 137 |
| 796 | 3300026075 | Ga0207708_10177217 | Ga0207708_101772172 | 137 |
| 797 | 3300026075 | Ga0207708_10390124 | Ga0207708_103901241 | 137 |
| 798 | 3300026078 | Ga0207702_10377290 | Ga0207702_103772902 | 137 |
| 799 | 3300026078 | Ga0207702_10985232 | Ga0207702_109852321 | 137 |
| 800 | 3300026088 | Ga0207641_10015592 | Ga0207641_100155926 | 137 |
| 801 | 3300026088 | Ga0207641_10834384 | Ga0207641_108343842 | 137 |
| 802 | 3300026089 | Ga0207648_10050207 | Ga0207648_100502074 | 137 |
| 803 | 3300026089 | Ga0207648_10327339 | Ga0207648_103273392 | 137 |
| 804 | 3300026095 | Ga0207676_10085302 | Ga0207676_100853022 | 137 |
| 805 | 3300026095 | Ga0207676_10096720 | Ga0207676_100967204 | 137 |
| 806 | 3300026095 | Ga0207676_10111922 | Ga0207676_101119222 | 137 |
| 807 | 3300026095 | Ga0207676_10127786 | Ga0207676_101277863 | 137 |
| 808 | 3300026095 | Ga0207676_10445685 | Ga0207676_104456852 | 137 |
| 809 | 3300026095 | Ga0207676_10519004 | Ga0207676_105190041 | 137 |
| 810 | 3300026116 | Ga0207674_10012767 | Ga0207674_100127678 | 137 |
| 811 | 3300026118 | Ga0207675_101293395 | Ga0207675_1012933952 | 137 |
| 812 | 3300026121 | Ga0207683_10026846 | Ga0207683_100268464 | 137 |
| 813 | 3300026121 | Ga0207683_10249194 | Ga0207683_102491943 | 137 |
| 814 | 3300026142 | Ga0207698_10159960 | Ga0207698_101599603 | 137 |
| 815 | 3300026142 | Ga0207698_10630498 | Ga0207698_106304981 | 137 |
| 816 | 3300027671 | Ga0209588_1012966 | Ga0209588_10129664 | 137 |
| 817 | 3300027866 | Ga0209813_10044519 | Ga0209813_100445192 | 137 |
| 818 | 3300027907 | Ga0207428_10013101 | Ga0207428_100131012 | 137 |
| 819 | 3300027907 | Ga0207428_10672915 | Ga0207428_106729151 | 137 |
| 820 | 3300028379 | Ga0268266_10000556 | Ga0268266_1000055624 | 137 |
| 821 | 3300028379 | Ga0268266_10039341 | Ga0268266_100393415 | 137 |
| 822 | 3300028379 | Ga0268266_10048311 | Ga0268266_100483115 | 137 |
| 823 | 3300028379 | Ga0268266_10326531 | Ga0268266_103265313 | 137 |
| 824 | 3300028379 | Ga0268266_10397223 | Ga0268266_103972233 | 137 |
| 825 | 3300028380 | Ga0268265_10012154 | Ga0268265_100121545 | 137 |
| 826 | 3300028381 | Ga0268264_10223039 | Ga0268264_102230393 | 137 |
| 827 | 3300028381 | Ga0268264_10420862 | Ga0268264_104208621 | 137 |
| 828 | 3300028381 | Ga0268264_10793565 | Ga0268264_107935652 | 137 |
| 829 | 3300030521 | Ga0307511_10000022 | Ga0307511_10000022114 | 137 |
| 830 | 3300031235 | Ga0265330_10068245 | Ga0265330_100682452 | 137 |
| 831 | 3300031235 | Ga0265330_10328184 | Ga0265330_103281841 | 137 |
| 832 | 3300031238 | Ga0265332_10078877 | Ga0265332_100788772 | 137 |
| 833 | 3300031238 | Ga0265332_10113667 | Ga0265332_101136672 | 137 |
| 834 | 3300031239 | Ga0265328_10401206 | Ga0265328_104012061 | 137 |
| 835 | 3300031240 | Ga0265320_10390794 | Ga0265320_103907941 | 137 |
| 836 | 3300031242 | Ga0265329_10237003 | Ga0265329_102370031 | 137 |
| 837 | 3300031247 | Ga0265340_10059333 | Ga0265340_100593333 | 137 |
| 838 | 3300031249 | Ga0265339_10209776 | Ga0265339_102097761 | 137 |
| 839 | 3300031250 | Ga0265331_10113290 | Ga0265331_101132903 | 137 |
| 840 | 3300031250 | Ga0265331_10221813 | Ga0265331_102218131 | 137 |
| 841 | 3300031344 | Ga0265316_10327442 | Ga0265316_103274421 | 137 |
| 842 | 3300031344 | Ga0265316_10332619 | Ga0265316_103326192 | 137 |
| 843 | 3300031507 | Ga0307509_10043196 | Ga0307509_100431965 | 137 |
| 844 | 3300031507 | Ga0307509_10123960 | Ga0307509_101239604 | 137 |
| 845 | 3300031548 | Ga0307408_100605884 | Ga0307408_1006058842 | 137 |
| 846 | 3300031595 | Ga0265313_10101121 | Ga0265313_101011212 | 137 |
| 847 | 3300031712 | Ga0265342_10115041 | Ga0265342_101150413 | 137 |
| 848 | 3300031731 | Ga0307405_10060792 | Ga0307405_100607923 | 137 |
| 849 | 3300031824 | Ga0307413_10014216 | Ga0307413_100142163 | 137 |
| 850 | 3300031852 | Ga0307410_10139331 | Ga0307410_101393312 | 137 |
| 851 | 3300031852 | Ga0307410_10832262 | Ga0307410_108322622 | 137 |
| 852 | 3300031903 | Ga0307407_10116439 | Ga0307407_101164392 | 137 |
| 853 | 3300031911 | Ga0307412_10022402 | Ga0307412_100224023 | 137 |
| 854 | 3300031911 | Ga0307412_10790530 | Ga0307412_107905301 | 137 |
| 855 | 3300031995 | Ga0307409_100146109 | Ga0307409_1001461092 | 137 |
| 856 | 3300032002 | Ga0307416_100025448 | Ga0307416_1000254484 | 137 |
| 857 | 3300032002 | Ga0307416_101073577 | Ga0307416_1010735772 | 137 |
| 858 | 3300032004 | Ga0307414_10010424 | Ga0307414_100104243 | 137 |
| 859 | 3300032004 | Ga0307414_11206243 | Ga0307414_112062431 | 137 |
| 860 | 3300032005 | Ga0307411_10022213 | Ga0307411_100222132 | 137 |
| 861 | 3300033179 | Ga0307507_10192176 | Ga0307507_101921763 | 137 |
| 862 | 3300035086 | Ga0373934_0059885 | Ga0373934_0059885_702_1118 | 137 |
| 863 | 3300035111 | Ga0373923_0070190 | Ga0373923_0070190_806_1222 | 137 |
| 864 | 3300035113 | Ga0373936_0201340 | Ga0373936_0201340_371_787 | 137 |
| 865 | 3300035117 | Ga0373953_0004518 | Ga0373953_0004518_2256_2672 | 137 |
| 866 | 3300035117 | Ga0373953_0274254 | Ga0373953_0274254_262_675 | 137 |
| 867 | 3300035118 | Ga0373954_0003164 | Ga0373954_0003164_5002_5418 | 137 |
| 868 | 3300035118 | Ga0373954_0006861 | Ga0373954_0006861_621_1040 | 137 |
| 869 | 3300035120 | Ga0373957_0015715 | Ga0373957_0015715_843_1259 | 137 |
| 870 | 3300035170 | Ga0373943_0174919 | Ga0373943_0174919_228_644 | 137 |
| 871 | 3300035172 | Ga0373955_0012729 | Ga0373955_0012729_2531_2947 | 137 |
| 872 | 3300035241 | Ga0373961_0000747 | Ga0373961_0000747_6365_6790 | 137 |
| 873 | 3300035692 | Ga0373935_0065045 | Ga0373935_0065045_1794_2210 | 137 |
| 874 | 3300035692 | Ga0373935_0762880 | Ga0373935_0762880_116_532 | 137 |
| 875 | 3300035724 | Ga0373933_0028682 | Ga0373933_0028682_1991_2407 | 137 |
| 876 | 3300036401 | Ga0373937_0016441 | Ga0373937_0016441_1017_1433 | 137 |
| 877 | 3300036401 | Ga0373937_0278614 | Ga0373937_0278614_76_504 | 137 |
| 878 | 3300037068 | Ga0373925_0073627 | Ga0373925_0073627_1609_2025 | 137 |
| 879 | 3300037068 | Ga0373925_0210856 | Ga0373925_0210856_737_1159 | 137 |
| 880 | 3300037312 | Ga0395899_0190097 | Ga0395899_0190097_101_517 | 137 |
| 881 | 3300037466 | Ga0395898_0035872 | Ga0395898_0035872_2492_2908 | 137 |
| 882 | 3300037471 | Ga0395905_1630589 | Ga0395905_1630589_17_445 | 137 |
| 883 | 3300037853 | Ga0436364_0090800 | Ga0436364_0090800_160_588 | 137 |
| 884 | 3300038443 | Ga0395901_1117206 | Ga0395901_1117206_62_478 | 137 |
| 885 | 3300039437 | Ga0436365_0921625 | Ga0436365_0921625_7357_7779 | 137 |
| 886 | 3300039447 | Ga0436361_0381832 | Ga0436361_0381832_62378_62806 | 137 |
| 887 | 3300039447 | Ga0436361_0536137 | Ga0436361_0536137_2008_2430 | 137 |
| 888 | 3300039447 | Ga0436361_1199929 | Ga0436361_1199929_83_505 | 137 |
| 889 | 3300039453 | Ga0436362_0741099 | Ga0436362_0741099_3420_3842 | 137 |
| 890 | 3300041494 | Ga0451837_1384319 | Ga0451837_1384319_138_560 | 137 |
| 891 | 3300041505 | Ga0451849_0877464 | Ga0451849_0877464_20_439 | 137 |
| 892 | 3300041507 | Ga0451851_0309592 | Ga0451851_0309592_74_502 | 137 |
| 893 | 3300041512 | Ga0451853_0720400 | Ga0451853_0720400_85_522 | 137 |
| 894 | 3300042876 | Ga0451577_0006711 | Ga0451577_0006711_4517_4939 | 137 |
| 895 | 3300042876 | Ga0451577_0057187 | Ga0451577_0057187_2557_2985 | 137 |
| 896 | 3300044673 | Ga0453683_0066699 | Ga0453683_0066699_1169_1591 | 137 |
| 897 | 3300044684 | Ga0466966_0551906 | Ga0466966_0551906_143_556 | 137 |
| 898 | 3300044712 | Ga0453684_0169318 | Ga0453684_0169318_1954_2376 | 137 |
| 899 | 3300045049 | Ga0466959_0018159 | Ga0466959_0018159_4195_4608 | 137 |
| 900 | 3300045051 | Ga0451576_0017314 | Ga0451576_0017314_994_1416 | 137 |
| 901 | 3300045051 | Ga0451576_1389516 | Ga0451576_1389516_18_446 | 137 |
| 902 | 3300046454 | Ga0495592_0101071 | Ga0495592_0101071_904_1323 | 137 |
| 903 | 3300046462 | Ga0495651_0015643 | Ga0495651_0015643_2240_2656 | 137 |
| 904 | 3300046462 | Ga0495651_0376347 | Ga0495651_0376347_258_686 | 137 |
| 905 | 3300046462 | Ga0495651_0520233 | Ga0495651_0520233_163_582 | 137 |
| 906 | 3300046463 | Ga0495653_0065346 | Ga0495653_0065346_1975_2391 | 137 |
| 907 | 3300046472 | Ga0495580_0174662 | Ga0495580_0174662_554_982 | 137 |
| 908 | 3300046477 | Ga0495664_0063179 | Ga0495664_0063179_435_863 | 137 |
| 909 | 3300046506 | Ga0495583_0041057 | Ga0495583_0041057_413_841 | 137 |
| 910 | 3300046511 | Ga0495608_0060188 | Ga0495608_0060188_338_754 | 137 |
| 911 | 3300046516 | Ga0495628_0033413 | Ga0495628_0033413_1372_1788 | 137 |
| 912 | 3300046516 | Ga0495628_0292103 | Ga0495628_0292103_211_639 | 137 |
| 913 | 3300046517 | Ga0495630_0035014 | Ga0495630_0035014_100_516 | 137 |
| 914 | 3300046518 | Ga0495631_0138051 | Ga0495631_0138051_594_1022 | 137 |
| 915 | 3300046524 | Ga0495648_0158956 | Ga0495648_0158956_291_719 | 137 |
| 916 | 3300046528 | Ga0495642_0183382 | Ga0495642_0183382_37_465 | 137 |
| 917 | 3300046529 | Ga0495652_0054846 | Ga0495652_0054846_510_926 | 137 |
| 918 | 3300046533 | Ga0495640_0100517 | Ga0495640_0100517_59_475 | 137 |
| 919 | 3300046535 | Ga0495586_0037182 | Ga0495586_0037182_806_1222 | 137 |
| 920 | 3300046535 | Ga0495586_0521954 | Ga0495586_0521954_158_586 | 137 |
| 921 | 3300046536 | Ga0495587_0070475 | Ga0495587_0070475_435_851 | 137 |
| 922 | 3300046537 | Ga0495598_0041459 | Ga0495598_0041459_387_815 | 137 |
| 923 | 3300046543 | Ga0495645_0053112 | Ga0495645_0053112_2463_2879 | 137 |
| 924 | 3300046543 | Ga0495645_0461961 | Ga0495645_0461961_159_587 | 137 |
| 925 | 3300046559 | Ga0495667_0135062 | Ga0495667_0135062_168_584 | 137 |
| 926 | 3300046642 | Ga0495634_0018650 | Ga0495634_0018650_1990_2406 | 137 |
| 927 | 3300046642 | Ga0495634_0027571 | Ga0495634_0027571_3428_3856 | 137 |
| 928 | 3300046660 | Ga0495625_0000276 | Ga0495625_0000276_2934_3356 | 137 |
| 929 | 3300046660 | Ga0495625_0035398 | Ga0495625_0035398_715_1143 | 137 |
| 930 | 3300046663 | Ga0495635_0021252 | Ga0495635_0021252_2249_2665 | 137 |
| 931 | 3300046665 | Ga0495661_0350616 | Ga0495661_0350616_98_526 | 137 |
| 932 | 3300046675 | Ga0495657_0007196 | Ga0495657_0007196_5611_6027 | 137 |
| 933 | 3300046675 | Ga0495657_0107056 | Ga0495657_0107056_380_799 | 137 |
| 934 | 3300046678 | Ga0495599_0004838 | Ga0495599_0004838_1770_2186 | 137 |
| 935 | 3300046678 | Ga0495599_0448102 | Ga0495599_0448102_328_747 | 137 |
| 936 | 3300046679 | Ga0495623_0035399 | Ga0495623_0035399_2373_2789 | 137 |
| 937 | 3300046679 | Ga0495623_0492223 | Ga0495623_0492223_20_448 | 137 |
| 938 | 3300046680 | Ga0495646_0020107 | Ga0495646_0020107_1325_1741 | 137 |
| 939 | 3300046680 | Ga0495646_0188504 | Ga0495646_0188504_189_617 | 137 |
| 940 | 3300046684 | Ga0495669_0496228 | Ga0495669_0496228_79_495 | 137 |
| 941 | 3300046689 | Ga0495613_0071465 | Ga0495613_0071465_1586_2014 | 137 |
| 942 | 3300046689 | Ga0495613_0114323 | Ga0495613_0114323_457_873 | 137 |
| 943 | 3300046690 | Ga0495624_0193503 | Ga0495624_0193503_279_695 | 137 |
| 944 | 3300046690 | Ga0495624_0513014 | Ga0495624_0513014_191_604 | 137 |
| 945 | 3300046694 | Ga0495649_0170434 | Ga0495649_0170434_701_1129 | 137 |
| 946 | 3300046809 | Ga0495600_0035461 | Ga0495600_0035461_1997_2416 | 137 |
| 947 | 3300046809 | Ga0495600_0035500 | Ga0495600_0035500_290_706 | 137 |
| 948 | 3300047317 | Ga0495604_0090026 | Ga0495604_0090026_389_805 | 137 |
| 949 | 3300047318 | Ga0495636_0372469 | Ga0495636_0372469_183_599 | 137 |
| 950 | 3300047319 | Ga0495674_0249057 | Ga0495674_0249057_880_1296 | 137 |
| 951 | 3300047319 | Ga0495674_0843822 | Ga0495674_0843822_95_517 | 137 |
| 952 | 3300047320 | Ga0495672_0001069 | Ga0495672_0001069_20426_20845 | 137 |
| 953 | 3300047320 | Ga0495672_0061509 | Ga0495672_0061509_1513_1944 | 137 |
| 954 | 3300047322 | Ga0495680_0003456 | Ga0495680_0003456_9570_9986 | 137 |
| 955 | 3300047444 | Ga0495675_0025788 | Ga0495675_0025788_2555_2971 | 137 |
| 956 | 3300047444 | Ga0495675_0436784 | Ga0495675_0436784_207_635 | 137 |
| 957 | 3300047471 | Ga0495684_0301087 | Ga0495684_0301087_172_600 | 137 |
| 958 | 3300047472 | Ga0495686_0223310 | Ga0495686_0223310_344_772 | 137 |
| 959 | 3300047472 | Ga0495686_0582242 | Ga0495686_0582242_78_512 | 137 |
| 960 | 3300047673 | Ga0495593_0045311 | Ga0495593_0045311_456_872 | 137 |
| 961 | 3300048088 | Ga0495602_0085112 | Ga0495602_0085112_768_1184 | 137 |
| 962 | 3300048903 | Ga0496100_0327758 | Ga0496100_0327758_437_850 | 137 |
| 963 | 3300048907 | Ga0496104_0362043 | Ga0496104_0362043_17_430 | 137 |
| 964 | 3300048910 | Ga0496107_0502392 | Ga0496107_0502392_457_885 | 137 |
| 965 | 3300048914 | Ga0496111_0314263 | Ga0496111_0314263_498_911 | 137 |
| 966 | 3300048915 | Ga0496112_0029852 | Ga0496112_0029852_4340_4753 | 137 |
| 967 | 3300048915 | Ga0496112_1502347 | Ga0496112_1502347_84_500 | 137 |
| 968 | 3300048916 | Ga0496113_0101821 | Ga0496113_0101821_882_1295 | 137 |
| 969 | 3300048916 | Ga0496113_0577017 | Ga0496113_0577017_59_475 | 137 |
| 970 | 3300048916 | Ga0496113_1311620 | Ga0496113_1311620_69_494 | 137 |
| 971 | 3300048917 | Ga0496114_0814778 | Ga0496114_0814778_168_581 | 137 |
| 972 | 3300048918 | Ga0496115_0662255 | Ga0496115_0662255_48_473 | 137 |
| 973 | 3300048918 | Ga0496115_0961324 | Ga0496115_0961324_40_459 | 137 |
| 974 | 3300048923 | Ga0496120_0184646 | Ga0496120_0184646_167_595 | 137 |
| 975 | 3300048924 | Ga0496121_0054026 | Ga0496121_0054026_1476_1889 | 137 |
| 976 | 3300048924 | Ga0496121_0121929 | Ga0496121_0121929_654_1091 | 137 |
| 977 | 3300048929 | Ga0496126_0000245 | Ga0496126_0000245_85942_86370 | 137 |
| 978 | 3300048929 | Ga0496126_0002541 | Ga0496126_0002541_4399_4818 | 137 |
| 979 | 3300048929 | Ga0496126_0042857 | Ga0496126_0042857_156_569 | 137 |
| 980 | 3300048929 | Ga0496126_0120816 | Ga0496126_0120816_1684_2121 | 137 |
| 981 | 3300048929 | Ga0496126_0136221 | Ga0496126_0136221_765_1190 | 137 |
| 982 | 3300049568 | Ga0501031_0001415 | Ga0501031_0001415_9250_9669 | 137 |
| 983 | 3300049569 | Ga0501032_0003300 | Ga0501032_0003300_2706_3125 | 137 |
| 984 | 3300049569 | Ga0501032_0010264 | Ga0501032_0010264_1859_2281 | 137 |
| 985 | 3300049569 | Ga0501032_0272266 | Ga0501032_0272266_155_577 | 137 |
| 986 | 3300049570 | Ga0501033_0000175 | Ga0501033_0000175_45123_45542 | 137 |
| 987 | 3300049570 | Ga0501033_0002596 | Ga0501033_0002596_11431_11853 | 137 |
| 988 | 3300049570 | Ga0501033_0170236 | Ga0501033_0170236_485_904 | 137 |
| 989 | 3300049571 | Ga0501034_0000202 | Ga0501034_0000202_103277_103696 | 137 |
| 990 | 3300049571 | Ga0501034_0023442 | Ga0501034_0023442_110_532 | 137 |
| 991 | 3300049571 | Ga0501034_0036158 | Ga0501034_0036158_460_879 | 137 |
| 992 | 3300049571 | Ga0501034_0625182 | Ga0501034_0625182_544_963 | 137 |
| 993 | 3300049572 | Ga0501036_0000042 | Ga0501036_0000042_70193_70612 | 137 |
| 994 | 3300049572 | Ga0501036_0009069 | Ga0501036_0009069_998_1420 | 137 |
| 995 | 3300049572 | Ga0501036_0140323 | Ga0501036_0140323_735_1154 | 137 |
| 996 | 3300049572 | Ga0501036_0585066 | Ga0501036_0585066_190_612 | 137 |
| 997 | 3300049573 | Ga0501037_0000100 | Ga0501037_0000100_67029_67448 | 137 |
| 998 | 3300049573 | Ga0501037_0021307 | Ga0501037_0021307_3302_3721 | 137 |
| 999 | 3300049574 | Ga0501038_0000157 | Ga0501038_0000157_45108_45527 | 137 |
| 1000 | 3300049574 | Ga0501038_0007361 | Ga0501038_0007361_6184_6606 | 137 |
| 1001 | 3300049574 | Ga0501038_0039833 | Ga0501038_0039833_71_499 | 137 |
| 1002 | 3300049574 | Ga0501038_0119559 | Ga0501038_0119559_969_1391 | 137 |
| 1003 | 3300049575 | Ga0501039_0000216 | Ga0501039_0000216_3177_3596 | 137 |
| 1004 | 3300049575 | Ga0501039_0060540 | Ga0501039_0060540_525_947 | 137 |
| 1005 | 3300049575 | Ga0501039_0333285 | Ga0501039_0333285_388_807 | 137 |
| 1006 | 3300049575 | Ga0501039_1048704 | Ga0501039_1048704_161_592 | 137 |
| 1007 | 3300049578 | Ga0501042_0044070 | Ga0501042_0044070_1199_1618 | 137 |
| 1008 | 3300049578 | Ga0501042_0083958 | Ga0501042_0083958_1263_1682 | 137 |
| 1009 | 3300049578 | Ga0501042_0341662 | Ga0501042_0341662_342_761 | 137 |
| 1010 | 3300049578 | Ga0501042_0905269 | Ga0501042_0905269_186_605 | 137 |
| 1011 | 3300049579 | Ga0501043_0001316 | Ga0501043_0001316_19670_20089 | 137 |
| 1012 | 3300049579 | Ga0501043_0001633 | Ga0501043_0001633_4622_5041 | 137 |
| 1013 | 3300049579 | Ga0501043_0003155 | Ga0501043_0003155_6644_7066 | 137 |
| 1014 | 3300049579 | Ga0501043_0136348 | Ga0501043_0136348_13_432 | 137 |
| 1015 | 3300049579 | Ga0501043_0168155 | Ga0501043_0168155_965_1384 | 137 |
| 1016 | 3300049579 | Ga0501043_0168463 | Ga0501043_0168463_618_1037 | 137 |
| 1017 | 3300049579 | Ga0501043_0296168 | Ga0501043_0296168_703_1122 | 137 |
| 1018 | 3300049580 | Ga0501046_0000387 | Ga0501046_0000387_36585_37004 | 137 |
| 1019 | 3300049580 | Ga0501046_0000448 | Ga0501046_0000448_17811_18233 | 137 |
| 1020 | 3300049581 | Ga0501047_0000159 | Ga0501047_0000159_11216_11635 | 137 |
| 1021 | 3300049581 | Ga0501047_0000517 | Ga0501047_0000517_25655_26077 | 137 |
| 1022 | 3300049581 | Ga0501047_0000662 | Ga0501047_0000662_5098_5526 | 137 |
| 1023 | 3300049581 | Ga0501047_0002554 | Ga0501047_0002554_1573_1992 | 137 |
| 1024 | 3300049581 | Ga0501047_0161197 | Ga0501047_0161197_681_1100 | 137 |
| 1025 | 3300049581 | Ga0501047_0173014 | Ga0501047_0173014_1183_1614 | 137 |
| 1026 | 3300049581 | Ga0501047_0511003 | Ga0501047_0511003_573_992 | 137 |
| 1027 | 3300049581 | Ga0501047_0619979 | Ga0501047_0619979_429_848 | 137 |
| 1028 | 3300049582 | Ga0501048_0000655 | Ga0501048_0000655_21629_22048 | 137 |
| 1029 | 3300049582 | Ga0501048_0059248 | Ga0501048_0059248_1116_1535 | 137 |
| 1030 | 3300049583 | Ga0501067_0011823 | Ga0501067_0011823_3244_3663 | 137 |
| 1031 | 3300049583 | Ga0501067_0022683 | Ga0501067_0022683_1273_1692 | 137 |
| 1032 | 3300049583 | Ga0501067_0042271 | Ga0501067_0042271_982_1413 | 137 |
| 1033 | 3300049583 | Ga0501067_0069488 | Ga0501067_0069488_1072_1491 | 137 |
| 1034 | 3300049583 | Ga0501067_0085853 | Ga0501067_0085853_269_697 | 137 |
| 1035 | 3300049584 | Ga0501068_0000168 | Ga0501068_0000168_14175_14594 | 137 |
| 1036 | 3300049584 | Ga0501068_0009657 | Ga0501068_0009657_2320_2748 | 137 |
| 1037 | 3300049584 | Ga0501068_0254886 | Ga0501068_0254886_546_968 | 137 |
| 1038 | 3300049584 | Ga0501068_0501064 | Ga0501068_0501064_273_704 | 137 |
| 1039 | 3300049585 | Ga0501069_0001651 | Ga0501069_0001651_7012_7440 | 137 |
| 1040 | 3300049585 | Ga0501069_0002689 | Ga0501069_0002689_4504_4923 | 137 |
| 1041 | 3300049585 | Ga0501069_0025378 | Ga0501069_0025378_1147_1566 | 137 |
| 1042 | 3300049586 | Ga0501070_0002236 | Ga0501070_0002236_2070_2489 | 137 |
| 1043 | 3300049586 | Ga0501070_0089085 | Ga0501070_0089085_1104_1526 | 137 |
| 1044 | 3300049586 | Ga0501070_0173575 | Ga0501070_0173575_620_1048 | 137 |
| 1045 | 3300049586 | Ga0501070_0390018 | Ga0501070_0390018_568_987 | 137 |
| 1046 | 3300049586 | Ga0501070_0436350 | Ga0501070_0436350_136_564 | 137 |
| 1047 | 3300049586 | Ga0501070_0530874 | Ga0501070_0530874_112_531 | 137 |
| 1048 | 3300049586 | Ga0501070_1288770 | Ga0501070_1288770_40_459 | 137 |
| 1049 | 3300049587 | Ga0501071_0391584 | Ga0501071_0391584_390_809 | 137 |
| 1050 | 3300049588 | Ga0501072_0000003 | Ga0501072_0000003_132740_133168 | 137 |
| 1051 | 3300049588 | Ga0501072_0000475 | Ga0501072_0000475_4193_4612 | 137 |
| 1052 | 3300049588 | Ga0501072_0007057 | Ga0501072_0007057_2984_3403 | 137 |
| 1053 | 3300049588 | Ga0501072_0193413 | Ga0501072_0193413_426_845 | 137 |
| 1054 | 3300049589 | Ga0501073_0000678 | Ga0501073_0000678_14232_14651 | 137 |
| 1055 | 3300049589 | Ga0501073_0009782 | Ga0501073_0009782_3112_3540 | 137 |
| 1056 | 3300049589 | Ga0501073_0044288 | Ga0501073_0044288_1873_2292 | 137 |
| 1057 | 3300049589 | Ga0501073_0086560 | Ga0501073_0086560_1346_1765 | 137 |
| 1058 | 3300049589 | Ga0501073_0243568 | Ga0501073_0243568_145_564 | 137 |
| 1059 | 3300049589 | Ga0501073_0496636 | Ga0501073_0496636_260_682 | 137 |
| 1060 | 3300049589 | Ga0501073_0621219 | Ga0501073_0621219_298_714 | 137 |
| 1061 | 3300049590 | Ga0501074_0001904 | Ga0501074_0001904_2024_2443 | 137 |
| 1062 | 3300049590 | Ga0501074_0004788 | Ga0501074_0004788_5104_5523 | 137 |
| 1063 | 3300049590 | Ga0501074_0031818 | Ga0501074_0031818_71_499 | 137 |
| 1064 | 3300049590 | Ga0501074_0451679 | Ga0501074_0451679_320_742 | 137 |
| 1065 | 3300049591 | Ga0501075_0000346 | Ga0501075_0000346_22163_22606 | 137 |
| 1066 | 3300049592 | Ga0501076_0024992 | Ga0501076_0024992_3392_3820 | 137 |
| 1067 | 3300049592 | Ga0501076_0041535 | Ga0501076_0041535_747_1166 | 137 |
| 1068 | 3300049592 | Ga0501076_0711201 | Ga0501076_0711201_139_558 | 137 |
| 1069 | 3300049593 | Ga0501077_0000509 | Ga0501077_0000509_2089_2532 | 137 |
| 1070 | 3300049593 | Ga0501077_0111681 | Ga0501077_0111681_664_1092 | 137 |
| 1071 | 3300049741 | Ga0501079_0006064 | Ga0501079_0006064_3223_3642 | 137 |
| 1072 | 3300049741 | Ga0501079_0013419 | Ga0501079_0013419_5025_5444 | 137 |
| 1073 | 3300049741 | Ga0501079_0047364 | Ga0501079_0047364_790_1218 | 137 |
| 1074 | 3300049742 | Ga0501080_0004449 | Ga0501080_0004449_391_810 | 137 |
| 1075 | 3300049742 | Ga0501080_0039623 | Ga0501080_0039623_3471_3893 | 137 |
| 1076 | 3300049742 | Ga0501080_0047355 | Ga0501080_0047355_1631_2062 | 137 |
| 1077 | 3300049742 | Ga0501080_0053498 | Ga0501080_0053498_3261_3680 | 137 |
| 1078 | 3300049742 | Ga0501080_0072909 | Ga0501080_0072909_1526_1945 | 137 |
| 1079 | 3300049742 | Ga0501080_0163259 | Ga0501080_0163259_1178_1606 | 137 |
| 1080 | 3300049742 | Ga0501080_1418234 | Ga0501080_1418234_133_552 | 137 |
| 1081 | 3300049742 | Ga0501080_1802687 | Ga0501080_1802687_14_433 | 137 |
| 1082 | 3300049744 | Ga0501083_0001555 | Ga0501083_0001555_9523_9942 | 137 |
| 1083 | 3300049744 | Ga0501083_0006723 | Ga0501083_0006723_6672_7091 | 137 |
| 1084 | 3300049744 | Ga0501083_0012456 | Ga0501083_0012456_1749_2180 | 137 |
| 1085 | 3300049744 | Ga0501083_0015606 | Ga0501083_0015606_603_1031 | 137 |
| 1086 | 3300049744 | Ga0501083_0048909 | Ga0501083_0048909_1590_2009 | 137 |
| 1087 | 3300049822 | Ga0501035_0000172 | Ga0501035_0000172_33505_33924 | 137 |
| 1088 | 3300049822 | Ga0501035_0002828 | Ga0501035_0002828_12558_12980 | 137 |
| 1089 | 3300049822 | Ga0501035_0147241 | Ga0501035_0147241_1006_1425 | 137 |
| 1090 | 3300049822 | Ga0501035_0911809 | Ga0501035_0911809_140_559 | 137 |
| 1091 | 3300049823 | Ga0501044_0000282 | Ga0501044_0000282_56400_56819 | 137 |
| 1092 | 3300049823 | Ga0501044_0008603 | Ga0501044_0008603_6688_7110 | 137 |
| 1093 | 3300049823 | Ga0501044_0022656 | Ga0501044_0022656_1506_1934 | 137 |
| 1094 | 3300049823 | Ga0501044_0192181 | Ga0501044_0192181_492_923 | 137 |
| 1095 | 3300049823 | Ga0501044_0256082 | Ga0501044_0256082_886_1305 | 137 |
| 1096 | 3300049823 | Ga0501044_0356408 | Ga0501044_0356408_63_485 | 137 |
| 1097 | 3300049823 | Ga0501044_0434616 | Ga0501044_0434616_138_557 | 137 |
| 1098 | 3300049824 | Ga0501045_0019340 | Ga0501045_0019340_1647_2066 | 137 |
| 1099 | 3300049824 | Ga0501045_0311726 | Ga0501045_0311726_434_853 | 137 |
| 1100 | 3300050489 | nmdc:mga03683_106687_c1 | nmdc:mga03683_106687_c1_100_525 | 137 |
| 1101 | 3300050489 | nmdc:mga03683_478216_c1 | nmdc:mga03683_478216_c1_159_572 | 137 |
| 1102 | 3300050490 | nmdc:mga03n38_73719_c1 | nmdc:mga03n38_73719_c1_118_543 | 137 |
| 1103 | 3300050492 | nmdc:mga0yw44_21119_c1 | nmdc:mga0yw44_21119_c1_443_868 | 137 |
| 1104 | 3300050492 | nmdc:mga0yw44_3171_c1 | nmdc:mga0yw44_3171_c1_1015_1455 | 137 |
| 1105 | 3300050493 | nmdc:mga0k408_102419_c1 | nmdc:mga0k408_102419_c1_58_483 | 137 |
| 1106 | 3300050493 | nmdc:mga0k408_133482_c1 | nmdc:mga0k408_133482_c1_505_918 | 137 |
| 1107 | 3300050493 | nmdc:mga0k408_269530_c1 | nmdc:mga0k408_269530_c1_415_846 | 137 |
| 1108 | 3300050493 | nmdc:mga0k408_312026_c1 | nmdc:mga0k408_312026_c1_298_780 | 137 |
| 1109 | 3300050494 | nmdc:mga06z11_137944_c1 | nmdc:mga06z11_137944_c1_44_469 | 137 |
| 1110 | 3300050494 | nmdc:mga06z11_150671_c1 | nmdc:mga06z11_150671_c1_203_634 | 137 |
| 1111 | 3300050494 | nmdc:mga06z11_155863_c1 | nmdc:mga06z11_155863_c1_258_740 | 137 |
| 1112 | 3300050494 | nmdc:mga06z11_281339_c1 | nmdc:mga06z11_281339_c1_78_500 | 137 |
| 1113 | 3300050495 | nmdc:mga04h51_63377_c1 | nmdc:mga04h51_63377_c1_263_688 | 137 |
| 1114 | 3300050496 | nmdc:mga07m45_8009_c1 | nmdc:mga07m45_8009_c1_149_574 | 137 |
| 1115 | 3300050507 | nmdc:mga05p37_366228_c1 | nmdc:mga05p37_366228_c1_40_468 | 137 |
| 1116 | 3300050508 | nmdc:mga09592_1315941_c1 | nmdc:mga09592_1315941_c1_94_522 | 137 |
| 1117 | 3300050508 | nmdc:mga09592_710664_c1 | nmdc:mga09592_710664_c1_22_447 | 137 |
| 1118 | 3300050509 | nmdc:mga0qj67_74728_c1 | nmdc:mga0qj67_74728_c1_1584_2018 | 137 |
| 1119 | 3300050509 | nmdc:mga0qj67_751281_c1 | nmdc:mga0qj67_751281_c1_101_523 | 137 |
| 1120 | 3300050509 | nmdc:mga0qj67_796210_c1 | nmdc:mga0qj67_796210_c1_282_698 | 137 |
| 1121 | 3300050509 | nmdc:mga0qj67_82208_c1 | nmdc:mga0qj67_82208_c1_1707_2126 | 137 |
| 1122 | 3300050509 | nmdc:mga0qj67_899214_c1 | nmdc:mga0qj67_899214_c1_234_662 | 137 |
| 1123 | 3300050511 | nmdc:mga08y16_3101_c1 | nmdc:mga08y16_3101_c1_9797_10225 | 137 |
| 1124 | 3300050511 | nmdc:mga08y16_788423_c1 | nmdc:mga08y16_788423_c1_213_677 | 137 |
| 1125 | 3300050511 | nmdc:mga08y16_799409_c1 | nmdc:mga08y16_799409_c1_186_614 | 137 |
| 1126 | 3300050512 | nmdc:mga0n895_248667_c1 | nmdc:mga0n895_248667_c1_215_643 | 137 |
| 1127 | 3300050512 | nmdc:mga0n895_526687_c1 | nmdc:mga0n895_526687_c1_551_967 | 137 |
| 1128 | 3300050514 | nmdc:mga08x19_11855_c1 | nmdc:mga08x19_11855_c1_2901_3329 | 137 |
| 1129 | 3300053077 | Ga0495601_0106010 | Ga0495601_0106010_551_967 | 137 |
| 1130 | 3300053078 | Ga0495612_0022244 | Ga0495612_0022244_1094_1510 | 137 |
| 1131 | 3300053084 | Ga0495595_0194461 | Ga0495595_0194461_331_747 | 137 |
| 1132 | 3300053085 | Ga0495619_0405228 | Ga0495619_0405228_510_926 | 137 |
| 1133 | 3300053085 | Ga0495619_0405231 | Ga0495619_0405231_510_926 | 137 |
| 1134 | 3300053090 | Ga0500646_0000925 | Ga0500646_0000925_5424_5837 | 137 |
| 1135 | 3300053092 | Ga0500583_0008247 | Ga0500583_0008247_1713_2126 | 137 |
| 1136 | 3300053093 | Ga0500651_0000005 | Ga0500651_0000005_294222_294650 | 137 |
| 1137 | 3300053093 | Ga0500651_0000299 | Ga0500651_0000299_26837_27259 | 137 |
| 1138 | 3300053098 | Ga0500650_0003454 | Ga0500650_0003454_3147_3560 | 137 |
| 1139 | 3300053104 | Ga0500556_0136229 | Ga0500556_0136229_246_659 | 137 |
| 1140 | 3300053111 | Ga0500572_000533 | Ga0500572_000533_11997_12413 | 137 |
| 1141 | 3300053119 | Ga0500595_023318 | Ga0500595_023318_1251_1679 | 137 |
| 1142 | 3300053133 | Ga0500655_019811 | Ga0500655_019811_282_695 | 137 |
| 1143 | 3300053136 | Ga0500559_0009452 | Ga0500559_0009452_676_1092 | 137 |
| 1144 | 3300053139 | Ga0500568_0290552 | Ga0500568_0290552_99_530 | 137 |
| 1145 | 3300053151 | Ga0500604_0006069 | Ga0500604_0006069_434_847 | 137 |
| 1146 | 3300053154 | Ga0500619_000014 | Ga0500619_000014_46995_47411 | 137 |
| 1147 | 3300053163 | Ga0500639_097955 | Ga0500639_097955_534_950 | 137 |
| 1148 | 3300053178 | Ga0500637_0108892 | Ga0500637_0108892_34_447 | 137 |
| 1149 | 3300053736 | Ga0500599_005642 | Ga0500599_005642_837_1349 | 137 |
| 1150 | 3300054114 | Ga0501084_0000278 | Ga0501084_0000278_27469_27897 | 137 |
| 1151 | 3300054114 | Ga0501084_0023457 | Ga0501084_0023457_3543_3962 | 137 |
| 1152 | 3300054114 | Ga0501084_0152138 | Ga0501084_0152138_1405_1824 | 137 |
| 1153 | 3300054114 | Ga0501084_0360234 | Ga0501084_0360234_287_718 | 137 |
| 1154 | 3300054114 | Ga0501084_1027720 | Ga0501084_1027720_40_459 | 137 |
| 1155 | 3300060353 | Ga0501082_0005465 | Ga0501082_0005465_8551_8970 | 137 |
| 1156 | 3300060353 | Ga0501082_0005775 | Ga0501082_0005775_6197_6625 | 137 |
| 1157 | 3300060353 | Ga0501082_0044917 | Ga0501082_0044917_2292_2723 | 137 |
| 1158 | 3300060353 | Ga0501082_0416753 | Ga0501082_0416753_173_598 | 137 |
| 1159 | 3300060353 | Ga0501082_0950329 | Ga0501082_0950329_216_635 | 137 |
| 1160 | 3300061719 | Ga0466962_0107632 | Ga0466962_0107632_227_640 | 137 |
| 1161 | 3300061734 | Ga0530510_0043557 | Ga0530510_0043557_893_1321 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8378 | 1 | 114 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7712 | 1 | 114 |
| 4fpi-assembly1.cif.gz_E | crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp | 0.7262 | 1 | 120 |
| 3pht-assembly1.cif.gz_B-2 | crystal structure of h74a mutant of helicobacter pylori nikr | 0.7204 | 2 | 112 |
| 3pht-assembly1.cif.gz_A-2 | crystal structure of h74a mutant of helicobacter pylori nikr | 0.7051 | 2 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8378 | 1 | 114 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7712 | 1 | 114 | 3.30.70.1060 |
| 3phtA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.7057 | 2 | 113 | 3.30.70.1150 |
| af_Q60386_31_124_3.30.70.1150 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.7055 | 2 | 112 | 3.30.70.1150 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7045 | 1 | 119 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A225DKA1-F1-model_v4 | PhnB protein | 0.993 | 1 | 134 |
|
| AF-A0A1I4TZG8-F1-model_v4 | Uncharacterized conserved protein | 0.9923 | 1 | 125 |
|
| AF-A0A1Q7RXR3-F1-model_v4 | Transcription initiation protein | 0.9897 | 1 | 127 |
|
| AF-A0A0K1EPB2-F1-model_v4 | Dehydrogenase | 0.9896 | 1 | 125 |
|
| AF-K9U9Q9-F1-model_v4 | YCII-related protein | 0.9894 | 1 | 127 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar