F491016

General Info

Members Datasets Scaffolds Average Seq Length
1161 460 1158 140

Family's Representative Sequence

Representative Sequence 3300053736|Ga0500599_005642|Ga0500599_005642_837_1349
Length 170
Sequence MVFRQSSSRSGSSGAAEEGEKENTIMRFMMLMIPKGYEQSAPGTMPDAKAVAAMMKYNESLQKAGVLLALDGLHPPSMGARVSFSGGKPTVTDGPFTEVKEVLGGYWMIQVKSKEEAIEWASRCPGSDNEVIEIRQVQELADFPADIQAIAEKYPEMQPQARTTSGGSGA

Samples

Sample ID Description Type Environment
1 2643221573 Lysobacter sp. Root604 Isolate Unclassified
2 2643221728 Lysobacter sp. Root983 Isolate Unclassified
3 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
143 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
270 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
271 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
274 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
275 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
387 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
388 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
405 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
406 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
407 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
408 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
412 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
413 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
414 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
422 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
423 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
428 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
431 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
432 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
433 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
434 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
435 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
438 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
439 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
442 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
445 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
446 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
447 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
448 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
449 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
452 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
453 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
454 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
455 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
456 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.52
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0
Rhizoplane 2.76
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001694 3300000546 Bacteria 2982
2 JGI24739J22299_10019000 3300001989 Bacteria 2465
3 JGI24737J22298_10026702 3300001990 Bacteria 1823
4 JGI24735J21928_10006056 3300002067 Bacteria 3996
5 JGI25160J50197_1046072 3300003354 Bacteria 960
6 Ga0065707_10087064 3300005295 Bacteria 5183
7 Ga0065707_10575343 3300005295 Bacteria 705
8 Ga0070658_10081234 3300005327 Bacteria 2662
9 Ga0070676_10459387 3300005328 Bacteria 897
10 Ga0070683_100014532 3300005329 Bacteria 6891
11 Ga0070683_100326919 3300005329 Bacteria 1460
12 Ga0070690_100022915 3300005330 Bacteria 3825
13 Ga0070677_10034532 3300005333 Bacteria 1955
14 Ga0070666_10011547 3300005335 Bacteria 5546
15 Ga0070680_100056302 3300005336 Bacteria 3214
16 Ga0070680_100135952 3300005336 Bacteria 2059
17 Ga0070680_100526542 3300005336 Bacteria 1012
18 Ga0070680_100879287 3300005336 Bacteria 773
19 Ga0070682_100051634 3300005337 Bacteria 2570
20 Ga0070682_100299680 3300005337 Bacteria 1179
21 Ga0070682_100440813 3300005337 Bacteria 995
22 Ga0068868_100439036 3300005338 Bacteria 1133
23 Ga0068868_100663348 3300005338 Bacteria 930
24 Ga0068868_101558113 3300005338 Bacteria 620
25 Ga0070660_100006936 3300005339 Bacteria 7856
26 Ga0070660_100079672 3300005339 Bacteria 2570
27 Ga0070660_100606388 3300005339 Bacteria 916
28 Ga0070660_101179924 3300005339 Bacteria 649
29 Ga0070689_100074231 3300005340 Bacteria 2661
30 Ga0070689_100093389 3300005340 Bacteria 2375
31 Ga0070689_100286455 3300005340 Bacteria 1368
32 Ga0070661_100204512 3300005344 Bacteria 1510
33 Ga0070668_100138606 3300005347 Bacteria 1959
34 Ga0070668_100380698 3300005347 Bacteria 1201
35 Ga0070668_100616941 3300005347 Bacteria 950
36 Ga0070669_100537399 3300005353 Bacteria 973
37 Ga0070675_100084124 3300005354 Bacteria 2657
38 Ga0070675_100086621 3300005354 Bacteria 2618
39 Ga0070675_100970290 3300005354 Bacteria 780
40 Ga0070671_100014275 3300005355 Bacteria 6413
41 Ga0070671_100905581 3300005355 Bacteria 771
42 Ga0070674_100430873 3300005356 Bacteria 1084
43 Ga0070673_100021234 3300005364 Bacteria 4701
44 Ga0070673_100082825 3300005364 Bacteria 2605
45 Ga0070673_100092788 3300005364 Bacteria 2471
46 Ga0070673_101414275 3300005364 Bacteria 655
47 Ga0070673_101490652 3300005364 Bacteria 638
48 Ga0070688_100006642 3300005365 Bacteria 6197
49 Ga0070688_100137146 3300005365 Bacteria 1658
50 Ga0070688_100346586 3300005365 Bacteria 1086
51 Ga0070688_100626785 3300005365 Bacteria 826
52 Ga0070659_100028575 3300005366 Bacteria 4308
53 Ga0070659_101526033 3300005366 Bacteria 596
54 Ga0070667_100013597 3300005367 Bacteria 6725
55 Ga0070667_100119570 3300005367 Bacteria 2291
56 Ga0070703_10159295 3300005406 Bacteria 855
57 Ga0070709_10047283 3300005434 Bacteria 2680
58 Ga0070709_11167343 3300005434 Bacteria 618
59 Ga0070714_100065164 3300005435 Bacteria 3138
60 Ga0070714_100230448 3300005435 Bacteria 1706
61 Ga0070714_100844896 3300005435 Bacteria 888
62 Ga0070713_100016796 3300005436 Bacteria 5512
63 Ga0070713_100077999 3300005436 Bacteria 2819
64 Ga0070713_100619879 3300005436 Bacteria 1029
65 Ga0070710_10883365 3300005437 Bacteria 644
66 Ga0070701_10768998 3300005438 Bacteria 654
67 Ga0070711_100076147 3300005439 Bacteria 2378
68 Ga0070711_100240552 3300005439 Bacteria 1415
69 Ga0070711_100468072 3300005439 Bacteria 1034
70 Ga0070705_100064876 3300005440 Bacteria 2184
71 Ga0070705_100083029 3300005440 Bacteria 1973
72 Ga0070705_100715728 3300005440 Bacteria 788
73 Ga0070705_100865791 3300005440 Bacteria 724
74 Ga0070694_100249952 3300005444 Bacteria 1341
75 Ga0070694_100354882 3300005444 Bacteria 1137
76 Ga0070694_100480046 3300005444 Bacteria 986
77 Ga0070694_101154765 3300005444 Bacteria 648
78 Ga0070708_100496865 3300005445 Bacteria 1151
79 Ga0070708_100530987 3300005445 Bacteria 1110
80 Ga0070708_100765806 3300005445 Bacteria 908
81 Ga0070663_100034280 3300005455 Bacteria 3515
82 Ga0070678_100638025 3300005456 Bacteria 954
83 Ga0070662_101122274 3300005457 Bacteria 675
84 Ga0070681_10001821 3300005458 Bacteria 19202
85 Ga0070681_10017662 3300005458 Bacteria 7129
86 Ga0070681_10021112 3300005458 Bacteria 6524
87 Ga0070681_10039710 3300005458 Bacteria 4716
88 Ga0070681_10066337 3300005458 Bacteria 3578
89 Ga0070681_10138993 3300005458 Bacteria 2359
90 Ga0070681_10850242 3300005458 Bacteria 830
91 Ga0070681_11512293 3300005458 Bacteria 596
92 Ga0068867_100136666 3300005459 Bacteria 1911
93 Ga0068867_100141508 3300005459 Bacteria 1881
94 Ga0068867_100196068 3300005459 Bacteria 1614
95 Ga0070707_100854486 3300005468 Bacteria 874
96 Ga0070707_101631829 3300005468 Bacteria 612
97 Ga0070698_100013880 3300005471 Bacteria 8520
98 Ga0070698_100176063 3300005471 Bacteria 2078
99 Ga0070698_100429553 3300005471 Bacteria 1256
100 Ga0070698_100933693 3300005471 Bacteria 814
101 Ga0070699_100000756 3300005518 Bacteria 29876
102 Ga0070699_100008827 3300005518 Bacteria 8727
103 Ga0070699_100278110 3300005518 Bacteria 1499
104 Ga0070699_100395736 3300005518 Bacteria 1249
105 Ga0070699_100480935 3300005518 Bacteria 1127
106 Ga0070699_100620095 3300005518 Bacteria 987
107 Ga0070679_100027556 3300005530 Bacteria 5593
108 Ga0070679_100194069 3300005530 Bacteria 1998
109 Ga0070679_100235244 3300005530 Bacteria 1791
110 Ga0070679_100356404 3300005530 Bacteria 1410
111 Ga0070684_100001913 3300005535 Bacteria 15266
112 Ga0070684_100078687 3300005535 Bacteria 2913
113 Ga0070684_101460439 3300005535 Bacteria 644
114 Ga0070684_102150412 3300005535 Bacteria 527
115 Ga0070697_100346871 3300005536 Bacteria 1282
116 Ga0070697_100568418 3300005536 Bacteria 995
117 Ga0068853_100003590 3300005539 Bacteria 11880
118 Ga0068853_100095948 3300005539 Bacteria 2616
119 Ga0068853_100146863 3300005539 Bacteria 2120
120 Ga0068853_100523009 3300005539 Bacteria 1122
121 Ga0070672_100021117 3300005543 Bacteria 4761
122 Ga0070672_100022820 3300005543 Bacteria 4603
123 Ga0070672_100138629 3300005543 Bacteria 2005
124 Ga0070672_100350342 3300005543 Bacteria 1259
125 Ga0070672_101746040 3300005543 Unclassified 559
126 Ga0070686_100094766 3300005544 Bacteria 2004
127 Ga0070695_100174256 3300005545 Bacteria 1520
128 Ga0070695_100179658 3300005545 Bacteria 1499
129 Ga0070695_100353799 3300005545 Bacteria 1101
130 Ga0070696_100003969 3300005546 Bacteria 9870
131 Ga0070696_100035553 3300005546 Bacteria 3431
132 Ga0070696_100210891 3300005546 Bacteria 1454
133 Ga0070696_100671626 3300005546 Bacteria 842
134 Ga0070696_100986611 3300005546 Bacteria 703
135 Ga0070693_100757297 3300005547 Bacteria 716
136 Ga0070665_100000472 3300005548 Bacteria 58087
137 Ga0070665_100001250 3300005548 Bacteria 30697
138 Ga0070665_100148555 3300005548 Bacteria 2346
139 Ga0070665_100175362 3300005548 Bacteria 2144
140 Ga0070665_100289883 3300005548 Bacteria 1639
141 Ga0070665_100542734 3300005548 Bacteria 1175
142 Ga0070665_100571624 3300005548 Bacteria 1143
143 Ga0070665_100579380 3300005548 Bacteria 1135
144 Ga0070665_100629658 3300005548 Bacteria 1086
145 Ga0070665_100956055 3300005548 Bacteria 869
146 Ga0070665_101475643 3300005548 Bacteria 689
147 Ga0070665_102506467 3300005548 Bacteria 517
148 Ga0070704_100283865 3300005549 Bacteria 1373
149 Ga0070704_100293290 3300005549 Bacteria 1352
150 Ga0068855_100211256 3300005563 Bacteria 2180
151 Ga0068855_100366352 3300005563 Bacteria 1585
152 Ga0068855_100460714 3300005563 Bacteria 1386
153 Ga0068855_100865936 3300005563 Bacteria 956
154 Ga0070664_100329660 3300005564 Bacteria 1384
155 Ga0070664_100763180 3300005564 Bacteria 903
156 Ga0070664_100845185 3300005564 Bacteria 857
157 Ga0068857_100034685 3300005577 Bacteria 4462
158 Ga0068857_100046709 3300005577 Bacteria 3843
159 Ga0068857_100061523 3300005577 Bacteria 3336
160 Ga0068854_100000738 3300005578 Bacteria 19378
161 Ga0068854_101139866 3300005578 Bacteria 696
162 Ga0068856_100052369 3300005614 Bacteria 4025
163 Ga0068856_100257540 3300005614 Bacteria 1760
164 Ga0068856_101925927 3300005614 Bacteria 602
165 Ga0070702_100001060 3300005615 Bacteria 10966
166 Ga0070702_100534428 3300005615 Bacteria 867
167 Ga0068852_100351640 3300005616 Bacteria 1439
168 Ga0068859_100066701 3300005617 Bacteria 3634
169 Ga0068859_100403632 3300005617 Bacteria 1463
170 Ga0068859_100534772 3300005617 Bacteria 1267
171 Ga0068859_100538753 3300005617 Bacteria 1262
172 Ga0068859_100818545 3300005617 Bacteria 1018
173 Ga0068864_100039880 3300005618 Bacteria 4014
174 Ga0068864_100097308 3300005618 Bacteria 2605
175 Ga0068864_100486535 3300005618 Bacteria 1185
176 Ga0068864_100642702 3300005618 Bacteria 1032
177 Ga0068866_10514857 3300005718 Bacteria 794
178 Ga0068861_100097989 3300005719 Bacteria 2327
179 Ga0068861_101069962 3300005719 Bacteria 774
180 Ga0068870_10026613 3300005840 Bacteria 2885
181 Ga0068870_11376633 3300005840 Bacteria 516
182 Ga0068863_100028857 3300005841 Bacteria 5298
183 Ga0068863_100066187 3300005841 Bacteria 3418
184 Ga0068863_100265640 3300005841 Bacteria 1660
185 Ga0068863_100448543 3300005841 Bacteria 1266
186 Ga0068863_102407628 3300005841 Bacteria 536
187 Ga0068863_102469689 3300005841 Bacteria 529
188 Ga0068858_100037359 3300005842 Bacteria 4504
189 Ga0068858_100089336 3300005842 Bacteria 2867
190 Ga0068858_100405422 3300005842 Bacteria 1310
191 Ga0068858_100736569 3300005842 Bacteria 960
192 Ga0068858_101979493 3300005842 Bacteria 576
193 Ga0068860_100048607 3300005843 Bacteria 4043
194 Ga0068860_100113101 3300005843 Bacteria 2595
195 Ga0068860_100676303 3300005843 Bacteria 1041
196 Ga0068862_100891676 3300005844 Bacteria 874
197 Ga0081455_10182342 3300005937 Bacteria 1588
198 Ga0070717_11102651 3300006028 Bacteria 723
199 Ga0075365_10005044 3300006038 Bacteria 7082
200 Ga0075365_10032431 3300006038 Bacteria 3358
201 Ga0075365_10464713 3300006038 Bacteria 894
202 Ga0075365_10520135 3300006038 Bacteria 841
203 Ga0075368_10001652 3300006042 Bacteria 7157
204 Ga0075363_100020335 3300006048 Bacteria 3328
205 Ga0075363_100021961 3300006048 Bacteria 3222
206 Ga0075364_10050476 3300006051 Bacteria 2715
207 Ga0070715_10789991 3300006163 Bacteria 575
208 Ga0075362_10562147 3300006177 Bacteria 587
209 Ga0075367_10012711 3300006178 Bacteria 4502
210 Ga0075367_10033438 3300006178 Bacteria 2963
211 Ga0075367_10861693 3300006178 Bacteria 577
212 Ga0075369_10022838 3300006186 Bacteria 2583
213 Ga0075366_10009517 3300006195 Bacteria 5425
214 Ga0075366_10044419 3300006195 Bacteria 2633
215 Ga0075366_10071689 3300006195 Bacteria 2064
216 Ga0075366_10212787 3300006195 Bacteria 1177
217 Ga0075366_10219408 3300006195 Bacteria 1158
218 Ga0097621_100052360 3300006237 Bacteria 3326
219 Ga0097621_100106910 3300006237 Bacteria 2361
220 Ga0097621_100197454 3300006237 Bacteria 1745
221 Ga0097621_101457386 3300006237 Bacteria 649
222 Ga0097621_101720706 3300006237 Bacteria 597
223 Ga0097621_102214406 3300006237 Bacteria 526
224 Ga0075370_10007354 3300006353 Bacteria 5605
225 Ga0075370_10052249 3300006353 Bacteria 2318
226 Ga0068871_100069385 3300006358 Bacteria 2894
227 Ga0068871_100276616 3300006358 Bacteria 1467
228 Ga0075428_100011868 3300006844 Bacteria 9690
229 Ga0075428_100157992 3300006844 Bacteria 2461
230 Ga0075428_100560944 3300006844 Bacteria 1221
231 Ga0075428_100564736 3300006844 Bacteria 1216
232 Ga0075430_100091478 3300006846 Bacteria 2544
233 Ga0075430_100184282 3300006846 Bacteria 1736
234 Ga0075430_100216580 3300006846 Bacteria 1589
235 Ga0075430_100383311 3300006846 Bacteria 1160
236 Ga0075430_100557577 3300006846 Bacteria 945
237 Ga0075431_100031779 3300006847 Bacteria 5438
238 Ga0075431_100587205 3300006847 Bacteria 1099
239 Ga0075431_100831958 3300006847 Bacteria 895
240 Ga0075431_101931563 3300006847 Bacteria 546
241 Ga0075433_10520957 3300006852 Bacteria 1046
242 Ga0075434_100670316 3300006871 Bacteria 1055
243 Ga0075429_100003374 3300006880 Bacteria 13618
244 Ga0075429_100115648 3300006880 Bacteria 2345
245 Ga0075429_100496951 3300006880 Bacteria 1069
246 Ga0068865_100189215 3300006881 Bacteria 1590
247 Ga0068865_100791942 3300006881 Bacteria 817
248 Ga0075436_100180074 3300006914 Bacteria 1493
249 Ga0075436_100190447 3300006914 Bacteria 1451
250 Ga0097620_100066701 3300006931 Bacteria 3634
251 Ga0097620_100403628 3300006931 Bacteria 1463
252 Ga0097620_100534787 3300006931 Bacteria 1267
253 Ga0097620_100538650 3300006931 Bacteria 1262
254 Ga0097620_100818687 3300006931 Bacteria 1018
255 Ga0075435_100230454 3300007076 Bacteria 1574
256 Ga0075435_100558190 3300007076 Bacteria 992
257 Ga0075435_101797919 3300007076 Bacteria 538
258 Ga0099794_10004791 3300007265 Bacteria 5367
259 Ga0099794_10108908 3300007265 Bacteria 1387
260 Ga0099794_10187155 3300007265 Bacteria 1058
261 Ga0099794_10322534 3300007265 Bacteria 801
262 Ga0099795_10164169 3300007788 Bacteria 919
263 Ga0099795_10421334 3300007788 Bacteria 610
264 Ga0105251_10001178 3300009011 Bacteria 22690
265 Ga0105250_10086139 3300009092 Bacteria 1275
266 Ga0105240_10003289 3300009093 Bacteria 25278
267 Ga0105240_10010109 3300009093 Bacteria 13278
268 Ga0105240_10150608 3300009093 Bacteria 2771
269 Ga0105240_10251676 3300009093 Bacteria 2043
270 Ga0105240_10558181 3300009093 Bacteria 1266
271 Ga0105240_10609204 3300009093 Bacteria 1201
272 Ga0105240_11252382 3300009093 Bacteria 784
273 Ga0111539_10000077 3300009094 Bacteria 98027
274 Ga0111539_10003306 3300009094 Bacteria 21295
275 Ga0111539_10021894 3300009094 Bacteria 7859
276 Ga0111539_11173545 3300009094 Bacteria 892
277 Ga0111539_11240637 3300009094 Bacteria 866
278 Ga0111539_11797714 3300009094 Bacteria 711
279 Ga0105245_10199591 3300009098 Bacteria 1920
280 Ga0105245_11160707 3300009098 Bacteria 820
281 Ga0105247_10657978 3300009101 Bacteria 783
282 Ga0105247_10948890 3300009101 Bacteria 668
283 Ga0114129_10007794 3300009147 Bacteria 15234
284 Ga0114129_10008984 3300009147 Bacteria 14252
285 Ga0114129_10118916 3300009147 Bacteria 3640
286 Ga0114129_12831810 3300009147 Bacteria 576
287 Ga0105243_10197677 3300009148 Bacteria 1761
288 Ga0105241_10335901 3300009174 Bacteria 1307
289 Ga0105241_10402256 3300009174 Bacteria 1201
290 Ga0105242_10006977 3300009176 Bacteria 8717
291 Ga0105242_10485534 3300009176 Bacteria 1172
292 Ga0105242_11779335 3300009176 Bacteria 654
293 Ga0105248_10046020 3300009177 Bacteria 4891
294 Ga0105248_10047231 3300009177 Bacteria 4828
295 Ga0105248_10053383 3300009177 Bacteria 4536
296 Ga0105248_11142571 3300009177 Bacteria 880
297 Ga0105248_11825797 3300009177 Bacteria 689
298 Ga0105237_10026579 3300009545 Bacteria 5916
299 Ga0105237_10276157 3300009545 Bacteria 1683
300 Ga0105237_10306741 3300009545 Bacteria 1590
301 Ga0105237_10650425 3300009545 Bacteria 1061
302 Ga0105237_10721395 3300009545 Bacteria 1003
303 Ga0105237_11907759 3300009545 Bacteria 602
304 Ga0105238_10001743 3300009551 Bacteria 21842
305 Ga0105238_10012194 3300009551 Bacteria 8664
306 Ga0105238_10018637 3300009551 Bacteria 7067
307 Ga0105238_10023731 3300009551 Bacteria 6251
308 Ga0105238_10544751 3300009551 Bacteria 1164
309 Ga0105238_10940318 3300009551 Bacteria 884
310 Ga0105238_11754103 3300009551 Bacteria 652
311 Ga0105249_10118923 3300009553 Bacteria 2509
312 Ga0105249_13323060 3300009553 Bacteria 517
313 Ga0099796_10356104 3300010159 Bacteria 632
314 Ga0105239_10232066 3300010375 Bacteria 2070
315 Ga0105239_11608684 3300010375 Bacteria 751
316 Ga0105239_12096390 3300010375 Bacteria 657
317 Ga0105246_10199278 3300011119 Bacteria 1555
318 Ga0105246_10523385 3300011119 Bacteria 1011
319 Ga0105246_11773288 3300011119 Bacteria 589
320 Ga0157371_10164182 3300013102 Bacteria 1586
321 Ga0157370_10853125 3300013104 Bacteria 828
322 Ga0157370_10884638 3300013104 Bacteria 811
323 Ga0157369_10020019 3300013105 Bacteria 7484
324 Ga0157369_10086636 3300013105 Bacteria 3345
325 Ga0157369_10285994 3300013105 Bacteria 1717
326 Ga0157369_10693705 3300013105 Bacteria 1049
327 Ga0157369_10730943 3300013105 Bacteria 1019
328 Ga0157374_10023456 3300013296 Bacteria 5519
329 Ga0157374_10438900 3300013296 Bacteria 1306
330 Ga0157374_10565413 3300013296 Bacteria 1145
331 Ga0157374_11087640 3300013296 Bacteria 820
332 Ga0157378_10227301 3300013297 Bacteria 1776
333 Ga0157378_11243708 3300013297 Bacteria 785
334 Ga0157378_11255824 3300013297 Bacteria 781
335 Ga0163162_10001419 3300013306 Bacteria 22265
336 Ga0163162_10018269 3300013306 Bacteria 6868
337 Ga0163162_10226937 3300013306 Bacteria 1997
338 Ga0163162_10306837 3300013306 Bacteria 1719
339 Ga0163162_10474129 3300013306 Bacteria 1383
340 Ga0163162_10640982 3300013306 Bacteria 1187
341 Ga0163162_12986097 3300013306 Bacteria 544
342 Ga0157372_10693317 3300013307 Bacteria 1185
343 Ga0157372_11655181 3300013307 Bacteria 737
344 Ga0157375_10017976 3300013308 Bacteria 6401
345 Ga0157375_10091058 3300013308 Bacteria 3110
346 Ga0157375_10117523 3300013308 Bacteria 2765
347 Ga0157375_10277014 3300013308 Bacteria 1840
348 Ga0157375_10341682 3300013308 Bacteria 1662
349 Ga0163163_10001175 3300014325 Bacteria 22194
350 Ga0163163_10034053 3300014325 Bacteria 4931
351 Ga0163163_10061204 3300014325 Bacteria 3730
352 Ga0163163_10164600 3300014325 Bacteria 2263
353 Ga0163163_10574153 3300014325 Bacteria 1191
354 Ga0163163_11603745 3300014325 Bacteria 712
355 Ga0163163_11720362 3300014325 Bacteria 688
356 Ga0157380_10003757 3300014326 Bacteria 10442
357 Ga0157380_10050020 3300014326 Bacteria 3299
358 Ga0157380_10055292 3300014326 Bacteria 3152
359 Ga0157380_10096266 3300014326 Bacteria 2454
360 Ga0157380_10428354 3300014326 Bacteria 1264
361 Ga0157380_10474033 3300014326 Bacteria 1209
362 Ga0157380_10619663 3300014326 Bacteria 1074
363 Ga0157380_10631083 3300014326 Bacteria 1065
364 Ga0157380_11508418 3300014326 Bacteria 725
365 Ga0157380_11905634 3300014326 Bacteria 655
366 Ga0157377_10058956 3300014745 Bacteria 2186
367 Ga0157377_10488276 3300014745 Unclassified 858
368 Ga0157379_10055424 3300014968 Bacteria 3542
369 Ga0157379_10186132 3300014968 Unclassified 1876
370 Ga0157379_10240962 3300014968 Bacteria 1640
371 Ga0157376_10012730 3300014969 Bacteria 6255
372 Ga0157376_10022851 3300014969 Bacteria 4883
373 Ga0157376_10039680 3300014969 Bacteria 3842
374 Ga0157376_10095961 3300014969 Bacteria 2580
375 Ga0157376_10276599 3300014969 Bacteria 1579
376 Ga0157376_10834667 3300014969 Bacteria 936
377 Ga0157376_12421888 3300014969 Bacteria 564
378 Ga0182005_1190655 3300015265 Bacteria 612
379 Ga0163161_10491754 3300017792 Bacteria 998
380 Ga0163161_11865395 3300017792 Bacteria 535
381 Ga0163161_11893057 3300017792 Bacteria 531
382 Ga0206356_10603777 3300020070 Bacteria 1039
383 Ga0206355_1350711 3300020076 Bacteria 561
384 Ga0206350_11423293 3300020080 Bacteria 2324
385 Ga0213873_10001286 3300021358 Bacteria 4127
386 Ga0213873_10119193 3300021358 Bacteria 773
387 Ga0213872_10000410 3300021361 Bacteria 35191
388 Ga0213872_10227148 3300021361 Bacteria 793
389 Ga0213876_10001491 3300021384 Bacteria 14550
390 Ga0213875_10053858 3300021388 Bacteria 1884
391 Ga0224712_10057505 3300022467 Bacteria 1537
392 Ga0224712_10368195 3300022467 Bacteria 681
393 Ga0224712_10589097 3300022467 Bacteria 542
394 Ga0224569_101138 3300022732 Bacteria 2256
395 Ga0224571_100306 3300022734 Bacteria 2538
396 Ga0224572_1089281 3300024225 Bacteria 569
397 Ga0228598_1013328 3300024227 Bacteria 1628
398 Ga0207426_1003370 3300025302 Bacteria 8772
399 Ga0207653_10069419 3300025885 Bacteria 1202
400 Ga0207682_10034274 3300025893 Bacteria 2046
401 Ga0207682_10079387 3300025893 Bacteria 1403
402 Ga0207642_10337504 3300025899 Bacteria 885
403 Ga0207710_10010195 3300025900 Bacteria 3953
404 Ga0207688_10243153 3300025901 Bacteria 1089
405 Ga0207680_10008344 3300025903 Bacteria 5079
406 Ga0207680_10164256 3300025903 Bacteria 1491
407 Ga0207647_10053824 3300025904 Bacteria 2478
408 Ga0207647_10329459 3300025904 Bacteria 866
409 Ga0207699_10020124 3300025906 Bacteria 3571
410 Ga0207699_10072594 3300025906 Bacteria 2108
411 Ga0207699_10968332 3300025906 Bacteria 629
412 Ga0207645_10050255 3300025907 Bacteria 2662
413 Ga0207643_10396497 3300025908 Bacteria 872
414 Ga0207705_10084861 3300025909 Bacteria 2313
415 Ga0207705_10154448 3300025909 Bacteria 1721
416 Ga0207684_10140711 3300025910 Bacteria 2074
417 Ga0207684_11116058 3300025910 Bacteria 656
418 Ga0207684_11727026 3300025910 Bacteria 504
419 Ga0207654_10138583 3300025911 Bacteria 1549
420 Ga0207654_11380980 3300025911 Bacteria 514
421 Ga0207707_10001016 3300025912 Bacteria 26912
422 Ga0207707_10021849 3300025912 Bacteria 5592
423 Ga0207707_10074899 3300025912 Bacteria 2953
424 Ga0207707_10499899 3300025912 Bacteria 1037
425 Ga0207707_11184262 3300025912 Bacteria 619
426 Ga0207695_10043515 3300025913 Bacteria 4785
427 Ga0207695_10067471 3300025913 Bacteria 3669
428 Ga0207695_10075299 3300025913 Bacteria 3435
429 Ga0207695_10356085 3300025913 Bacteria 1350
430 Ga0207695_10419478 3300025913 Bacteria 1222
431 Ga0207671_10000278 3300025914 Bacteria 76457
432 Ga0207671_10031884 3300025914 Bacteria 3924
433 Ga0207671_10034743 3300025914 Bacteria 3745
434 Ga0207671_11099040 3300025914 Bacteria 625
435 Ga0207693_10506859 3300025915 Bacteria 942
436 Ga0207693_10568868 3300025915 Bacteria 883
437 Ga0207693_10826340 3300025915 Bacteria 713
438 Ga0207663_10660754 3300025916 Bacteria 825
439 Ga0207663_10963947 3300025916 Bacteria 683
440 Ga0207660_10000924 3300025917 Bacteria 19378
441 Ga0207660_10227525 3300025917 Bacteria 1465
442 Ga0207660_11272732 3300025917 Bacteria 598
443 Ga0207657_10001391 3300025919 Bacteria 25799
444 Ga0207657_10070294 3300025919 Bacteria 2968
445 Ga0207657_10340465 3300025919 Bacteria 1184
446 Ga0207652_10003893 3300025921 Bacteria 12209
447 Ga0207652_10147705 3300025921 Bacteria 2104
448 Ga0207652_10201676 3300025921 Bacteria 1790
449 Ga0207652_10798153 3300025921 Bacteria 838
450 Ga0207652_11295060 3300025921 Bacteria 631
451 Ga0207646_10774558 3300025922 Bacteria 855
452 Ga0207646_11157247 3300025922 Bacteria 679
453 Ga0207694_10009430 3300025924 Bacteria 7358
454 Ga0207694_10013532 3300025924 Bacteria 6147
455 Ga0207694_10030192 3300025924 Bacteria 4139
456 Ga0207694_10143281 3300025924 Bacteria 1922
457 Ga0207694_10249457 3300025924 Bacteria 1452
458 Ga0207694_10574736 3300025924 Bacteria 947
459 Ga0207694_10633808 3300025924 Bacteria 900
460 Ga0207694_10949253 3300025924 Bacteria 727
461 Ga0207650_10038847 3300025925 Bacteria 3478
462 Ga0207650_10181560 3300025925 Bacteria 1677
463 Ga0207650_10206935 3300025925 Bacteria 1574
464 Ga0207650_10481726 3300025925 Bacteria 1035
465 Ga0207650_10655671 3300025925 Bacteria 885
466 Ga0207659_10057006 3300025926 Bacteria 2799
467 Ga0207659_10102224 3300025926 Bacteria 2163
468 Ga0207659_10110349 3300025926 Bacteria 2090
469 Ga0207659_10379219 3300025926 Bacteria 1179
470 Ga0207687_10005541 3300025927 Bacteria 8347
471 Ga0207687_10049830 3300025927 Bacteria 2913
472 Ga0207687_10356207 3300025927 Bacteria 1193
473 Ga0207700_10036339 3300025928 Bacteria 3556
474 Ga0207700_10365144 3300025928 Unclassified 1259
475 Ga0207664_10776520 3300025929 Bacteria 862
476 Ga0207644_10006671 3300025931 Bacteria 7523
477 Ga0207690_10164702 3300025932 Bacteria 1656
478 Ga0207690_10680536 3300025932 Bacteria 845
479 Ga0207706_10179825 3300025933 Bacteria 1857
480 Ga0207706_10437078 3300025933 Bacteria 1133
481 Ga0207706_10988563 3300025933 Bacteria 707
482 Ga0207686_10089059 3300025934 Bacteria 2033
483 Ga0207686_10161618 3300025934 Bacteria 1570
484 Ga0207670_10008916 3300025936 Bacteria 5689
485 Ga0207670_10126979 3300025936 Bacteria 1862
486 Ga0207670_10140794 3300025936 Bacteria 1779
487 Ga0207669_10001908 3300025937 Bacteria 8846
488 Ga0207704_10940631 3300025938 Bacteria 728
489 Ga0207704_11377986 3300025938 Bacteria 604
490 Ga0207665_10091265 3300025939 Bacteria 2112
491 Ga0207691_10014131 3300025940 Bacteria 7616
492 Ga0207691_10051753 3300025940 Bacteria 3753
493 Ga0207691_10260613 3300025940 Bacteria 1495
494 Ga0207691_10409061 3300025940 Bacteria 1157
495 Ga0207711_10058789 3300025941 Bacteria 3310
496 Ga0207711_10085535 3300025941 Bacteria 2763
497 Ga0207711_10097152 3300025941 Bacteria 2601
498 Ga0207711_10110236 3300025941 Bacteria 2447
499 Ga0207711_10140536 3300025941 Bacteria 2172
500 Ga0207711_10156220 3300025941 Bacteria 2062
501 Ga0207689_10272279 3300025942 Bacteria 1402
502 Ga0207661_10000421 3300025944 Bacteria 27342
503 Ga0207661_10122912 3300025944 Bacteria 2213
504 Ga0207661_10939226 3300025944 Bacteria 797
505 Ga0207661_11177703 3300025944 Bacteria 705
506 Ga0207679_10471259 3300025945 Bacteria 1116
507 Ga0207679_10683442 3300025945 Bacteria 930
508 Ga0207679_10898183 3300025945 Bacteria 810
509 Ga0207667_10011614 3300025949 Bacteria 10225
510 Ga0207667_10116617 3300025949 Bacteria 2752
511 Ga0207667_10169338 3300025949 Bacteria 2245
512 Ga0207667_10320269 3300025949 Bacteria 1584
513 Ga0207667_10952451 3300025949 Bacteria 848
514 Ga0207651_10112117 3300025960 Bacteria 2050
515 Ga0207651_10146645 3300025960 Bacteria 1831
516 Ga0207651_10632119 3300025960 Bacteria 938
517 Ga0207712_11248941 3300025961 Bacteria 663
518 Ga0207668_10994622 3300025972 Bacteria 749
519 Ga0207668_11249376 3300025972 Bacteria 668
520 Ga0207668_12014458 3300025972 Bacteria 520
521 Ga0207640_10737658 3300025981 Bacteria 848
522 Ga0207658_10021461 3300025986 Bacteria 4484
523 Ga0207658_10055159 3300025986 Bacteria 2944
524 Ga0207658_10156750 3300025986 Bacteria 1862
525 Ga0207658_10399430 3300025986 Bacteria 1208
526 Ga0207658_11179460 3300025986 Bacteria 700
527 Ga0207677_10656406 3300026023 Bacteria 926
528 Ga0207677_10814953 3300026023 Bacteria 836
529 Ga0207703_10004120 3300026035 Bacteria 12003
530 Ga0207703_10310417 3300026035 Bacteria 1441
531 Ga0207703_11229680 3300026035 Bacteria 720
532 Ga0207703_12287443 3300026035 Bacteria 516
533 Ga0207639_10246814 3300026041 Bacteria 1555
534 Ga0207639_10756008 3300026041 Bacteria 904
535 Ga0207678_10031631 3300026067 Bacteria 4615
536 Ga0207678_10253431 3300026067 Bacteria 1508
537 Ga0207678_11335151 3300026067 Bacteria 634
538 Ga0207708_10054534 3300026075 Bacteria 3048
539 Ga0207708_10177217 3300026075 Bacteria 1691
540 Ga0207708_10390124 3300026075 Bacteria 1149
541 Ga0207702_10317238 3300026078 Bacteria 1483
542 Ga0207702_10377290 3300026078 Bacteria 1363
543 Ga0207702_10985232 3300026078 Bacteria 836
544 Ga0207641_10015592 3300026088 Bacteria 6228
545 Ga0207641_10834384 3300026088 Bacteria 913
546 Ga0207648_10050207 3300026089 Bacteria 3648
547 Ga0207648_10268012 3300026089 Bacteria 1525
548 Ga0207648_10327339 3300026089 Bacteria 1378
549 Ga0207648_10453217 3300026089 Bacteria 1168
550 Ga0207676_10085302 3300026095 Bacteria 2577
551 Ga0207676_10096720 3300026095 Bacteria 2438
552 Ga0207676_10111922 3300026095 Bacteria 2286
553 Ga0207676_10127786 3300026095 Bacteria 2156
554 Ga0207676_10445685 3300026095 Bacteria 1219
555 Ga0207676_10519004 3300026095 Bacteria 1134
556 Ga0207676_10843971 3300026095 Bacteria 896
557 Ga0207674_10012767 3300026116 Bacteria 9383
558 Ga0207674_10077186 3300026116 Bacteria 3337
559 Ga0207675_101293395 3300026118 Bacteria 750
560 Ga0207683_10026846 3300026121 Bacteria 4974
561 Ga0207683_10249194 3300026121 Bacteria 1621
562 Ga0207698_10159960 3300026142 Bacteria 1968
563 Ga0207698_10630498 3300026142 Bacteria 1060
564 Ga0209588_1000591 3300027671 Bacteria 9230
565 Ga0209588_1012966 3300027671 Bacteria 2537
566 Ga0209813_10044519 3300027866 Bacteria 1364
567 Ga0207428_10013101 3300027907 Bacteria 7260
568 Ga0207428_10130579 3300027907 Bacteria 1922
569 Ga0207428_10672915 3300027907 Bacteria 742
570 Ga0268266_10000556 3300028379 Bacteria 52036
571 Ga0268266_10039341 3300028379 Bacteria 4027
572 Ga0268266_10048311 3300028379 Bacteria 3647
573 Ga0268266_10126210 3300028379 Bacteria 2284
574 Ga0268266_10326531 3300028379 Bacteria 1437
575 Ga0268266_10397223 3300028379 Bacteria 1303
576 Ga0268266_10467159 3300028379 Bacteria 1201
577 Ga0268266_10940450 3300028379 Bacteria 836
578 Ga0268265_10012154 3300028380 Bacteria 5831
579 Ga0268264_10189353 3300028381 Bacteria 1874
580 Ga0268264_10223039 3300028381 Bacteria 1736
581 Ga0268264_10420862 3300028381 Bacteria 1288
582 Ga0268264_10793565 3300028381 Bacteria 946
583 Ga0265334_10118299 3300028573 Bacteria 948
584 Ga0265318_10000160 3300028577 Bacteria 59769
585 Ga0265338_10336515 3300028800 Bacteria 1089
586 Ga0307511_10000022 3300030521 Bacteria 116875
587 Ga0265330_10000084 3300031235 Bacteria 79237
588 Ga0265330_10068245 3300031235 Bacteria 1540
589 Ga0265330_10328184 3300031235 Bacteria 646
590 Ga0265332_10000518 3300031238 Bacteria 26331
591 Ga0265332_10078877 3300031238 Bacteria 1398
592 Ga0265332_10113667 3300031238 Bacteria 1139
593 Ga0265328_10004449 3300031239 Bacteria 6087
594 Ga0265328_10401206 3300031239 Bacteria 538
595 Ga0265320_10000144 3300031240 Bacteria 59885
596 Ga0265320_10231262 3300031240 Bacteria 822
597 Ga0265320_10390794 3300031240 Bacteria 614
598 Ga0265325_10321592 3300031241 Bacteria 687
599 Ga0265329_10006155 3300031242 Bacteria 4780
600 Ga0265329_10237003 3300031242 Bacteria 606
601 Ga0265340_10059333 3300031247 Bacteria 1835
602 Ga0265339_10209776 3300031249 Bacteria 957
603 Ga0265331_10000264 3300031250 Bacteria 59763
604 Ga0265331_10113290 3300031250 Bacteria 1243
605 Ga0265331_10221813 3300031250 Bacteria 850
606 Ga0265316_10014879 3300031344 Bacteria 6824
607 Ga0265316_10327442 3300031344 Bacteria 1112
608 Ga0265316_10332619 3300031344 Bacteria 1102
609 Ga0307509_10043196 3300031507 Bacteria 4879
610 Ga0307509_10123960 3300031507 Bacteria 2554
611 Ga0307408_100605884 3300031548 Bacteria 974
612 Ga0307408_100675332 3300031548 Bacteria 926
613 Ga0265313_10000404 3300031595 Bacteria 46486
614 Ga0265313_10020862 3300031595 Bacteria 3600
615 Ga0265313_10101121 3300031595 Bacteria 1280
616 Ga0265314_10000385 3300031711 Bacteria 59807
617 Ga0265342_10063487 3300031712 Bacteria 2171
618 Ga0265342_10115041 3300031712 Bacteria 1519
619 Ga0265342_10137397 3300031712 Bacteria 1365
620 Ga0307405_10060792 3300031731 Bacteria 2385
621 Ga0307405_10216190 3300031731 Bacteria 1403
622 Ga0307413_10014216 3300031824 Bacteria 4033
623 Ga0307410_10139331 3300031852 Bacteria 1792
624 Ga0307410_10832262 3300031852 Bacteria 787
625 Ga0307407_10116439 3300031903 Bacteria 1686
626 Ga0307407_10335684 3300031903 Bacteria 1065
627 Ga0307412_10022402 3300031911 Bacteria 3872
628 Ga0307412_10112122 3300031911 Bacteria 1949
629 Ga0307412_10790530 3300031911 Bacteria 823
630 Ga0307409_100001098 3300031995 Bacteria 12796
631 Ga0307409_100146109 3300031995 Bacteria 2045
632 Ga0307409_100520326 3300031995 Bacteria 1162
633 Ga0307416_100025448 3300032002 Bacteria 4338
634 Ga0307416_101073577 3300032002 Bacteria 909
635 Ga0307414_10010424 3300032004 Bacteria 5391
636 Ga0307414_11206243 3300032004 Bacteria 701
637 Ga0307411_10022213 3300032005 Bacteria 3730
638 Ga0307411_10039290 3300032005 Bacteria 2992
639 Ga0307411_10088639 3300032005 Bacteria 2153
640 Ga0307415_100661300 3300032126 Bacteria 938
641 Ga0307507_10192176 3300033179 Bacteria 1432
642 Ga0373934_0059885 3300035086 Bacteria 1516
643 Ga0373944_0039280 3300035089 Bacteria 1457
644 Ga0373923_0070190 3300035111 Bacteria 1503
645 Ga0373936_0201340 3300035113 Bacteria 879
646 Ga0373953_0004518 3300035117 Bacteria 4445
647 Ga0373953_0274254 3300035117 Bacteria 735
648 Ga0373954_0003164 3300035118 Bacteria 6955
649 Ga0373954_0006861 3300035118 Bacteria 4971
650 Ga0373956_0325313 3300035119 Bacteria 733
651 Ga0373957_0015715 3300035120 Bacteria 2610
652 Ga0373957_0150730 3300035120 Bacteria 954
653 Ga0373943_0174919 3300035170 Bacteria 1177
654 Ga0373955_0012729 3300035172 Bacteria 4051
655 Ga0373961_0000747 3300035241 Bacteria 11220
656 Ga0373935_0065045 3300035692 Bacteria 2339
657 Ga0373935_0762880 3300035692 Bacteria 713
658 Ga0373935_1277448 3300035692 Bacteria 548
659 Ga0373933_0028682 3300035724 Bacteria 3212
660 Ga0373947_0163710 3300035725 Bacteria 1440
661 Ga0373947_0386003 3300035725 Bacteria 943
662 Ga0373947_0408879 3300035725 Bacteria 916
663 Ga0373937_0016441 3300036401 Bacteria 6572
664 Ga0373937_0278614 3300036401 Bacteria 1579
665 Ga0373937_1287209 3300036401 Bacteria 679
666 Ga0373925_0073627 3300037068 Bacteria 2586
667 Ga0373925_0210856 3300037068 Bacteria 1547
668 Ga0373925_0903496 3300037068 Bacteria 728
669 Ga0395899_0190097 3300037312 Bacteria 1437
670 Ga0395900_0777820 3300037418 Bacteria 886
671 Ga0395898_0035872 3300037466 Bacteria 4928
672 Ga0395905_1630589 3300037471 Bacteria 550
673 Ga0436364_0090800 3300037853 Bacteria 991
674 Ga0436364_0816778 3300037853 Bacteria 950
675 Ga0436364_1386291 3300037853 Bacteria 20302
676 Ga0395901_1117206 3300038443 Bacteria 758
677 Ga0436365_0921625 3300039437 Bacteria 24575
678 Ga0436361_0381832 3300039447 Bacteria 88698
679 Ga0436361_0536137 3300039447 Bacteria 4868
680 Ga0436361_1199929 3300039447 Bacteria 899
681 Ga0436363_0113419 3300039450 Bacteria 554
682 Ga0436363_0974932 3300039450 Bacteria 966
683 Ga0436362_0741099 3300039453 Bacteria 4353
684 Ga0436362_0830499 3300039453 Bacteria 3978
685 Ga0451793_0564301 3300041452 Bacteria 872
686 Ga0451795_0020277 3300041456 Bacteria 935
687 Ga0451806_486766 3300041462 Bacteria 530
688 Ga0451807_0761906 3300041486 Bacteria 1001
689 Ga0451837_1384319 3300041494 Bacteria 584
690 Ga0451849_0877464 3300041505 Bacteria 670
691 Ga0451851_0309592 3300041507 Bacteria 528
692 Ga0451853_0720400 3300041512 Bacteria 581
693 Ga0439464_0281481 3300042439 Bacteria 541
694 Ga0450918_050400 3300042531 Bacteria 758
695 Ga0451577_0006711 3300042876 Bacteria 11423
696 Ga0451577_0057187 3300042876 Bacteria 3478
697 Ga0453683_0066699 3300044673 Bacteria 2249
698 Ga0453683_0186671 3300044673 Bacteria 1315
699 Ga0466966_0551906 3300044684 Bacteria 693
700 Ga0466963_0677440 3300044694 Bacteria 728
701 Ga0453684_0169318 3300044712 Bacteria 2576
702 Ga0466959_0018159 3300045049 Bacteria 5162
703 Ga0451576_0000006 3300045051 Bacteria 949698
704 Ga0451576_0017314 3300045051 Bacteria 7929
705 Ga0451576_1389516 3300045051 Bacteria 731
706 Ga0495592_0101071 3300046454 Bacteria 2055
707 Ga0495592_0531970 3300046454 Bacteria 725
708 Ga0495603_0019546 3300046455 Bacteria 4100
709 Ga0495629_0054375 3300046459 Bacteria 2800
710 Ga0495629_0177700 3300046459 Bacteria 1476
711 Ga0495638_0021351 3300046460 Bacteria 4270
712 Ga0495638_0043419 3300046460 Bacteria 2836
713 Ga0495638_0186081 3300046460 Bacteria 1181
714 Ga0495651_0015643 3300046462 Bacteria 5873
715 Ga0495651_0376347 3300046462 Bacteria 932
716 Ga0495651_0520233 3300046462 Bacteria 759
717 Ga0495653_0065346 3300046463 Bacteria 2738
718 Ga0495650_0000022 3300046471 Bacteria 530747
719 Ga0495580_0174662 3300046472 Bacteria 1484
720 Ga0495582_0004969 3300046473 Bacteria 7452
721 Ga0495582_0024664 3300046473 Bacteria 3291
722 Ga0495605_0002109 3300046474 Bacteria 12468
723 Ga0495639_0044514 3300046475 Bacteria 2006
724 Ga0495662_0330298 3300046476 Bacteria 750
725 Ga0495664_0063179 3300046477 Bacteria 2206
726 Ga0495664_0811403 3300046477 Bacteria 550
727 Ga0495584_0030290 3300046491 Bacteria 2741
728 Ga0495585_0034383 3300046492 Bacteria 2865
729 Ga0495585_0048682 3300046492 Bacteria 2356
730 Ga0495594_0002702 3300046499 Bacteria 9208
731 Ga0495594_0059763 3300046499 Bacteria 2108
732 Ga0495596_0187731 3300046500 Bacteria 804
733 Ga0495583_0035602 3300046506 Bacteria 2375
734 Ga0495583_0041057 3300046506 Bacteria 2169
735 Ga0495606_0599829 3300046507 Bacteria 540
736 Ga0495608_0060188 3300046511 Bacteria 2499
737 Ga0495610_0314430 3300046512 Bacteria 600
738 Ga0495616_0222149 3300046513 Bacteria 822
739 Ga0495628_0033413 3300046516 Bacteria 4147
740 Ga0495628_0292103 3300046516 Bacteria 1208
741 Ga0495630_0035014 3300046517 Bacteria 3752
742 Ga0495631_0138051 3300046518 Bacteria 1047
743 Ga0495632_0072993 3300046519 Bacteria 1646
744 Ga0495644_0000085 3300046523 Bacteria 46343
745 Ga0495648_0145420 3300046524 Bacteria 1243
746 Ga0495648_0158956 3300046524 Bacteria 1170
747 Ga0495666_0021121 3300046526 Bacteria 3223
748 Ga0495642_0055733 3300046528 Bacteria 1632
749 Ga0495642_0183382 3300046528 Bacteria 911
750 Ga0495652_0054846 3300046529 Bacteria 3392
751 Ga0495652_0136578 3300046529 Bacteria 1934
752 Ga0495652_0140682 3300046529 Bacteria 1898
753 Ga0495665_0085444 3300046531 Bacteria 1658
754 Ga0495640_0100517 3300046533 Bacteria 1899
755 Ga0495586_0037182 3300046535 Bacteria 2613
756 Ga0495586_0080798 3300046535 Bacteria 1786
757 Ga0495586_0521954 3300046535 Bacteria 685
758 Ga0495587_0070475 3300046536 Bacteria 2034
759 Ga0495598_0041459 3300046537 Bacteria 1347
760 Ga0495609_0005078 3300046538 Bacteria 7016
761 Ga0495621_0254838 3300046539 Bacteria 718
762 Ga0495645_0053112 3300046543 Bacteria 2946
763 Ga0495645_0461961 3300046543 Bacteria 799
764 Ga0495633_0151428 3300046558 Bacteria 1071
765 Ga0495633_0358235 3300046558 Bacteria 661
766 Ga0495667_0015927 3300046559 Bacteria 5081
767 Ga0495667_0076083 3300046559 Bacteria 2184
768 Ga0495667_0135062 3300046559 Bacteria 1590
769 Ga0495656_0667933 3300046615 Bacteria 558
770 Ga0495668_0129752 3300046616 Bacteria 1380
771 Ga0495634_0018650 3300046642 Bacteria 4935
772 Ga0495634_0027571 3300046642 Bacteria 3951
773 Ga0495634_0182482 3300046642 Bacteria 1313
774 Ga0495625_0000276 3300046660 Bacteria 79774
775 Ga0495625_0019550 3300046660 Bacteria 5249
776 Ga0495625_0035398 3300046660 Bacteria 3681
777 Ga0495625_0450166 3300046660 Bacteria 796
778 Ga0495635_0021252 3300046663 Bacteria 4524
779 Ga0495659_0528218 3300046664 Bacteria 519
780 Ga0495661_0350616 3300046665 Bacteria 727
781 Ga0495588_0214034 3300046674 Bacteria 1017
782 Ga0495657_0007196 3300046675 Bacteria 8628
783 Ga0495657_0107056 3300046675 Bacteria 1775
784 Ga0495599_0004838 3300046678 Bacteria 8011
785 Ga0495599_0117533 3300046678 Bacteria 1654
786 Ga0495599_0133273 3300046678 Bacteria 1543
787 Ga0495599_0448102 3300046678 Bacteria 764
788 Ga0495623_0035399 3300046679 Bacteria 3201
789 Ga0495623_0492223 3300046679 Bacteria 648
790 Ga0495646_0020107 3300046680 Bacteria 4221
791 Ga0495646_0057461 3300046680 Bacteria 2328
792 Ga0495646_0188504 3300046680 Bacteria 1128
793 Ga0495646_0381091 3300046680 Bacteria 735
794 Ga0495658_0303121 3300046683 Bacteria 1011
795 Ga0495669_0002518 3300046684 Bacteria 7482
796 Ga0495669_0496228 3300046684 Bacteria 594
797 Ga0495613_0071465 3300046689 Bacteria 2529
798 Ga0495613_0089821 3300046689 Bacteria 2225
799 Ga0495613_0114323 3300046689 Bacteria 1943
800 Ga0495624_0170813 3300046690 Bacteria 1326
801 Ga0495624_0193503 3300046690 Bacteria 1237
802 Ga0495624_0513014 3300046690 Bacteria 717
803 Ga0495670_0004905 3300046691 Bacteria 6573
804 Ga0495670_0053026 3300046691 Bacteria 2031
805 Ga0495671_0063960 3300046692 Bacteria 1812
806 Ga0495649_0013003 3300046694 Bacteria 4817
807 Ga0495649_0170434 3300046694 Bacteria 1139
808 Ga0495589_0204728 3300046794 Bacteria 930
809 Ga0495600_0035461 3300046809 Bacteria 3240
810 Ga0495600_0035500 3300046809 Bacteria 3238
811 Ga0495600_0077553 3300046809 Bacteria 2170
812 Ga0495660_0043762 3300046810 Bacteria 2467
813 Ga0495581_0004471 3300047315 Bacteria 8084
814 Ga0495604_0090026 3300047317 Bacteria 2279
815 Ga0495604_0204016 3300047317 Bacteria 1370
816 Ga0495604_0221717 3300047317 Bacteria 1301
817 Ga0495636_0270770 3300047318 Bacteria 789
818 Ga0495636_0278288 3300047318 Bacteria 779
819 Ga0495636_0372469 3300047318 Bacteria 677
820 Ga0495674_0033102 3300047319 Bacteria 4685
821 Ga0495674_0147877 3300047319 Bacteria 1971
822 Ga0495674_0249057 3300047319 Bacteria 1462
823 Ga0495674_0843822 3300047319 Bacteria 710
824 Ga0495672_0001069 3300047320 Bacteria 27899
825 Ga0495672_0003551 3300047320 Bacteria 13278
826 Ga0495672_0061509 3300047320 Bacteria 2164
827 Ga0495672_0192404 3300047320 Bacteria 1025
828 Ga0495676_0010423 3300047321 Bacteria 8431
829 Ga0495680_0003456 3300047322 Bacteria 15551
830 Ga0495680_0323792 3300047322 Bacteria 1078
831 Ga0495683_0041743 3300047323 Bacteria 2314
832 Ga0495675_0025788 3300047444 Bacteria 3745
833 Ga0495675_0235857 3300047444 Bacteria 1103
834 Ga0495675_0436784 3300047444 Bacteria 759
835 Ga0495677_0192506 3300047445 Bacteria 792
836 Ga0495679_044976 3300047446 Bacteria 1350
837 Ga0495673_0058235 3300047469 Bacteria 1666
838 Ga0495684_0301087 3300047471 Bacteria 1152
839 Ga0495684_0402057 3300047471 Bacteria 961
840 Ga0495686_0223310 3300047472 Bacteria 1070
841 Ga0495686_0582242 3300047472 Bacteria 581
842 Ga0495593_0045311 3300047673 Bacteria 2348
843 Ga0495602_0085112 3300048088 Bacteria 2643
844 Ga0495626_0209040 3300048091 Bacteria 797
845 Ga0496100_0327758 3300048903 Bacteria 1152
846 Ga0496101_0002922 3300048904 Bacteria 10507
847 Ga0496101_0269061 3300048904 Bacteria 1330
848 Ga0496103_0114305 3300048906 Bacteria 1716
849 Ga0496104_0055263 3300048907 Bacteria 3754
850 Ga0496104_0119674 3300048907 Bacteria 2528
851 Ga0496104_0209473 3300048907 Bacteria 1861
852 Ga0496104_0362043 3300048907 Bacteria 1363
853 Ga0496105_0079528 3300048908 Bacteria 2707
854 Ga0496105_0129938 3300048908 Bacteria 2077
855 Ga0496106_0044716 3300048909 Bacteria 3325
856 Ga0496107_0007817 3300048910 Bacteria 7380
857 Ga0496107_0502392 3300048910 Bacteria 899
858 Ga0496109_0352817 3300048912 Bacteria 1389
859 Ga0496110_0075456 3300048913 Bacteria 2996
860 Ga0496111_0314263 3300048914 Bacteria 1161
861 Ga0496112_0025641 3300048915 Bacteria 5663
862 Ga0496112_0029852 3300048915 Bacteria 5274
863 Ga0496112_1502347 3300048915 Bacteria 587
864 Ga0496113_0101821 3300048916 Bacteria 2227
865 Ga0496113_0234321 3300048916 Bacteria 1464
866 Ga0496113_0577017 3300048916 Bacteria 901
867 Ga0496113_1311620 3300048916 Bacteria 563
868 Ga0496114_0697222 3300048917 Bacteria 891
869 Ga0496114_0814778 3300048917 Bacteria 813
870 Ga0496115_0104467 3300048918 Bacteria 2325
871 Ga0496115_0662255 3300048918 Bacteria 824
872 Ga0496115_0961324 3300048918 Bacteria 655
873 Ga0496116_0002045 3300048919 Bacteria 21613
874 Ga0496117_0003643 3300048920 Bacteria 17745
875 Ga0496118_0006911 3300048921 Bacteria 12277
876 Ga0496120_0184646 3300048923 Bacteria 1021
877 Ga0496121_0001997 3300048924 Bacteria 32409
878 Ga0496121_0054026 3300048924 Bacteria 3360
879 Ga0496121_0121929 3300048924 Bacteria 1967
880 Ga0496123_0020557 3300048926 Bacteria 5161
881 Ga0496126_0000245 3300048929 Bacteria 116888
882 Ga0496126_0002541 3300048929 Bacteria 24417
883 Ga0496126_0019943 3300048929 Bacteria 6589
884 Ga0496126_0042857 3300048929 Bacteria 4178
885 Ga0496126_0120816 3300048929 Bacteria 2272
886 Ga0496126_0136221 3300048929 Bacteria 2118
887 Ga0496126_0240126 3300048929 Bacteria 1514
888 Ga0496126_0553417 3300048929 Bacteria 912
889 Ga0495678_023400 3300049459 Bacteria 2685
890 Ga0501291_082556 3300049514 Bacteria 642
891 Ga0501031_0001415 3300049568 Bacteria 14850
892 Ga0501031_0016517 3300049568 Bacteria 4795
893 Ga0501032_0000283 3300049569 Bacteria 42856
894 Ga0501032_0003300 3300049569 Bacteria 12404
895 Ga0501032_0010264 3300049569 Bacteria 6756
896 Ga0501032_0017169 3300049569 Bacteria 5085
897 Ga0501032_0083823 3300049569 Bacteria 2119
898 Ga0501032_0272266 3300049569 Bacteria 1097
899 Ga0501032_0513398 3300049569 Bacteria 765
900 Ga0501033_0000175 3300049570 Bacteria 60845
901 Ga0501033_0002596 3300049570 Bacteria 15232
902 Ga0501033_0010273 3300049570 Bacteria 7184
903 Ga0501033_0170236 3300049570 Bacteria 1564
904 Ga0501034_0000202 3300049571 Bacteria 112985
905 Ga0501034_0003011 3300049571 Bacteria 19483
906 Ga0501034_0023442 3300049571 Bacteria 6289
907 Ga0501034_0036158 3300049571 Bacteria 5004
908 Ga0501034_0040008 3300049571 Bacteria 4747
909 Ga0501034_0625182 3300049571 Bacteria 980
910 Ga0501036_0000042 3300049572 Bacteria 79876
911 Ga0501036_0000429 3300049572 Bacteria 29860
912 Ga0501036_0009069 3300049572 Bacteria 8181
913 Ga0501036_0015599 3300049572 Bacteria 6347
914 Ga0501036_0069084 3300049572 Bacteria 2989
915 Ga0501036_0073428 3300049572 Bacteria 2892
916 Ga0501036_0140323 3300049572 Bacteria 2039
917 Ga0501036_0585066 3300049572 Bacteria 927
918 Ga0501037_0000100 3300049573 Bacteria 81013
919 Ga0501037_0021307 3300049573 Bacteria 4789
920 Ga0501038_0000157 3300049574 Bacteria 58169
921 Ga0501038_0001559 3300049574 Bacteria 21197
922 Ga0501038_0001785 3300049574 Bacteria 19959
923 Ga0501038_0007361 3300049574 Bacteria 10155
924 Ga0501038_0009652 3300049574 Bacteria 8853
925 Ga0501038_0039833 3300049574 Bacteria 4109
926 Ga0501038_0119559 3300049574 Bacteria 2175
927 Ga0501038_0186576 3300049574 Bacteria 1671
928 Ga0501039_0000216 3300049575 Bacteria 42349
929 Ga0501039_0002846 3300049575 Bacteria 12932
930 Ga0501039_0037679 3300049575 Bacteria 3733
931 Ga0501039_0060540 3300049575 Bacteria 2933
932 Ga0501039_0157722 3300049575 Bacteria 1783
933 Ga0501039_0333285 3300049575 Bacteria 1192
934 Ga0501039_1048704 3300049575 Bacteria 633
935 Ga0501040_0039344 3300049576 Bacteria 3216
936 Ga0501041_0273730 3300049577 Bacteria 1062
937 Ga0501042_0044070 3300049578 Bacteria 3178
938 Ga0501042_0083958 3300049578 Bacteria 2283
939 Ga0501042_0341662 3300049578 Bacteria 1082
940 Ga0501042_0344741 3300049578 Bacteria 1077
941 Ga0501042_0905269 3300049578 Bacteria 642
942 Ga0501043_0001316 3300049579 Bacteria 21701
943 Ga0501043_0001633 3300049579 Bacteria 19499
944 Ga0501043_0003155 3300049579 Bacteria 13640
945 Ga0501043_0008209 3300049579 Bacteria 8228
946 Ga0501043_0136348 3300049579 Bacteria 1922
947 Ga0501043_0168155 3300049579 Bacteria 1711
948 Ga0501043_0168463 3300049579 Bacteria 1709
949 Ga0501043_0296168 3300049579 Bacteria 1237
950 Ga0501043_0336716 3300049579 Bacteria 1148
951 Ga0501046_0000387 3300049580 Bacteria 44269
952 Ga0501046_0000448 3300049580 Bacteria 41389
953 Ga0501046_0000815 3300049580 Bacteria 30371
954 Ga0501046_0035091 3300049580 Bacteria 4042
955 Ga0501046_0316381 3300049580 Bacteria 1138
956 Ga0501047_0000159 3300049581 Bacteria 82106
957 Ga0501047_0000517 3300049581 Bacteria 41739
958 Ga0501047_0000662 3300049581 Bacteria 35973
959 Ga0501047_0001472 3300049581 Bacteria 22950
960 Ga0501047_0002554 3300049581 Bacteria 17351
961 Ga0501047_0039979 3300049581 Bacteria 4535
962 Ga0501047_0161197 3300049581 Bacteria 2114
963 Ga0501047_0173014 3300049581 Bacteria 2028
964 Ga0501047_0511003 3300049581 Bacteria 1028
965 Ga0501047_0619979 3300049581 Bacteria 902
966 Ga0501048_0000655 3300049582 Bacteria 24936
967 Ga0501048_0000726 3300049582 Bacteria 24134
968 Ga0501048_0059248 3300049582 Bacteria 2713
969 Ga0501048_0075906 3300049582 Bacteria 2372
970 Ga0501067_0008361 3300049583 Bacteria 5745
971 Ga0501067_0011823 3300049583 Bacteria 4836
972 Ga0501067_0022683 3300049583 Bacteria 3473
973 Ga0501067_0042271 3300049583 Bacteria 2530
974 Ga0501067_0069488 3300049583 Bacteria 1950
975 Ga0501067_0085853 3300049583 Bacteria 1746
976 Ga0501067_0193025 3300049583 Bacteria 1134
977 Ga0501068_0000168 3300049584 Bacteria 30562
978 Ga0501068_0009657 3300049584 Bacteria 5401
979 Ga0501068_0012207 3300049584 Bacteria 4860
980 Ga0501068_0104456 3300049584 Bacteria 1758
981 Ga0501068_0254886 3300049584 Bacteria 1119
982 Ga0501068_0501064 3300049584 Bacteria 788
983 Ga0501069_0001651 3300049585 Bacteria 11084
984 Ga0501069_0002689 3300049585 Bacteria 9073
985 Ga0501069_0025378 3300049585 Bacteria 3239
986 Ga0501069_0031583 3300049585 Bacteria 2914
987 Ga0501069_0068053 3300049585 Bacteria 1993
988 Ga0501069_0162680 3300049585 Bacteria 1285
989 Ga0501070_0002236 3300049586 Bacteria 17009
990 Ga0501070_0036050 3300049586 Bacteria 4130
991 Ga0501070_0089085 3300049586 Bacteria 2554
992 Ga0501070_0173575 3300049586 Bacteria 1775
993 Ga0501070_0390018 3300049586 Bacteria 1127
994 Ga0501070_0436350 3300049586 Bacteria 1057
995 Ga0501070_0530874 3300049586 Bacteria 943
996 Ga0501070_0566401 3300049586 Bacteria 908
997 Ga0501070_1288770 3300049586 Bacteria 558
998 Ga0501071_0054879 3300049587 Bacteria 2875
999 Ga0501071_0214082 3300049587 Bacteria 1449
1000 Ga0501071_0391584 3300049587 Bacteria 1060
1001 Ga0501072_0000003 3300049588 Bacteria 298632
1002 Ga0501072_0000475 3300049588 Bacteria 28798
1003 Ga0501072_0007057 3300049588 Bacteria 8529
1004 Ga0501072_0141690 3300049588 Bacteria 1917
1005 Ga0501072_0193413 3300049588 Bacteria 1622
1006 Ga0501072_0571474 3300049588 Bacteria 892
1007 Ga0501072_0581566 3300049588 Bacteria 883
1008 Ga0501073_0000678 3300049589 Bacteria 23931
1009 Ga0501073_0009782 3300049589 Bacteria 7057
1010 Ga0501073_0044288 3300049589 Bacteria 3136
1011 Ga0501073_0086560 3300049589 Bacteria 2179
1012 Ga0501073_0122986 3300049589 Bacteria 1798
1013 Ga0501073_0243568 3300049589 Bacteria 1241
1014 Ga0501073_0496636 3300049589 Bacteria 844
1015 Ga0501073_0621219 3300049589 Bacteria 746
1016 Ga0501074_0001904 3300049590 Bacteria 14331
1017 Ga0501074_0004788 3300049590 Bacteria 9702
1018 Ga0501074_0007337 3300049590 Bacteria 7970
1019 Ga0501074_0031818 3300049590 Bacteria 3822
1020 Ga0501074_0050292 3300049590 Bacteria 3009
1021 Ga0501074_0451679 3300049590 Bacteria 911
1022 Ga0501075_0000346 3300049591 Bacteria 26327
1023 Ga0501075_0030713 3300049591 Bacteria 3981
1024 Ga0501076_0024992 3300049592 Bacteria 4621
1025 Ga0501076_0041535 3300049592 Bacteria 3619
1026 Ga0501076_0137368 3300049592 Bacteria 1985
1027 Ga0501076_0271977 3300049592 Bacteria 1387
1028 Ga0501076_0486070 3300049592 Bacteria 1017
1029 Ga0501076_0711201 3300049592 Bacteria 829
1030 Ga0501077_0000509 3300049593 Bacteria 23725
1031 Ga0501077_0052836 3300049593 Bacteria 2580
1032 Ga0501077_0111681 3300049593 Bacteria 1732
1033 Ga0501079_0006064 3300049741 Bacteria 9059
1034 Ga0501079_0006855 3300049741 Bacteria 8580
1035 Ga0501079_0013419 3300049741 Bacteria 6248
1036 Ga0501079_0047364 3300049741 Bacteria 3316
1037 Ga0501079_0071226 3300049741 Bacteria 2685
1038 Ga0501079_0565241 3300049741 Bacteria 895
1039 Ga0501080_0004275 3300049742 Bacteria 12675
1040 Ga0501080_0004449 3300049742 Bacteria 12471
1041 Ga0501080_0027460 3300049742 Bacteria 5292
1042 Ga0501080_0039623 3300049742 Bacteria 4398
1043 Ga0501080_0047355 3300049742 Bacteria 4002
1044 Ga0501080_0053498 3300049742 Bacteria 3759
1045 Ga0501080_0072909 3300049742 Bacteria 3194
1046 Ga0501080_0105408 3300049742 Bacteria 2614
1047 Ga0501080_0163259 3300049742 Bacteria 2056
1048 Ga0501080_0806817 3300049742 Bacteria 823
1049 Ga0501080_1418234 3300049742 Bacteria 592
1050 Ga0501080_1802687 3300049742 Bacteria 514
1051 Ga0501081_0373781 3300049743 Bacteria 1052
1052 Ga0501083_0001555 3300049744 Bacteria 15682
1053 Ga0501083_0006723 3300049744 Bacteria 8157
1054 Ga0501083_0012456 3300049744 Bacteria 5947
1055 Ga0501083_0015606 3300049744 Bacteria 5319
1056 Ga0501083_0024439 3300049744 Bacteria 4185
1057 Ga0501083_0027627 3300049744 Bacteria 3914
1058 Ga0501083_0048909 3300049744 Bacteria 2852
1059 Ga0501083_0145560 3300049744 Bacteria 1551
1060 Ga0501035_0000172 3300049822 Bacteria 79203
1061 Ga0501035_0002828 3300049822 Bacteria 16789
1062 Ga0501035_0027104 3300049822 Bacteria 5238
1063 Ga0501035_0147241 3300049822 Bacteria 2044
1064 Ga0501035_0276813 3300049822 Bacteria 1419
1065 Ga0501035_0911809 3300049822 Bacteria 695
1066 Ga0501044_0000282 3300049823 Bacteria 64640
1067 Ga0501044_0001507 3300049823 Bacteria 27295
1068 Ga0501044_0008603 3300049823 Bacteria 11176
1069 Ga0501044_0022656 3300049823 Bacteria 6689
1070 Ga0501044_0192181 3300049823 Bacteria 2003
1071 Ga0501044_0256082 3300049823 Bacteria 1689
1072 Ga0501044_0356408 3300049823 Bacteria 1381
1073 Ga0501044_0420692 3300049823 Bacteria 1246
1074 Ga0501044_0434616 3300049823 Bacteria 1221
1075 Ga0501045_0019340 3300049824 Bacteria 4854
1076 Ga0501045_0076109 3300049824 Bacteria 2472
1077 Ga0501045_0311726 3300049824 Bacteria 1171
1078 nmdc:mga03683_106687_c1 3300050489 Bacteria 1235
1079 nmdc:mga03683_478216_c1 3300050489 Bacteria 601
1080 nmdc:mga03n38_52095_c1 3300050490 Bacteria 1830
1081 nmdc:mga03n38_73719_c1 3300050490 Bacteria 1586
1082 nmdc:mga0yw44_21119_c1 3300050492 Bacteria 3627
1083 nmdc:mga0yw44_3171_c1 3300050492 Bacteria 7223
1084 nmdc:mga0k408_102419_c1 3300050493 Bacteria 1689
1085 nmdc:mga0k408_133482_c1 3300050493 Bacteria 1474
1086 nmdc:mga0k408_269530_c1 3300050493 Bacteria 1016
1087 nmdc:mga0k408_312026_c1 3300050493 Bacteria 939
1088 nmdc:mga0k408_7616_c1 3300050493 Bacteria 5783
1089 nmdc:mga06z11_137944_c1 3300050494 Bacteria 1376
1090 nmdc:mga06z11_150671_c1 3300050494 Bacteria 1322
1091 nmdc:mga06z11_155863_c1 3300050494 Bacteria 1302
1092 nmdc:mga06z11_281339_c1 3300050494 Bacteria 985
1093 nmdc:mga04h51_63377_c1 3300050495 Bacteria 1273
1094 nmdc:mga07m45_137022_c1 3300050496 Bacteria 1417
1095 nmdc:mga07m45_8009_c1 3300050496 Bacteria 5417
1096 nmdc:mga05p37_366228_c1 3300050507 Bacteria 1693
1097 nmdc:mga05p37_40532_c1 3300050507 Bacteria 5719
1098 nmdc:mga09592_104591_c1 3300050508 Bacteria 2426
1099 nmdc:mga09592_11287_c1 3300050508 Bacteria 7270
1100 nmdc:mga09592_1315941_c1 3300050508 Bacteria 593
1101 nmdc:mga09592_710664_c1 3300050508 Bacteria 855
1102 nmdc:mga0qj67_35688_c1 3300050509 Bacteria 3888
1103 nmdc:mga0qj67_74728_c1 3300050509 Bacteria 2708
1104 nmdc:mga0qj67_751281_c1 3300050509 Bacteria 774
1105 nmdc:mga0qj67_796210_c1 3300050509 Bacteria 748
1106 nmdc:mga0qj67_82208_c1 3300050509 Bacteria 2583
1107 nmdc:mga0qj67_899214_c1 3300050509 Bacteria 698
1108 nmdc:mga06r32_493125_c1 3300050510 Bacteria 1202
1109 nmdc:mga06r32_627763_c1 3300050510 Bacteria 1044
1110 nmdc:mga06r32_86434_c1 3300050510 Bacteria 3058
1111 nmdc:mga08y16_1186920_c1 3300050511 Bacteria 734
1112 nmdc:mga08y16_121251_c1 3300050511 Bacteria 2721
1113 nmdc:mga08y16_129122_c1 3300050511 Bacteria 2629
1114 nmdc:mga08y16_3101_c1 3300050511 Bacteria 17200
1115 nmdc:mga08y16_788423_c1 3300050511 Bacteria 944
1116 nmdc:mga08y16_799409_c1 3300050511 Bacteria 936
1117 nmdc:mga08y16_88723_c1 3300050511 Bacteria 3223
1118 nmdc:mga0n895_1415980_c1 3300050512 Bacteria 663
1119 nmdc:mga0n895_248667_c1 3300050512 Bacteria 1804
1120 nmdc:mga0n895_526687_c1 3300050512 Bacteria 1189
1121 nmdc:mga08x19_11855_c1 3300050514 Bacteria 5242
1122 Ga0495601_0037678 3300053077 Bacteria 3023
1123 Ga0495601_0106010 3300053077 Bacteria 1817
1124 Ga0495612_0022244 3300053078 Bacteria 2542
1125 Ga0495595_0194461 3300053084 Bacteria 1008
1126 Ga0495619_0405228 3300053085 Bacteria 941
1127 Ga0495619_0405231 3300053085 Bacteria 941
1128 Ga0500643_012947 3300053087 Bacteria 2969
1129 Ga0500646_0000925 3300053090 Bacteria 8090
1130 Ga0500583_0008247 3300053092 Bacteria 3726
1131 Ga0500651_0000005 3300053093 Bacteria 384761
1132 Ga0500651_0000299 3300053093 Bacteria 28598
1133 Ga0500650_0003454 3300053098 Bacteria 5500
1134 Ga0500555_074593 3300053103 Bacteria 890
1135 Ga0500556_0136229 3300053104 Bacteria 964
1136 Ga0500572_000533 3300053111 Bacteria 12931
1137 Ga0500595_023318 3300053119 Bacteria 2177
1138 Ga0500655_019811 3300053133 Bacteria 1254
1139 Ga0500559_0009452 3300053136 Bacteria 4218
1140 Ga0500568_0290552 3300053139 Bacteria 593
1141 Ga0500604_0006069 3300053151 Bacteria 3189
1142 Ga0500619_000014 3300053154 Bacteria 55951
1143 Ga0500639_097955 3300053163 Bacteria 1449
1144 Ga0500637_0108892 3300053178 Bacteria 1607
1145 Ga0500599_005642 3300053736 Bacteria 1579
1146 Ga0501084_0000278 3300054114 Bacteria 38673
1147 Ga0501084_0023457 3300054114 Bacteria 5148
1148 Ga0501084_0152138 3300054114 Bacteria 1950
1149 Ga0501084_0360234 3300054114 Bacteria 1229
1150 Ga0501084_1027720 3300054114 Bacteria 692
1151 Ga0501082_0005465 3300060353 Bacteria 11036
1152 Ga0501082_0005775 3300060353 Bacteria 10739
1153 Ga0501082_0038642 3300060353 Bacteria 4117
1154 Ga0501082_0044917 3300060353 Bacteria 3811
1155 Ga0501082_0416753 3300060353 Bacteria 1173
1156 Ga0501082_0950329 3300060353 Bacteria 751
1157 Ga0466962_0107632 3300061719 Bacteria 1341
1158 Ga0530510_0043557 3300061734 Bacteria 3242

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0564301 Ga0451793_0564301_428_850 127
2 3300013306 Ga0163162_12986097 Ga0163162_129860971 129
3 3300039450 Ga0436363_0113419 Ga0436363_0113419_76_504 129
4 3300049569 Ga0501032_0083823 Ga0501032_0083823_444_926 129
5 3300049570 Ga0501033_0010273 Ga0501033_0010273_6506_6988 129
6 3300049571 Ga0501034_0040008 Ga0501034_0040008_2128_2610 129
7 3300049572 Ga0501036_0000429 Ga0501036_0000429_16644_17126 129
8 3300049574 Ga0501038_0009652 Ga0501038_0009652_1282_1764 129
9 3300049575 Ga0501039_0157722 Ga0501039_0157722_947_1429 129
10 3300049579 Ga0501043_0008209 Ga0501043_0008209_4114_4596 129
11 3300049581 Ga0501047_0039979 Ga0501047_0039979_414_896 129
12 3300049582 Ga0501048_0000726 Ga0501048_0000726_15599_16081 129
13 3300049583 Ga0501067_0008361 Ga0501067_0008361_1004_1486 129
14 3300049585 Ga0501069_0031583 Ga0501069_0031583_276_758 129
15 3300049586 Ga0501070_0036050 Ga0501070_0036050_1468_1950 129
16 3300049587 Ga0501071_0214082 Ga0501071_0214082_466_948 129
17 3300049590 Ga0501074_0007337 Ga0501074_0007337_4161_4643 129
18 3300049741 Ga0501079_0006855 Ga0501079_0006855_1436_1918 129
19 3300049742 Ga0501080_0004275 Ga0501080_0004275_10402_10884 129
20 3300049744 Ga0501083_0024439 Ga0501083_0024439_1982_2464 129
21 3300049824 Ga0501045_0076109 Ga0501045_0076109_819_1301 129
22 3300009101 Ga0105247_10948890 Ga0105247_109488902 131
23 3300013297 Ga0157378_10227301 Ga0157378_102273013 131
24 3300013306 Ga0163162_10001419 Ga0163162_1000141922 131
25 3300013306 Ga0163162_10640982 Ga0163162_106409822 131
26 3300046455 Ga0495603_0019546 Ga0495603_0019546_913_1329 131
27 3300046476 Ga0495662_0330298 Ga0495662_0330298_241_651 131
28 3300046492 Ga0495585_0048682 Ga0495585_0048682_527_943 131
29 3300046499 Ga0495594_0002702 Ga0495594_0002702_7016_7432 131
30 3300046506 Ga0495583_0035602 Ga0495583_0035602_1808_2224 131
31 3300046513 Ga0495616_0222149 Ga0495616_0222149_305_721 131
32 3300046523 Ga0495644_0000085 Ga0495644_0000085_70_486 131
33 3300046524 Ga0495648_0145420 Ga0495648_0145420_753_1169 131
34 3300046528 Ga0495642_0055733 Ga0495642_0055733_1028_1444 131
35 3300046538 Ga0495609_0005078 Ga0495609_0005078_139_555 131
36 3300046558 Ga0495633_0151428 Ga0495633_0151428_629_1045 131
37 3300046615 Ga0495656_0667933 Ga0495656_0667933_126_542 131
38 3300046616 Ga0495668_0129752 Ga0495668_0129752_747_1157 131
39 3300046660 Ga0495625_0019550 Ga0495625_0019550_229_645 131
40 3300046674 Ga0495588_0214034 Ga0495588_0214034_286_702 131
41 3300046678 Ga0495599_0117533 Ga0495599_0117533_367_777 131
42 3300046680 Ga0495646_0381091 Ga0495646_0381091_268_678 131
43 3300046691 Ga0495670_0053026 Ga0495670_0053026_712_1128 131
44 3300046809 Ga0495600_0077553 Ga0495600_0077553_580_990 131
45 3300047317 Ga0495604_0204016 Ga0495604_0204016_696_1106 131
46 3300047318 Ga0495636_0278288 Ga0495636_0278288_122_538 131
47 3300047319 Ga0495674_0033102 Ga0495674_0033102_1786_2196 131
48 3300047323 Ga0495683_0041743 Ga0495683_0041743_1308_1724 131
49 3300047444 Ga0495675_0235857 Ga0495675_0235857_587_997 131
50 3300047469 Ga0495673_0058235 Ga0495673_0058235_592_1008 131
51 3300048907 Ga0496104_0209473 Ga0496104_0209473_454_864 131
52 3300048918 Ga0496115_0104467 Ga0496115_0104467_669_1079 131
53 3300005458 Ga0070681_10021112 Ga0070681_100211122 133
54 3300006177 Ga0075362_10562147 Ga0075362_105621471 133
55 3300006195 Ga0075366_10009517 Ga0075366_100095173 133
56 3300006237 Ga0097621_101457386 Ga0097621_1014573861 133
57 3300006353 Ga0075370_10052249 Ga0075370_100522493 133
58 3300009011 Ga0105251_10001178 Ga0105251_1000117819 133
59 3300009092 Ga0105250_10086139 Ga0105250_100861392 133
60 3300009093 Ga0105240_10010109 Ga0105240_100101096 133
61 3300009147 Ga0114129_10118916 Ga0114129_101189163 133
62 3300009148 Ga0105243_10197677 Ga0105243_101976772 133
63 3300011119 Ga0105246_10199278 Ga0105246_101992782 133
64 3300025912 Ga0207707_10021849 Ga0207707_100218494 133
65 3300035692 Ga0373935_1277448 Ga0373935_1277448_25_444 133
66 3300036401 Ga0373937_1287209 Ga0373937_1287209_135_554 133
67 3300046558 Ga0495633_0358235 Ga0495633_0358235_31_450 133
68 3300046683 Ga0495658_0303121 Ga0495658_0303121_133_552 133
69 3300048904 Ga0496101_0269061 Ga0496101_0269061_50_469 133
70 3300048907 Ga0496104_0119674 Ga0496104_0119674_941_1360 133
71 3300048908 Ga0496105_0129938 Ga0496105_0129938_791_1210 133
72 3300050493 nmdc:mga0k408_7616_c1 nmdc:mga0k408_7616_c1_5063_5485 133
73 3300050496 nmdc:mga07m45_137022_c1 nmdc:mga07m45_137022_c1_442_864 133
74 iso_pu_bacteria 2643221573 2643878639 133
75 iso_pu_bacteria 2643221728 2644697258 133
76 iso_pu_bacteria 2884215851 2884216172 133
77 3300005444 Ga0070694_100249952 Ga0070694_1002499522 134
78 3300005937 Ga0081455_10182342 Ga0081455_101823422 134
79 3300007265 Ga0099794_10004791 Ga0099794_100047913 134
80 3300007265 Ga0099794_10187155 Ga0099794_101871552 134
81 3300007265 Ga0099794_10322534 Ga0099794_103225341 134
82 3300007788 Ga0099795_10164169 Ga0099795_101641692 134
83 3300007788 Ga0099795_10421334 Ga0099795_104213341 134
84 3300009093 Ga0105240_10558181 Ga0105240_105581811 134
85 3300009093 Ga0105240_10609204 Ga0105240_106092042 134
86 3300009098 Ga0105245_10199591 Ga0105245_101995912 134
87 3300009147 Ga0114129_10007794 Ga0114129_100077948 134
88 3300009174 Ga0105241_10335901 Ga0105241_103359013 134
89 3300009174 Ga0105241_10402256 Ga0105241_104022562 134
90 3300009176 Ga0105242_10485534 Ga0105242_104855342 134
91 3300009176 Ga0105242_11779335 Ga0105242_117793351 134
92 3300009177 Ga0105248_10047231 Ga0105248_100472313 134
93 3300009177 Ga0105248_10053383 Ga0105248_100533837 134
94 3300009177 Ga0105248_11142571 Ga0105248_111425712 134
95 3300009545 Ga0105237_10650425 Ga0105237_106504252 134
96 3300009553 Ga0105249_10118923 Ga0105249_101189234 134
97 3300010159 Ga0099796_10356104 Ga0099796_103561042 134
98 3300010375 Ga0105239_11608684 Ga0105239_116086842 134
99 3300013296 Ga0157374_10023456 Ga0157374_100234569 134
100 3300013296 Ga0157374_10565413 Ga0157374_105654132 134
101 3300013306 Ga0163162_10474129 Ga0163162_104741293 134
102 3300013308 Ga0157375_10091058 Ga0157375_100910583 134
103 3300013308 Ga0157375_10117523 Ga0157375_101175234 134
104 3300013308 Ga0157375_10341682 Ga0157375_103416823 134
105 3300014325 Ga0163163_10061204 Ga0163163_100612044 134
106 3300014325 Ga0163163_10164600 Ga0163163_101646004 134
107 3300014968 Ga0157379_10055424 Ga0157379_100554243 134
108 3300014969 Ga0157376_10022851 Ga0157376_100228514 134
109 3300014969 Ga0157376_10039680 Ga0157376_100396805 134
110 3300014969 Ga0157376_10276599 Ga0157376_102765992 134
111 3300015265 Ga0182005_1190655 Ga0182005_11906551 134
112 3300025961 Ga0207712_11248941 Ga0207712_112489411 134
113 3300035089 Ga0373944_0039280 Ga0373944_0039280_273_686 134
114 3300035119 Ga0373956_0325313 Ga0373956_0325313_74_493 134
115 3300035120 Ga0373957_0150730 Ga0373957_0150730_155_583 134
116 3300035725 Ga0373947_0163710 Ga0373947_0163710_528_947 134
117 3300035725 Ga0373947_0386003 Ga0373947_0386003_409_825 134
118 3300035725 Ga0373947_0408879 Ga0373947_0408879_251_664 134
119 3300037068 Ga0373925_0903496 Ga0373925_0903496_77_496 134
120 3300037418 Ga0395900_0777820 Ga0395900_0777820_238_651 134
121 3300037853 Ga0436364_0816778 Ga0436364_0816778_137_556 134
122 3300037853 Ga0436364_1386291 Ga0436364_1386291_15973_16392 134
123 3300039450 Ga0436363_0974932 Ga0436363_0974932_519_935 134
124 3300041456 Ga0451795_0020277 Ga0451795_0020277_34_453 134
125 3300041486 Ga0451807_0761906 Ga0451807_0761906_536_946 134
126 3300042439 Ga0439464_0281481 Ga0439464_0281481_31_447 134
127 3300042531 Ga0450918_050400 Ga0450918_050400_145_567 134
128 3300044673 Ga0453683_0186671 Ga0453683_0186671_877_1296 134
129 3300046454 Ga0495592_0531970 Ga0495592_0531970_210_629 134
130 3300046459 Ga0495629_0054375 Ga0495629_0054375_1964_2383 134
131 3300046459 Ga0495629_0177700 Ga0495629_0177700_121_534 134
132 3300046473 Ga0495582_0004969 Ga0495582_0004969_6059_6472 134
133 3300046473 Ga0495582_0024664 Ga0495582_0024664_319_738 134
134 3300046475 Ga0495639_0044514 Ga0495639_0044514_1020_1439 134
135 3300046477 Ga0495664_0811403 Ga0495664_0811403_35_454 134
136 3300046499 Ga0495594_0059763 Ga0495594_0059763_991_1410 134
137 3300046500 Ga0495596_0187731 Ga0495596_0187731_83_502 134
138 3300046507 Ga0495606_0599829 Ga0495606_0599829_34_453 134
139 3300046519 Ga0495632_0072993 Ga0495632_0072993_1206_1625 134
140 3300046526 Ga0495666_0021121 Ga0495666_0021121_872_1291 134
141 3300046529 Ga0495652_0136578 Ga0495652_0136578_1313_1741 134
142 3300046529 Ga0495652_0140682 Ga0495652_0140682_48_467 134
143 3300046531 Ga0495665_0085444 Ga0495665_0085444_673_1092 134
144 3300046535 Ga0495586_0080798 Ga0495586_0080798_520_933 134
145 3300046539 Ga0495621_0254838 Ga0495621_0254838_171_590 134
146 3300046559 Ga0495667_0015927 Ga0495667_0015927_121_549 134
147 3300046559 Ga0495667_0076083 Ga0495667_0076083_242_661 134
148 3300046642 Ga0495634_0182482 Ga0495634_0182482_877_1290 134
149 3300046660 Ga0495625_0450166 Ga0495625_0450166_22_441 134
150 3300046664 Ga0495659_0528218 Ga0495659_0528218_79_498 134
151 3300046678 Ga0495599_0133273 Ga0495599_0133273_673_1092 134
152 3300046680 Ga0495646_0057461 Ga0495646_0057461_683_1102 134
153 3300046689 Ga0495613_0089821 Ga0495613_0089821_724_1143 134
154 3300046690 Ga0495624_0170813 Ga0495624_0170813_92_511 134
155 3300047315 Ga0495581_0004471 Ga0495581_0004471_6122_6541 134
156 3300047317 Ga0495604_0221717 Ga0495604_0221717_592_1011 134
157 3300047318 Ga0495636_0270770 Ga0495636_0270770_216_635 134
158 3300047319 Ga0495674_0147877 Ga0495674_0147877_807_1226 134
159 3300047320 Ga0495672_0003551 Ga0495672_0003551_5324_5737 134
160 3300047320 Ga0495672_0192404 Ga0495672_0192404_156_575 134
161 3300047321 Ga0495676_0010423 Ga0495676_0010423_3873_4292 134
162 3300047322 Ga0495680_0323792 Ga0495680_0323792_129_548 134
163 3300047445 Ga0495677_0192506 Ga0495677_0192506_55_474 134
164 3300047471 Ga0495684_0402057 Ga0495684_0402057_110_529 134
165 3300048929 Ga0496126_0240126 Ga0496126_0240126_25_522 134
166 3300049569 Ga0501032_0000283 Ga0501032_0000283_16402_16812 134
167 3300049569 Ga0501032_0017169 Ga0501032_0017169_1213_1623 134
168 3300049571 Ga0501034_0003011 Ga0501034_0003011_3512_3922 134
169 3300049572 Ga0501036_0015599 Ga0501036_0015599_5774_6184 134
170 3300049572 Ga0501036_0069084 Ga0501036_0069084_1333_1743 134
171 3300049574 Ga0501038_0001559 Ga0501038_0001559_19917_20327 134
172 3300049574 Ga0501038_0001785 Ga0501038_0001785_16479_16889 134
173 3300049575 Ga0501039_0002846 Ga0501039_0002846_3284_3694 134
174 3300049575 Ga0501039_0037679 Ga0501039_0037679_19_429 134
175 3300049579 Ga0501043_0336716 Ga0501043_0336716_284_694 134
176 3300049580 Ga0501046_0000815 Ga0501046_0000815_25456_25866 134
177 3300049580 Ga0501046_0035091 Ga0501046_0035091_1306_1716 134
178 3300049581 Ga0501047_0001472 Ga0501047_0001472_4507_4917 134
179 3300049583 Ga0501067_0193025 Ga0501067_0193025_198_608 134
180 3300049584 Ga0501068_0012207 Ga0501068_0012207_3169_3579 134
181 3300049585 Ga0501069_0068053 Ga0501069_0068053_996_1406 134
182 3300049585 Ga0501069_0162680 Ga0501069_0162680_679_1089 134
183 3300049586 Ga0501070_0566401 Ga0501070_0566401_412_822 134
184 3300049588 Ga0501072_0571474 Ga0501072_0571474_375_785 134
185 3300049588 Ga0501072_0581566 Ga0501072_0581566_81_491 134
186 3300049589 Ga0501073_0122986 Ga0501073_0122986_1243_1653 134
187 3300049592 Ga0501076_0137368 Ga0501076_0137368_910_1320 134
188 3300049592 Ga0501076_0486070 Ga0501076_0486070_83_493 134
189 3300049741 Ga0501079_0565241 Ga0501079_0565241_434_847 134
190 3300049742 Ga0501080_0027460 Ga0501080_0027460_4507_4917 134
191 3300049742 Ga0501080_0806817 Ga0501080_0806817_26_445 134
192 3300049744 Ga0501083_0027627 Ga0501083_0027627_647_1057 134
193 3300049744 Ga0501083_0145560 Ga0501083_0145560_1047_1457 134
194 3300049822 Ga0501035_0027104 Ga0501035_0027104_4207_4617 134
195 3300049823 Ga0501044_0001507 Ga0501044_0001507_25838_26248 134
196 3300049823 Ga0501044_0420692 Ga0501044_0420692_190_600 134
197 3300050508 nmdc:mga09592_104591_c1 nmdc:mga09592_104591_c1_549_959 134
198 3300050509 nmdc:mga0qj67_35688_c1 nmdc:mga0qj67_35688_c1_2463_2873 134
199 3300050510 nmdc:mga06r32_627763_c1 nmdc:mga06r32_627763_c1_599_1009 134
200 3300050510 nmdc:mga06r32_86434_c1 nmdc:mga06r32_86434_c1_986_1399 134
201 3300050511 nmdc:mga08y16_1186920_c1 nmdc:mga08y16_1186920_c1_58_477 134
202 3300050511 nmdc:mga08y16_129122_c1 nmdc:mga08y16_129122_c1_1337_1753 134
203 3300053077 Ga0495601_0037678 Ga0495601_0037678_1321_1731 134
204 3300060353 Ga0501082_0038642 Ga0501082_0038642_196_606 134
205 3300005295 Ga0065707_10087064 Ga0065707_100870647 135
206 3300005327 Ga0070658_10081234 Ga0070658_100812343 135
207 3300005337 Ga0070682_100051634 Ga0070682_1000516344 135
208 3300005339 Ga0070660_100079672 Ga0070660_1000796722 135
209 3300005347 Ga0070668_100616941 Ga0070668_1006169412 135
210 3300005458 Ga0070681_10001821 Ga0070681_1000182115 135
211 3300005459 Ga0068867_100141508 Ga0068867_1001415082 135
212 3300005530 Ga0070679_100194069 Ga0070679_1001940692 135
213 3300005530 Ga0070679_100356404 Ga0070679_1003564044 135
214 3300005543 Ga0070672_101746040 Ga0070672_1017460401 135
215 3300005545 Ga0070695_100174256 Ga0070695_1001742562 135
216 3300005548 Ga0070665_102506467 Ga0070665_1025064671 135
217 3300005563 Ga0068855_100211256 Ga0068855_1002112562 135
218 3300005564 Ga0070664_100763180 Ga0070664_1007631801 135
219 3300005577 Ga0068857_100034685 Ga0068857_1000346854 135
220 3300005614 Ga0068856_100052369 Ga0068856_1000523692 135
221 3300005719 Ga0068861_101069962 Ga0068861_1010699622 135
222 3300005841 Ga0068863_102407628 Ga0068863_1024076281 135
223 3300007076 Ga0075435_101797919 Ga0075435_1017979191 135
224 3300009093 Ga0105240_10003289 Ga0105240_100032894 135
225 3300009093 Ga0105240_10251676 Ga0105240_102516763 135
226 3300009094 Ga0111539_11173545 Ga0111539_111735451 135
227 3300009551 Ga0105238_10012194 Ga0105238_100121942 135
228 3300014325 Ga0163163_10001175 Ga0163163_1000117525 135
229 3300014326 Ga0157380_10055292 Ga0157380_100552922 135
230 3300014326 Ga0157380_10631083 Ga0157380_106310831 135
231 3300014326 Ga0157380_11508418 Ga0157380_115084182 135
232 3300021358 Ga0213873_10119193 Ga0213873_101191932 135
233 3300025885 Ga0207653_10069419 Ga0207653_100694192 135
234 3300025909 Ga0207705_10154448 Ga0207705_101544482 135
235 3300025913 Ga0207695_10043515 Ga0207695_100435154 135
236 3300025914 Ga0207671_10000278 Ga0207671_100002784 135
237 3300025919 Ga0207657_10340465 Ga0207657_103404651 135
238 3300025921 Ga0207652_10147705 Ga0207652_101477052 135
239 3300025924 Ga0207694_10013532 Ga0207694_100135326 135
240 3300025925 Ga0207650_10181560 Ga0207650_101815602 135
241 3300025925 Ga0207650_10206935 Ga0207650_102069351 135
242 3300025926 Ga0207659_10110349 Ga0207659_101103492 135
243 3300025932 Ga0207690_10680536 Ga0207690_106805361 135
244 3300025942 Ga0207689_10272279 Ga0207689_102722792 135
245 3300025945 Ga0207679_10683442 Ga0207679_106834421 135
246 3300025949 Ga0207667_10116617 Ga0207667_101166173 135
247 3300025960 Ga0207651_10112117 Ga0207651_101121172 135
248 3300028573 Ga0265334_10118299 Ga0265334_101182992 135
249 3300028577 Ga0265318_10000160 Ga0265318_1000016043 135
250 3300028800 Ga0265338_10336515 Ga0265338_103365152 135
251 3300031235 Ga0265330_10000084 Ga0265330_1000008413 135
252 3300031238 Ga0265332_10000518 Ga0265332_100005188 135
253 3300031239 Ga0265328_10004449 Ga0265328_100044493 135
254 3300031240 Ga0265320_10000144 Ga0265320_1000014443 135
255 3300031240 Ga0265320_10231262 Ga0265320_102312621 135
256 3300031241 Ga0265325_10321592 Ga0265325_103215921 135
257 3300031242 Ga0265329_10006155 Ga0265329_100061552 135
258 3300031250 Ga0265331_10000264 Ga0265331_1000026443 135
259 3300031344 Ga0265316_10014879 Ga0265316_100148792 135
260 3300031595 Ga0265313_10000404 Ga0265313_1000040413 135
261 3300031595 Ga0265313_10020862 Ga0265313_100208624 135
262 3300031711 Ga0265314_10000385 Ga0265314_1000038543 135
263 3300031712 Ga0265342_10063487 Ga0265342_100634875 135
264 3300031712 Ga0265342_10137397 Ga0265342_101373971 135
265 3300039453 Ga0436362_0830499 Ga0436362_0830499_3435_3854 135
266 3300041462 Ga0451806_486766 Ga0451806_486766_15_437 135
267 3300046460 Ga0495638_0043419 Ga0495638_0043419_297_728 135
268 3300001989 JGI24739J22299_10019000 JGI24739J22299_100190002 136
269 3300001990 JGI24737J22298_10026702 JGI24737J22298_100267022 136
270 3300002067 JGI24735J21928_10006056 JGI24735J21928_100060562 136
271 3300003354 JGI25160J50197_1046072 JGI25160J50197_10460722 136
272 3300005329 Ga0070683_100326919 Ga0070683_1003269193 136
273 3300005335 Ga0070666_10011547 Ga0070666_100115475 136
274 3300005337 Ga0070682_100299680 Ga0070682_1002996803 136
275 3300005338 Ga0068868_100439036 Ga0068868_1004390362 136
276 3300005356 Ga0070674_100430873 Ga0070674_1004308732 136
277 3300005367 Ga0070667_100013597 Ga0070667_1000135973 136
278 3300005445 Ga0070708_100496865 Ga0070708_1004968652 136
279 3300005455 Ga0070663_100034280 Ga0070663_1000342803 136
280 3300005458 Ga0070681_10066337 Ga0070681_100663371 136
281 3300005458 Ga0070681_11512293 Ga0070681_115122931 136
282 3300005459 Ga0068867_100136666 Ga0068867_1001366662 136
283 3300005535 Ga0070684_101460439 Ga0070684_1014604391 136
284 3300005539 Ga0068853_100146863 Ga0068853_1001468633 136
285 3300005545 Ga0070695_100353799 Ga0070695_1003537991 136
286 3300005546 Ga0070696_100671626 Ga0070696_1006716262 136
287 3300005548 Ga0070665_100175362 Ga0070665_1001753623 136
288 3300005548 Ga0070665_100289883 Ga0070665_1002898832 136
289 3300005548 Ga0070665_101475643 Ga0070665_1014756432 136
290 3300005563 Ga0068855_100366352 Ga0068855_1003663523 136
291 3300005563 Ga0068855_100865936 Ga0068855_1008659361 136
292 3300005564 Ga0070664_100845185 Ga0070664_1008451852 136
293 3300005577 Ga0068857_100061523 Ga0068857_1000615234 136
294 3300005617 Ga0068859_100403632 Ga0068859_1004036321 136
295 3300005718 Ga0068866_10514857 Ga0068866_105148572 136
296 3300005841 Ga0068863_100265640 Ga0068863_1002656401 136
297 3300005842 Ga0068858_100037359 Ga0068858_1000373596 136
298 3300005842 Ga0068858_101979493 Ga0068858_1019794931 136
299 3300005843 Ga0068860_100113101 Ga0068860_1001131013 136
300 3300006048 Ga0075363_100021961 Ga0075363_1000219613 136
301 3300006195 Ga0075366_10071689 Ga0075366_100716892 136
302 3300006237 Ga0097621_100052360 Ga0097621_1000523605 136
303 3300006237 Ga0097621_100106910 Ga0097621_1001069102 136
304 3300006237 Ga0097621_101720706 Ga0097621_1017207061 136
305 3300006358 Ga0068871_100069385 Ga0068871_1000693853 136
306 3300006358 Ga0068871_100276616 Ga0068871_1002766162 136
307 3300006844 Ga0075428_100564736 Ga0075428_1005647362 136
308 3300006847 Ga0075431_100587205 Ga0075431_1005872052 136
309 3300006847 Ga0075431_100831958 Ga0075431_1008319582 136
310 3300006880 Ga0075429_100003374 Ga0075429_10000337411 136
311 3300006880 Ga0075429_100496951 Ga0075429_1004969513 136
312 3300006881 Ga0068865_100189215 Ga0068865_1001892153 136
313 3300006931 Ga0097620_100403628 Ga0097620_1004036283 136
314 3300007076 Ga0075435_100558190 Ga0075435_1005581902 136
315 3300007265 Ga0099794_10108908 Ga0099794_101089081 136
316 3300009094 Ga0111539_10003306 Ga0111539_1000330621 136
317 3300009094 Ga0111539_10021894 Ga0111539_100218949 136
318 3300009094 Ga0111539_11240637 Ga0111539_112406371 136
319 3300009094 Ga0111539_11797714 Ga0111539_117977142 136
320 3300009147 Ga0114129_10008984 Ga0114129_1000898413 136
321 3300009176 Ga0105242_10006977 Ga0105242_100069773 136
322 3300009177 Ga0105248_10046020 Ga0105248_100460204 136
323 3300009545 Ga0105237_11907759 Ga0105237_119077591 136
324 3300009551 Ga0105238_10940318 Ga0105238_109403182 136
325 3300011119 Ga0105246_10523385 Ga0105246_105233852 136
326 3300011119 Ga0105246_11773288 Ga0105246_117732881 136
327 3300013105 Ga0157369_10730943 Ga0157369_107309431 136
328 3300013297 Ga0157378_11243708 Ga0157378_112437082 136
329 3300013306 Ga0163162_10226937 Ga0163162_102269372 136
330 3300013306 Ga0163162_10306837 Ga0163162_103068373 136
331 3300013308 Ga0157375_10277014 Ga0157375_102770141 136
332 3300014325 Ga0163163_10034053 Ga0163163_100340533 136
333 3300014969 Ga0157376_10012730 Ga0157376_100127304 136
334 3300014969 Ga0157376_12421888 Ga0157376_124218882 136
335 3300017792 Ga0163161_11893057 Ga0163161_118930571 136
336 3300020076 Ga0206355_1350711 Ga0206355_13507111 136
337 3300020080 Ga0206350_11423293 Ga0206350_114232932 136
338 3300022467 Ga0224712_10057505 Ga0224712_100575053 136
339 3300025302 Ga0207426_1003370 Ga0207426_10033702 136
340 3300025899 Ga0207642_10337504 Ga0207642_103375041 136
341 3300025903 Ga0207680_10008344 Ga0207680_100083444 136
342 3300025904 Ga0207647_10329459 Ga0207647_103294592 136
343 3300025906 Ga0207699_10968332 Ga0207699_109683321 136
344 3300025911 Ga0207654_11380980 Ga0207654_113809801 136
345 3300025912 Ga0207707_10499899 Ga0207707_104998992 136
346 3300025913 Ga0207695_10075299 Ga0207695_100752994 136
347 3300025913 Ga0207695_10419478 Ga0207695_104194782 136
348 3300025924 Ga0207694_10009430 Ga0207694_100094302 136
349 3300025924 Ga0207694_10633808 Ga0207694_106338081 136
350 3300025927 Ga0207687_10005541 Ga0207687_100055414 136
351 3300025927 Ga0207687_10049830 Ga0207687_100498305 136
352 3300025933 Ga0207706_10179825 Ga0207706_101798252 136
353 3300025934 Ga0207686_10089059 Ga0207686_100890592 136
354 3300025934 Ga0207686_10161618 Ga0207686_101616182 136
355 3300025938 Ga0207704_11377986 Ga0207704_113779861 136
356 3300025941 Ga0207711_10085535 Ga0207711_100855353 136
357 3300025941 Ga0207711_10097152 Ga0207711_100971523 136
358 3300025941 Ga0207711_10156220 Ga0207711_101562202 136
359 3300025944 Ga0207661_10122912 Ga0207661_101229123 136
360 3300025949 Ga0207667_10169338 Ga0207667_101693383 136
361 3300025986 Ga0207658_10021461 Ga0207658_100214613 136
362 3300026023 Ga0207677_10814953 Ga0207677_108149531 136
363 3300026035 Ga0207703_10004120 Ga0207703_1000412011 136
364 3300026041 Ga0207639_10756008 Ga0207639_107560082 136
365 3300026067 Ga0207678_10031631 Ga0207678_100316312 136
366 3300026078 Ga0207702_10317238 Ga0207702_103172382 136
367 3300026089 Ga0207648_10268012 Ga0207648_102680122 136
368 3300026089 Ga0207648_10453217 Ga0207648_104532171 136
369 3300026095 Ga0207676_10843971 Ga0207676_108439712 136
370 3300026116 Ga0207674_10077186 Ga0207674_100771864 136
371 3300027671 Ga0209588_1000591 Ga0209588_10005913 136
372 3300027907 Ga0207428_10130579 Ga0207428_101305792 136
373 3300028379 Ga0268266_10126210 Ga0268266_101262103 136
374 3300028379 Ga0268266_10467159 Ga0268266_104671592 136
375 3300028379 Ga0268266_10940450 Ga0268266_109404501 136
376 3300028381 Ga0268264_10189353 Ga0268264_101893533 136
377 3300031548 Ga0307408_100675332 Ga0307408_1006753321 136
378 3300031731 Ga0307405_10216190 Ga0307405_102161902 136
379 3300031903 Ga0307407_10335684 Ga0307407_103356842 136
380 3300031911 Ga0307412_10112122 Ga0307412_101121222 136
381 3300031995 Ga0307409_100001098 Ga0307409_1000010985 136
382 3300031995 Ga0307409_100520326 Ga0307409_1005203262 136
383 3300032005 Ga0307411_10039290 Ga0307411_100392904 136
384 3300032005 Ga0307411_10088639 Ga0307411_100886392 136
385 3300032126 Ga0307415_100661300 Ga0307415_1006613002 136
386 3300044694 Ga0466963_0677440 Ga0466963_0677440_82_492 136
387 3300045051 Ga0451576_0000006 Ga0451576_0000006_96003_96413 136
388 3300046460 Ga0495638_0021351 Ga0495638_0021351_3561_3983 136
389 3300046460 Ga0495638_0186081 Ga0495638_0186081_87_512 136
390 3300046471 Ga0495650_0000022 Ga0495650_0000022_105711_106136 136
391 3300046474 Ga0495605_0002109 Ga0495605_0002109_6973_7389 136
392 3300046491 Ga0495584_0030290 Ga0495584_0030290_1482_1907 136
393 3300046492 Ga0495585_0034383 Ga0495585_0034383_56_472 136
394 3300046512 Ga0495610_0314430 Ga0495610_0314430_156_572 136
395 3300046684 Ga0495669_0002518 Ga0495669_0002518_7016_7432 136
396 3300046691 Ga0495670_0004905 Ga0495670_0004905_43_459 136
397 3300046692 Ga0495671_0063960 Ga0495671_0063960_1040_1456 136
398 3300046694 Ga0495649_0013003 Ga0495649_0013003_3460_3876 136
399 3300046794 Ga0495589_0204728 Ga0495589_0204728_61_477 136
400 3300046810 Ga0495660_0043762 Ga0495660_0043762_26_442 136
401 3300047446 Ga0495679_044976 Ga0495679_044976_29_445 136
402 3300048091 Ga0495626_0209040 Ga0495626_0209040_271_687 136
403 3300048904 Ga0496101_0002922 Ga0496101_0002922_1916_2332 136
404 3300048906 Ga0496103_0114305 Ga0496103_0114305_214_633 136
405 3300048907 Ga0496104_0055263 Ga0496104_0055263_3292_3708 136
406 3300048908 Ga0496105_0079528 Ga0496105_0079528_329_745 136
407 3300048909 Ga0496106_0044716 Ga0496106_0044716_428_847 136
408 3300048910 Ga0496107_0007817 Ga0496107_0007817_2980_3396 136
409 3300048912 Ga0496109_0352817 Ga0496109_0352817_563_982 136
410 3300048913 Ga0496110_0075456 Ga0496110_0075456_1937_2356 136
411 3300048915 Ga0496112_0025641 Ga0496112_0025641_2490_2909 136
412 3300048916 Ga0496113_0234321 Ga0496113_0234321_624_1043 136
413 3300048917 Ga0496114_0697222 Ga0496114_0697222_427_843 136
414 3300048919 Ga0496116_0002045 Ga0496116_0002045_18199_18615 136
415 3300048920 Ga0496117_0003643 Ga0496117_0003643_9707_10123 136
416 3300048921 Ga0496118_0006911 Ga0496118_0006911_3000_3416 136
417 3300048924 Ga0496121_0001997 Ga0496121_0001997_21909_22325 136
418 3300048926 Ga0496123_0020557 Ga0496123_0020557_1416_1832 136
419 3300048929 Ga0496126_0019943 Ga0496126_0019943_719_1129 136
420 3300048929 Ga0496126_0553417 Ga0496126_0553417_365_784 136
421 3300049459 Ga0495678_023400 Ga0495678_023400_1398_1814 136
422 3300049514 Ga0501291_082556 Ga0501291_082556_202_612 136
423 3300049568 Ga0501031_0016517 Ga0501031_0016517_2617_3027 136
424 3300049569 Ga0501032_0513398 Ga0501032_0513398_141_551 136
425 3300049572 Ga0501036_0073428 Ga0501036_0073428_2025_2435 136
426 3300049574 Ga0501038_0186576 Ga0501038_0186576_404_814 136
427 3300049576 Ga0501040_0039344 Ga0501040_0039344_256_666 136
428 3300049577 Ga0501041_0273730 Ga0501041_0273730_146_556 136
429 3300049578 Ga0501042_0344741 Ga0501042_0344741_210_620 136
430 3300049580 Ga0501046_0316381 Ga0501046_0316381_493_903 136
431 3300049582 Ga0501048_0075906 Ga0501048_0075906_1096_1506 136
432 3300049584 Ga0501068_0104456 Ga0501068_0104456_1012_1422 136
433 3300049587 Ga0501071_0054879 Ga0501071_0054879_1162_1572 136
434 3300049588 Ga0501072_0141690 Ga0501072_0141690_166_576 136
435 3300049590 Ga0501074_0050292 Ga0501074_0050292_921_1331 136
436 3300049591 Ga0501075_0030713 Ga0501075_0030713_1522_1932 136
437 3300049592 Ga0501076_0271977 Ga0501076_0271977_581_991 136
438 3300049593 Ga0501077_0052836 Ga0501077_0052836_2013_2423 136
439 3300049741 Ga0501079_0071226 Ga0501079_0071226_1900_2310 136
440 3300049742 Ga0501080_0105408 Ga0501080_0105408_1412_1822 136
441 3300049743 Ga0501081_0373781 Ga0501081_0373781_325_735 136
442 3300049822 Ga0501035_0276813 Ga0501035_0276813_464_874 136
443 3300050490 nmdc:mga03n38_52095_c1 nmdc:mga03n38_52095_c1_462_890 136
444 3300050507 nmdc:mga05p37_40532_c1 nmdc:mga05p37_40532_c1_4724_5137 136
445 3300050508 nmdc:mga09592_11287_c1 nmdc:mga09592_11287_c1_5721_6134 136
446 3300050510 nmdc:mga06r32_493125_c1 nmdc:mga06r32_493125_c1_364_789 136
447 3300050511 nmdc:mga08y16_121251_c1 nmdc:mga08y16_121251_c1_259_669 136
448 3300050511 nmdc:mga08y16_88723_c1 nmdc:mga08y16_88723_c1_1546_1971 136
449 3300050512 nmdc:mga0n895_1415980_c1 nmdc:mga0n895_1415980_c1_33_452 136
450 3300053087 Ga0500643_012947 Ga0500643_012947_1490_1915 136
451 3300053103 Ga0500555_074593 Ga0500555_074593_56_466 136
452 3300000546 LJNas_1001694 LJNas_10016943 137
453 3300005295 Ga0065707_10575343 Ga0065707_105753431 137
454 3300005328 Ga0070676_10459387 Ga0070676_104593872 137
455 3300005329 Ga0070683_100014532 Ga0070683_1000145326 137
456 3300005330 Ga0070690_100022915 Ga0070690_1000229151 137
457 3300005333 Ga0070677_10034532 Ga0070677_100345323 137
458 3300005336 Ga0070680_100056302 Ga0070680_1000563025 137
459 3300005336 Ga0070680_100135952 Ga0070680_1001359522 137
460 3300005336 Ga0070680_100526542 Ga0070680_1005265421 137
461 3300005336 Ga0070680_100879287 Ga0070680_1008792872 137
462 3300005337 Ga0070682_100440813 Ga0070682_1004408131 137
463 3300005338 Ga0068868_100663348 Ga0068868_1006633481 137
464 3300005338 Ga0068868_101558113 Ga0068868_1015581131 137
465 3300005339 Ga0070660_100006936 Ga0070660_1000069362 137
466 3300005339 Ga0070660_100606388 Ga0070660_1006063882 137
467 3300005339 Ga0070660_101179924 Ga0070660_1011799242 137
468 3300005340 Ga0070689_100074231 Ga0070689_1000742312 137
469 3300005340 Ga0070689_100093389 Ga0070689_1000933892 137
470 3300005340 Ga0070689_100286455 Ga0070689_1002864553 137
471 3300005344 Ga0070661_100204512 Ga0070661_1002045122 137
472 3300005347 Ga0070668_100138606 Ga0070668_1001386063 137
473 3300005347 Ga0070668_100380698 Ga0070668_1003806982 137
474 3300005353 Ga0070669_100537399 Ga0070669_1005373992 137
475 3300005354 Ga0070675_100084124 Ga0070675_1000841244 137
476 3300005354 Ga0070675_100086621 Ga0070675_1000866212 137
477 3300005354 Ga0070675_100970290 Ga0070675_1009702901 137
478 3300005355 Ga0070671_100014275 Ga0070671_1000142756 137
479 3300005355 Ga0070671_100905581 Ga0070671_1009055812 137
480 3300005364 Ga0070673_100021234 Ga0070673_1000212342 137
481 3300005364 Ga0070673_100082825 Ga0070673_1000828254 137
482 3300005364 Ga0070673_100092788 Ga0070673_1000927881 137
483 3300005364 Ga0070673_101414275 Ga0070673_1014142752 137
484 3300005364 Ga0070673_101490652 Ga0070673_1014906521 137
485 3300005365 Ga0070688_100006642 Ga0070688_1000066422 137
486 3300005365 Ga0070688_100137146 Ga0070688_1001371463 137
487 3300005365 Ga0070688_100346586 Ga0070688_1003465862 137
488 3300005365 Ga0070688_100626785 Ga0070688_1006267852 137
489 3300005366 Ga0070659_100028575 Ga0070659_1000285755 137
490 3300005366 Ga0070659_101526033 Ga0070659_1015260331 137
491 3300005367 Ga0070667_100119570 Ga0070667_1001195703 137
492 3300005406 Ga0070703_10159295 Ga0070703_101592951 137
493 3300005434 Ga0070709_10047283 Ga0070709_100472832 137
494 3300005434 Ga0070709_11167343 Ga0070709_111673431 137
495 3300005435 Ga0070714_100065164 Ga0070714_1000651642 137
496 3300005435 Ga0070714_100230448 Ga0070714_1002304483 137
497 3300005435 Ga0070714_100844896 Ga0070714_1008448962 137
498 3300005436 Ga0070713_100016796 Ga0070713_1000167964 137
499 3300005436 Ga0070713_100077999 Ga0070713_1000779992 137
500 3300005436 Ga0070713_100619879 Ga0070713_1006198791 137
501 3300005437 Ga0070710_10883365 Ga0070710_108833651 137
502 3300005438 Ga0070701_10768998 Ga0070701_107689982 137
503 3300005439 Ga0070711_100076147 Ga0070711_1000761471 137
504 3300005439 Ga0070711_100240552 Ga0070711_1002405522 137
505 3300005439 Ga0070711_100468072 Ga0070711_1004680721 137
506 3300005440 Ga0070705_100064876 Ga0070705_1000648761 137
507 3300005440 Ga0070705_100083029 Ga0070705_1000830292 137
508 3300005440 Ga0070705_100715728 Ga0070705_1007157282 137
509 3300005440 Ga0070705_100865791 Ga0070705_1008657911 137
510 3300005444 Ga0070694_100354882 Ga0070694_1003548822 137
511 3300005444 Ga0070694_100480046 Ga0070694_1004800462 137
512 3300005444 Ga0070694_101154765 Ga0070694_1011547651 137
513 3300005445 Ga0070708_100530987 Ga0070708_1005309872 137
514 3300005445 Ga0070708_100765806 Ga0070708_1007658062 137
515 3300005456 Ga0070678_100638025 Ga0070678_1006380252 137
516 3300005457 Ga0070662_101122274 Ga0070662_1011222742 137
517 3300005458 Ga0070681_10017662 Ga0070681_100176629 137
518 3300005458 Ga0070681_10039710 Ga0070681_100397103 137
519 3300005458 Ga0070681_10138993 Ga0070681_101389932 137
520 3300005458 Ga0070681_10850242 Ga0070681_108502422 137
521 3300005459 Ga0068867_100196068 Ga0068867_1001960682 137
522 3300005468 Ga0070707_100854486 Ga0070707_1008544861 137
523 3300005468 Ga0070707_101631829 Ga0070707_1016318291 137
524 3300005471 Ga0070698_100013880 Ga0070698_10001388010 137
525 3300005471 Ga0070698_100176063 Ga0070698_1001760633 137
526 3300005471 Ga0070698_100429553 Ga0070698_1004295532 137
527 3300005471 Ga0070698_100933693 Ga0070698_1009336932 137
528 3300005518 Ga0070699_100000756 Ga0070699_10000075612 137
529 3300005518 Ga0070699_100008827 Ga0070699_1000088277 137
530 3300005518 Ga0070699_100278110 Ga0070699_1002781101 137
531 3300005518 Ga0070699_100395736 Ga0070699_1003957362 137
532 3300005518 Ga0070699_100480935 Ga0070699_1004809351 137
533 3300005518 Ga0070699_100620095 Ga0070699_1006200952 137
534 3300005530 Ga0070679_100027556 Ga0070679_1000275568 137
535 3300005530 Ga0070679_100235244 Ga0070679_1002352442 137
536 3300005535 Ga0070684_100001913 Ga0070684_1000019135 137
537 3300005535 Ga0070684_100078687 Ga0070684_1000786875 137
538 3300005535 Ga0070684_102150412 Ga0070684_1021504121 137
539 3300005536 Ga0070697_100346871 Ga0070697_1003468712 137
540 3300005536 Ga0070697_100568418 Ga0070697_1005684182 137
541 3300005539 Ga0068853_100003590 Ga0068853_10000359012 137
542 3300005539 Ga0068853_100095948 Ga0068853_1000959482 137
543 3300005539 Ga0068853_100523009 Ga0068853_1005230092 137
544 3300005543 Ga0070672_100021117 Ga0070672_1000211174 137
545 3300005543 Ga0070672_100022820 Ga0070672_1000228207 137
546 3300005543 Ga0070672_100138629 Ga0070672_1001386292 137
547 3300005543 Ga0070672_100350342 Ga0070672_1003503422 137
548 3300005544 Ga0070686_100094766 Ga0070686_1000947662 137
549 3300005545 Ga0070695_100179658 Ga0070695_1001796581 137
550 3300005546 Ga0070696_100003969 Ga0070696_1000039697 137
551 3300005546 Ga0070696_100035553 Ga0070696_1000355532 137
552 3300005546 Ga0070696_100210891 Ga0070696_1002108912 137
553 3300005546 Ga0070696_100986611 Ga0070696_1009866112 137
554 3300005547 Ga0070693_100757297 Ga0070693_1007572971 137
555 3300005548 Ga0070665_100000472 Ga0070665_10000047224 137
556 3300005548 Ga0070665_100001250 Ga0070665_1000012502 137
557 3300005548 Ga0070665_100148555 Ga0070665_1001485553 137
558 3300005548 Ga0070665_100542734 Ga0070665_1005427341 137
559 3300005548 Ga0070665_100571624 Ga0070665_1005716242 137
560 3300005548 Ga0070665_100579380 Ga0070665_1005793802 137
561 3300005548 Ga0070665_100629658 Ga0070665_1006296582 137
562 3300005548 Ga0070665_100956055 Ga0070665_1009560551 137
563 3300005549 Ga0070704_100283865 Ga0070704_1002838652 137
564 3300005549 Ga0070704_100293290 Ga0070704_1002932902 137
565 3300005563 Ga0068855_100460714 Ga0068855_1004607142 137
566 3300005564 Ga0070664_100329660 Ga0070664_1003296602 137
567 3300005577 Ga0068857_100046709 Ga0068857_1000467094 137
568 3300005578 Ga0068854_100000738 Ga0068854_10000073810 137
569 3300005578 Ga0068854_101139866 Ga0068854_1011398662 137
570 3300005614 Ga0068856_100257540 Ga0068856_1002575403 137
571 3300005614 Ga0068856_101925927 Ga0068856_1019259271 137
572 3300005615 Ga0070702_100001060 Ga0070702_1000010609 137
573 3300005615 Ga0070702_100534428 Ga0070702_1005344282 137
574 3300005616 Ga0068852_100351640 Ga0068852_1003516403 137
575 3300005617 Ga0068859_100066701 Ga0068859_1000667012 137
576 3300005617 Ga0068859_100534772 Ga0068859_1005347723 137
577 3300005617 Ga0068859_100538753 Ga0068859_1005387532 137
578 3300005617 Ga0068859_100818545 Ga0068859_1008185452 137
579 3300005618 Ga0068864_100039880 Ga0068864_1000398805 137
580 3300005618 Ga0068864_100097308 Ga0068864_1000973085 137
581 3300005618 Ga0068864_100486535 Ga0068864_1004865351 137
582 3300005618 Ga0068864_100642702 Ga0068864_1006427022 137
583 3300005719 Ga0068861_100097989 Ga0068861_1000979894 137
584 3300005840 Ga0068870_10026613 Ga0068870_100266132 137
585 3300005840 Ga0068870_11376633 Ga0068870_113766332 137
586 3300005841 Ga0068863_100028857 Ga0068863_1000288577 137
587 3300005841 Ga0068863_100066187 Ga0068863_1000661874 137
588 3300005841 Ga0068863_100448543 Ga0068863_1004485432 137
589 3300005841 Ga0068863_102469689 Ga0068863_1024696891 137
590 3300005842 Ga0068858_100089336 Ga0068858_1000893363 137
591 3300005842 Ga0068858_100405422 Ga0068858_1004054222 137
592 3300005842 Ga0068858_100736569 Ga0068858_1007365691 137
593 3300005843 Ga0068860_100048607 Ga0068860_1000486072 137
594 3300005843 Ga0068860_100676303 Ga0068860_1006763032 137
595 3300005844 Ga0068862_100891676 Ga0068862_1008916761 137
596 3300006028 Ga0070717_11102651 Ga0070717_111026512 137
597 3300006038 Ga0075365_10005044 Ga0075365_100050445 137
598 3300006038 Ga0075365_10032431 Ga0075365_100324314 137
599 3300006038 Ga0075365_10464713 Ga0075365_104647131 137
600 3300006038 Ga0075365_10520135 Ga0075365_105201351 137
601 3300006042 Ga0075368_10001652 Ga0075368_100016526 137
602 3300006048 Ga0075363_100020335 Ga0075363_1000203352 137
603 3300006051 Ga0075364_10050476 Ga0075364_100504763 137
604 3300006163 Ga0070715_10789991 Ga0070715_107899911 137
605 3300006178 Ga0075367_10012711 Ga0075367_100127114 137
606 3300006178 Ga0075367_10033438 Ga0075367_100334383 137
607 3300006178 Ga0075367_10861693 Ga0075367_108616932 137
608 3300006186 Ga0075369_10022838 Ga0075369_100228383 137
609 3300006195 Ga0075366_10044419 Ga0075366_100444193 137
610 3300006195 Ga0075366_10212787 Ga0075366_102127872 137
611 3300006195 Ga0075366_10219408 Ga0075366_102194082 137
612 3300006237 Ga0097621_100197454 Ga0097621_1001974542 137
613 3300006237 Ga0097621_102214406 Ga0097621_1022144061 137
614 3300006353 Ga0075370_10007354 Ga0075370_100073546 137
615 3300006844 Ga0075428_100011868 Ga0075428_1000118682 137
616 3300006844 Ga0075428_100157992 Ga0075428_1001579923 137
617 3300006844 Ga0075428_100560944 Ga0075428_1005609442 137
618 3300006846 Ga0075430_100091478 Ga0075430_1000914782 137
619 3300006846 Ga0075430_100184282 Ga0075430_1001842823 137
620 3300006846 Ga0075430_100216580 Ga0075430_1002165802 137
621 3300006846 Ga0075430_100383311 Ga0075430_1003833113 137
622 3300006846 Ga0075430_100557577 Ga0075430_1005575772 137
623 3300006847 Ga0075431_100031779 Ga0075431_1000317794 137
624 3300006847 Ga0075431_101931563 Ga0075431_1019315631 137
625 3300006852 Ga0075433_10520957 Ga0075433_105209571 137
626 3300006871 Ga0075434_100670316 Ga0075434_1006703162 137
627 3300006880 Ga0075429_100115648 Ga0075429_1001156482 137
628 3300006881 Ga0068865_100791942 Ga0068865_1007919422 137
629 3300006914 Ga0075436_100180074 Ga0075436_1001800742 137
630 3300006914 Ga0075436_100190447 Ga0075436_1001904472 137
631 3300006931 Ga0097620_100066701 Ga0097620_1000667012 137
632 3300006931 Ga0097620_100534787 Ga0097620_1005347872 137
633 3300006931 Ga0097620_100538650 Ga0097620_1005386502 137
634 3300006931 Ga0097620_100818687 Ga0097620_1008186871 137
635 3300007076 Ga0075435_100230454 Ga0075435_1002304542 137
636 3300009093 Ga0105240_10150608 Ga0105240_101506084 137
637 3300009093 Ga0105240_11252382 Ga0105240_112523822 137
638 3300009094 Ga0111539_10000077 Ga0111539_1000007730 137
639 3300009098 Ga0105245_11160707 Ga0105245_111607072 137
640 3300009101 Ga0105247_10657978 Ga0105247_106579782 137
641 3300009147 Ga0114129_12831810 Ga0114129_128318102 137
642 3300009177 Ga0105248_11825797 Ga0105248_118257972 137
643 3300009545 Ga0105237_10026579 Ga0105237_100265797 137
644 3300009545 Ga0105237_10276157 Ga0105237_102761573 137
645 3300009545 Ga0105237_10306741 Ga0105237_103067412 137
646 3300009545 Ga0105237_10721395 Ga0105237_107213951 137
647 3300009551 Ga0105238_10001743 Ga0105238_100017435 137
648 3300009551 Ga0105238_10018637 Ga0105238_100186374 137
649 3300009551 Ga0105238_10023731 Ga0105238_100237312 137
650 3300009551 Ga0105238_10544751 Ga0105238_105447512 137
651 3300009551 Ga0105238_11754103 Ga0105238_117541031 137
652 3300009553 Ga0105249_13323060 Ga0105249_133230601 137
653 3300010375 Ga0105239_10232066 Ga0105239_102320662 137
654 3300010375 Ga0105239_12096390 Ga0105239_120963902 137
655 3300013102 Ga0157371_10164182 Ga0157371_101641822 137
656 3300013104 Ga0157370_10853125 Ga0157370_108531252 137
657 3300013104 Ga0157370_10884638 Ga0157370_108846382 137
658 3300013105 Ga0157369_10020019 Ga0157369_100200193 137
659 3300013105 Ga0157369_10086636 Ga0157369_100866362 137
660 3300013105 Ga0157369_10285994 Ga0157369_102859943 137
661 3300013105 Ga0157369_10693705 Ga0157369_106937052 137
662 3300013296 Ga0157374_10438900 Ga0157374_104389002 137
663 3300013296 Ga0157374_11087640 Ga0157374_110876402 137
664 3300013297 Ga0157378_11255824 Ga0157378_112558241 137
665 3300013306 Ga0163162_10018269 Ga0163162_100182695 137
666 3300013307 Ga0157372_10693317 Ga0157372_106933172 137
667 3300013307 Ga0157372_11655181 Ga0157372_116551811 137
668 3300013308 Ga0157375_10017976 Ga0157375_100179762 137
669 3300014325 Ga0163163_10574153 Ga0163163_105741532 137
670 3300014325 Ga0163163_11603745 Ga0163163_116037451 137
671 3300014325 Ga0163163_11720362 Ga0163163_117203621 137
672 3300014326 Ga0157380_10003757 Ga0157380_100037575 137
673 3300014326 Ga0157380_10050020 Ga0157380_100500205 137
674 3300014326 Ga0157380_10096266 Ga0157380_100962662 137
675 3300014326 Ga0157380_10428354 Ga0157380_104283542 137
676 3300014326 Ga0157380_10474033 Ga0157380_104740332 137
677 3300014326 Ga0157380_10619663 Ga0157380_106196632 137
678 3300014326 Ga0157380_11905634 Ga0157380_119056342 137
679 3300014745 Ga0157377_10058956 Ga0157377_100589563 137
680 3300014745 Ga0157377_10488276 Ga0157377_104882762 137
681 3300014968 Ga0157379_10186132 Ga0157379_101861323 137
682 3300014968 Ga0157379_10240962 Ga0157379_102409623 137
683 3300014969 Ga0157376_10095961 Ga0157376_100959613 137
684 3300014969 Ga0157376_10834667 Ga0157376_108346672 137
685 3300017792 Ga0163161_10491754 Ga0163161_104917541 137
686 3300017792 Ga0163161_11865395 Ga0163161_118653951 137
687 3300020070 Ga0206356_10603777 Ga0206356_106037771 137
688 3300021358 Ga0213873_10001286 Ga0213873_100012863 137
689 3300021361 Ga0213872_10000410 Ga0213872_1000041017 137
690 3300021361 Ga0213872_10227148 Ga0213872_102271481 137
691 3300021384 Ga0213876_10001491 Ga0213876_1000149111 137
692 3300021388 Ga0213875_10053858 Ga0213875_100538584 137
693 3300022467 Ga0224712_10368195 Ga0224712_103681951 137
694 3300022467 Ga0224712_10589097 Ga0224712_105890971 137
695 3300022732 Ga0224569_101138 Ga0224569_1011382 137
696 3300022734 Ga0224571_100306 Ga0224571_1003063 137
697 3300024225 Ga0224572_1089281 Ga0224572_10892811 137
698 3300024227 Ga0228598_1013328 Ga0228598_10133282 137
699 3300025893 Ga0207682_10034274 Ga0207682_100342742 137
700 3300025893 Ga0207682_10079387 Ga0207682_100793872 137
701 3300025900 Ga0207710_10010195 Ga0207710_100101953 137
702 3300025901 Ga0207688_10243153 Ga0207688_102431532 137
703 3300025903 Ga0207680_10164256 Ga0207680_101642563 137
704 3300025904 Ga0207647_10053824 Ga0207647_100538243 137
705 3300025906 Ga0207699_10020124 Ga0207699_100201245 137
706 3300025906 Ga0207699_10072594 Ga0207699_100725944 137
707 3300025907 Ga0207645_10050255 Ga0207645_100502552 137
708 3300025908 Ga0207643_10396497 Ga0207643_103964972 137
709 3300025909 Ga0207705_10084861 Ga0207705_100848613 137
710 3300025910 Ga0207684_10140711 Ga0207684_101407112 137
711 3300025910 Ga0207684_11116058 Ga0207684_111160581 137
712 3300025910 Ga0207684_11727026 Ga0207684_117270261 137
713 3300025911 Ga0207654_10138583 Ga0207654_101385832 137
714 3300025912 Ga0207707_10001016 Ga0207707_1000101619 137
715 3300025912 Ga0207707_10074899 Ga0207707_100748993 137
716 3300025912 Ga0207707_11184262 Ga0207707_111842622 137
717 3300025913 Ga0207695_10067471 Ga0207695_100674711 137
718 3300025913 Ga0207695_10356085 Ga0207695_103560852 137
719 3300025914 Ga0207671_10031884 Ga0207671_100318842 137
720 3300025914 Ga0207671_10034743 Ga0207671_100347432 137
721 3300025914 Ga0207671_11099040 Ga0207671_110990402 137
722 3300025915 Ga0207693_10506859 Ga0207693_105068592 137
723 3300025915 Ga0207693_10568868 Ga0207693_105688682 137
724 3300025915 Ga0207693_10826340 Ga0207693_108263402 137
725 3300025916 Ga0207663_10660754 Ga0207663_106607541 137
726 3300025916 Ga0207663_10963947 Ga0207663_109639472 137
727 3300025917 Ga0207660_10000924 Ga0207660_1000092420 137
728 3300025917 Ga0207660_10227525 Ga0207660_102275251 137
729 3300025917 Ga0207660_11272732 Ga0207660_112727322 137
730 3300025919 Ga0207657_10001391 Ga0207657_1000139119 137
731 3300025919 Ga0207657_10070294 Ga0207657_100702941 137
732 3300025921 Ga0207652_10003893 Ga0207652_100038938 137
733 3300025921 Ga0207652_10201676 Ga0207652_102016762 137
734 3300025921 Ga0207652_10798153 Ga0207652_107981532 137
735 3300025921 Ga0207652_11295060 Ga0207652_112950601 137
736 3300025922 Ga0207646_10774558 Ga0207646_107745582 137
737 3300025922 Ga0207646_11157247 Ga0207646_111572472 137
738 3300025924 Ga0207694_10030192 Ga0207694_100301922 137
739 3300025924 Ga0207694_10143281 Ga0207694_101432812 137
740 3300025924 Ga0207694_10249457 Ga0207694_102494573 137
741 3300025924 Ga0207694_10574736 Ga0207694_105747362 137
742 3300025924 Ga0207694_10949253 Ga0207694_109492532 137
743 3300025925 Ga0207650_10038847 Ga0207650_100388473 137
744 3300025925 Ga0207650_10481726 Ga0207650_104817262 137
745 3300025925 Ga0207650_10655671 Ga0207650_106556712 137
746 3300025926 Ga0207659_10057006 Ga0207659_100570063 137
747 3300025926 Ga0207659_10102224 Ga0207659_101022244 137
748 3300025926 Ga0207659_10379219 Ga0207659_103792192 137
749 3300025927 Ga0207687_10356207 Ga0207687_103562072 137
750 3300025928 Ga0207700_10036339 Ga0207700_100363395 137
751 3300025928 Ga0207700_10365144 Ga0207700_103651441 137
752 3300025929 Ga0207664_10776520 Ga0207664_107765202 137
753 3300025931 Ga0207644_10006671 Ga0207644_100066714 137
754 3300025932 Ga0207690_10164702 Ga0207690_101647022 137
755 3300025933 Ga0207706_10437078 Ga0207706_104370782 137
756 3300025933 Ga0207706_10988563 Ga0207706_109885631 137
757 3300025936 Ga0207670_10008916 Ga0207670_100089162 137
758 3300025936 Ga0207670_10126979 Ga0207670_101269794 137
759 3300025936 Ga0207670_10140794 Ga0207670_101407942 137
760 3300025937 Ga0207669_10001908 Ga0207669_100019082 137
761 3300025938 Ga0207704_10940631 Ga0207704_109406312 137
762 3300025939 Ga0207665_10091265 Ga0207665_100912651 137
763 3300025940 Ga0207691_10014131 Ga0207691_100141317 137
764 3300025940 Ga0207691_10051753 Ga0207691_100517533 137
765 3300025940 Ga0207691_10260613 Ga0207691_102606132 137
766 3300025940 Ga0207691_10409061 Ga0207691_104090612 137
767 3300025941 Ga0207711_10058789 Ga0207711_100587895 137
768 3300025941 Ga0207711_10110236 Ga0207711_101102363 137
769 3300025941 Ga0207711_10140536 Ga0207711_101405362 137
770 3300025944 Ga0207661_10000421 Ga0207661_1000042113 137
771 3300025944 Ga0207661_10939226 Ga0207661_109392261 137
772 3300025944 Ga0207661_11177703 Ga0207661_111777032 137
773 3300025945 Ga0207679_10471259 Ga0207679_104712592 137
774 3300025945 Ga0207679_10898183 Ga0207679_108981832 137
775 3300025949 Ga0207667_10011614 Ga0207667_100116149 137
776 3300025949 Ga0207667_10320269 Ga0207667_103202692 137
777 3300025949 Ga0207667_10952451 Ga0207667_109524512 137
778 3300025960 Ga0207651_10146645 Ga0207651_101466452 137
779 3300025960 Ga0207651_10632119 Ga0207651_106321192 137
780 3300025972 Ga0207668_10994622 Ga0207668_109946221 137
781 3300025972 Ga0207668_11249376 Ga0207668_112493761 137
782 3300025972 Ga0207668_12014458 Ga0207668_120144581 137
783 3300025981 Ga0207640_10737658 Ga0207640_107376582 137
784 3300025986 Ga0207658_10055159 Ga0207658_100551594 137
785 3300025986 Ga0207658_10156750 Ga0207658_101567501 137
786 3300025986 Ga0207658_10399430 Ga0207658_103994302 137
787 3300025986 Ga0207658_11179460 Ga0207658_111794602 137
788 3300026023 Ga0207677_10656406 Ga0207677_106564061 137
789 3300026035 Ga0207703_10310417 Ga0207703_103104172 137
790 3300026035 Ga0207703_11229680 Ga0207703_112296801 137
791 3300026035 Ga0207703_12287443 Ga0207703_122874431 137
792 3300026041 Ga0207639_10246814 Ga0207639_102468142 137
793 3300026067 Ga0207678_10253431 Ga0207678_102534312 137
794 3300026067 Ga0207678_11335151 Ga0207678_113351512 137
795 3300026075 Ga0207708_10054534 Ga0207708_100545345 137
796 3300026075 Ga0207708_10177217 Ga0207708_101772172 137
797 3300026075 Ga0207708_10390124 Ga0207708_103901241 137
798 3300026078 Ga0207702_10377290 Ga0207702_103772902 137
799 3300026078 Ga0207702_10985232 Ga0207702_109852321 137
800 3300026088 Ga0207641_10015592 Ga0207641_100155926 137
801 3300026088 Ga0207641_10834384 Ga0207641_108343842 137
802 3300026089 Ga0207648_10050207 Ga0207648_100502074 137
803 3300026089 Ga0207648_10327339 Ga0207648_103273392 137
804 3300026095 Ga0207676_10085302 Ga0207676_100853022 137
805 3300026095 Ga0207676_10096720 Ga0207676_100967204 137
806 3300026095 Ga0207676_10111922 Ga0207676_101119222 137
807 3300026095 Ga0207676_10127786 Ga0207676_101277863 137
808 3300026095 Ga0207676_10445685 Ga0207676_104456852 137
809 3300026095 Ga0207676_10519004 Ga0207676_105190041 137
810 3300026116 Ga0207674_10012767 Ga0207674_100127678 137
811 3300026118 Ga0207675_101293395 Ga0207675_1012933952 137
812 3300026121 Ga0207683_10026846 Ga0207683_100268464 137
813 3300026121 Ga0207683_10249194 Ga0207683_102491943 137
814 3300026142 Ga0207698_10159960 Ga0207698_101599603 137
815 3300026142 Ga0207698_10630498 Ga0207698_106304981 137
816 3300027671 Ga0209588_1012966 Ga0209588_10129664 137
817 3300027866 Ga0209813_10044519 Ga0209813_100445192 137
818 3300027907 Ga0207428_10013101 Ga0207428_100131012 137
819 3300027907 Ga0207428_10672915 Ga0207428_106729151 137
820 3300028379 Ga0268266_10000556 Ga0268266_1000055624 137
821 3300028379 Ga0268266_10039341 Ga0268266_100393415 137
822 3300028379 Ga0268266_10048311 Ga0268266_100483115 137
823 3300028379 Ga0268266_10326531 Ga0268266_103265313 137
824 3300028379 Ga0268266_10397223 Ga0268266_103972233 137
825 3300028380 Ga0268265_10012154 Ga0268265_100121545 137
826 3300028381 Ga0268264_10223039 Ga0268264_102230393 137
827 3300028381 Ga0268264_10420862 Ga0268264_104208621 137
828 3300028381 Ga0268264_10793565 Ga0268264_107935652 137
829 3300030521 Ga0307511_10000022 Ga0307511_10000022114 137
830 3300031235 Ga0265330_10068245 Ga0265330_100682452 137
831 3300031235 Ga0265330_10328184 Ga0265330_103281841 137
832 3300031238 Ga0265332_10078877 Ga0265332_100788772 137
833 3300031238 Ga0265332_10113667 Ga0265332_101136672 137
834 3300031239 Ga0265328_10401206 Ga0265328_104012061 137
835 3300031240 Ga0265320_10390794 Ga0265320_103907941 137
836 3300031242 Ga0265329_10237003 Ga0265329_102370031 137
837 3300031247 Ga0265340_10059333 Ga0265340_100593333 137
838 3300031249 Ga0265339_10209776 Ga0265339_102097761 137
839 3300031250 Ga0265331_10113290 Ga0265331_101132903 137
840 3300031250 Ga0265331_10221813 Ga0265331_102218131 137
841 3300031344 Ga0265316_10327442 Ga0265316_103274421 137
842 3300031344 Ga0265316_10332619 Ga0265316_103326192 137
843 3300031507 Ga0307509_10043196 Ga0307509_100431965 137
844 3300031507 Ga0307509_10123960 Ga0307509_101239604 137
845 3300031548 Ga0307408_100605884 Ga0307408_1006058842 137
846 3300031595 Ga0265313_10101121 Ga0265313_101011212 137
847 3300031712 Ga0265342_10115041 Ga0265342_101150413 137
848 3300031731 Ga0307405_10060792 Ga0307405_100607923 137
849 3300031824 Ga0307413_10014216 Ga0307413_100142163 137
850 3300031852 Ga0307410_10139331 Ga0307410_101393312 137
851 3300031852 Ga0307410_10832262 Ga0307410_108322622 137
852 3300031903 Ga0307407_10116439 Ga0307407_101164392 137
853 3300031911 Ga0307412_10022402 Ga0307412_100224023 137
854 3300031911 Ga0307412_10790530 Ga0307412_107905301 137
855 3300031995 Ga0307409_100146109 Ga0307409_1001461092 137
856 3300032002 Ga0307416_100025448 Ga0307416_1000254484 137
857 3300032002 Ga0307416_101073577 Ga0307416_1010735772 137
858 3300032004 Ga0307414_10010424 Ga0307414_100104243 137
859 3300032004 Ga0307414_11206243 Ga0307414_112062431 137
860 3300032005 Ga0307411_10022213 Ga0307411_100222132 137
861 3300033179 Ga0307507_10192176 Ga0307507_101921763 137
862 3300035086 Ga0373934_0059885 Ga0373934_0059885_702_1118 137
863 3300035111 Ga0373923_0070190 Ga0373923_0070190_806_1222 137
864 3300035113 Ga0373936_0201340 Ga0373936_0201340_371_787 137
865 3300035117 Ga0373953_0004518 Ga0373953_0004518_2256_2672 137
866 3300035117 Ga0373953_0274254 Ga0373953_0274254_262_675 137
867 3300035118 Ga0373954_0003164 Ga0373954_0003164_5002_5418 137
868 3300035118 Ga0373954_0006861 Ga0373954_0006861_621_1040 137
869 3300035120 Ga0373957_0015715 Ga0373957_0015715_843_1259 137
870 3300035170 Ga0373943_0174919 Ga0373943_0174919_228_644 137
871 3300035172 Ga0373955_0012729 Ga0373955_0012729_2531_2947 137
872 3300035241 Ga0373961_0000747 Ga0373961_0000747_6365_6790 137
873 3300035692 Ga0373935_0065045 Ga0373935_0065045_1794_2210 137
874 3300035692 Ga0373935_0762880 Ga0373935_0762880_116_532 137
875 3300035724 Ga0373933_0028682 Ga0373933_0028682_1991_2407 137
876 3300036401 Ga0373937_0016441 Ga0373937_0016441_1017_1433 137
877 3300036401 Ga0373937_0278614 Ga0373937_0278614_76_504 137
878 3300037068 Ga0373925_0073627 Ga0373925_0073627_1609_2025 137
879 3300037068 Ga0373925_0210856 Ga0373925_0210856_737_1159 137
880 3300037312 Ga0395899_0190097 Ga0395899_0190097_101_517 137
881 3300037466 Ga0395898_0035872 Ga0395898_0035872_2492_2908 137
882 3300037471 Ga0395905_1630589 Ga0395905_1630589_17_445 137
883 3300037853 Ga0436364_0090800 Ga0436364_0090800_160_588 137
884 3300038443 Ga0395901_1117206 Ga0395901_1117206_62_478 137
885 3300039437 Ga0436365_0921625 Ga0436365_0921625_7357_7779 137
886 3300039447 Ga0436361_0381832 Ga0436361_0381832_62378_62806 137
887 3300039447 Ga0436361_0536137 Ga0436361_0536137_2008_2430 137
888 3300039447 Ga0436361_1199929 Ga0436361_1199929_83_505 137
889 3300039453 Ga0436362_0741099 Ga0436362_0741099_3420_3842 137
890 3300041494 Ga0451837_1384319 Ga0451837_1384319_138_560 137
891 3300041505 Ga0451849_0877464 Ga0451849_0877464_20_439 137
892 3300041507 Ga0451851_0309592 Ga0451851_0309592_74_502 137
893 3300041512 Ga0451853_0720400 Ga0451853_0720400_85_522 137
894 3300042876 Ga0451577_0006711 Ga0451577_0006711_4517_4939 137
895 3300042876 Ga0451577_0057187 Ga0451577_0057187_2557_2985 137
896 3300044673 Ga0453683_0066699 Ga0453683_0066699_1169_1591 137
897 3300044684 Ga0466966_0551906 Ga0466966_0551906_143_556 137
898 3300044712 Ga0453684_0169318 Ga0453684_0169318_1954_2376 137
899 3300045049 Ga0466959_0018159 Ga0466959_0018159_4195_4608 137
900 3300045051 Ga0451576_0017314 Ga0451576_0017314_994_1416 137
901 3300045051 Ga0451576_1389516 Ga0451576_1389516_18_446 137
902 3300046454 Ga0495592_0101071 Ga0495592_0101071_904_1323 137
903 3300046462 Ga0495651_0015643 Ga0495651_0015643_2240_2656 137
904 3300046462 Ga0495651_0376347 Ga0495651_0376347_258_686 137
905 3300046462 Ga0495651_0520233 Ga0495651_0520233_163_582 137
906 3300046463 Ga0495653_0065346 Ga0495653_0065346_1975_2391 137
907 3300046472 Ga0495580_0174662 Ga0495580_0174662_554_982 137
908 3300046477 Ga0495664_0063179 Ga0495664_0063179_435_863 137
909 3300046506 Ga0495583_0041057 Ga0495583_0041057_413_841 137
910 3300046511 Ga0495608_0060188 Ga0495608_0060188_338_754 137
911 3300046516 Ga0495628_0033413 Ga0495628_0033413_1372_1788 137
912 3300046516 Ga0495628_0292103 Ga0495628_0292103_211_639 137
913 3300046517 Ga0495630_0035014 Ga0495630_0035014_100_516 137
914 3300046518 Ga0495631_0138051 Ga0495631_0138051_594_1022 137
915 3300046524 Ga0495648_0158956 Ga0495648_0158956_291_719 137
916 3300046528 Ga0495642_0183382 Ga0495642_0183382_37_465 137
917 3300046529 Ga0495652_0054846 Ga0495652_0054846_510_926 137
918 3300046533 Ga0495640_0100517 Ga0495640_0100517_59_475 137
919 3300046535 Ga0495586_0037182 Ga0495586_0037182_806_1222 137
920 3300046535 Ga0495586_0521954 Ga0495586_0521954_158_586 137
921 3300046536 Ga0495587_0070475 Ga0495587_0070475_435_851 137
922 3300046537 Ga0495598_0041459 Ga0495598_0041459_387_815 137
923 3300046543 Ga0495645_0053112 Ga0495645_0053112_2463_2879 137
924 3300046543 Ga0495645_0461961 Ga0495645_0461961_159_587 137
925 3300046559 Ga0495667_0135062 Ga0495667_0135062_168_584 137
926 3300046642 Ga0495634_0018650 Ga0495634_0018650_1990_2406 137
927 3300046642 Ga0495634_0027571 Ga0495634_0027571_3428_3856 137
928 3300046660 Ga0495625_0000276 Ga0495625_0000276_2934_3356 137
929 3300046660 Ga0495625_0035398 Ga0495625_0035398_715_1143 137
930 3300046663 Ga0495635_0021252 Ga0495635_0021252_2249_2665 137
931 3300046665 Ga0495661_0350616 Ga0495661_0350616_98_526 137
932 3300046675 Ga0495657_0007196 Ga0495657_0007196_5611_6027 137
933 3300046675 Ga0495657_0107056 Ga0495657_0107056_380_799 137
934 3300046678 Ga0495599_0004838 Ga0495599_0004838_1770_2186 137
935 3300046678 Ga0495599_0448102 Ga0495599_0448102_328_747 137
936 3300046679 Ga0495623_0035399 Ga0495623_0035399_2373_2789 137
937 3300046679 Ga0495623_0492223 Ga0495623_0492223_20_448 137
938 3300046680 Ga0495646_0020107 Ga0495646_0020107_1325_1741 137
939 3300046680 Ga0495646_0188504 Ga0495646_0188504_189_617 137
940 3300046684 Ga0495669_0496228 Ga0495669_0496228_79_495 137
941 3300046689 Ga0495613_0071465 Ga0495613_0071465_1586_2014 137
942 3300046689 Ga0495613_0114323 Ga0495613_0114323_457_873 137
943 3300046690 Ga0495624_0193503 Ga0495624_0193503_279_695 137
944 3300046690 Ga0495624_0513014 Ga0495624_0513014_191_604 137
945 3300046694 Ga0495649_0170434 Ga0495649_0170434_701_1129 137
946 3300046809 Ga0495600_0035461 Ga0495600_0035461_1997_2416 137
947 3300046809 Ga0495600_0035500 Ga0495600_0035500_290_706 137
948 3300047317 Ga0495604_0090026 Ga0495604_0090026_389_805 137
949 3300047318 Ga0495636_0372469 Ga0495636_0372469_183_599 137
950 3300047319 Ga0495674_0249057 Ga0495674_0249057_880_1296 137
951 3300047319 Ga0495674_0843822 Ga0495674_0843822_95_517 137
952 3300047320 Ga0495672_0001069 Ga0495672_0001069_20426_20845 137
953 3300047320 Ga0495672_0061509 Ga0495672_0061509_1513_1944 137
954 3300047322 Ga0495680_0003456 Ga0495680_0003456_9570_9986 137
955 3300047444 Ga0495675_0025788 Ga0495675_0025788_2555_2971 137
956 3300047444 Ga0495675_0436784 Ga0495675_0436784_207_635 137
957 3300047471 Ga0495684_0301087 Ga0495684_0301087_172_600 137
958 3300047472 Ga0495686_0223310 Ga0495686_0223310_344_772 137
959 3300047472 Ga0495686_0582242 Ga0495686_0582242_78_512 137
960 3300047673 Ga0495593_0045311 Ga0495593_0045311_456_872 137
961 3300048088 Ga0495602_0085112 Ga0495602_0085112_768_1184 137
962 3300048903 Ga0496100_0327758 Ga0496100_0327758_437_850 137
963 3300048907 Ga0496104_0362043 Ga0496104_0362043_17_430 137
964 3300048910 Ga0496107_0502392 Ga0496107_0502392_457_885 137
965 3300048914 Ga0496111_0314263 Ga0496111_0314263_498_911 137
966 3300048915 Ga0496112_0029852 Ga0496112_0029852_4340_4753 137
967 3300048915 Ga0496112_1502347 Ga0496112_1502347_84_500 137
968 3300048916 Ga0496113_0101821 Ga0496113_0101821_882_1295 137
969 3300048916 Ga0496113_0577017 Ga0496113_0577017_59_475 137
970 3300048916 Ga0496113_1311620 Ga0496113_1311620_69_494 137
971 3300048917 Ga0496114_0814778 Ga0496114_0814778_168_581 137
972 3300048918 Ga0496115_0662255 Ga0496115_0662255_48_473 137
973 3300048918 Ga0496115_0961324 Ga0496115_0961324_40_459 137
974 3300048923 Ga0496120_0184646 Ga0496120_0184646_167_595 137
975 3300048924 Ga0496121_0054026 Ga0496121_0054026_1476_1889 137
976 3300048924 Ga0496121_0121929 Ga0496121_0121929_654_1091 137
977 3300048929 Ga0496126_0000245 Ga0496126_0000245_85942_86370 137
978 3300048929 Ga0496126_0002541 Ga0496126_0002541_4399_4818 137
979 3300048929 Ga0496126_0042857 Ga0496126_0042857_156_569 137
980 3300048929 Ga0496126_0120816 Ga0496126_0120816_1684_2121 137
981 3300048929 Ga0496126_0136221 Ga0496126_0136221_765_1190 137
982 3300049568 Ga0501031_0001415 Ga0501031_0001415_9250_9669 137
983 3300049569 Ga0501032_0003300 Ga0501032_0003300_2706_3125 137
984 3300049569 Ga0501032_0010264 Ga0501032_0010264_1859_2281 137
985 3300049569 Ga0501032_0272266 Ga0501032_0272266_155_577 137
986 3300049570 Ga0501033_0000175 Ga0501033_0000175_45123_45542 137
987 3300049570 Ga0501033_0002596 Ga0501033_0002596_11431_11853 137
988 3300049570 Ga0501033_0170236 Ga0501033_0170236_485_904 137
989 3300049571 Ga0501034_0000202 Ga0501034_0000202_103277_103696 137
990 3300049571 Ga0501034_0023442 Ga0501034_0023442_110_532 137
991 3300049571 Ga0501034_0036158 Ga0501034_0036158_460_879 137
992 3300049571 Ga0501034_0625182 Ga0501034_0625182_544_963 137
993 3300049572 Ga0501036_0000042 Ga0501036_0000042_70193_70612 137
994 3300049572 Ga0501036_0009069 Ga0501036_0009069_998_1420 137
995 3300049572 Ga0501036_0140323 Ga0501036_0140323_735_1154 137
996 3300049572 Ga0501036_0585066 Ga0501036_0585066_190_612 137
997 3300049573 Ga0501037_0000100 Ga0501037_0000100_67029_67448 137
998 3300049573 Ga0501037_0021307 Ga0501037_0021307_3302_3721 137
999 3300049574 Ga0501038_0000157 Ga0501038_0000157_45108_45527 137
1000 3300049574 Ga0501038_0007361 Ga0501038_0007361_6184_6606 137
1001 3300049574 Ga0501038_0039833 Ga0501038_0039833_71_499 137
1002 3300049574 Ga0501038_0119559 Ga0501038_0119559_969_1391 137
1003 3300049575 Ga0501039_0000216 Ga0501039_0000216_3177_3596 137
1004 3300049575 Ga0501039_0060540 Ga0501039_0060540_525_947 137
1005 3300049575 Ga0501039_0333285 Ga0501039_0333285_388_807 137
1006 3300049575 Ga0501039_1048704 Ga0501039_1048704_161_592 137
1007 3300049578 Ga0501042_0044070 Ga0501042_0044070_1199_1618 137
1008 3300049578 Ga0501042_0083958 Ga0501042_0083958_1263_1682 137
1009 3300049578 Ga0501042_0341662 Ga0501042_0341662_342_761 137
1010 3300049578 Ga0501042_0905269 Ga0501042_0905269_186_605 137
1011 3300049579 Ga0501043_0001316 Ga0501043_0001316_19670_20089 137
1012 3300049579 Ga0501043_0001633 Ga0501043_0001633_4622_5041 137
1013 3300049579 Ga0501043_0003155 Ga0501043_0003155_6644_7066 137
1014 3300049579 Ga0501043_0136348 Ga0501043_0136348_13_432 137
1015 3300049579 Ga0501043_0168155 Ga0501043_0168155_965_1384 137
1016 3300049579 Ga0501043_0168463 Ga0501043_0168463_618_1037 137
1017 3300049579 Ga0501043_0296168 Ga0501043_0296168_703_1122 137
1018 3300049580 Ga0501046_0000387 Ga0501046_0000387_36585_37004 137
1019 3300049580 Ga0501046_0000448 Ga0501046_0000448_17811_18233 137
1020 3300049581 Ga0501047_0000159 Ga0501047_0000159_11216_11635 137
1021 3300049581 Ga0501047_0000517 Ga0501047_0000517_25655_26077 137
1022 3300049581 Ga0501047_0000662 Ga0501047_0000662_5098_5526 137
1023 3300049581 Ga0501047_0002554 Ga0501047_0002554_1573_1992 137
1024 3300049581 Ga0501047_0161197 Ga0501047_0161197_681_1100 137
1025 3300049581 Ga0501047_0173014 Ga0501047_0173014_1183_1614 137
1026 3300049581 Ga0501047_0511003 Ga0501047_0511003_573_992 137
1027 3300049581 Ga0501047_0619979 Ga0501047_0619979_429_848 137
1028 3300049582 Ga0501048_0000655 Ga0501048_0000655_21629_22048 137
1029 3300049582 Ga0501048_0059248 Ga0501048_0059248_1116_1535 137
1030 3300049583 Ga0501067_0011823 Ga0501067_0011823_3244_3663 137
1031 3300049583 Ga0501067_0022683 Ga0501067_0022683_1273_1692 137
1032 3300049583 Ga0501067_0042271 Ga0501067_0042271_982_1413 137
1033 3300049583 Ga0501067_0069488 Ga0501067_0069488_1072_1491 137
1034 3300049583 Ga0501067_0085853 Ga0501067_0085853_269_697 137
1035 3300049584 Ga0501068_0000168 Ga0501068_0000168_14175_14594 137
1036 3300049584 Ga0501068_0009657 Ga0501068_0009657_2320_2748 137
1037 3300049584 Ga0501068_0254886 Ga0501068_0254886_546_968 137
1038 3300049584 Ga0501068_0501064 Ga0501068_0501064_273_704 137
1039 3300049585 Ga0501069_0001651 Ga0501069_0001651_7012_7440 137
1040 3300049585 Ga0501069_0002689 Ga0501069_0002689_4504_4923 137
1041 3300049585 Ga0501069_0025378 Ga0501069_0025378_1147_1566 137
1042 3300049586 Ga0501070_0002236 Ga0501070_0002236_2070_2489 137
1043 3300049586 Ga0501070_0089085 Ga0501070_0089085_1104_1526 137
1044 3300049586 Ga0501070_0173575 Ga0501070_0173575_620_1048 137
1045 3300049586 Ga0501070_0390018 Ga0501070_0390018_568_987 137
1046 3300049586 Ga0501070_0436350 Ga0501070_0436350_136_564 137
1047 3300049586 Ga0501070_0530874 Ga0501070_0530874_112_531 137
1048 3300049586 Ga0501070_1288770 Ga0501070_1288770_40_459 137
1049 3300049587 Ga0501071_0391584 Ga0501071_0391584_390_809 137
1050 3300049588 Ga0501072_0000003 Ga0501072_0000003_132740_133168 137
1051 3300049588 Ga0501072_0000475 Ga0501072_0000475_4193_4612 137
1052 3300049588 Ga0501072_0007057 Ga0501072_0007057_2984_3403 137
1053 3300049588 Ga0501072_0193413 Ga0501072_0193413_426_845 137
1054 3300049589 Ga0501073_0000678 Ga0501073_0000678_14232_14651 137
1055 3300049589 Ga0501073_0009782 Ga0501073_0009782_3112_3540 137
1056 3300049589 Ga0501073_0044288 Ga0501073_0044288_1873_2292 137
1057 3300049589 Ga0501073_0086560 Ga0501073_0086560_1346_1765 137
1058 3300049589 Ga0501073_0243568 Ga0501073_0243568_145_564 137
1059 3300049589 Ga0501073_0496636 Ga0501073_0496636_260_682 137
1060 3300049589 Ga0501073_0621219 Ga0501073_0621219_298_714 137
1061 3300049590 Ga0501074_0001904 Ga0501074_0001904_2024_2443 137
1062 3300049590 Ga0501074_0004788 Ga0501074_0004788_5104_5523 137
1063 3300049590 Ga0501074_0031818 Ga0501074_0031818_71_499 137
1064 3300049590 Ga0501074_0451679 Ga0501074_0451679_320_742 137
1065 3300049591 Ga0501075_0000346 Ga0501075_0000346_22163_22606 137
1066 3300049592 Ga0501076_0024992 Ga0501076_0024992_3392_3820 137
1067 3300049592 Ga0501076_0041535 Ga0501076_0041535_747_1166 137
1068 3300049592 Ga0501076_0711201 Ga0501076_0711201_139_558 137
1069 3300049593 Ga0501077_0000509 Ga0501077_0000509_2089_2532 137
1070 3300049593 Ga0501077_0111681 Ga0501077_0111681_664_1092 137
1071 3300049741 Ga0501079_0006064 Ga0501079_0006064_3223_3642 137
1072 3300049741 Ga0501079_0013419 Ga0501079_0013419_5025_5444 137
1073 3300049741 Ga0501079_0047364 Ga0501079_0047364_790_1218 137
1074 3300049742 Ga0501080_0004449 Ga0501080_0004449_391_810 137
1075 3300049742 Ga0501080_0039623 Ga0501080_0039623_3471_3893 137
1076 3300049742 Ga0501080_0047355 Ga0501080_0047355_1631_2062 137
1077 3300049742 Ga0501080_0053498 Ga0501080_0053498_3261_3680 137
1078 3300049742 Ga0501080_0072909 Ga0501080_0072909_1526_1945 137
1079 3300049742 Ga0501080_0163259 Ga0501080_0163259_1178_1606 137
1080 3300049742 Ga0501080_1418234 Ga0501080_1418234_133_552 137
1081 3300049742 Ga0501080_1802687 Ga0501080_1802687_14_433 137
1082 3300049744 Ga0501083_0001555 Ga0501083_0001555_9523_9942 137
1083 3300049744 Ga0501083_0006723 Ga0501083_0006723_6672_7091 137
1084 3300049744 Ga0501083_0012456 Ga0501083_0012456_1749_2180 137
1085 3300049744 Ga0501083_0015606 Ga0501083_0015606_603_1031 137
1086 3300049744 Ga0501083_0048909 Ga0501083_0048909_1590_2009 137
1087 3300049822 Ga0501035_0000172 Ga0501035_0000172_33505_33924 137
1088 3300049822 Ga0501035_0002828 Ga0501035_0002828_12558_12980 137
1089 3300049822 Ga0501035_0147241 Ga0501035_0147241_1006_1425 137
1090 3300049822 Ga0501035_0911809 Ga0501035_0911809_140_559 137
1091 3300049823 Ga0501044_0000282 Ga0501044_0000282_56400_56819 137
1092 3300049823 Ga0501044_0008603 Ga0501044_0008603_6688_7110 137
1093 3300049823 Ga0501044_0022656 Ga0501044_0022656_1506_1934 137
1094 3300049823 Ga0501044_0192181 Ga0501044_0192181_492_923 137
1095 3300049823 Ga0501044_0256082 Ga0501044_0256082_886_1305 137
1096 3300049823 Ga0501044_0356408 Ga0501044_0356408_63_485 137
1097 3300049823 Ga0501044_0434616 Ga0501044_0434616_138_557 137
1098 3300049824 Ga0501045_0019340 Ga0501045_0019340_1647_2066 137
1099 3300049824 Ga0501045_0311726 Ga0501045_0311726_434_853 137
1100 3300050489 nmdc:mga03683_106687_c1 nmdc:mga03683_106687_c1_100_525 137
1101 3300050489 nmdc:mga03683_478216_c1 nmdc:mga03683_478216_c1_159_572 137
1102 3300050490 nmdc:mga03n38_73719_c1 nmdc:mga03n38_73719_c1_118_543 137
1103 3300050492 nmdc:mga0yw44_21119_c1 nmdc:mga0yw44_21119_c1_443_868 137
1104 3300050492 nmdc:mga0yw44_3171_c1 nmdc:mga0yw44_3171_c1_1015_1455 137
1105 3300050493 nmdc:mga0k408_102419_c1 nmdc:mga0k408_102419_c1_58_483 137
1106 3300050493 nmdc:mga0k408_133482_c1 nmdc:mga0k408_133482_c1_505_918 137
1107 3300050493 nmdc:mga0k408_269530_c1 nmdc:mga0k408_269530_c1_415_846 137
1108 3300050493 nmdc:mga0k408_312026_c1 nmdc:mga0k408_312026_c1_298_780 137
1109 3300050494 nmdc:mga06z11_137944_c1 nmdc:mga06z11_137944_c1_44_469 137
1110 3300050494 nmdc:mga06z11_150671_c1 nmdc:mga06z11_150671_c1_203_634 137
1111 3300050494 nmdc:mga06z11_155863_c1 nmdc:mga06z11_155863_c1_258_740 137
1112 3300050494 nmdc:mga06z11_281339_c1 nmdc:mga06z11_281339_c1_78_500 137
1113 3300050495 nmdc:mga04h51_63377_c1 nmdc:mga04h51_63377_c1_263_688 137
1114 3300050496 nmdc:mga07m45_8009_c1 nmdc:mga07m45_8009_c1_149_574 137
1115 3300050507 nmdc:mga05p37_366228_c1 nmdc:mga05p37_366228_c1_40_468 137
1116 3300050508 nmdc:mga09592_1315941_c1 nmdc:mga09592_1315941_c1_94_522 137
1117 3300050508 nmdc:mga09592_710664_c1 nmdc:mga09592_710664_c1_22_447 137
1118 3300050509 nmdc:mga0qj67_74728_c1 nmdc:mga0qj67_74728_c1_1584_2018 137
1119 3300050509 nmdc:mga0qj67_751281_c1 nmdc:mga0qj67_751281_c1_101_523 137
1120 3300050509 nmdc:mga0qj67_796210_c1 nmdc:mga0qj67_796210_c1_282_698 137
1121 3300050509 nmdc:mga0qj67_82208_c1 nmdc:mga0qj67_82208_c1_1707_2126 137
1122 3300050509 nmdc:mga0qj67_899214_c1 nmdc:mga0qj67_899214_c1_234_662 137
1123 3300050511 nmdc:mga08y16_3101_c1 nmdc:mga08y16_3101_c1_9797_10225 137
1124 3300050511 nmdc:mga08y16_788423_c1 nmdc:mga08y16_788423_c1_213_677 137
1125 3300050511 nmdc:mga08y16_799409_c1 nmdc:mga08y16_799409_c1_186_614 137
1126 3300050512 nmdc:mga0n895_248667_c1 nmdc:mga0n895_248667_c1_215_643 137
1127 3300050512 nmdc:mga0n895_526687_c1 nmdc:mga0n895_526687_c1_551_967 137
1128 3300050514 nmdc:mga08x19_11855_c1 nmdc:mga08x19_11855_c1_2901_3329 137
1129 3300053077 Ga0495601_0106010 Ga0495601_0106010_551_967 137
1130 3300053078 Ga0495612_0022244 Ga0495612_0022244_1094_1510 137
1131 3300053084 Ga0495595_0194461 Ga0495595_0194461_331_747 137
1132 3300053085 Ga0495619_0405228 Ga0495619_0405228_510_926 137
1133 3300053085 Ga0495619_0405231 Ga0495619_0405231_510_926 137
1134 3300053090 Ga0500646_0000925 Ga0500646_0000925_5424_5837 137
1135 3300053092 Ga0500583_0008247 Ga0500583_0008247_1713_2126 137
1136 3300053093 Ga0500651_0000005 Ga0500651_0000005_294222_294650 137
1137 3300053093 Ga0500651_0000299 Ga0500651_0000299_26837_27259 137
1138 3300053098 Ga0500650_0003454 Ga0500650_0003454_3147_3560 137
1139 3300053104 Ga0500556_0136229 Ga0500556_0136229_246_659 137
1140 3300053111 Ga0500572_000533 Ga0500572_000533_11997_12413 137
1141 3300053119 Ga0500595_023318 Ga0500595_023318_1251_1679 137
1142 3300053133 Ga0500655_019811 Ga0500655_019811_282_695 137
1143 3300053136 Ga0500559_0009452 Ga0500559_0009452_676_1092 137
1144 3300053139 Ga0500568_0290552 Ga0500568_0290552_99_530 137
1145 3300053151 Ga0500604_0006069 Ga0500604_0006069_434_847 137
1146 3300053154 Ga0500619_000014 Ga0500619_000014_46995_47411 137
1147 3300053163 Ga0500639_097955 Ga0500639_097955_534_950 137
1148 3300053178 Ga0500637_0108892 Ga0500637_0108892_34_447 137
1149 3300053736 Ga0500599_005642 Ga0500599_005642_837_1349 137
1150 3300054114 Ga0501084_0000278 Ga0501084_0000278_27469_27897 137
1151 3300054114 Ga0501084_0023457 Ga0501084_0023457_3543_3962 137
1152 3300054114 Ga0501084_0152138 Ga0501084_0152138_1405_1824 137
1153 3300054114 Ga0501084_0360234 Ga0501084_0360234_287_718 137
1154 3300054114 Ga0501084_1027720 Ga0501084_1027720_40_459 137
1155 3300060353 Ga0501082_0005465 Ga0501082_0005465_8551_8970 137
1156 3300060353 Ga0501082_0005775 Ga0501082_0005775_6197_6625 137
1157 3300060353 Ga0501082_0044917 Ga0501082_0044917_2292_2723 137
1158 3300060353 Ga0501082_0416753 Ga0501082_0416753_173_598 137
1159 3300060353 Ga0501082_0950329 Ga0501082_0950329_216_635 137
1160 3300061719 Ga0466962_0107632 Ga0466962_0107632_227_640 137
1161 3300061734 Ga0530510_0043557 Ga0530510_0043557_893_1321 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

26

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8378 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7712 1 114
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7262 1 120
3pht-assembly1.cif.gz_B-2 crystal structure of h74a mutant of helicobacter pylori nikr 0.7204 2 112
3pht-assembly1.cif.gz_A-2 crystal structure of h74a mutant of helicobacter pylori nikr 0.7051 2 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8378 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7712 1 114 3.30.70.1060
3phtA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.7057 2 113 3.30.70.1150
af_Q60386_31_124_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.7055 2 112 3.30.70.1150
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7045 1 119 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A225DKA1-F1-model_v4 PhnB protein 0.993 1 134
AF-A0A1I4TZG8-F1-model_v4 Uncharacterized conserved protein 0.9923 1 125
AF-A0A1Q7RXR3-F1-model_v4 Transcription initiation protein 0.9897 1 127
AF-A0A0K1EPB2-F1-model_v4 Dehydrogenase 0.9896 1 125
AF-K9U9Q9-F1-model_v4 YCII-related protein 0.9894 1 127

Feature Viewer

pLDDT pTM Quality
94.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map