F491010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1161 | 520 | 2322 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10972052|Ga0207707_109720522 |
| Length | 99 |
| Sequence | MGLVIRLTRVGAKKRPQYRVVVADSRYPRDGRYLERLGTYNPMLAKDKRVDLELDRVKHWLSKGAQPSDRVARFLDAAGLMKRKARNNPEKAVPRKERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 218 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 219 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 250 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 251 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 252 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 253 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 259 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 273 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 373 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 374 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 431 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 432 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 433 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 434 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 435 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 437 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 438 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 440 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 441 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 442 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 443 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 444 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 445 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 448 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 449 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 451 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 452 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 453 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 456 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 459 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 460 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 461 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 462 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 469 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 470 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 471 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 472 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 473 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 474 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 475 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 476 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 477 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 478 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 479 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 480 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 481 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 482 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 483 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 484 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 485 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 486 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 487 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 488 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 489 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 490 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 491 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 492 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 493 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 494 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 495 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 496 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 497 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 498 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 499 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 500 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 501 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 502 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 503 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 504 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 505 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 506 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 507 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 508 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 509 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 510 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 511 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 512 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 513 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 514 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 515 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 516 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 517 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 518 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 519 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 520 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.23 |
| Metatranscriptomes | 1.38 |
| Isolates | 4.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.86 |
| Nodule | 4.22 |
| Rhizoplane | 5.08 |
| Rhizosphere | 79.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207707_10972052 | 3300025912 | Bacteria | 698 |
| 2 | JGI24739J22299_10014759 | 3300001989 | Bacteria | 2841 |
| 3 | JGI24737J22298_10004663 | 3300001990 | Bacteria | 4765 |
| 4 | JGI24735J21928_10050759 | 3300002067 | Bacteria | 1198 |
| 5 | JGI24744J21845_10011748 | 3300002077 | Bacteria | 1787 |
| 6 | Ga0070658_10249918 | 3300005327 | Bacteria | 1504 |
| 7 | Ga0070658_10935885 | 3300005327 | Bacteria | 753 |
| 8 | Ga0070676_10883334 | 3300005328 | Bacteria | 665 |
| 9 | Ga0070676_11068875 | 3300005328 | Bacteria | 608 |
| 10 | Ga0070683_100283347 | 3300005329 | Bacteria | 1576 |
| 11 | Ga0068869_102015950 | 3300005334 | Bacteria | 518 |
| 12 | Ga0070680_100028451 | 3300005336 | Bacteria | 4483 |
| 13 | Ga0070680_100042072 | 3300005336 | Bacteria | 3706 |
| 14 | Ga0070680_100375947 | 3300005336 | Bacteria | 1209 |
| 15 | Ga0070682_100045925 | 3300005337 | Bacteria | 2709 |
| 16 | Ga0070660_100123628 | 3300005339 | Bacteria | 2066 |
| 17 | Ga0070660_100955644 | 3300005339 | Bacteria | 723 |
| 18 | Ga0070689_100424420 | 3300005340 | Bacteria | 1128 |
| 19 | Ga0070691_10068228 | 3300005341 | Bacteria | 1721 |
| 20 | Ga0070687_100277394 | 3300005343 | Bacteria | 1054 |
| 21 | Ga0070661_101655238 | 3300005344 | Bacteria | 542 |
| 22 | Ga0070668_100146800 | 3300005347 | Bacteria | 1904 |
| 23 | Ga0070668_100630255 | 3300005347 | Bacteria | 940 |
| 24 | Ga0070675_102031974 | 3300005354 | Bacteria | 530 |
| 25 | Ga0070674_100562463 | 3300005356 | Bacteria | 958 |
| 26 | Ga0070673_100397078 | 3300005364 | Bacteria | 1232 |
| 27 | Ga0070673_101043446 | 3300005364 | Bacteria | 762 |
| 28 | Ga0070688_100847716 | 3300005365 | Bacteria | 718 |
| 29 | Ga0070659_100145959 | 3300005366 | Bacteria | 1927 |
| 30 | Ga0070659_100885153 | 3300005366 | Bacteria | 780 |
| 31 | Ga0070659_101446936 | 3300005366 | Bacteria | 611 |
| 32 | Ga0070667_100201893 | 3300005367 | Bacteria | 1764 |
| 33 | Ga0070703_10370564 | 3300005406 | Bacteria | 616 |
| 34 | Ga0070709_10012916 | 3300005434 | Bacteria | 4681 |
| 35 | Ga0070709_10062926 | 3300005434 | Bacteria | 2368 |
| 36 | Ga0070709_10109326 | 3300005434 | Bacteria | 1856 |
| 37 | Ga0070709_10257247 | 3300005434 | Bacteria | 1260 |
| 38 | Ga0070709_10538545 | 3300005434 | Bacteria | 892 |
| 39 | Ga0070709_10559599 | 3300005434 | Bacteria | 876 |
| 40 | Ga0070714_100001717 | 3300005435 | Bacteria | 15944 |
| 41 | Ga0070714_100221863 | 3300005435 | Bacteria | 1737 |
| 42 | Ga0070713_100003576 | 3300005436 | Bacteria | 10269 |
| 43 | Ga0070713_100008626 | 3300005436 | Bacteria | 7242 |
| 44 | Ga0070713_100014423 | 3300005436 | Bacteria | 5870 |
| 45 | Ga0070713_100176437 | 3300005436 | Bacteria | 1918 |
| 46 | Ga0070713_100296433 | 3300005436 | Bacteria | 1488 |
| 47 | Ga0070713_100300072 | 3300005436 | Bacteria | 1479 |
| 48 | Ga0070713_100527932 | 3300005436 | Bacteria | 1116 |
| 49 | Ga0070710_10091980 | 3300005437 | Bacteria | 1791 |
| 50 | Ga0070710_10544375 | 3300005437 | Bacteria | 801 |
| 51 | Ga0070711_100013825 | 3300005439 | Bacteria | 5076 |
| 52 | Ga0070711_100068708 | 3300005439 | Bacteria | 2490 |
| 53 | Ga0070705_100046068 | 3300005440 | Bacteria | 2512 |
| 54 | Ga0070705_100992381 | 3300005440 | Bacteria | 681 |
| 55 | Ga0070700_100234600 | 3300005441 | Bacteria | 1307 |
| 56 | Ga0070700_100417822 | 3300005441 | Bacteria | 1013 |
| 57 | Ga0070708_100010550 | 3300005445 | Bacteria | 7492 |
| 58 | Ga0070663_100128393 | 3300005455 | Bacteria | 1922 |
| 59 | Ga0070663_100135611 | 3300005455 | Bacteria | 1873 |
| 60 | Ga0070663_100549018 | 3300005455 | Bacteria | 966 |
| 61 | Ga0070678_100128549 | 3300005456 | Bacteria | 2009 |
| 62 | Ga0070678_101577283 | 3300005456 | Bacteria | 616 |
| 63 | Ga0070681_10002937 | 3300005458 | Bacteria | 15801 |
| 64 | Ga0070681_10049242 | 3300005458 | Bacteria | 4209 |
| 65 | Ga0070681_10277360 | 3300005458 | Bacteria | 1587 |
| 66 | Ga0070681_10316163 | 3300005458 | Bacteria | 1471 |
| 67 | Ga0070681_10667266 | 3300005458 | Bacteria | 955 |
| 68 | Ga0070681_10738608 | 3300005458 | Bacteria | 901 |
| 69 | Ga0070681_11620348 | 3300005458 | Bacteria | 573 |
| 70 | Ga0070706_100068710 | 3300005467 | Bacteria | 3277 |
| 71 | Ga0070706_100382641 | 3300005467 | Bacteria | 1310 |
| 72 | Ga0070706_101121691 | 3300005467 | Bacteria | 724 |
| 73 | Ga0070707_100865648 | 3300005468 | Bacteria | 868 |
| 74 | Ga0070698_100328179 | 3300005471 | Bacteria | 1461 |
| 75 | Ga0070698_100572825 | 3300005471 | Bacteria | 1069 |
| 76 | Ga0070698_101673838 | 3300005471 | Bacteria | 589 |
| 77 | Ga0070699_100082086 | 3300005518 | Bacteria | 2809 |
| 78 | Ga0070699_100470352 | 3300005518 | Bacteria | 1140 |
| 79 | Ga0070699_100756499 | 3300005518 | Bacteria | 889 |
| 80 | Ga0070699_100889313 | 3300005518 | Bacteria | 816 |
| 81 | Ga0070699_100947478 | 3300005518 | Bacteria | 789 |
| 82 | Ga0070699_101285802 | 3300005518 | Bacteria | 671 |
| 83 | Ga0070699_101417312 | 3300005518 | Bacteria | 637 |
| 84 | Ga0070679_100022390 | 3300005530 | Bacteria | 6177 |
| 85 | Ga0070679_100073695 | 3300005530 | Bacteria | 3405 |
| 86 | Ga0070679_100091966 | 3300005530 | Bacteria | 3021 |
| 87 | Ga0070679_100576798 | 3300005530 | Bacteria | 1068 |
| 88 | Ga0070684_100166080 | 3300005535 | Bacteria | 2003 |
| 89 | Ga0070684_100239243 | 3300005535 | Bacteria | 1658 |
| 90 | Ga0070684_100318128 | 3300005535 | Bacteria | 1429 |
| 91 | Ga0070684_100517623 | 3300005535 | Bacteria | 1106 |
| 92 | Ga0070684_101111630 | 3300005535 | Bacteria | 743 |
| 93 | Ga0070697_100000401 | 3300005536 | Bacteria | 33563 |
| 94 | Ga0070697_100194397 | 3300005536 | Bacteria | 1723 |
| 95 | Ga0068853_100000639 | 3300005539 | Bacteria | 23990 |
| 96 | Ga0068853_100075280 | 3300005539 | Bacteria | 2946 |
| 97 | Ga0068853_100133322 | 3300005539 | Bacteria | 2225 |
| 98 | Ga0068853_100278271 | 3300005539 | Bacteria | 1542 |
| 99 | Ga0068853_100407809 | 3300005539 | Bacteria | 1273 |
| 100 | Ga0068853_100684543 | 3300005539 | Bacteria | 977 |
| 101 | Ga0068853_100811691 | 3300005539 | Bacteria | 896 |
| 102 | Ga0068853_101005797 | 3300005539 | Bacteria | 803 |
| 103 | Ga0070672_100080066 | 3300005543 | Bacteria | 2616 |
| 104 | Ga0070686_100135597 | 3300005544 | Bacteria | 1707 |
| 105 | Ga0070695_100024318 | 3300005545 | Bacteria | 3730 |
| 106 | Ga0070695_100416262 | 3300005545 | Bacteria | 1022 |
| 107 | Ga0070695_101694498 | 3300005545 | Bacteria | 529 |
| 108 | Ga0070696_100052110 | 3300005546 | Bacteria | 2846 |
| 109 | Ga0070696_101366836 | 3300005546 | Bacteria | 603 |
| 110 | Ga0070693_100012359 | 3300005547 | Bacteria | 4318 |
| 111 | Ga0070693_100066852 | 3300005547 | Bacteria | 2104 |
| 112 | Ga0070665_100095398 | 3300005548 | Bacteria | 2979 |
| 113 | Ga0070665_100548292 | 3300005548 | Bacteria | 1168 |
| 114 | Ga0070704_100170686 | 3300005549 | Bacteria | 1729 |
| 115 | Ga0070704_100302787 | 3300005549 | Bacteria | 1333 |
| 116 | Ga0070704_100526294 | 3300005549 | Bacteria | 1030 |
| 117 | Ga0070704_101116027 | 3300005549 | Bacteria | 717 |
| 118 | Ga0068855_100037045 | 3300005563 | Bacteria | 5803 |
| 119 | Ga0068855_100100703 | 3300005563 | Bacteria | 3326 |
| 120 | Ga0068855_100139474 | 3300005563 | Bacteria | 2765 |
| 121 | Ga0068855_100240004 | 3300005563 | Bacteria | 2025 |
| 122 | Ga0068855_100375635 | 3300005563 | Bacteria | 1561 |
| 123 | Ga0068855_101118743 | 3300005563 | Bacteria | 822 |
| 124 | Ga0068855_101370942 | 3300005563 | Bacteria | 730 |
| 125 | Ga0070664_100974627 | 3300005564 | Bacteria | 796 |
| 126 | Ga0068857_100025105 | 3300005577 | Bacteria | 5249 |
| 127 | Ga0068857_100110916 | 3300005577 | Bacteria | 2466 |
| 128 | Ga0068857_100359955 | 3300005577 | Bacteria | 1348 |
| 129 | Ga0068854_100021505 | 3300005578 | Bacteria | 4379 |
| 130 | Ga0068854_100148564 | 3300005578 | Bacteria | 1805 |
| 131 | Ga0068854_100211940 | 3300005578 | Bacteria | 1528 |
| 132 | Ga0068854_100272852 | 3300005578 | Bacteria | 1359 |
| 133 | Ga0068854_101153061 | 3300005578 | Bacteria | 693 |
| 134 | Ga0068856_100112903 | 3300005614 | Bacteria | 2715 |
| 135 | Ga0068856_100416860 | 3300005614 | Bacteria | 1363 |
| 136 | Ga0068856_100533640 | 3300005614 | Bacteria | 1195 |
| 137 | Ga0070702_100024299 | 3300005615 | Bacteria | 3231 |
| 138 | Ga0068852_101625701 | 3300005616 | Bacteria | 668 |
| 139 | Ga0068852_102033794 | 3300005616 | Bacteria | 596 |
| 140 | Ga0068864_101760559 | 3300005618 | Bacteria | 625 |
| 141 | Ga0068866_10363224 | 3300005718 | Bacteria | 923 |
| 142 | Ga0068861_100126333 | 3300005719 | Bacteria | 2069 |
| 143 | Ga0068861_100126335 | 3300005719 | Bacteria | 2069 |
| 144 | Ga0068851_10080441 | 3300005834 | Bacteria | 1701 |
| 145 | Ga0068870_10251101 | 3300005840 | Bacteria | 1096 |
| 146 | Ga0068858_100145503 | 3300005842 | Bacteria | 2225 |
| 147 | Ga0068862_100437377 | 3300005844 | Bacteria | 1230 |
| 148 | Ga0081455_10041815 | 3300005937 | Bacteria | 4026 |
| 149 | Ga0081455_10124008 | 3300005937 | Bacteria | 2031 |
| 150 | Ga0081538_10085014 | 3300005981 | Bacteria | 1664 |
| 151 | Ga0081538_10154479 | 3300005981 | Bacteria | 1032 |
| 152 | Ga0081540_1034564 | 3300005983 | Bacteria | 2723 |
| 153 | Ga0081539_10096276 | 3300005985 | Bacteria | 1518 |
| 154 | Ga0070717_10005256 | 3300006028 | Bacteria | 9433 |
| 155 | Ga0070717_10031009 | 3300006028 | Bacteria | 4298 |
| 156 | Ga0070717_10109793 | 3300006028 | Bacteria | 2351 |
| 157 | Ga0070717_10457573 | 3300006028 | Bacteria | 1150 |
| 158 | Ga0070717_10863649 | 3300006028 | Bacteria | 823 |
| 159 | Ga0075365_10148733 | 3300006038 | Bacteria | 1629 |
| 160 | Ga0075365_10350757 | 3300006038 | Bacteria | 1040 |
| 161 | Ga0070715_10004133 | 3300006163 | Bacteria | 4721 |
| 162 | Ga0070715_10149722 | 3300006163 | Bacteria | 1142 |
| 163 | Ga0070716_100014993 | 3300006173 | Bacteria | 3976 |
| 164 | Ga0070716_100056098 | 3300006173 | Bacteria | 2257 |
| 165 | Ga0070716_100276966 | 3300006173 | Bacteria | 1156 |
| 166 | Ga0070712_100062528 | 3300006175 | Bacteria | 2633 |
| 167 | Ga0070712_100949710 | 3300006175 | Bacteria | 743 |
| 168 | Ga0070712_101062262 | 3300006175 | Bacteria | 702 |
| 169 | Ga0075362_10376122 | 3300006177 | Bacteria | 714 |
| 170 | Ga0075367_10454374 | 3300006178 | Bacteria | 812 |
| 171 | Ga0075367_10760733 | 3300006178 | Bacteria | 617 |
| 172 | Ga0075369_10076549 | 3300006186 | Bacteria | 1479 |
| 173 | Ga0075369_10436264 | 3300006186 | Bacteria | 619 |
| 174 | Ga0097621_100379210 | 3300006237 | Bacteria | 1263 |
| 175 | Ga0068871_101956981 | 3300006358 | Bacteria | 558 |
| 176 | Ga0075428_100128383 | 3300006844 | Bacteria | 2758 |
| 177 | Ga0075428_101058163 | 3300006844 | Bacteria | 858 |
| 178 | Ga0075430_100199707 | 3300006846 | Bacteria | 1661 |
| 179 | Ga0075431_100104798 | 3300006847 | Bacteria | 2918 |
| 180 | Ga0075431_100576494 | 3300006847 | Bacteria | 1111 |
| 181 | Ga0075431_100955841 | 3300006847 | Bacteria | 825 |
| 182 | Ga0075433_10739352 | 3300006852 | Bacteria | 861 |
| 183 | Ga0075434_100031871 | 3300006871 | Bacteria | 5198 |
| 184 | Ga0075434_100326280 | 3300006871 | Bacteria | 1555 |
| 185 | Ga0075434_100905945 | 3300006871 | Bacteria | 897 |
| 186 | Ga0075434_101718541 | 3300006871 | Bacteria | 635 |
| 187 | Ga0075429_100195517 | 3300006880 | Bacteria | 1772 |
| 188 | Ga0075429_100614184 | 3300006880 | Bacteria | 953 |
| 189 | Ga0075436_100000298 | 3300006914 | Bacteria | 31645 |
| 190 | Ga0075436_100010890 | 3300006914 | Bacteria | 6240 |
| 191 | Ga0075436_100549487 | 3300006914 | Bacteria | 848 |
| 192 | Ga0099825_1038906 | 3300006941 | Bacteria | 1490 |
| 193 | Ga0099824_1010644 | 3300006942 | Bacteria | 10734 |
| 194 | Ga0099822_1012672 | 3300006943 | Bacteria | 10032 |
| 195 | Ga0075435_100047801 | 3300007076 | Bacteria | 3436 |
| 196 | Ga0075435_100056829 | 3300007076 | Bacteria | 3164 |
| 197 | Ga0075435_102007772 | 3300007076 | Bacteria | 508 |
| 198 | Ga0099794_10133906 | 3300007265 | Bacteria | 1253 |
| 199 | Ga0099795_10097540 | 3300007788 | Bacteria | 1148 |
| 200 | Ga0099795_10099619 | 3300007788 | Bacteria | 1138 |
| 201 | Ga0105240_10014356 | 3300009093 | Bacteria | 10815 |
| 202 | Ga0105240_10042838 | 3300009093 | Bacteria | 5766 |
| 203 | Ga0105240_10095109 | 3300009093 | Bacteria | 3633 |
| 204 | Ga0105240_11301003 | 3300009093 | Bacteria | 767 |
| 205 | Ga0105240_12744306 | 3300009093 | Bacteria | 507 |
| 206 | Ga0111539_10157666 | 3300009094 | Bacteria | 2655 |
| 207 | Ga0111539_11138734 | 3300009094 | Bacteria | 907 |
| 208 | Ga0111539_11259109 | 3300009094 | Bacteria | 859 |
| 209 | Ga0105245_10894260 | 3300009098 | Bacteria | 929 |
| 210 | Ga0105247_10389859 | 3300009101 | Bacteria | 990 |
| 211 | Ga0114129_10459084 | 3300009147 | Bacteria | 1669 |
| 212 | Ga0114129_11057924 | 3300009147 | Bacteria | 1018 |
| 213 | Ga0114129_11890174 | 3300009147 | Bacteria | 724 |
| 214 | Ga0105243_10077558 | 3300009148 | Bacteria | 2703 |
| 215 | Ga0105243_10492496 | 3300009148 | Bacteria | 1160 |
| 216 | Ga0105243_11772946 | 3300009148 | Bacteria | 648 |
| 217 | Ga0105241_10019098 | 3300009174 | Bacteria | 5055 |
| 218 | Ga0105241_10589264 | 3300009174 | Bacteria | 1003 |
| 219 | Ga0105242_10833308 | 3300009176 | Bacteria | 916 |
| 220 | Ga0105242_11234792 | 3300009176 | Bacteria | 768 |
| 221 | Ga0105237_10347378 | 3300009545 | Bacteria | 1488 |
| 222 | Ga0105237_10430198 | 3300009545 | Bacteria | 1325 |
| 223 | Ga0105238_10155040 | 3300009551 | Bacteria | 2266 |
| 224 | Ga0105238_10565772 | 3300009551 | Bacteria | 1142 |
| 225 | Ga0105238_10874956 | 3300009551 | Bacteria | 916 |
| 226 | Ga0105238_12213757 | 3300009551 | Bacteria | 584 |
| 227 | Ga0105249_10189764 | 3300009553 | Bacteria | 2005 |
| 228 | Ga0105249_11578001 | 3300009553 | Bacteria | 729 |
| 229 | Ga0105239_10137662 | 3300010375 | Bacteria | 2718 |
| 230 | Ga0105239_10962857 | 3300010375 | Bacteria | 981 |
| 231 | Ga0105246_10691860 | 3300011119 | Bacteria | 892 |
| 232 | Ga0157343_1010982 | 3300012488 | Bacteria | 695 |
| 233 | Ga0157373_10020703 | 3300013100 | Bacteria | 4777 |
| 234 | Ga0157373_10764011 | 3300013100 | Bacteria | 711 |
| 235 | Ga0157371_10020656 | 3300013102 | Bacteria | 4845 |
| 236 | Ga0157370_10008510 | 3300013104 | Bacteria | 11064 |
| 237 | Ga0157370_10079308 | 3300013104 | Bacteria | 3092 |
| 238 | Ga0157370_10241775 | 3300013104 | Bacteria | 1670 |
| 239 | Ga0157370_10739446 | 3300013104 | Bacteria | 897 |
| 240 | Ga0157369_10020114 | 3300013105 | Bacteria | 7466 |
| 241 | Ga0157369_10027434 | 3300013105 | Bacteria | 6313 |
| 242 | Ga0157369_10117623 | 3300013105 | Bacteria | 2821 |
| 243 | Ga0157378_12905619 | 3300013297 | Bacteria | 531 |
| 244 | Ga0163162_10924989 | 3300013306 | Bacteria | 984 |
| 245 | Ga0163162_12615669 | 3300013306 | Bacteria | 581 |
| 246 | Ga0157372_10362773 | 3300013307 | Bacteria | 1688 |
| 247 | Ga0157372_10395957 | 3300013307 | Bacteria | 1609 |
| 248 | Ga0157372_10471525 | 3300013307 | Bacteria | 1463 |
| 249 | Ga0157372_11505973 | 3300013307 | Bacteria | 775 |
| 250 | Ga0157375_11323314 | 3300013308 | Bacteria | 847 |
| 251 | Ga0163163_11460393 | 3300014325 | Bacteria | 745 |
| 252 | Ga0157380_11445509 | 3300014326 | Bacteria | 739 |
| 253 | Ga0182008_10187114 | 3300014497 | Bacteria | 1050 |
| 254 | Ga0182008_10206861 | 3300014497 | Bacteria | 1000 |
| 255 | Ga0182008_10344530 | 3300014497 | Bacteria | 789 |
| 256 | Ga0157379_10392099 | 3300014968 | Bacteria | 1275 |
| 257 | Ga0157379_11007356 | 3300014968 | Bacteria | 794 |
| 258 | Ga0157376_10504415 | 3300014969 | Bacteria | 1190 |
| 259 | Ga0157376_12391339 | 3300014969 | Bacteria | 568 |
| 260 | Ga0182007_10059545 | 3300015262 | Bacteria | 1252 |
| 261 | Ga0163161_10232139 | 3300017792 | Bacteria | 1432 |
| 262 | Ga0163161_10459163 | 3300017792 | Bacteria | 1031 |
| 263 | Ga0163161_10949958 | 3300017792 | Bacteria | 731 |
| 264 | Ga0197907_10638588 | 3300020069 | Bacteria | 942 |
| 265 | Ga0206356_10079857 | 3300020070 | Bacteria | 996 |
| 266 | Ga0206350_10077760 | 3300020080 | Bacteria | 720 |
| 267 | Ga0206353_10632584 | 3300020082 | Bacteria | 1593 |
| 268 | Ga0213873_10274433 | 3300021358 | Bacteria | 539 |
| 269 | Ga0213876_10042405 | 3300021384 | Bacteria | 2404 |
| 270 | Ga0213876_10046641 | 3300021384 | Bacteria | 2291 |
| 271 | Ga0213876_10230991 | 3300021384 | Bacteria | 983 |
| 272 | Ga0213876_10318816 | 3300021384 | Bacteria | 826 |
| 273 | Ga0213875_10182541 | 3300021388 | Bacteria | 986 |
| 274 | Ga0224712_10281473 | 3300022467 | Bacteria | 774 |
| 275 | Ga0228598_1088474 | 3300024227 | Bacteria | 623 |
| 276 | Ga0207673_1027447 | 3300025290 | Bacteria | 783 |
| 277 | Ga0209758_1004128 | 3300025297 | Bacteria | 12418 |
| 278 | Ga0209758_1024995 | 3300025297 | Bacteria | 2639 |
| 279 | Ga0207426_1162183 | 3300025302 | Bacteria | 511 |
| 280 | Ga0207682_10065791 | 3300025893 | Bacteria | 1526 |
| 281 | Ga0207692_10000073 | 3300025898 | Bacteria | 29005 |
| 282 | Ga0207692_10101629 | 3300025898 | Bacteria | 1579 |
| 283 | Ga0207710_10294828 | 3300025900 | Bacteria | 818 |
| 284 | Ga0207688_10360509 | 3300025901 | Bacteria | 897 |
| 285 | Ga0207680_10245865 | 3300025903 | Bacteria | 1234 |
| 286 | Ga0207647_10011910 | 3300025904 | Bacteria | 6074 |
| 287 | Ga0207685_10001894 | 3300025905 | Bacteria | 4609 |
| 288 | Ga0207685_10230869 | 3300025905 | Bacteria | 885 |
| 289 | Ga0207699_10001951 | 3300025906 | Bacteria | 9731 |
| 290 | Ga0207699_10030879 | 3300025906 | Bacteria | 3003 |
| 291 | Ga0207699_10577858 | 3300025906 | Bacteria | 817 |
| 292 | Ga0207645_10531517 | 3300025907 | Bacteria | 797 |
| 293 | Ga0207645_11025821 | 3300025907 | Bacteria | 558 |
| 294 | Ga0207705_10123210 | 3300025909 | Bacteria | 1925 |
| 295 | Ga0207705_10169733 | 3300025909 | Bacteria | 1642 |
| 296 | Ga0207705_10248344 | 3300025909 | Bacteria | 1357 |
| 297 | Ga0207705_10370782 | 3300025909 | Bacteria | 1105 |
| 298 | Ga0207705_10470315 | 3300025909 | Bacteria | 975 |
| 299 | Ga0207705_11094866 | 3300025909 | Bacteria | 614 |
| 300 | Ga0207684_10470678 | 3300025910 | Bacteria | 1078 |
| 301 | Ga0207684_10736002 | 3300025910 | Bacteria | 836 |
| 302 | Ga0207707_10001947 | 3300025912 | Bacteria | 18789 |
| 303 | Ga0207707_10007389 | 3300025912 | Bacteria | 9570 |
| 304 | Ga0207707_10069804 | 3300025912 | Bacteria | 3062 |
| 305 | Ga0207707_10081921 | 3300025912 | Bacteria | 2817 |
| 306 | Ga0207707_10202844 | 3300025912 | Bacteria | 1729 |
| 307 | Ga0207707_10574701 | 3300025912 | Bacteria | 956 |
| 308 | Ga0207695_10025135 | 3300025913 | Bacteria | 6679 |
| 309 | Ga0207695_10028873 | 3300025913 | Bacteria | 6140 |
| 310 | Ga0207695_10060768 | 3300025913 | Bacteria | 3909 |
| 311 | Ga0207695_10286110 | 3300025913 | Bacteria | 1541 |
| 312 | Ga0207695_11358342 | 3300025913 | Bacteria | 591 |
| 313 | Ga0207695_11622513 | 3300025913 | Bacteria | 527 |
| 314 | Ga0207671_10264244 | 3300025914 | Bacteria | 1355 |
| 315 | Ga0207671_10969100 | 3300025914 | Bacteria | 671 |
| 316 | Ga0207693_10029326 | 3300025915 | Bacteria | 4347 |
| 317 | Ga0207693_10051697 | 3300025915 | Bacteria | 3224 |
| 318 | Ga0207693_10506889 | 3300025915 | Bacteria | 942 |
| 319 | Ga0207693_10564210 | 3300025915 | Bacteria | 887 |
| 320 | Ga0207663_10002920 | 3300025916 | Bacteria | 8265 |
| 321 | Ga0207663_10019599 | 3300025916 | Bacteria | 3815 |
| 322 | Ga0207663_10107536 | 3300025916 | Bacteria | 1887 |
| 323 | Ga0207663_10138774 | 3300025916 | Bacteria | 1690 |
| 324 | Ga0207660_10008070 | 3300025917 | Bacteria | 6811 |
| 325 | Ga0207660_10042879 | 3300025917 | Bacteria | 3178 |
| 326 | Ga0207660_10073313 | 3300025917 | Bacteria | 2496 |
| 327 | Ga0207660_10124206 | 3300025917 | Bacteria | 1958 |
| 328 | Ga0207660_10370745 | 3300025917 | Bacteria | 1150 |
| 329 | Ga0207657_10030313 | 3300025919 | Bacteria | 4910 |
| 330 | Ga0207657_10214569 | 3300025919 | Bacteria | 1543 |
| 331 | Ga0207657_10378835 | 3300025919 | Bacteria | 1114 |
| 332 | Ga0207657_10679062 | 3300025919 | Bacteria | 801 |
| 333 | Ga0207652_10014863 | 3300025921 | Bacteria | 6312 |
| 334 | Ga0207652_10022051 | 3300025921 | Bacteria | 5264 |
| 335 | Ga0207652_10040147 | 3300025921 | Bacteria | 3973 |
| 336 | Ga0207652_10062998 | 3300025921 | Bacteria | 3205 |
| 337 | Ga0207652_10349301 | 3300025921 | Bacteria | 1335 |
| 338 | Ga0207652_11734721 | 3300025921 | Bacteria | 529 |
| 339 | Ga0207646_10101215 | 3300025922 | Bacteria | 2583 |
| 340 | Ga0207694_10476789 | 3300025924 | Bacteria | 1043 |
| 341 | Ga0207694_11507755 | 3300025924 | Bacteria | 567 |
| 342 | Ga0207659_10412879 | 3300025926 | Bacteria | 1131 |
| 343 | Ga0207687_10184771 | 3300025927 | Bacteria | 1618 |
| 344 | Ga0207700_10007626 | 3300025928 | Bacteria | 6638 |
| 345 | Ga0207700_10012388 | 3300025928 | Bacteria | 5498 |
| 346 | Ga0207700_10089771 | 3300025928 | Bacteria | 2423 |
| 347 | Ga0207700_10108545 | 3300025928 | Bacteria | 2229 |
| 348 | Ga0207700_10122465 | 3300025928 | Bacteria | 2111 |
| 349 | Ga0207700_10150413 | 3300025928 | Bacteria | 1923 |
| 350 | Ga0207700_10173084 | 3300025928 | Bacteria | 1802 |
| 351 | Ga0207700_10643177 | 3300025928 | Bacteria | 945 |
| 352 | Ga0207664_10002018 | 3300025929 | Bacteria | 13367 |
| 353 | Ga0207664_10193516 | 3300025929 | Bacteria | 1752 |
| 354 | Ga0207664_10195774 | 3300025929 | Bacteria | 1742 |
| 355 | Ga0207644_10641609 | 3300025931 | Bacteria | 883 |
| 356 | Ga0207690_10137098 | 3300025932 | Bacteria | 1798 |
| 357 | Ga0207690_10185179 | 3300025932 | Bacteria | 1571 |
| 358 | Ga0207690_10417989 | 3300025932 | Bacteria | 1072 |
| 359 | Ga0207706_11109995 | 3300025933 | Bacteria | 660 |
| 360 | Ga0207706_11538908 | 3300025933 | Bacteria | 541 |
| 361 | Ga0207706_11559464 | 3300025933 | Bacteria | 536 |
| 362 | Ga0207686_10073445 | 3300025934 | Bacteria | 2207 |
| 363 | Ga0207686_10679750 | 3300025934 | Bacteria | 817 |
| 364 | Ga0207686_10822484 | 3300025934 | Bacteria | 746 |
| 365 | Ga0207709_10007306 | 3300025935 | Bacteria | 6159 |
| 366 | Ga0207709_10327201 | 3300025935 | Bacteria | 1149 |
| 367 | Ga0207709_10794834 | 3300025935 | Bacteria | 763 |
| 368 | Ga0207669_10015280 | 3300025937 | Bacteria | 3868 |
| 369 | Ga0207669_10060537 | 3300025937 | Bacteria | 2322 |
| 370 | Ga0207665_10013613 | 3300025939 | Bacteria | 5351 |
| 371 | Ga0207665_10023380 | 3300025939 | Bacteria | 4072 |
| 372 | Ga0207665_10296652 | 3300025939 | Bacteria | 1207 |
| 373 | Ga0207665_10312589 | 3300025939 | Bacteria | 1177 |
| 374 | Ga0207665_11200517 | 3300025939 | Bacteria | 605 |
| 375 | Ga0207691_10139944 | 3300025940 | Bacteria | 2133 |
| 376 | Ga0207691_10680869 | 3300025940 | Bacteria | 868 |
| 377 | Ga0207661_10002867 | 3300025944 | Bacteria | 11914 |
| 378 | Ga0207661_10037738 | 3300025944 | Bacteria | 3781 |
| 379 | Ga0207661_10141543 | 3300025944 | Bacteria | 2070 |
| 380 | Ga0207661_10447566 | 3300025944 | Bacteria | 1176 |
| 381 | Ga0207667_10023350 | 3300025949 | Bacteria | 6809 |
| 382 | Ga0207667_10027203 | 3300025949 | Bacteria | 6231 |
| 383 | Ga0207667_10209344 | 3300025949 | Bacteria | 1999 |
| 384 | Ga0207667_10223853 | 3300025949 | Bacteria | 1927 |
| 385 | Ga0207667_11323505 | 3300025949 | Bacteria | 696 |
| 386 | Ga0207651_10062536 | 3300025960 | Bacteria | 2595 |
| 387 | Ga0207651_11246040 | 3300025960 | Bacteria | 668 |
| 388 | Ga0207651_11965121 | 3300025960 | Bacteria | 526 |
| 389 | Ga0207712_10114450 | 3300025961 | Bacteria | 2029 |
| 390 | Ga0207712_11485068 | 3300025961 | Bacteria | 607 |
| 391 | Ga0207712_11952808 | 3300025961 | Bacteria | 525 |
| 392 | Ga0207668_10113133 | 3300025972 | Bacteria | 2040 |
| 393 | Ga0207668_10718466 | 3300025972 | Bacteria | 879 |
| 394 | Ga0207668_11585037 | 3300025972 | Bacteria | 591 |
| 395 | Ga0207640_10032514 | 3300025981 | Bacteria | 3236 |
| 396 | Ga0207640_10087940 | 3300025981 | Bacteria | 2144 |
| 397 | Ga0207640_10356609 | 3300025981 | Bacteria | 1177 |
| 398 | Ga0207640_10712878 | 3300025981 | Bacteria | 861 |
| 399 | Ga0207640_10869899 | 3300025981 | Bacteria | 785 |
| 400 | Ga0207639_10041551 | 3300026041 | Bacteria | 3441 |
| 401 | Ga0207639_10077818 | 3300026041 | Bacteria | 2616 |
| 402 | Ga0207639_10163191 | 3300026041 | Bacteria | 1880 |
| 403 | Ga0207639_10195874 | 3300026041 | Bacteria | 1729 |
| 404 | Ga0207639_10664008 | 3300026041 | Bacteria | 965 |
| 405 | Ga0207639_11139238 | 3300026041 | Bacteria | 732 |
| 406 | Ga0207639_12029346 | 3300026041 | Bacteria | 536 |
| 407 | Ga0207678_10026230 | 3300026067 | Bacteria | 5084 |
| 408 | Ga0207678_10389794 | 3300026067 | Bacteria | 1205 |
| 409 | Ga0207678_11479925 | 3300026067 | Bacteria | 600 |
| 410 | Ga0207708_10161210 | 3300026075 | Bacteria | 1771 |
| 411 | Ga0207702_10042791 | 3300026078 | Bacteria | 3800 |
| 412 | Ga0207702_10247926 | 3300026078 | Bacteria | 1671 |
| 413 | Ga0207676_10747094 | 3300026095 | Bacteria | 951 |
| 414 | Ga0207674_10005964 | 3300026116 | Bacteria | 14418 |
| 415 | Ga0207674_10012348 | 3300026116 | Bacteria | 9549 |
| 416 | Ga0207674_10125442 | 3300026116 | Bacteria | 2533 |
| 417 | Ga0207674_10380457 | 3300026116 | Bacteria | 1365 |
| 418 | Ga0207674_10431427 | 3300026116 | Bacteria | 1274 |
| 419 | Ga0207674_10683769 | 3300026116 | Bacteria | 991 |
| 420 | Ga0207674_10701855 | 3300026116 | Bacteria | 977 |
| 421 | Ga0207675_100542496 | 3300026118 | Bacteria | 1161 |
| 422 | Ga0207698_10126031 | 3300026142 | Bacteria | 2178 |
| 423 | Ga0207698_10235792 | 3300026142 | Bacteria | 1664 |
| 424 | Ga0207698_10336963 | 3300026142 | Bacteria | 1419 |
| 425 | Ga0207698_10433840 | 3300026142 | Bacteria | 1264 |
| 426 | Ga0207698_11442629 | 3300026142 | Bacteria | 703 |
| 427 | Ga0207698_12039497 | 3300026142 | Bacteria | 588 |
| 428 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 429 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 430 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 431 | Ga0209179_1060282 | 3300027512 | Bacteria | 823 |
| 432 | Ga0209588_1024170 | 3300027671 | Bacteria | 1918 |
| 433 | Ga0209588_1086810 | 3300027671 | Bacteria | 1009 |
| 434 | Ga0209813_10030393 | 3300027866 | Bacteria | 1587 |
| 435 | Ga0209813_10089863 | 3300027866 | Bacteria | 1029 |
| 436 | Ga0209813_10141954 | 3300027866 | Bacteria | 853 |
| 437 | Ga0209813_10195383 | 3300027866 | Bacteria | 747 |
| 438 | Ga0207428_10288701 | 3300027907 | Bacteria | 1216 |
| 439 | Ga0268266_10034993 | 3300028379 | Bacteria | 4272 |
| 440 | Ga0268266_10645514 | 3300028379 | Bacteria | 1018 |
| 441 | Ga0268265_10397976 | 3300028380 | Bacteria | 1272 |
| 442 | Ga0265322_10095920 | 3300028654 | Bacteria | 843 |
| 443 | Ga0265338_10623195 | 3300028800 | Bacteria | 750 |
| 444 | Ga0265762_1153715 | 3300030760 | Bacteria | 549 |
| 445 | Ga0265765_1063688 | 3300030879 | Bacteria | 525 |
| 446 | Ga0265332_10189507 | 3300031238 | Bacteria | 856 |
| 447 | Ga0265332_10203235 | 3300031238 | Bacteria | 823 |
| 448 | Ga0265328_10279960 | 3300031239 | Bacteria | 642 |
| 449 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 450 | Ga0265325_10006799 | 3300031241 | Bacteria | 6913 |
| 451 | Ga0265325_10479868 | 3300031241 | Bacteria | 540 |
| 452 | Ga0265329_10095925 | 3300031242 | Bacteria | 942 |
| 453 | Ga0265339_10036600 | 3300031249 | Bacteria | 2746 |
| 454 | Ga0265339_10177146 | 3300031249 | Bacteria | 1064 |
| 455 | Ga0265339_10337565 | 3300031249 | Bacteria | 712 |
| 456 | Ga0265339_10366001 | 3300031249 | Bacteria | 677 |
| 457 | Ga0265331_10123320 | 3300031250 | Bacteria | 1184 |
| 458 | Ga0307513_11048031 | 3300031456 | Bacteria | 526 |
| 459 | Ga0307408_101135702 | 3300031548 | Bacteria | 726 |
| 460 | Ga0307508_10039201 | 3300031616 | Bacteria | 4257 |
| 461 | Ga0307508_10281692 | 3300031616 | Bacteria | 1256 |
| 462 | Ga0307508_10557780 | 3300031616 | Bacteria | 744 |
| 463 | Ga0310114_124249 | 3300031678 | Bacteria | 525 |
| 464 | Ga0265314_10001306 | 3300031711 | Bacteria | 28247 |
| 465 | Ga0265342_10005212 | 3300031712 | Bacteria | 9983 |
| 466 | Ga0316576_10193963 | 3300031727 | Bacteria | 1531 |
| 467 | Ga0316578_10000979 | 3300031728 | Bacteria | 10870 |
| 468 | Ga0307405_10415069 | 3300031731 | Bacteria | 1057 |
| 469 | Ga0307405_10628737 | 3300031731 | Bacteria | 880 |
| 470 | Ga0316577_10181864 | 3300031733 | Bacteria | 1188 |
| 471 | Ga0307413_10105713 | 3300031824 | Bacteria | 1872 |
| 472 | Ga0307413_10393908 | 3300031824 | Bacteria | 1083 |
| 473 | Ga0326468_10054462 | 3300031889 | Bacteria | 617 |
| 474 | Ga0307406_11416759 | 3300031901 | Bacteria | 609 |
| 475 | Ga0307409_102183465 | 3300031995 | Bacteria | 583 |
| 476 | Ga0307416_102048631 | 3300032002 | Bacteria | 675 |
| 477 | Ga0307416_102871423 | 3300032002 | Bacteria | 576 |
| 478 | Ga0307416_103660851 | 3300032002 | Bacteria | 514 |
| 479 | Ga0307414_11863394 | 3300032004 | Bacteria | 561 |
| 480 | Ga0307414_12140646 | 3300032004 | Bacteria | 522 |
| 481 | Ga0307411_10489337 | 3300032005 | Bacteria | 1038 |
| 482 | Ga0307415_100344205 | 3300032126 | Bacteria | 1252 |
| 483 | Ga0307415_100742895 | 3300032126 | Bacteria | 890 |
| 484 | Ga0307415_100860721 | 3300032126 | Bacteria | 832 |
| 485 | Ga0307415_101147701 | 3300032126 | Bacteria | 730 |
| 486 | Ga0316585_10217915 | 3300032137 | Bacteria | 631 |
| 487 | Ga0316215_1004619 | 3300033544 | Bacteria | 1321 |
| 488 | Ga0316214_1004062 | 3300033545 | Bacteria | 1873 |
| 489 | Ga0373938_0041833 | 3300034957 | Bacteria | 1021 |
| 490 | Ga0373926_0019265 | 3300035083 | Bacteria | 2352 |
| 491 | Ga0373926_0023812 | 3300035083 | Bacteria | 2129 |
| 492 | Ga0373926_0041726 | 3300035083 | Bacteria | 1640 |
| 493 | Ga0373926_0098587 | 3300035083 | Bacteria | 1091 |
| 494 | Ga0373926_0104870 | 3300035083 | Bacteria | 1059 |
| 495 | Ga0373934_0038446 | 3300035086 | Bacteria | 1885 |
| 496 | Ga0373940_0083102 | 3300035088 | Bacteria | 950 |
| 497 | Ga0373951_0067614 | 3300035091 | Bacteria | 905 |
| 498 | Ga0373952_0055758 | 3300035092 | Bacteria | 954 |
| 499 | Ga0373923_0002261 | 3300035111 | Bacteria | 5867 |
| 500 | Ga0373923_0014077 | 3300035111 | Bacteria | 2997 |
| 501 | Ga0373923_0423216 | 3300035111 | Bacteria | 643 |
| 502 | Ga0373932_0153418 | 3300035112 | Bacteria | 792 |
| 503 | Ga0373936_0010029 | 3300035113 | Bacteria | 3576 |
| 504 | Ga0373936_0032164 | 3300035113 | Bacteria | 2074 |
| 505 | Ga0373936_0071575 | 3300035113 | Bacteria | 1430 |
| 506 | Ga0373936_0072468 | 3300035113 | Bacteria | 1422 |
| 507 | Ga0373936_0156340 | 3300035113 | Bacteria | 991 |
| 508 | Ga0373941_0258755 | 3300035115 | Bacteria | 682 |
| 509 | Ga0373945_0007295 | 3300035116 | Bacteria | 3580 |
| 510 | Ga0373945_0112256 | 3300035116 | Bacteria | 1076 |
| 511 | Ga0373953_0003179 | 3300035117 | Bacteria | 5083 |
| 512 | Ga0373953_0102715 | 3300035117 | Bacteria | 1204 |
| 513 | Ga0373954_0012353 | 3300035118 | Bacteria | 3796 |
| 514 | Ga0373954_0020732 | 3300035118 | Bacteria | 2975 |
| 515 | Ga0373954_0063009 | 3300035118 | Bacteria | 1752 |
| 516 | Ga0373954_0094359 | 3300035118 | Bacteria | 1439 |
| 517 | Ga0373956_0179989 | 3300035119 | Bacteria | 999 |
| 518 | Ga0373957_0029385 | 3300035120 | Bacteria | 2008 |
| 519 | Ga0373960_0443635 | 3300035121 | Bacteria | 507 |
| 520 | Ga0373943_0009944 | 3300035170 | Bacteria | 4264 |
| 521 | Ga0373943_0038876 | 3300035170 | Bacteria | 2289 |
| 522 | Ga0373943_0050092 | 3300035170 | Bacteria | 2051 |
| 523 | Ga0373943_0205678 | 3300035170 | Bacteria | 1091 |
| 524 | Ga0373943_0588763 | 3300035170 | Bacteria | 654 |
| 525 | Ga0373946_0003462 | 3300035171 | Bacteria | 5604 |
| 526 | Ga0373946_0234698 | 3300035171 | Bacteria | 890 |
| 527 | Ga0373946_0363281 | 3300035171 | Bacteria | 725 |
| 528 | Ga0373946_0579875 | 3300035171 | Bacteria | 580 |
| 529 | Ga0373955_0013183 | 3300035172 | Bacteria | 3988 |
| 530 | Ga0373955_0021533 | 3300035172 | Bacteria | 3256 |
| 531 | Ga0373955_0061212 | 3300035172 | Bacteria | 2078 |
| 532 | Ga0373955_0406453 | 3300035172 | Bacteria | 828 |
| 533 | Ga0373942_0135697 | 3300035207 | Bacteria | 780 |
| 534 | Ga0373961_0138744 | 3300035241 | Bacteria | 820 |
| 535 | Ga0316574_0000936 | 3300035398 | Bacteria | 13027 |
| 536 | Ga0373924_0049175 | 3300035410 | Bacteria | 1744 |
| 537 | Ga0373931_0185799 | 3300035691 | Bacteria | 1233 |
| 538 | Ga0373935_0001683 | 3300035692 | Bacteria | 12361 |
| 539 | Ga0373935_0027001 | 3300035692 | Bacteria | 3548 |
| 540 | Ga0373935_0081237 | 3300035692 | Bacteria | 2107 |
| 541 | Ga0373935_0282712 | 3300035692 | Bacteria | 1168 |
| 542 | Ga0373935_0333725 | 3300035692 | Bacteria | 1078 |
| 543 | Ga0373935_1069378 | 3300035692 | Bacteria | 600 |
| 544 | Ga0373935_1468908 | 3300035692 | Unclassified | 510 |
| 545 | Ga0373927_0001064 | 3300035695 | Bacteria | 20972 |
| 546 | Ga0373927_0003727 | 3300035695 | Bacteria | 10831 |
| 547 | Ga0373927_0022190 | 3300035695 | Bacteria | 4158 |
| 548 | Ga0373927_0024958 | 3300035695 | Bacteria | 3908 |
| 549 | Ga0373927_0034318 | 3300035695 | Bacteria | 3301 |
| 550 | Ga0373927_0067417 | 3300035695 | Bacteria | 2315 |
| 551 | Ga0373927_0074461 | 3300035695 | Bacteria | 2198 |
| 552 | Ga0373933_0016105 | 3300035724 | Bacteria | 4177 |
| 553 | Ga0373933_0347994 | 3300035724 | Bacteria | 962 |
| 554 | Ga0373947_0002167 | 3300035725 | Bacteria | 11925 |
| 555 | Ga0373947_0039278 | 3300035725 | Bacteria | 2815 |
| 556 | Ga0373947_0077843 | 3300035725 | Bacteria | 2046 |
| 557 | Ga0373947_0093373 | 3300035725 | Bacteria | 1880 |
| 558 | Ga0373947_0097415 | 3300035725 | Bacteria | 1843 |
| 559 | Ga0373947_0174947 | 3300035725 | Bacteria | 1395 |
| 560 | Ga0373937_0038800 | 3300036401 | Bacteria | 4340 |
| 561 | Ga0373937_0054380 | 3300036401 | Bacteria | 3673 |
| 562 | Ga0373937_0129029 | 3300036401 | Bacteria | 2361 |
| 563 | Ga0373937_0153911 | 3300036401 | Bacteria | 2154 |
| 564 | Ga0373937_0657564 | 3300036401 | Bacteria | 993 |
| 565 | Ga0265778_046832 | 3300036457 | Bacteria | 585 |
| 566 | Ga0310112_020380 | 3300036458 | Bacteria | 931 |
| 567 | Ga0310112_046367 | 3300036458 | Bacteria | 589 |
| 568 | Ga0372808_015496 | 3300036459 | Bacteria | 1090 |
| 569 | Ga0372808_051417 | 3300036459 | Bacteria | 590 |
| 570 | Ga0310109_017434 | 3300036534 | Bacteria | 971 |
| 571 | Ga0316582_0226541 | 3300036647 | Bacteria | 1279 |
| 572 | Ga0316584_0009641 | 3300036712 | Bacteria | 6715 |
| 573 | Ga0373925_0004723 | 3300037068 | Bacteria | 10276 |
| 574 | Ga0373925_0042979 | 3300037068 | Bacteria | 3353 |
| 575 | Ga0373925_0114709 | 3300037068 | Bacteria | 2085 |
| 576 | Ga0373925_0154664 | 3300037068 | Bacteria | 1803 |
| 577 | Ga0373925_0261631 | 3300037068 | Bacteria | 1390 |
| 578 | Ga0373925_0853388 | 3300037068 | Bacteria | 750 |
| 579 | Ga0395899_0231590 | 3300037312 | Bacteria | 1275 |
| 580 | Ga0395899_0437576 | 3300037312 | Bacteria | 859 |
| 581 | Ga0395899_0901400 | 3300037312 | Bacteria | 539 |
| 582 | Ga0395900_0009214 | 3300037418 | Bacteria | 10119 |
| 583 | Ga0395900_0082588 | 3300037418 | Bacteria | 3301 |
| 584 | Ga0395900_0166999 | 3300037418 | Bacteria | 2242 |
| 585 | Ga0395900_0272185 | 3300037418 | Bacteria | 1688 |
| 586 | Ga0395900_0843588 | 3300037418 | Bacteria | 842 |
| 587 | Ga0395898_0015137 | 3300037466 | Bacteria | 7917 |
| 588 | Ga0395898_0174104 | 3300037466 | Bacteria | 2057 |
| 589 | Ga0395898_0219407 | 3300037466 | Bacteria | 1814 |
| 590 | Ga0395898_0592250 | 3300037466 | Bacteria | 1051 |
| 591 | Ga0395905_0801984 | 3300037471 | Bacteria | 844 |
| 592 | Ga0395905_0827994 | 3300037471 | Bacteria | 828 |
| 593 | Ga0436364_0139182 | 3300037853 | Bacteria | 2049 |
| 594 | Ga0436364_0397665 | 3300037853 | Bacteria | 1014 |
| 595 | Ga0436364_0551645 | 3300037853 | Bacteria | 1497 |
| 596 | Ga0436364_0606227 | 3300037853 | Bacteria | 820 |
| 597 | Ga0395901_0061737 | 3300038443 | Bacteria | 3900 |
| 598 | Ga0395901_0171134 | 3300038443 | Bacteria | 2279 |
| 599 | Ga0395901_0185877 | 3300038443 | Bacteria | 2179 |
| 600 | Ga0395901_0363326 | 3300038443 | Bacteria | 1492 |
| 601 | Ga0395901_0686968 | 3300038443 | Bacteria | 1023 |
| 602 | Ga0395901_0851427 | 3300038443 | Bacteria | 897 |
| 603 | Ga0395901_0927463 | 3300038443 | Bacteria | 851 |
| 604 | Ga0436365_0161580 | 3300039437 | Bacteria | 1393 |
| 605 | Ga0436365_0364824 | 3300039437 | Bacteria | 4903 |
| 606 | Ga0436365_0370916 | 3300039437 | Bacteria | 2570 |
| 607 | Ga0436365_0415957 | 3300039437 | Bacteria | 1887 |
| 608 | Ga0436365_0750057 | 3300039437 | Bacteria | 5012 |
| 609 | Ga0436365_1010158 | 3300039437 | Bacteria | 565 |
| 610 | Ga0436365_1642110 | 3300039437 | Bacteria | 7073 |
| 611 | Ga0436365_1792715 | 3300039437 | Bacteria | 6792 |
| 612 | Ga0436360_0532387 | 3300039438 | Bacteria | 3194 |
| 613 | Ga0436360_1277159 | 3300039438 | Bacteria | 906 |
| 614 | Ga0436360_1365185 | 3300039438 | Bacteria | 518 |
| 615 | Ga0436361_0025609 | 3300039447 | Bacteria | 527 |
| 616 | Ga0436361_0879738 | 3300039447 | Bacteria | 596 |
| 617 | Ga0436363_0361340 | 3300039450 | Bacteria | 549 |
| 618 | Ga0436363_0399592 | 3300039450 | Bacteria | 1479 |
| 619 | Ga0436363_0687335 | 3300039450 | Bacteria | 2214 |
| 620 | Ga0436363_0727811 | 3300039450 | Bacteria | 852 |
| 621 | Ga0436363_0817040 | 3300039450 | Bacteria | 792 |
| 622 | Ga0436362_0539811 | 3300039453 | Bacteria | 764 |
| 623 | Ga0436362_0933613 | 3300039453 | Bacteria | 606 |
| 624 | Ga0439461_0234301 | 3300041410 | Bacteria | 505 |
| 625 | Ga0439465_0023914 | 3300041413 | Bacteria | 1924 |
| 626 | Ga0439465_0080922 | 3300041413 | Bacteria | 1101 |
| 627 | Ga0451787_391387 | 3300041441 | Bacteria | 568 |
| 628 | Ga0451789_0144202 | 3300041443 | Bacteria | 645 |
| 629 | Ga0451789_0595937 | 3300041443 | Bacteria | 766 |
| 630 | Ga0451795_1257867 | 3300041456 | Bacteria | 655 |
| 631 | Ga0451807_2041796 | 3300041486 | Bacteria | 659 |
| 632 | Ga0451837_0654691 | 3300041494 | Bacteria | 564 |
| 633 | Ga0451839_1368304 | 3300041496 | Bacteria | 567 |
| 634 | Ga0451853_3202264 | 3300041512 | Bacteria | 924 |
| 635 | Ga0450888_031227 | 3300042126 | Unclassified | 713 |
| 636 | Ga0466969_0034466 | 3300044656 | Bacteria | 2565 |
| 637 | Ga0466966_0087508 | 3300044684 | Bacteria | 1936 |
| 638 | Ga0466961_0448588 | 3300044693 | Bacteria | 781 |
| 639 | Ga0466963_0047877 | 3300044694 | Bacteria | 2823 |
| 640 | Ga0466963_0223740 | 3300044694 | Bacteria | 1318 |
| 641 | Ga0466963_0229283 | 3300044694 | Bacteria | 1301 |
| 642 | Ga0466963_0355320 | 3300044694 | Bacteria | 1032 |
| 643 | Ga0466963_0360864 | 3300044694 | Bacteria | 1023 |
| 644 | Ga0466964_0206987 | 3300044706 | Bacteria | 945 |
| 645 | Ga0466971_0265734 | 3300044719 | Bacteria | 819 |
| 646 | Ga0466971_0384265 | 3300044719 | Bacteria | 683 |
| 647 | Ga0466970_0421743 | 3300044765 | Bacteria | 763 |
| 648 | Ga0466970_0686219 | 3300044765 | Bacteria | 597 |
| 649 | Ga0466957_0164481 | 3300044842 | Bacteria | 1442 |
| 650 | Ga0466957_0424691 | 3300044842 | Bacteria | 912 |
| 651 | Ga0466959_0022942 | 3300045049 | Bacteria | 4614 |
| 652 | Ga0466959_0754021 | 3300045049 | Bacteria | 651 |
| 653 | Ga0466959_0878411 | 3300045049 | Bacteria | 598 |
| 654 | Ga0466958_0088392 | 3300045836 | Bacteria | 1914 |
| 655 | Ga0466958_0419423 | 3300045836 | Bacteria | 865 |
| 656 | Ga0466967_0146038 | 3300045976 | Bacteria | 2206 |
| 657 | Ga0466967_0247928 | 3300045976 | Bacteria | 1700 |
| 658 | Ga0466967_0528743 | 3300045976 | Bacteria | 1159 |
| 659 | Ga0466967_0943875 | 3300045976 | Bacteria | 858 |
| 660 | Ga0495617_245971 | 3300046452 | Bacteria | 552 |
| 661 | Ga0495592_0221929 | 3300046454 | Bacteria | 1263 |
| 662 | Ga0495603_0003128 | 3300046455 | Bacteria | 9841 |
| 663 | Ga0495603_0003243 | 3300046455 | Bacteria | 9693 |
| 664 | Ga0495603_0404795 | 3300046455 | Bacteria | 782 |
| 665 | Ga0495603_0821880 | 3300046455 | Bacteria | 529 |
| 666 | Ga0495629_0001107 | 3300046459 | Bacteria | 21326 |
| 667 | Ga0495629_0089202 | 3300046459 | Bacteria | 2151 |
| 668 | Ga0495629_0098558 | 3300046459 | Bacteria | 2039 |
| 669 | Ga0495638_0166650 | 3300046460 | Bacteria | 1267 |
| 670 | Ga0495638_0246856 | 3300046460 | Bacteria | 986 |
| 671 | Ga0495641_0040501 | 3300046461 | Bacteria | 2166 |
| 672 | Ga0495641_0199627 | 3300046461 | Bacteria | 896 |
| 673 | Ga0495651_0502320 | 3300046462 | Bacteria | 776 |
| 674 | Ga0495653_0238318 | 3300046463 | Bacteria | 1214 |
| 675 | Ga0495653_0415391 | 3300046463 | Bacteria | 852 |
| 676 | Ga0495580_0001546 | 3300046472 | Bacteria | 20242 |
| 677 | Ga0495580_0001981 | 3300046472 | Bacteria | 18011 |
| 678 | Ga0495580_0168301 | 3300046472 | Bacteria | 1516 |
| 679 | Ga0495580_0739524 | 3300046472 | Bacteria | 641 |
| 680 | Ga0495582_0000535 | 3300046473 | Bacteria | 20995 |
| 681 | Ga0495582_0102956 | 3300046473 | Bacteria | 1599 |
| 682 | Ga0495582_0119264 | 3300046473 | Bacteria | 1486 |
| 683 | Ga0495639_0009219 | 3300046475 | Bacteria | 4229 |
| 684 | Ga0495639_0017198 | 3300046475 | Bacteria | 3141 |
| 685 | Ga0495639_0033361 | 3300046475 | Bacteria | 2299 |
| 686 | Ga0495639_0075284 | 3300046475 | Bacteria | 1565 |
| 687 | Ga0495639_0441696 | 3300046475 | Bacteria | 660 |
| 688 | Ga0495662_0000510 | 3300046476 | Bacteria | 17683 |
| 689 | Ga0495662_0121165 | 3300046476 | Bacteria | 1284 |
| 690 | Ga0495664_0001402 | 3300046477 | Bacteria | 12752 |
| 691 | Ga0495664_0029743 | 3300046477 | Bacteria | 3196 |
| 692 | Ga0495664_0241390 | 3300046477 | Bacteria | 1093 |
| 693 | Ga0495584_0004392 | 3300046491 | Bacteria | 7592 |
| 694 | Ga0495585_0261743 | 3300046492 | Bacteria | 860 |
| 695 | Ga0495594_0000467 | 3300046499 | Bacteria | 20554 |
| 696 | Ga0495594_0084607 | 3300046499 | Bacteria | 1774 |
| 697 | Ga0495594_0689406 | 3300046499 | Bacteria | 578 |
| 698 | Ga0495608_0920840 | 3300046511 | Bacteria | 511 |
| 699 | Ga0495610_0157826 | 3300046512 | Bacteria | 962 |
| 700 | Ga0495618_0062328 | 3300046514 | Bacteria | 2366 |
| 701 | Ga0495618_0200439 | 3300046514 | Bacteria | 1263 |
| 702 | Ga0495620_0355863 | 3300046515 | Bacteria | 555 |
| 703 | Ga0495628_0092988 | 3300046516 | Bacteria | 2332 |
| 704 | Ga0495628_0131467 | 3300046516 | Bacteria | 1914 |
| 705 | Ga0495628_0277802 | 3300046516 | Bacteria | 1244 |
| 706 | Ga0495630_0019769 | 3300046517 | Bacteria | 4955 |
| 707 | Ga0495630_0044534 | 3300046517 | Bacteria | 3316 |
| 708 | Ga0495630_0362684 | 3300046517 | Bacteria | 1109 |
| 709 | Ga0495632_0077587 | 3300046519 | Bacteria | 1588 |
| 710 | Ga0495648_0002812 | 3300046524 | Bacteria | 15664 |
| 711 | Ga0495648_0467576 | 3300046524 | Bacteria | 548 |
| 712 | Ga0495666_0011698 | 3300046526 | Bacteria | 4376 |
| 713 | Ga0495666_0033648 | 3300046526 | Bacteria | 2503 |
| 714 | Ga0495666_0456114 | 3300046526 | Bacteria | 572 |
| 715 | Ga0495652_0195048 | 3300046529 | Bacteria | 1542 |
| 716 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 717 | Ga0495665_0070660 | 3300046531 | Bacteria | 1840 |
| 718 | Ga0495665_0266706 | 3300046531 | Bacteria | 880 |
| 719 | Ga0495665_0276537 | 3300046531 | Bacteria | 862 |
| 720 | Ga0495640_0042109 | 3300046533 | Bacteria | 3188 |
| 721 | Ga0495586_0225914 | 3300046535 | Bacteria | 1064 |
| 722 | Ga0495587_0017095 | 3300046536 | Bacteria | 4509 |
| 723 | Ga0495609_0112730 | 3300046538 | Bacteria | 1173 |
| 724 | Ga0495645_0058917 | 3300046543 | Bacteria | 2785 |
| 725 | Ga0495645_0143023 | 3300046543 | Bacteria | 1667 |
| 726 | Ga0495622_0002649 | 3300046557 | Bacteria | 8603 |
| 727 | Ga0495622_0229209 | 3300046557 | Bacteria | 821 |
| 728 | Ga0495667_0045386 | 3300046559 | Bacteria | 2910 |
| 729 | Ga0495667_0092318 | 3300046559 | Bacteria | 1960 |
| 730 | Ga0495667_0293849 | 3300046559 | Bacteria | 1030 |
| 731 | Ga0495656_0056008 | 3300046615 | Bacteria | 1702 |
| 732 | Ga0495656_0091280 | 3300046615 | Bacteria | 1393 |
| 733 | Ga0495668_0152135 | 3300046616 | Bacteria | 1267 |
| 734 | Ga0495668_0305656 | 3300046616 | Bacteria | 872 |
| 735 | Ga0495634_0004246 | 3300046642 | Bacteria | 11306 |
| 736 | Ga0495634_0021251 | 3300046642 | Bacteria | 4590 |
| 737 | Ga0495634_0267807 | 3300046642 | Bacteria | 1040 |
| 738 | Ga0495634_0485616 | 3300046642 | Bacteria | 725 |
| 739 | Ga0495635_0000564 | 3300046663 | Bacteria | 23651 |
| 740 | Ga0495635_0019084 | 3300046663 | Bacteria | 4787 |
| 741 | Ga0495659_0142610 | 3300046664 | Bacteria | 957 |
| 742 | Ga0495588_0007923 | 3300046674 | Bacteria | 4855 |
| 743 | Ga0495588_0199531 | 3300046674 | Bacteria | 1057 |
| 744 | Ga0495588_0380568 | 3300046674 | Bacteria | 741 |
| 745 | Ga0495588_0465807 | 3300046674 | Bacteria | 663 |
| 746 | Ga0495657_0008385 | 3300046675 | Bacteria | 7909 |
| 747 | Ga0495599_0063269 | 3300046678 | Bacteria | 2312 |
| 748 | Ga0495623_0087451 | 3300046679 | Bacteria | 1920 |
| 749 | Ga0495646_0003182 | 3300046680 | Bacteria | 10197 |
| 750 | Ga0495647_0002893 | 3300046681 | Bacteria | 5449 |
| 751 | Ga0495647_0164970 | 3300046681 | Bacteria | 956 |
| 752 | Ga0495658_0000707 | 3300046683 | Bacteria | 18088 |
| 753 | Ga0495658_0017267 | 3300046683 | Bacteria | 3725 |
| 754 | Ga0495658_0057106 | 3300046683 | Bacteria | 2228 |
| 755 | Ga0495658_0620831 | 3300046683 | Bacteria | 692 |
| 756 | Ga0495669_0142667 | 3300046684 | Bacteria | 1131 |
| 757 | Ga0495669_0165011 | 3300046684 | Bacteria | 1052 |
| 758 | Ga0495613_0197986 | 3300046689 | Bacteria | 1417 |
| 759 | Ga0495613_0396047 | 3300046689 | Bacteria | 942 |
| 760 | Ga0495613_0455611 | 3300046689 | Bacteria | 866 |
| 761 | Ga0495613_0499379 | 3300046689 | Bacteria | 819 |
| 762 | Ga0495624_0007718 | 3300046690 | Bacteria | 7549 |
| 763 | Ga0495624_0011115 | 3300046690 | Bacteria | 6192 |
| 764 | Ga0495624_0093997 | 3300046690 | Bacteria | 1848 |
| 765 | Ga0495624_0095840 | 3300046690 | Bacteria | 1828 |
| 766 | Ga0495624_0663570 | 3300046690 | Bacteria | 620 |
| 767 | Ga0495589_0116157 | 3300046794 | Bacteria | 1290 |
| 768 | Ga0495600_0303587 | 3300046809 | Bacteria | 1007 |
| 769 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 770 | Ga0495581_0115188 | 3300047315 | Bacteria | 1563 |
| 771 | Ga0495581_0123942 | 3300047315 | Bacteria | 1504 |
| 772 | Ga0495581_0903406 | 3300047315 | Bacteria | 504 |
| 773 | Ga0495604_0231500 | 3300047317 | Bacteria | 1267 |
| 774 | Ga0495604_0407544 | 3300047317 | Bacteria | 894 |
| 775 | Ga0495636_0379968 | 3300047318 | Bacteria | 670 |
| 776 | Ga0495674_0010478 | 3300047319 | Bacteria | 8775 |
| 777 | Ga0495674_0057472 | 3300047319 | Bacteria | 3404 |
| 778 | Ga0495674_1080358 | 3300047319 | Bacteria | 612 |
| 779 | Ga0495672_0041241 | 3300047320 | Bacteria | 2793 |
| 780 | Ga0495672_0044248 | 3300047320 | Bacteria | 2672 |
| 781 | Ga0495672_0067834 | 3300047320 | Bacteria | 2030 |
| 782 | Ga0495672_0198780 | 3300047320 | Bacteria | 1004 |
| 783 | Ga0495672_0251413 | 3300047320 | Bacteria | 858 |
| 784 | Ga0495676_0597770 | 3300047321 | Bacteria | 719 |
| 785 | Ga0495680_0404230 | 3300047322 | Bacteria | 942 |
| 786 | Ga0495675_0559047 | 3300047444 | Bacteria | 652 |
| 787 | Ga0495677_0143494 | 3300047445 | Bacteria | 917 |
| 788 | Ga0495673_0216853 | 3300047469 | Bacteria | 710 |
| 789 | Ga0495684_0001760 | 3300047471 | Bacteria | 17401 |
| 790 | Ga0495684_0005411 | 3300047471 | Bacteria | 9938 |
| 791 | Ga0495684_0014071 | 3300047471 | Bacteria | 6153 |
| 792 | Ga0495684_0060045 | 3300047471 | Bacteria | 2895 |
| 793 | Ga0495684_0479522 | 3300047471 | Bacteria | 859 |
| 794 | Ga0495686_0364035 | 3300047472 | Bacteria | 783 |
| 795 | Ga0495686_0465043 | 3300047472 | Bacteria | 670 |
| 796 | Ga0495593_0003034 | 3300047673 | Bacteria | 10117 |
| 797 | Ga0495593_0056442 | 3300047673 | Bacteria | 2064 |
| 798 | Ga0495593_0219375 | 3300047673 | Bacteria | 954 |
| 799 | Ga0495602_0760132 | 3300048088 | Bacteria | 653 |
| 800 | Ga0495614_0017309 | 3300048089 | Bacteria | 3132 |
| 801 | Ga0495626_0334815 | 3300048091 | Bacteria | 593 |
| 802 | Ga0496100_0289001 | 3300048903 | Bacteria | 1224 |
| 803 | Ga0496100_0830230 | 3300048903 | Bacteria | 724 |
| 804 | Ga0496100_1019075 | 3300048903 | Bacteria | 652 |
| 805 | Ga0496100_1547431 | 3300048903 | Bacteria | 524 |
| 806 | Ga0496101_0035354 | 3300048904 | Bacteria | 3534 |
| 807 | Ga0496101_0348283 | 3300048904 | Bacteria | 1164 |
| 808 | Ga0496101_0484922 | 3300048904 | Bacteria | 976 |
| 809 | Ga0496101_0503800 | 3300048904 | Bacteria | 956 |
| 810 | Ga0496101_0533848 | 3300048904 | Bacteria | 927 |
| 811 | Ga0496101_1111307 | 3300048904 | Bacteria | 620 |
| 812 | Ga0496101_1236865 | 3300048904 | Bacteria | 585 |
| 813 | Ga0496102_0224740 | 3300048905 | Bacteria | 1770 |
| 814 | Ga0496102_0377466 | 3300048905 | Bacteria | 1334 |
| 815 | Ga0496102_0611236 | 3300048905 | Bacteria | 1013 |
| 816 | Ga0496103_0316057 | 3300048906 | Bacteria | 1005 |
| 817 | Ga0496104_0001202 | 3300048907 | Bacteria | 22309 |
| 818 | Ga0496104_0036601 | 3300048907 | Bacteria | 4589 |
| 819 | Ga0496105_0018940 | 3300048908 | Bacteria | 5546 |
| 820 | Ga0496105_0130174 | 3300048908 | Bacteria | 2075 |
| 821 | Ga0496105_0169587 | 3300048908 | Bacteria | 1789 |
| 822 | Ga0496106_0064052 | 3300048909 | Bacteria | 2796 |
| 823 | Ga0496106_0828128 | 3300048909 | Bacteria | 733 |
| 824 | Ga0496106_0893478 | 3300048909 | Bacteria | 702 |
| 825 | Ga0496106_1478705 | 3300048909 | Bacteria | 523 |
| 826 | Ga0496107_0183784 | 3300048910 | Bacteria | 1552 |
| 827 | Ga0496108_0985894 | 3300048911 | Bacteria | 720 |
| 828 | Ga0496108_1143321 | 3300048911 | Bacteria | 660 |
| 829 | Ga0496108_1710467 | 3300048911 | Bacteria | 517 |
| 830 | Ga0496109_0105036 | 3300048912 | Bacteria | 2623 |
| 831 | Ga0496109_0205702 | 3300048912 | Bacteria | 1851 |
| 832 | Ga0496109_0752362 | 3300048912 | Bacteria | 912 |
| 833 | Ga0496109_1749107 | 3300048912 | Bacteria | 555 |
| 834 | Ga0496110_0554662 | 3300048913 | Bacteria | 1044 |
| 835 | Ga0496110_0647649 | 3300048913 | Bacteria | 956 |
| 836 | Ga0496112_0126959 | 3300048915 | Bacteria | 2521 |
| 837 | Ga0496112_0159292 | 3300048915 | Bacteria | 2224 |
| 838 | Ga0496112_0189832 | 3300048915 | Bacteria | 2017 |
| 839 | Ga0496112_1208213 | 3300048915 | Bacteria | 673 |
| 840 | Ga0496113_0172727 | 3300048916 | Bacteria | 1712 |
| 841 | Ga0496113_0410815 | 3300048916 | Bacteria | 1087 |
| 842 | Ga0496113_0569454 | 3300048916 | Bacteria | 908 |
| 843 | Ga0496113_1115101 | 3300048916 | Bacteria | 618 |
| 844 | Ga0496113_1287522 | 3300048916 | Bacteria | 569 |
| 845 | Ga0496114_0272621 | 3300048917 | Bacteria | 1491 |
| 846 | Ga0496114_0311513 | 3300048917 | Bacteria | 1390 |
| 847 | Ga0496114_0362703 | 3300048917 | Bacteria | 1282 |
| 848 | Ga0496114_1001883 | 3300048917 | Bacteria | 719 |
| 849 | Ga0496114_1718153 | 3300048917 | Bacteria | 516 |
| 850 | Ga0496115_0195321 | 3300048918 | Bacteria | 1672 |
| 851 | Ga0496115_0221492 | 3300048918 | Bacteria | 1561 |
| 852 | Ga0496115_0608827 | 3300048918 | Bacteria | 868 |
| 853 | Ga0496115_0825330 | 3300048918 | Bacteria | 720 |
| 854 | Ga0496115_0932849 | 3300048918 | Bacteria | 667 |
| 855 | Ga0496115_1122224 | 3300048918 | Bacteria | 595 |
| 856 | Ga0496117_0309225 | 3300048920 | Bacteria | 833 |
| 857 | Ga0496118_0037063 | 3300048921 | Bacteria | 3931 |
| 858 | Ga0496118_0234669 | 3300048921 | Bacteria | 1055 |
| 859 | Ga0496119_0104795 | 3300048922 | Bacteria | 1581 |
| 860 | Ga0496120_0088659 | 3300048923 | Bacteria | 1658 |
| 861 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 862 | Ga0496121_0000654 | 3300048924 | Bacteria | 64945 |
| 863 | Ga0496121_0018630 | 3300048924 | Bacteria | 6989 |
| 864 | Ga0496121_0197090 | 3300048924 | Bacteria | 1439 |
| 865 | Ga0496122_0158680 | 3300048925 | Bacteria | 1383 |
| 866 | Ga0496124_0428665 | 3300048927 | Bacteria | 909 |
| 867 | Ga0496126_0005056 | 3300048929 | Bacteria | 15313 |
| 868 | Ga0496126_0014598 | 3300048929 | Bacteria | 7933 |
| 869 | Ga0496126_0038863 | 3300048929 | Bacteria | 4423 |
| 870 | Ga0496126_0064357 | 3300048929 | Bacteria | 3285 |
| 871 | Ga0496126_0098767 | 3300048929 | Bacteria | 2558 |
| 872 | Ga0496126_0132213 | 3300048929 | Bacteria | 2155 |
| 873 | Ga0496126_0330191 | 3300048929 | Bacteria | 1252 |
| 874 | Ga0496126_0349592 | 3300048929 | Bacteria | 1209 |
| 875 | Ga0496126_0365809 | 3300048929 | Bacteria | 1177 |
| 876 | Ga0496126_0421770 | 3300048929 | Bacteria | 1078 |
| 877 | Ga0496126_0648549 | 3300048929 | Bacteria | 826 |
| 878 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 879 | Ga0501031_0193337 | 3300049568 | Bacteria | 1328 |
| 880 | Ga0501032_0005539 | 3300049569 | Bacteria | 9369 |
| 881 | Ga0501032_0174703 | 3300049569 | Bacteria | 1408 |
| 882 | Ga0501032_0254903 | 3300049569 | Bacteria | 1138 |
| 883 | Ga0501032_0340392 | 3300049569 | Bacteria | 967 |
| 884 | Ga0501032_0379657 | 3300049569 | Bacteria | 909 |
| 885 | Ga0501032_0591508 | 3300049569 | Bacteria | 706 |
| 886 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 887 | Ga0501033_0035113 | 3300049570 | Bacteria | 3759 |
| 888 | Ga0501033_0205835 | 3300049570 | Bacteria | 1404 |
| 889 | Ga0501033_0655015 | 3300049570 | Bacteria | 717 |
| 890 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 891 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 892 | Ga0501034_0010525 | 3300049571 | Bacteria | 9631 |
| 893 | Ga0501034_0025723 | 3300049571 | Bacteria | 5994 |
| 894 | Ga0501034_0046257 | 3300049571 | Bacteria | 4396 |
| 895 | Ga0501034_0078922 | 3300049571 | Bacteria | 3295 |
| 896 | Ga0501034_0707810 | 3300049571 | Bacteria | 905 |
| 897 | Ga0501036_0001033 | 3300049572 | Bacteria | 21031 |
| 898 | Ga0501036_0001435 | 3300049572 | Bacteria | 18318 |
| 899 | Ga0501036_0032297 | 3300049572 | Bacteria | 4423 |
| 900 | Ga0501036_0092628 | 3300049572 | Bacteria | 2553 |
| 901 | Ga0501036_0305562 | 3300049572 | Bacteria | 1330 |
| 902 | Ga0501036_0835499 | 3300049572 | Bacteria | 757 |
| 903 | Ga0501036_1127562 | 3300049572 | Bacteria | 640 |
| 904 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 905 | Ga0501037_0219185 | 3300049573 | Bacteria | 1339 |
| 906 | Ga0501037_0319746 | 3300049573 | Bacteria | 1075 |
| 907 | Ga0501038_0000538 | 3300049574 | Bacteria | 33271 |
| 908 | Ga0501038_0009770 | 3300049574 | Bacteria | 8793 |
| 909 | Ga0501038_0127917 | 3300049574 | Bacteria | 2089 |
| 910 | Ga0501038_0154740 | 3300049574 | Bacteria | 1868 |
| 911 | Ga0501038_1155675 | 3300049574 | Bacteria | 563 |
| 912 | Ga0501039_0000366 | 3300049575 | Bacteria | 32333 |
| 913 | Ga0501041_0077354 | 3300049577 | Bacteria | 2047 |
| 914 | Ga0501041_0264939 | 3300049577 | Bacteria | 1081 |
| 915 | Ga0501041_0290432 | 3300049577 | Bacteria | 1030 |
| 916 | Ga0501042_0307741 | 3300049578 | Bacteria | 1145 |
| 917 | Ga0501042_0940246 | 3300049578 | Bacteria | 630 |
| 918 | Ga0501043_0001664 | 3300049579 | Bacteria | 19297 |
| 919 | Ga0501043_0002453 | 3300049579 | Bacteria | 15684 |
| 920 | Ga0501043_0047182 | 3300049579 | Bacteria | 3386 |
| 921 | Ga0501043_0071832 | 3300049579 | Bacteria | 2718 |
| 922 | Ga0501043_0349189 | 3300049579 | Bacteria | 1124 |
| 923 | Ga0501046_0028312 | 3300049580 | Bacteria | 4564 |
| 924 | Ga0501046_0034979 | 3300049580 | Bacteria | 4050 |
| 925 | Ga0501046_0038152 | 3300049580 | Bacteria | 3858 |
| 926 | Ga0501046_0387002 | 3300049580 | Bacteria | 1011 |
| 927 | Ga0501046_1209992 | 3300049580 | Bacteria | 519 |
| 928 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 929 | Ga0501047_0002756 | 3300049581 | Bacteria | 16693 |
| 930 | Ga0501047_0011978 | 3300049581 | Bacteria | 8207 |
| 931 | Ga0501047_0024774 | 3300049581 | Bacteria | 5760 |
| 932 | Ga0501047_0062952 | 3300049581 | Bacteria | 3578 |
| 933 | Ga0501047_0133509 | 3300049581 | Bacteria | 2362 |
| 934 | Ga0501047_0426355 | 3300049581 | Bacteria | 1157 |
| 935 | Ga0501047_0453385 | 3300049581 | Bacteria | 1112 |
| 936 | Ga0501048_0000531 | 3300049582 | Bacteria | 26809 |
| 937 | Ga0501067_0000101 | 3300049583 | Bacteria | 49019 |
| 938 | Ga0501067_0069015 | 3300049583 | Bacteria | 1957 |
| 939 | Ga0501067_0073658 | 3300049583 | Bacteria | 1892 |
| 940 | Ga0501068_0000988 | 3300049584 | Bacteria | 14949 |
| 941 | Ga0501068_0267791 | 3300049584 | Bacteria | 1090 |
| 942 | Ga0501068_0322657 | 3300049584 | Bacteria | 990 |
| 943 | Ga0501069_0001211 | 3300049585 | Bacteria | 12577 |
| 944 | Ga0501069_0278180 | 3300049585 | Bacteria | 979 |
| 945 | Ga0501070_0001845 | 3300049586 | Bacteria | 18698 |
| 946 | Ga0501070_0025512 | 3300049586 | Bacteria | 4958 |
| 947 | Ga0501070_0036820 | 3300049586 | Bacteria | 4086 |
| 948 | Ga0501070_0488791 | 3300049586 | Bacteria | 990 |
| 949 | Ga0501070_1015912 | 3300049586 | Bacteria | 643 |
| 950 | Ga0501071_0101944 | 3300049587 | Bacteria | 2116 |
| 951 | Ga0501071_0117240 | 3300049587 | Bacteria | 1972 |
| 952 | Ga0501071_0658585 | 3300049587 | Bacteria | 806 |
| 953 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 954 | Ga0501072_0120095 | 3300049588 | Bacteria | 2094 |
| 955 | Ga0501073_0000230 | 3300049589 | Bacteria | 36799 |
| 956 | Ga0501073_0006293 | 3300049589 | Bacteria | 8844 |
| 957 | Ga0501073_0159305 | 3300049589 | Bacteria | 1564 |
| 958 | Ga0501074_0000141 | 3300049590 | Bacteria | 37729 |
| 959 | Ga0501074_0040096 | 3300049590 | Bacteria | 3392 |
| 960 | Ga0501074_0422054 | 3300049590 | Bacteria | 946 |
| 961 | Ga0501075_0041655 | 3300049591 | Bacteria | 3441 |
| 962 | Ga0501075_1528447 | 3300049591 | Bacteria | 505 |
| 963 | Ga0501076_0007746 | 3300049592 | Bacteria | 7828 |
| 964 | Ga0501076_0248308 | 3300049592 | Bacteria | 1456 |
| 965 | Ga0501076_0381156 | 3300049592 | Bacteria | 1159 |
| 966 | Ga0501077_0014321 | 3300049593 | Bacteria | 4982 |
| 967 | Ga0501077_0864856 | 3300049593 | Bacteria | 581 |
| 968 | Ga0501079_0003847 | 3300049741 | Bacteria | 11077 |
| 969 | Ga0501079_0335323 | 3300049741 | Bacteria | 1184 |
| 970 | Ga0501079_0410914 | 3300049741 | Bacteria | 1062 |
| 971 | Ga0501079_1168128 | 3300049741 | Bacteria | 606 |
| 972 | Ga0501080_0000383 | 3300049742 | Bacteria | 34102 |
| 973 | Ga0501080_0019207 | 3300049742 | Bacteria | 6328 |
| 974 | Ga0501080_0046554 | 3300049742 | Bacteria | 4038 |
| 975 | Ga0501080_0276796 | 3300049742 | Bacteria | 1526 |
| 976 | Ga0501080_0545595 | 3300049742 | Bacteria | 1033 |
| 977 | Ga0501081_0001105 | 3300049743 | Bacteria | 16197 |
| 978 | Ga0501081_0156885 | 3300049743 | Bacteria | 1638 |
| 979 | Ga0501081_0710629 | 3300049743 | Bacteria | 755 |
| 980 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 981 | Ga0501083_0008290 | 3300049744 | Bacteria | 7350 |
| 982 | Ga0501083_0109505 | 3300049744 | Bacteria | 1817 |
| 983 | Ga0501083_0207770 | 3300049744 | Bacteria | 1277 |
| 984 | Ga0501083_0991926 | 3300049744 | Bacteria | 547 |
| 985 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 986 | Ga0501035_0035937 | 3300049822 | Bacteria | 4494 |
| 987 | Ga0501035_0084773 | 3300049822 | Bacteria | 2794 |
| 988 | Ga0501035_0261056 | 3300049822 | Bacteria | 1468 |
| 989 | Ga0501035_0262481 | 3300049822 | Bacteria | 1464 |
| 990 | Ga0501035_0568375 | 3300049822 | Bacteria | 927 |
| 991 | Ga0501035_0741728 | 3300049822 | Bacteria | 789 |
| 992 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 993 | Ga0501044_0066736 | 3300049823 | Bacteria | 3667 |
| 994 | Ga0501044_0078775 | 3300049823 | Bacteria | 3339 |
| 995 | Ga0501044_0091785 | 3300049823 | Bacteria | 3063 |
| 996 | Ga0501044_0157290 | 3300049823 | Bacteria | 2251 |
| 997 | Ga0501044_0195949 | 3300049823 | Bacteria | 1980 |
| 998 | Ga0501044_0236656 | 3300049823 | Bacteria | 1771 |
| 999 | Ga0501044_0320980 | 3300049823 | Bacteria | 1473 |
| 1000 | Ga0501044_0451935 | 3300049823 | Bacteria | 1191 |
| 1001 | Ga0501044_1065661 | 3300049823 | Bacteria | 678 |
| 1002 | Ga0501045_0016159 | 3300049824 | Bacteria | 5297 |
| 1003 | Ga0501045_0097861 | 3300049824 | Bacteria | 2171 |
| 1004 | Ga0501045_0559518 | 3300049824 | Bacteria | 848 |
| 1005 | nmdc:mga03683_64937_c1 | 3300050489 | Bacteria | 1550 |
| 1006 | nmdc:mga03n38_618880_c1 | 3300050490 | Bacteria | 618 |
| 1007 | nmdc:mga03n38_69835_c1 | 3300050490 | Bacteria | 1623 |
| 1008 | nmdc:mga00v17_475262_c1 | 3300050491 | Bacteria | 811 |
| 1009 | nmdc:mga00v17_74556_c1 | 3300050491 | Bacteria | 2109 |
| 1010 | nmdc:mga0yw44_386868_c1 | 3300050492 | Bacteria | 945 |
| 1011 | nmdc:mga0yw44_773758_c1 | 3300050492 | Bacteria | 652 |
| 1012 | nmdc:mga06z11_172327_c1 | 3300050494 | Bacteria | 1243 |
| 1013 | nmdc:mga06z11_414261_c1 | 3300050494 | Bacteria | 812 |
| 1014 | nmdc:mga06z11_528630_c1 | 3300050494 | Bacteria | 715 |
| 1015 | nmdc:mga04h51_113359_c1 | 3300050495 | Bacteria | 1002 |
| 1016 | nmdc:mga04h51_34349_c1 | 3300050495 | Bacteria | 1619 |
| 1017 | nmdc:mga04h51_483862_c1 | 3300050495 | Bacteria | 527 |
| 1018 | nmdc:mga05p37_1695412_c1 | 3300050507 | Bacteria | 616 |
| 1019 | nmdc:mga05p37_172846_c1 | 3300050507 | Bacteria | 2634 |
| 1020 | nmdc:mga05p37_367324_c1 | 3300050507 | Bacteria | 1690 |
| 1021 | nmdc:mga09592_501130_c1 | 3300050508 | Bacteria | 1045 |
| 1022 | nmdc:mga09592_60724_c1 | 3300050508 | Bacteria | 3196 |
| 1023 | nmdc:mga09592_664666_c1 | 3300050508 | Bacteria | 889 |
| 1024 | nmdc:mga0qj67_1526_c1 | 3300050509 | Bacteria | 16241 |
| 1025 | nmdc:mga0qj67_25789_c1 | 3300050509 | Bacteria | 4546 |
| 1026 | nmdc:mga0qj67_696359_c1 | 3300050509 | Bacteria | 808 |
| 1027 | nmdc:mga06r32_1722422_c1 | 3300050510 | Bacteria | 563 |
| 1028 | nmdc:mga06r32_1760000_c1 | 3300050510 | Bacteria | 556 |
| 1029 | nmdc:mga06r32_213319_c1 | 3300050510 | Bacteria | 1918 |
| 1030 | nmdc:mga06r32_222504_c1 | 3300050510 | Bacteria | 1876 |
| 1031 | nmdc:mga08y16_1630265_c1 | 3300050511 | Bacteria | 602 |
| 1032 | nmdc:mga08y16_32617_c1 | 3300050511 | Bacteria | 5474 |
| 1033 | nmdc:mga08y16_453180_c1 | 3300050511 | Bacteria | 1308 |
| 1034 | nmdc:mga0n895_148282_c1 | 3300050512 | Bacteria | 2375 |
| 1035 | nmdc:mga0n895_41309_c1 | 3300050512 | Bacteria | 4482 |
| 1036 | nmdc:mga0n895_57163_c1 | 3300050512 | Bacteria | 3845 |
| 1037 | nmdc:mga0rr50_101477_c1 | 3300050513 | Bacteria | 2262 |
| 1038 | nmdc:mga0rr50_49311_c1 | 3300050513 | Bacteria | 3117 |
| 1039 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 1040 | nmdc:mga08x19_6179_c1 | 3300050514 | Bacteria | 7082 |
| 1041 | nmdc:mga0a205_1006435_c1 | 3300050515 | Bacteria | 680 |
| 1042 | nmdc:mga0a205_739594_c1 | 3300050515 | Bacteria | 832 |
| 1043 | nmdc:mga0sz30_175232_c1 | 3300050516 | Bacteria | 951 |
| 1044 | Ga0495601_0075387 | 3300053077 | Bacteria | 2159 |
| 1045 | Ga0495601_0085540 | 3300053077 | Bacteria | 2026 |
| 1046 | Ga0495601_0243250 | 3300053077 | Bacteria | 1175 |
| 1047 | Ga0495601_0701822 | 3300053077 | Bacteria | 645 |
| 1048 | Ga0495601_0816671 | 3300053077 | Bacteria | 591 |
| 1049 | Ga0495612_0108457 | 3300053078 | Bacteria | 1186 |
| 1050 | Ga0495612_0346256 | 3300053078 | Bacteria | 671 |
| 1051 | Ga0495655_0097702 | 3300053083 | Bacteria | 865 |
| 1052 | Ga0495655_0308239 | 3300053083 | Bacteria | 546 |
| 1053 | Ga0495595_0052600 | 3300053084 | Bacteria | 1890 |
| 1054 | Ga0495595_0309539 | 3300053084 | Bacteria | 795 |
| 1055 | Ga0495619_0057366 | 3300053085 | Bacteria | 2584 |
| 1056 | Ga0495619_0132713 | 3300053085 | Bacteria | 1712 |
| 1057 | Ga0495619_0386963 | 3300053085 | Bacteria | 966 |
| 1058 | Ga0495619_0515335 | 3300053085 | Bacteria | 822 |
| 1059 | Ga0500643_029258 | 3300053087 | Bacteria | 1697 |
| 1060 | Ga0500646_0285690 | 3300053090 | Bacteria | 588 |
| 1061 | Ga0500647_0104063 | 3300053091 | Bacteria | 1354 |
| 1062 | Ga0500583_0596915 | 3300053092 | Bacteria | 508 |
| 1063 | Ga0500651_0432608 | 3300053093 | Bacteria | 734 |
| 1064 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 1065 | Ga0500566_0137806 | 3300053094 | Bacteria | 1298 |
| 1066 | Ga0500640_025401 | 3300053095 | Bacteria | 2577 |
| 1067 | Ga0500641_0304479 | 3300053096 | Bacteria | 653 |
| 1068 | Ga0500572_003532 | 3300053111 | Bacteria | 3564 |
| 1069 | Ga0500591_158649 | 3300053115 | Bacteria | 860 |
| 1070 | Ga0500594_0050483 | 3300053118 | Bacteria | 1170 |
| 1071 | Ga0500595_001968 | 3300053119 | Bacteria | 10552 |
| 1072 | Ga0500595_002941 | 3300053119 | Bacteria | 8136 |
| 1073 | Ga0500595_003169 | 3300053119 | Bacteria | 7788 |
| 1074 | Ga0500608_133305 | 3300053122 | Bacteria | 1111 |
| 1075 | Ga0500614_034737 | 3300053123 | Bacteria | 1253 |
| 1076 | Ga0500614_259499 | 3300053123 | Bacteria | 542 |
| 1077 | Ga0500617_296604 | 3300053124 | Bacteria | 510 |
| 1078 | Ga0500618_020181 | 3300053125 | Bacteria | 1634 |
| 1079 | Ga0500642_0020919 | 3300053130 | Bacteria | 2581 |
| 1080 | Ga0500652_000091 | 3300053131 | Bacteria | 37722 |
| 1081 | Ga0500561_0079170 | 3300053137 | Bacteria | 954 |
| 1082 | Ga0500568_0004292 | 3300053139 | Bacteria | 7648 |
| 1083 | Ga0500568_0014374 | 3300053139 | Bacteria | 3577 |
| 1084 | Ga0500577_0005334 | 3300053142 | Bacteria | 3459 |
| 1085 | Ga0500589_174716 | 3300053147 | Bacteria | 850 |
| 1086 | Ga0500590_089533 | 3300053148 | Bacteria | 1497 |
| 1087 | Ga0500603_015136 | 3300053150 | Bacteria | 1811 |
| 1088 | Ga0500616_0000244 | 3300053153 | Bacteria | 85079 |
| 1089 | Ga0500630_096978 | 3300053159 | Bacteria | 1350 |
| 1090 | Ga0500634_0211943 | 3300053161 | Bacteria | 840 |
| 1091 | Ga0500638_049043 | 3300053162 | Bacteria | 2043 |
| 1092 | Ga0500638_062202 | 3300053162 | Bacteria | 1793 |
| 1093 | Ga0500639_033217 | 3300053163 | Bacteria | 2726 |
| 1094 | Ga0500637_0493734 | 3300053178 | Bacteria | 609 |
| 1095 | Ga0500611_074670 | 3300053727 | Bacteria | 834 |
| 1096 | Ga0500657_181975 | 3300053728 | Bacteria | 727 |
| 1097 | Ga0500596_000997 | 3300053735 | Bacteria | 5672 |
| 1098 | Ga0500601_006033 | 3300053737 | Bacteria | 1335 |
| 1099 | Ga0501084_0003563 | 3300054114 | Bacteria | 12638 |
| 1100 | Ga0501084_0012059 | 3300054114 | Bacteria | 7158 |
| 1101 | Ga0501084_0535253 | 3300054114 | Bacteria | 990 |
| 1102 | Ga0587083_0232800 | 3300059505 | Bacteria | 541 |
| 1103 | Ga0587107_119996 | 3300059652 | Bacteria | 541 |
| 1104 | Ga0501082_0001776 | 3300060353 | Bacteria | 18967 |
| 1105 | Ga0501082_0012968 | 3300060353 | Bacteria | 7164 |
| 1106 | Ga0501082_0372902 | 3300060353 | Bacteria | 1245 |
| 1107 | Ga0466962_0299836 | 3300061719 | Bacteria | 795 |
| 1108 | Ga0530510_0074394 | 3300061734 | Bacteria | 2466 |
| 1109 | Ga0530510_1210358 | 3300061734 | Bacteria | 579 |
| 1110 | Ga0530510_1420608 | 3300061734 | Bacteria | 533 |
| 1111 | 2507505421 | 2507262055 | Bacteria | 8048963 |
| 1112 | 2508539307 | 2508501009 | Bacteria | 7784016 |
| 1113 | 2508695634 | 2508501042 | Bacteria | 8719808 |
| 1114 | 2513659482 | 2513237096 | Bacteria | 8722461 |
| 1115 | 2513888607 | 2513237141 | Bacteria | 8496279 |
| 1116 | 2513921585 | 2513237145 | Bacteria | 8979722 |
| 1117 | 2515627616 | 2515154112 | Bacteria | 8294334 |
| 1118 | 2517889021 | 2517572143 | Bacteria | 9484767 |
| 1119 | 2644291063 | 2643221651 | Bacteria | 4798932 |
| 1120 | 2857526553 | 2857524615 | Bacteria | 6615449 |
| 1121 | 2874591662 | 2874590934 | Bacteria | 8299676 |
| 1122 | 2874646147 | 2874645413 | Bacteria | 8214782 |
| 1123 | 2876771763 | 2876771140 | Bacteria | 8287509 |
| 1124 | 2876819107 | 2876818435 | Bacteria | 8274608 |
| 1125 | 2879075646 | 2879074833 | Bacteria | 8279565 |
| 1126 | 2879128455 | 2879127579 | Bacteria | 8294491 |
| 1127 | 2879143567 | 2879142872 | Bacteria | 8267021 |
| 1128 | 2885382811 | 2885374607 | Bacteria | 8927485 |
| 1129 | 2885388529 | 2885383462 | Bacteria | 9473874 |
| 1130 | 2903775491 | 2903768456 | Bacteria | 9749579 |
| 1131 | 2904691035 | 2904690495 | Bacteria | 9412302 |
| 1132 | 2906641610 | 2906635258 | Bacteria | 8601019 |
| 1133 | 2906668137 | 2906660503 | Bacteria | 8595048 |
| 1134 | 2908747621 | 2908739725 | Bacteria | 8628932 |
| 1135 | 2908757093 | 2908756301 | Bacteria | 8864324 |
| 1136 | 2919073627 | 2919073203 | Bacteria | 6531949 |
| 1137 | 2935654481 | 2935648319 | Bacteria | 8801166 |
| 1138 | 2935663361 | 2935656913 | Bacteria | 8965014 |
| 1139 | 2935915014 | 2935908558 | Bacteria | 8568796 |
| 1140 | 2935918862 | 2935916978 | Bacteria | 9113783 |
| 1141 | 2935931421 | 2935926038 | Bacteria | 8601059 |
| 1142 | 2935940018 | 2935934488 | Bacteria | 8602579 |
| 1143 | 2935947635 | 2935942939 | Bacteria | 8599779 |
| 1144 | 2935956406 | 2935951376 | Bacteria | 8602333 |
| 1145 | 2935973200 | 2935967501 | Bacteria | 8603075 |
| 1146 | 2935980556 | 2935975950 | Bacteria | 8347125 |
| 1147 | 2935990092 | 2935984226 | Bacteria | 8302647 |
| 1148 | 2936017480 | 2936011229 | Bacteria | 8801034 |
| 1149 | 2936026019 | 2936019824 | Bacteria | 8804134 |
| 1150 | 2936034861 | 2936028420 | Bacteria | 8965941 |
| 1151 | 2936052881 | 2936046547 | Bacteria | 8903709 |
| 1152 | 2936060260 | 2936055302 | Bacteria | 8785755 |
| 1153 | 8016635457 | 8016630954 | Bacteria | 9217207 |
| 1154 | 8019623132 | 8019619141 | Bacteria | 9218857 |
| 1155 | 8019629967 | 8019629233 | Bacteria | 8687553 |
| 1156 | 8019640640 | 8019638758 | Bacteria | 9062356 |
| 1157 | 8019666808 | 8019659431 | Bacteria | 8577854 |
| 1158 | 8019676565 | 8019668869 | Bacteria | 8791617 |
| 1159 | 8019696080 | 8019687851 | Bacteria | 8712826 |
| 1160 | 8056682911 | 8056681323 | Bacteria | 8472857 |
| 1161 | 8056691114 | 8056689827 | Bacteria | 6712655 |
| 1162 | Ga0207707_10972052 | |||
| 1163 | JGI24739J22299_10014759 | |||
| 1164 | JGI24737J22298_10004663 | |||
| 1165 | JGI24735J21928_10050759 | |||
| 1166 | JGI24744J21845_10011748 | |||
| 1167 | Ga0070658_10249918 | |||
| 1168 | Ga0070658_10935885 | |||
| 1169 | Ga0070676_10883334 | |||
| 1170 | Ga0070676_11068875 | |||
| 1171 | Ga0070683_100283347 | |||
| 1172 | Ga0068869_102015950 | |||
| 1173 | Ga0070680_100028451 | |||
| 1174 | Ga0070680_100042072 | |||
| 1175 | Ga0070680_100375947 | |||
| 1176 | Ga0070682_100045925 | |||
| 1177 | Ga0070660_100123628 | |||
| 1178 | Ga0070660_100955644 | |||
| 1179 | Ga0070689_100424420 | |||
| 1180 | Ga0070691_10068228 | |||
| 1181 | Ga0070687_100277394 | |||
| 1182 | Ga0070661_101655238 | |||
| 1183 | Ga0070668_100146800 | |||
| 1184 | Ga0070668_100630255 | |||
| 1185 | Ga0070675_102031974 | |||
| 1186 | Ga0070674_100562463 | |||
| 1187 | Ga0070673_100397078 | |||
| 1188 | Ga0070673_101043446 | |||
| 1189 | Ga0070688_100847716 | |||
| 1190 | Ga0070659_100145959 | |||
| 1191 | Ga0070659_100885153 | |||
| 1192 | Ga0070659_101446936 | |||
| 1193 | Ga0070667_100201893 | |||
| 1194 | Ga0070703_10370564 | |||
| 1195 | Ga0070709_10012916 | |||
| 1196 | Ga0070709_10062926 | |||
| 1197 | Ga0070709_10109326 | |||
| 1198 | Ga0070709_10257247 | |||
| 1199 | Ga0070709_10538545 | |||
| 1200 | Ga0070709_10559599 | |||
| 1201 | Ga0070714_100001717 | |||
| 1202 | Ga0070714_100221863 | |||
| 1203 | Ga0070713_100003576 | |||
| 1204 | Ga0070713_100008626 | |||
| 1205 | Ga0070713_100014423 | |||
| 1206 | Ga0070713_100176437 | |||
| 1207 | Ga0070713_100296433 | |||
| 1208 | Ga0070713_100300072 | |||
| 1209 | Ga0070713_100527932 | |||
| 1210 | Ga0070710_10091980 | |||
| 1211 | Ga0070710_10544375 | |||
| 1212 | Ga0070711_100013825 | |||
| 1213 | Ga0070711_100068708 | |||
| 1214 | Ga0070705_100046068 | |||
| 1215 | Ga0070705_100992381 | |||
| 1216 | Ga0070700_100234600 | |||
| 1217 | Ga0070700_100417822 | |||
| 1218 | Ga0070708_100010550 | |||
| 1219 | Ga0070663_100128393 | |||
| 1220 | Ga0070663_100135611 | |||
| 1221 | Ga0070663_100549018 | |||
| 1222 | Ga0070678_100128549 | |||
| 1223 | Ga0070678_101577283 | |||
| 1224 | Ga0070681_10002937 | |||
| 1225 | Ga0070681_10049242 | |||
| 1226 | Ga0070681_10277360 | |||
| 1227 | Ga0070681_10316163 | |||
| 1228 | Ga0070681_10667266 | |||
| 1229 | Ga0070681_10738608 | |||
| 1230 | Ga0070681_11620348 | |||
| 1231 | Ga0070706_100068710 | |||
| 1232 | Ga0070706_100382641 | |||
| 1233 | Ga0070706_101121691 | |||
| 1234 | Ga0070707_100865648 | |||
| 1235 | Ga0070698_100328179 | |||
| 1236 | Ga0070698_100572825 | |||
| 1237 | Ga0070698_101673838 | |||
| 1238 | Ga0070699_100082086 | |||
| 1239 | Ga0070699_100470352 | |||
| 1240 | Ga0070699_100756499 | |||
| 1241 | Ga0070699_100889313 | |||
| 1242 | Ga0070699_100947478 | |||
| 1243 | Ga0070699_101285802 | |||
| 1244 | Ga0070699_101417312 | |||
| 1245 | Ga0070679_100022390 | |||
| 1246 | Ga0070679_100073695 | |||
| 1247 | Ga0070679_100091966 | |||
| 1248 | Ga0070679_100576798 | |||
| 1249 | Ga0070684_100166080 | |||
| 1250 | Ga0070684_100239243 | |||
| 1251 | Ga0070684_100318128 | |||
| 1252 | Ga0070684_100517623 | |||
| 1253 | Ga0070684_101111630 | |||
| 1254 | Ga0070697_100000401 | |||
| 1255 | Ga0070697_100194397 | |||
| 1256 | Ga0068853_100000639 | |||
| 1257 | Ga0068853_100075280 | |||
| 1258 | Ga0068853_100133322 | |||
| 1259 | Ga0068853_100278271 | |||
| 1260 | Ga0068853_100407809 | |||
| 1261 | Ga0068853_100684543 | |||
| 1262 | Ga0068853_100811691 | |||
| 1263 | Ga0068853_101005797 | |||
| 1264 | Ga0070672_100080066 | |||
| 1265 | Ga0070686_100135597 | |||
| 1266 | Ga0070695_100024318 | |||
| 1267 | Ga0070695_100416262 | |||
| 1268 | Ga0070695_101694498 | |||
| 1269 | Ga0070696_100052110 | |||
| 1270 | Ga0070696_101366836 | |||
| 1271 | Ga0070693_100012359 | |||
| 1272 | Ga0070693_100066852 | |||
| 1273 | Ga0070665_100095398 | |||
| 1274 | Ga0070665_100548292 | |||
| 1275 | Ga0070704_100170686 | |||
| 1276 | Ga0070704_100302787 | |||
| 1277 | Ga0070704_100526294 | |||
| 1278 | Ga0070704_101116027 | |||
| 1279 | Ga0068855_100037045 | |||
| 1280 | Ga0068855_100100703 | |||
| 1281 | Ga0068855_100139474 | |||
| 1282 | Ga0068855_100240004 | |||
| 1283 | Ga0068855_100375635 | |||
| 1284 | Ga0068855_101118743 | |||
| 1285 | Ga0068855_101370942 | |||
| 1286 | Ga0070664_100974627 | |||
| 1287 | Ga0068857_100025105 | |||
| 1288 | Ga0068857_100110916 | |||
| 1289 | Ga0068857_100359955 | |||
| 1290 | Ga0068854_100021505 | |||
| 1291 | Ga0068854_100148564 | |||
| 1292 | Ga0068854_100211940 | |||
| 1293 | Ga0068854_100272852 | |||
| 1294 | Ga0068854_101153061 | |||
| 1295 | Ga0068856_100112903 | |||
| 1296 | Ga0068856_100416860 | |||
| 1297 | Ga0068856_100533640 | |||
| 1298 | Ga0070702_100024299 | |||
| 1299 | Ga0068852_101625701 | |||
| 1300 | Ga0068852_102033794 | |||
| 1301 | Ga0068864_101760559 | |||
| 1302 | Ga0068866_10363224 | |||
| 1303 | Ga0068861_100126333 | |||
| 1304 | Ga0068861_100126335 | |||
| 1305 | Ga0068851_10080441 | |||
| 1306 | Ga0068870_10251101 | |||
| 1307 | Ga0068858_100145503 | |||
| 1308 | Ga0068862_100437377 | |||
| 1309 | Ga0081455_10041815 | |||
| 1310 | Ga0081455_10124008 | |||
| 1311 | Ga0081538_10085014 | |||
| 1312 | Ga0081538_10154479 | |||
| 1313 | Ga0081540_1034564 | |||
| 1314 | Ga0081539_10096276 | |||
| 1315 | Ga0070717_10005256 | |||
| 1316 | Ga0070717_10031009 | |||
| 1317 | Ga0070717_10109793 | |||
| 1318 | Ga0070717_10457573 | |||
| 1319 | Ga0070717_10863649 | |||
| 1320 | Ga0075365_10148733 | |||
| 1321 | Ga0075365_10350757 | |||
| 1322 | Ga0070715_10004133 | |||
| 1323 | Ga0070715_10149722 | |||
| 1324 | Ga0070716_100014993 | |||
| 1325 | Ga0070716_100056098 | |||
| 1326 | Ga0070716_100276966 | |||
| 1327 | Ga0070712_100062528 | |||
| 1328 | Ga0070712_100949710 | |||
| 1329 | Ga0070712_101062262 | |||
| 1330 | Ga0075362_10376122 | |||
| 1331 | Ga0075367_10454374 | |||
| 1332 | Ga0075367_10760733 | |||
| 1333 | Ga0075369_10076549 | |||
| 1334 | Ga0075369_10436264 | |||
| 1335 | Ga0097621_100379210 | |||
| 1336 | Ga0068871_101956981 | |||
| 1337 | Ga0075428_100128383 | |||
| 1338 | Ga0075428_101058163 | |||
| 1339 | Ga0075430_100199707 | |||
| 1340 | Ga0075431_100104798 | |||
| 1341 | Ga0075431_100576494 | |||
| 1342 | Ga0075431_100955841 | |||
| 1343 | Ga0075433_10739352 | |||
| 1344 | Ga0075434_100031871 | |||
| 1345 | Ga0075434_100326280 | |||
| 1346 | Ga0075434_100905945 | |||
| 1347 | Ga0075434_101718541 | |||
| 1348 | Ga0075429_100195517 | |||
| 1349 | Ga0075429_100614184 | |||
| 1350 | Ga0075436_100000298 | |||
| 1351 | Ga0075436_100010890 | |||
| 1352 | Ga0075436_100549487 | |||
| 1353 | Ga0099825_1038906 | |||
| 1354 | Ga0099824_1010644 | |||
| 1355 | Ga0099822_1012672 | |||
| 1356 | Ga0075435_100047801 | |||
| 1357 | Ga0075435_100056829 | |||
| 1358 | Ga0075435_102007772 | |||
| 1359 | Ga0099794_10133906 | |||
| 1360 | Ga0099795_10097540 | |||
| 1361 | Ga0099795_10099619 | |||
| 1362 | Ga0105240_10014356 | |||
| 1363 | Ga0105240_10042838 | |||
| 1364 | Ga0105240_10095109 | |||
| 1365 | Ga0105240_11301003 | |||
| 1366 | Ga0105240_12744306 | |||
| 1367 | Ga0111539_10157666 | |||
| 1368 | Ga0111539_11138734 | |||
| 1369 | Ga0111539_11259109 | |||
| 1370 | Ga0105245_10894260 | |||
| 1371 | Ga0105247_10389859 | |||
| 1372 | Ga0114129_10459084 | |||
| 1373 | Ga0114129_11057924 | |||
| 1374 | Ga0114129_11890174 | |||
| 1375 | Ga0105243_10077558 | |||
| 1376 | Ga0105243_10492496 | |||
| 1377 | Ga0105243_11772946 | |||
| 1378 | Ga0105241_10019098 | |||
| 1379 | Ga0105241_10589264 | |||
| 1380 | Ga0105242_10833308 | |||
| 1381 | Ga0105242_11234792 | |||
| 1382 | Ga0105237_10347378 | |||
| 1383 | Ga0105237_10430198 | |||
| 1384 | Ga0105238_10155040 | |||
| 1385 | Ga0105238_10565772 | |||
| 1386 | Ga0105238_10874956 | |||
| 1387 | Ga0105238_12213757 | |||
| 1388 | Ga0105249_10189764 | |||
| 1389 | Ga0105249_11578001 | |||
| 1390 | Ga0105239_10137662 | |||
| 1391 | Ga0105239_10962857 | |||
| 1392 | Ga0105246_10691860 | |||
| 1393 | Ga0157343_1010982 | |||
| 1394 | Ga0157373_10020703 | |||
| 1395 | Ga0157373_10764011 | |||
| 1396 | Ga0157371_10020656 | |||
| 1397 | Ga0157370_10008510 | |||
| 1398 | Ga0157370_10079308 | |||
| 1399 | Ga0157370_10241775 | |||
| 1400 | Ga0157370_10739446 | |||
| 1401 | Ga0157369_10020114 | |||
| 1402 | Ga0157369_10027434 | |||
| 1403 | Ga0157369_10117623 | |||
| 1404 | Ga0157378_12905619 | |||
| 1405 | Ga0163162_10924989 | |||
| 1406 | Ga0163162_12615669 | |||
| 1407 | Ga0157372_10362773 | |||
| 1408 | Ga0157372_10395957 | |||
| 1409 | Ga0157372_10471525 | |||
| 1410 | Ga0157372_11505973 | |||
| 1411 | Ga0157375_11323314 | |||
| 1412 | Ga0163163_11460393 | |||
| 1413 | Ga0157380_11445509 | |||
| 1414 | Ga0182008_10187114 | |||
| 1415 | Ga0182008_10206861 | |||
| 1416 | Ga0182008_10344530 | |||
| 1417 | Ga0157379_10392099 | |||
| 1418 | Ga0157379_11007356 | |||
| 1419 | Ga0157376_10504415 | |||
| 1420 | Ga0157376_12391339 | |||
| 1421 | Ga0182007_10059545 | |||
| 1422 | Ga0163161_10232139 | |||
| 1423 | Ga0163161_10459163 | |||
| 1424 | Ga0163161_10949958 | |||
| 1425 | Ga0197907_10638588 | |||
| 1426 | Ga0206356_10079857 | |||
| 1427 | Ga0206350_10077760 | |||
| 1428 | Ga0206353_10632584 | |||
| 1429 | Ga0213873_10274433 | |||
| 1430 | Ga0213876_10042405 | |||
| 1431 | Ga0213876_10046641 | |||
| 1432 | Ga0213876_10230991 | |||
| 1433 | Ga0213876_10318816 | |||
| 1434 | Ga0213875_10182541 | |||
| 1435 | Ga0224712_10281473 | |||
| 1436 | Ga0228598_1088474 | |||
| 1437 | Ga0207673_1027447 | |||
| 1438 | Ga0209758_1004128 | |||
| 1439 | Ga0209758_1024995 | |||
| 1440 | Ga0207426_1162183 | |||
| 1441 | Ga0207682_10065791 | |||
| 1442 | Ga0207692_10000073 | |||
| 1443 | Ga0207692_10101629 | |||
| 1444 | Ga0207710_10294828 | |||
| 1445 | Ga0207688_10360509 | |||
| 1446 | Ga0207680_10245865 | |||
| 1447 | Ga0207647_10011910 | |||
| 1448 | Ga0207685_10001894 | |||
| 1449 | Ga0207685_10230869 | |||
| 1450 | Ga0207699_10001951 | |||
| 1451 | Ga0207699_10030879 | |||
| 1452 | Ga0207699_10577858 | |||
| 1453 | Ga0207645_10531517 | |||
| 1454 | Ga0207645_11025821 | |||
| 1455 | Ga0207705_10123210 | |||
| 1456 | Ga0207705_10169733 | |||
| 1457 | Ga0207705_10248344 | |||
| 1458 | Ga0207705_10370782 | |||
| 1459 | Ga0207705_10470315 | |||
| 1460 | Ga0207705_11094866 | |||
| 1461 | Ga0207684_10470678 | |||
| 1462 | Ga0207684_10736002 | |||
| 1463 | Ga0207707_10001947 | |||
| 1464 | Ga0207707_10007389 | |||
| 1465 | Ga0207707_10069804 | |||
| 1466 | Ga0207707_10081921 | |||
| 1467 | Ga0207707_10202844 | |||
| 1468 | Ga0207707_10574701 | |||
| 1469 | Ga0207695_10025135 | |||
| 1470 | Ga0207695_10028873 | |||
| 1471 | Ga0207695_10060768 | |||
| 1472 | Ga0207695_10286110 | |||
| 1473 | Ga0207695_11358342 | |||
| 1474 | Ga0207695_11622513 | |||
| 1475 | Ga0207671_10264244 | |||
| 1476 | Ga0207671_10969100 | |||
| 1477 | Ga0207693_10029326 | |||
| 1478 | Ga0207693_10051697 | |||
| 1479 | Ga0207693_10506889 | |||
| 1480 | Ga0207693_10564210 | |||
| 1481 | Ga0207663_10002920 | |||
| 1482 | Ga0207663_10019599 | |||
| 1483 | Ga0207663_10107536 | |||
| 1484 | Ga0207663_10138774 | |||
| 1485 | Ga0207660_10008070 | |||
| 1486 | Ga0207660_10042879 | |||
| 1487 | Ga0207660_10073313 | |||
| 1488 | Ga0207660_10124206 | |||
| 1489 | Ga0207660_10370745 | |||
| 1490 | Ga0207657_10030313 | |||
| 1491 | Ga0207657_10214569 | |||
| 1492 | Ga0207657_10378835 | |||
| 1493 | Ga0207657_10679062 | |||
| 1494 | Ga0207652_10014863 | |||
| 1495 | Ga0207652_10022051 | |||
| 1496 | Ga0207652_10040147 | |||
| 1497 | Ga0207652_10062998 | |||
| 1498 | Ga0207652_10349301 | |||
| 1499 | Ga0207652_11734721 | |||
| 1500 | Ga0207646_10101215 | |||
| 1501 | Ga0207694_10476789 | |||
| 1502 | Ga0207694_11507755 | |||
| 1503 | Ga0207659_10412879 | |||
| 1504 | Ga0207687_10184771 | |||
| 1505 | Ga0207700_10007626 | |||
| 1506 | Ga0207700_10012388 | |||
| 1507 | Ga0207700_10089771 | |||
| 1508 | Ga0207700_10108545 | |||
| 1509 | Ga0207700_10122465 | |||
| 1510 | Ga0207700_10150413 | |||
| 1511 | Ga0207700_10173084 | |||
| 1512 | Ga0207700_10643177 | |||
| 1513 | Ga0207664_10002018 | |||
| 1514 | Ga0207664_10193516 | |||
| 1515 | Ga0207664_10195774 | |||
| 1516 | Ga0207644_10641609 | |||
| 1517 | Ga0207690_10137098 | |||
| 1518 | Ga0207690_10185179 | |||
| 1519 | Ga0207690_10417989 | |||
| 1520 | Ga0207706_11109995 | |||
| 1521 | Ga0207706_11538908 | |||
| 1522 | Ga0207706_11559464 | |||
| 1523 | Ga0207686_10073445 | |||
| 1524 | Ga0207686_10679750 | |||
| 1525 | Ga0207686_10822484 | |||
| 1526 | Ga0207709_10007306 | |||
| 1527 | Ga0207709_10327201 | |||
| 1528 | Ga0207709_10794834 | |||
| 1529 | Ga0207669_10015280 | |||
| 1530 | Ga0207669_10060537 | |||
| 1531 | Ga0207665_10013613 | |||
| 1532 | Ga0207665_10023380 | |||
| 1533 | Ga0207665_10296652 | |||
| 1534 | Ga0207665_10312589 | |||
| 1535 | Ga0207665_11200517 | |||
| 1536 | Ga0207691_10139944 | |||
| 1537 | Ga0207691_10680869 | |||
| 1538 | Ga0207661_10002867 | |||
| 1539 | Ga0207661_10037738 | |||
| 1540 | Ga0207661_10141543 | |||
| 1541 | Ga0207661_10447566 | |||
| 1542 | Ga0207667_10023350 | |||
| 1543 | Ga0207667_10027203 | |||
| 1544 | Ga0207667_10209344 | |||
| 1545 | Ga0207667_10223853 | |||
| 1546 | Ga0207667_11323505 | |||
| 1547 | Ga0207651_10062536 | |||
| 1548 | Ga0207651_11246040 | |||
| 1549 | Ga0207651_11965121 | |||
| 1550 | Ga0207712_10114450 | |||
| 1551 | Ga0207712_11485068 | |||
| 1552 | Ga0207712_11952808 | |||
| 1553 | Ga0207668_10113133 | |||
| 1554 | Ga0207668_10718466 | |||
| 1555 | Ga0207668_11585037 | |||
| 1556 | Ga0207640_10032514 | |||
| 1557 | Ga0207640_10087940 | |||
| 1558 | Ga0207640_10356609 | |||
| 1559 | Ga0207640_10712878 | |||
| 1560 | Ga0207640_10869899 | |||
| 1561 | Ga0207639_10041551 | |||
| 1562 | Ga0207639_10077818 | |||
| 1563 | Ga0207639_10163191 | |||
| 1564 | Ga0207639_10195874 | |||
| 1565 | Ga0207639_10664008 | |||
| 1566 | Ga0207639_11139238 | |||
| 1567 | Ga0207639_12029346 | |||
| 1568 | Ga0207678_10026230 | |||
| 1569 | Ga0207678_10389794 | |||
| 1570 | Ga0207678_11479925 | |||
| 1571 | Ga0207708_10161210 | |||
| 1572 | Ga0207702_10042791 | |||
| 1573 | Ga0207702_10247926 | |||
| 1574 | Ga0207676_10747094 | |||
| 1575 | Ga0207674_10005964 | |||
| 1576 | Ga0207674_10012348 | |||
| 1577 | Ga0207674_10125442 | |||
| 1578 | Ga0207674_10380457 | |||
| 1579 | Ga0207674_10431427 | |||
| 1580 | Ga0207674_10683769 | |||
| 1581 | Ga0207674_10701855 | |||
| 1582 | Ga0207675_100542496 | |||
| 1583 | Ga0207698_10126031 | |||
| 1584 | Ga0207698_10235792 | |||
| 1585 | Ga0207698_10336963 | |||
| 1586 | Ga0207698_10433840 | |||
| 1587 | Ga0207698_11442629 | |||
| 1588 | Ga0207698_12039497 | |||
| 1589 | Ga0209589_1000035 | |||
| 1590 | Ga0209489_100079 | |||
| 1591 | Ga0209700_100077 | |||
| 1592 | Ga0209179_1060282 | |||
| 1593 | Ga0209588_1024170 | |||
| 1594 | Ga0209588_1086810 | |||
| 1595 | Ga0209813_10030393 | |||
| 1596 | Ga0209813_10089863 | |||
| 1597 | Ga0209813_10141954 | |||
| 1598 | Ga0209813_10195383 | |||
| 1599 | Ga0207428_10288701 | |||
| 1600 | Ga0268266_10034993 | |||
| 1601 | Ga0268266_10645514 | |||
| 1602 | Ga0268265_10397976 | |||
| 1603 | Ga0265322_10095920 | |||
| 1604 | Ga0265338_10623195 | |||
| 1605 | Ga0265762_1153715 | |||
| 1606 | Ga0265765_1063688 | |||
| 1607 | Ga0265332_10189507 | |||
| 1608 | Ga0265332_10203235 | |||
| 1609 | Ga0265328_10279960 | |||
| 1610 | Ga0265325_10000141 | |||
| 1611 | Ga0265325_10006799 | |||
| 1612 | Ga0265325_10479868 | |||
| 1613 | Ga0265329_10095925 | |||
| 1614 | Ga0265339_10036600 | |||
| 1615 | Ga0265339_10177146 | |||
| 1616 | Ga0265339_10337565 | |||
| 1617 | Ga0265339_10366001 | |||
| 1618 | Ga0265331_10123320 | |||
| 1619 | Ga0307513_11048031 | |||
| 1620 | Ga0307408_101135702 | |||
| 1621 | Ga0307508_10039201 | |||
| 1622 | Ga0307508_10281692 | |||
| 1623 | Ga0307508_10557780 | |||
| 1624 | Ga0310114_124249 | |||
| 1625 | Ga0265314_10001306 | |||
| 1626 | Ga0265342_10005212 | |||
| 1627 | Ga0316576_10193963 | |||
| 1628 | Ga0316578_10000979 | |||
| 1629 | Ga0307405_10415069 | |||
| 1630 | Ga0307405_10628737 | |||
| 1631 | Ga0316577_10181864 | |||
| 1632 | Ga0307413_10105713 | |||
| 1633 | Ga0307413_10393908 | |||
| 1634 | Ga0326468_10054462 | |||
| 1635 | Ga0307406_11416759 | |||
| 1636 | Ga0307409_102183465 | |||
| 1637 | Ga0307416_102048631 | |||
| 1638 | Ga0307416_102871423 | |||
| 1639 | Ga0307416_103660851 | |||
| 1640 | Ga0307414_11863394 | |||
| 1641 | Ga0307414_12140646 | |||
| 1642 | Ga0307411_10489337 | |||
| 1643 | Ga0307415_100344205 | |||
| 1644 | Ga0307415_100742895 | |||
| 1645 | Ga0307415_100860721 | |||
| 1646 | Ga0307415_101147701 | |||
| 1647 | Ga0316585_10217915 | |||
| 1648 | Ga0316215_1004619 | |||
| 1649 | Ga0316214_1004062 | |||
| 1650 | Ga0373938_0041833 | |||
| 1651 | Ga0373926_0019265 | |||
| 1652 | Ga0373926_0023812 | |||
| 1653 | Ga0373926_0041726 | |||
| 1654 | Ga0373926_0098587 | |||
| 1655 | Ga0373926_0104870 | |||
| 1656 | Ga0373934_0038446 | |||
| 1657 | Ga0373940_0083102 | |||
| 1658 | Ga0373951_0067614 | |||
| 1659 | Ga0373952_0055758 | |||
| 1660 | Ga0373923_0002261 | |||
| 1661 | Ga0373923_0014077 | |||
| 1662 | Ga0373923_0423216 | |||
| 1663 | Ga0373932_0153418 | |||
| 1664 | Ga0373936_0010029 | |||
| 1665 | Ga0373936_0032164 | |||
| 1666 | Ga0373936_0071575 | |||
| 1667 | Ga0373936_0072468 | |||
| 1668 | Ga0373936_0156340 | |||
| 1669 | Ga0373941_0258755 | |||
| 1670 | Ga0373945_0007295 | |||
| 1671 | Ga0373945_0112256 | |||
| 1672 | Ga0373953_0003179 | |||
| 1673 | Ga0373953_0102715 | |||
| 1674 | Ga0373954_0012353 | |||
| 1675 | Ga0373954_0020732 | |||
| 1676 | Ga0373954_0063009 | |||
| 1677 | Ga0373954_0094359 | |||
| 1678 | Ga0373956_0179989 | |||
| 1679 | Ga0373957_0029385 | |||
| 1680 | Ga0373960_0443635 | |||
| 1681 | Ga0373943_0009944 | |||
| 1682 | Ga0373943_0038876 | |||
| 1683 | Ga0373943_0050092 | |||
| 1684 | Ga0373943_0205678 | |||
| 1685 | Ga0373943_0588763 | |||
| 1686 | Ga0373946_0003462 | |||
| 1687 | Ga0373946_0234698 | |||
| 1688 | Ga0373946_0363281 | |||
| 1689 | Ga0373946_0579875 | |||
| 1690 | Ga0373955_0013183 | |||
| 1691 | Ga0373955_0021533 | |||
| 1692 | Ga0373955_0061212 | |||
| 1693 | Ga0373955_0406453 | |||
| 1694 | Ga0373942_0135697 | |||
| 1695 | Ga0373961_0138744 | |||
| 1696 | Ga0316574_0000936 | |||
| 1697 | Ga0373924_0049175 | |||
| 1698 | Ga0373931_0185799 | |||
| 1699 | Ga0373935_0001683 | |||
| 1700 | Ga0373935_0027001 | |||
| 1701 | Ga0373935_0081237 | |||
| 1702 | Ga0373935_0282712 | |||
| 1703 | Ga0373935_0333725 | |||
| 1704 | Ga0373935_1069378 | |||
| 1705 | Ga0373935_1468908 | |||
| 1706 | Ga0373927_0001064 | |||
| 1707 | Ga0373927_0003727 | |||
| 1708 | Ga0373927_0022190 | |||
| 1709 | Ga0373927_0024958 | |||
| 1710 | Ga0373927_0034318 | |||
| 1711 | Ga0373927_0067417 | |||
| 1712 | Ga0373927_0074461 | |||
| 1713 | Ga0373933_0016105 | |||
| 1714 | Ga0373933_0347994 | |||
| 1715 | Ga0373947_0002167 | |||
| 1716 | Ga0373947_0039278 | |||
| 1717 | Ga0373947_0077843 | |||
| 1718 | Ga0373947_0093373 | |||
| 1719 | Ga0373947_0097415 | |||
| 1720 | Ga0373947_0174947 | |||
| 1721 | Ga0373937_0038800 | |||
| 1722 | Ga0373937_0054380 | |||
| 1723 | Ga0373937_0129029 | |||
| 1724 | Ga0373937_0153911 | |||
| 1725 | Ga0373937_0657564 | |||
| 1726 | Ga0265778_046832 | |||
| 1727 | Ga0310112_020380 | |||
| 1728 | Ga0310112_046367 | |||
| 1729 | Ga0372808_015496 | |||
| 1730 | Ga0372808_051417 | |||
| 1731 | Ga0310109_017434 | |||
| 1732 | Ga0316582_0226541 | |||
| 1733 | Ga0316584_0009641 | |||
| 1734 | Ga0373925_0004723 | |||
| 1735 | Ga0373925_0042979 | |||
| 1736 | Ga0373925_0114709 | |||
| 1737 | Ga0373925_0154664 | |||
| 1738 | Ga0373925_0261631 | |||
| 1739 | Ga0373925_0853388 | |||
| 1740 | Ga0395899_0231590 | |||
| 1741 | Ga0395899_0437576 | |||
| 1742 | Ga0395899_0901400 | |||
| 1743 | Ga0395900_0009214 | |||
| 1744 | Ga0395900_0082588 | |||
| 1745 | Ga0395900_0166999 | |||
| 1746 | Ga0395900_0272185 | |||
| 1747 | Ga0395900_0843588 | |||
| 1748 | Ga0395898_0015137 | |||
| 1749 | Ga0395898_0174104 | |||
| 1750 | Ga0395898_0219407 | |||
| 1751 | Ga0395898_0592250 | |||
| 1752 | Ga0395905_0801984 | |||
| 1753 | Ga0395905_0827994 | |||
| 1754 | Ga0436364_0139182 | |||
| 1755 | Ga0436364_0397665 | |||
| 1756 | Ga0436364_0551645 | |||
| 1757 | Ga0436364_0606227 | |||
| 1758 | Ga0395901_0061737 | |||
| 1759 | Ga0395901_0171134 | |||
| 1760 | Ga0395901_0185877 | |||
| 1761 | Ga0395901_0363326 | |||
| 1762 | Ga0395901_0686968 | |||
| 1763 | Ga0395901_0851427 | |||
| 1764 | Ga0395901_0927463 | |||
| 1765 | Ga0436365_0161580 | |||
| 1766 | Ga0436365_0364824 | |||
| 1767 | Ga0436365_0370916 | |||
| 1768 | Ga0436365_0415957 | |||
| 1769 | Ga0436365_0750057 | |||
| 1770 | Ga0436365_1010158 | |||
| 1771 | Ga0436365_1642110 | |||
| 1772 | Ga0436365_1792715 | |||
| 1773 | Ga0436360_0532387 | |||
| 1774 | Ga0436360_1277159 | |||
| 1775 | Ga0436360_1365185 | |||
| 1776 | Ga0436361_0025609 | |||
| 1777 | Ga0436361_0879738 | |||
| 1778 | Ga0436363_0361340 | |||
| 1779 | Ga0436363_0399592 | |||
| 1780 | Ga0436363_0687335 | |||
| 1781 | Ga0436363_0727811 | |||
| 1782 | Ga0436363_0817040 | |||
| 1783 | Ga0436362_0539811 | |||
| 1784 | Ga0436362_0933613 | |||
| 1785 | Ga0439461_0234301 | |||
| 1786 | Ga0439465_0023914 | |||
| 1787 | Ga0439465_0080922 | |||
| 1788 | Ga0451787_391387 | |||
| 1789 | Ga0451789_0144202 | |||
| 1790 | Ga0451789_0595937 | |||
| 1791 | Ga0451795_1257867 | |||
| 1792 | Ga0451807_2041796 | |||
| 1793 | Ga0451837_0654691 | |||
| 1794 | Ga0451839_1368304 | |||
| 1795 | Ga0451853_3202264 | |||
| 1796 | Ga0450888_031227 | |||
| 1797 | Ga0466969_0034466 | |||
| 1798 | Ga0466966_0087508 | |||
| 1799 | Ga0466961_0448588 | |||
| 1800 | Ga0466963_0047877 | |||
| 1801 | Ga0466963_0223740 | |||
| 1802 | Ga0466963_0229283 | |||
| 1803 | Ga0466963_0355320 | |||
| 1804 | Ga0466963_0360864 | |||
| 1805 | Ga0466964_0206987 | |||
| 1806 | Ga0466971_0265734 | |||
| 1807 | Ga0466971_0384265 | |||
| 1808 | Ga0466970_0421743 | |||
| 1809 | Ga0466970_0686219 | |||
| 1810 | Ga0466957_0164481 | |||
| 1811 | Ga0466957_0424691 | |||
| 1812 | Ga0466959_0022942 | |||
| 1813 | Ga0466959_0754021 | |||
| 1814 | Ga0466959_0878411 | |||
| 1815 | Ga0466958_0088392 | |||
| 1816 | Ga0466958_0419423 | |||
| 1817 | Ga0466967_0146038 | |||
| 1818 | Ga0466967_0247928 | |||
| 1819 | Ga0466967_0528743 | |||
| 1820 | Ga0466967_0943875 | |||
| 1821 | Ga0495617_245971 | |||
| 1822 | Ga0495592_0221929 | |||
| 1823 | Ga0495603_0003128 | |||
| 1824 | Ga0495603_0003243 | |||
| 1825 | Ga0495603_0404795 | |||
| 1826 | Ga0495603_0821880 | |||
| 1827 | Ga0495629_0001107 | |||
| 1828 | Ga0495629_0089202 | |||
| 1829 | Ga0495629_0098558 | |||
| 1830 | Ga0495638_0166650 | |||
| 1831 | Ga0495638_0246856 | |||
| 1832 | Ga0495641_0040501 | |||
| 1833 | Ga0495641_0199627 | |||
| 1834 | Ga0495651_0502320 | |||
| 1835 | Ga0495653_0238318 | |||
| 1836 | Ga0495653_0415391 | |||
| 1837 | Ga0495580_0001546 | |||
| 1838 | Ga0495580_0001981 | |||
| 1839 | Ga0495580_0168301 | |||
| 1840 | Ga0495580_0739524 | |||
| 1841 | Ga0495582_0000535 | |||
| 1842 | Ga0495582_0102956 | |||
| 1843 | Ga0495582_0119264 | |||
| 1844 | Ga0495639_0009219 | |||
| 1845 | Ga0495639_0017198 | |||
| 1846 | Ga0495639_0033361 | |||
| 1847 | Ga0495639_0075284 | |||
| 1848 | Ga0495639_0441696 | |||
| 1849 | Ga0495662_0000510 | |||
| 1850 | Ga0495662_0121165 | |||
| 1851 | Ga0495664_0001402 | |||
| 1852 | Ga0495664_0029743 | |||
| 1853 | Ga0495664_0241390 | |||
| 1854 | Ga0495584_0004392 | |||
| 1855 | Ga0495585_0261743 | |||
| 1856 | Ga0495594_0000467 | |||
| 1857 | Ga0495594_0084607 | |||
| 1858 | Ga0495594_0689406 | |||
| 1859 | Ga0495608_0920840 | |||
| 1860 | Ga0495610_0157826 | |||
| 1861 | Ga0495618_0062328 | |||
| 1862 | Ga0495618_0200439 | |||
| 1863 | Ga0495620_0355863 | |||
| 1864 | Ga0495628_0092988 | |||
| 1865 | Ga0495628_0131467 | |||
| 1866 | Ga0495628_0277802 | |||
| 1867 | Ga0495630_0019769 | |||
| 1868 | Ga0495630_0044534 | |||
| 1869 | Ga0495630_0362684 | |||
| 1870 | Ga0495632_0077587 | |||
| 1871 | Ga0495648_0002812 | |||
| 1872 | Ga0495648_0467576 | |||
| 1873 | Ga0495666_0011698 | |||
| 1874 | Ga0495666_0033648 | |||
| 1875 | Ga0495666_0456114 | |||
| 1876 | Ga0495652_0195048 | |||
| 1877 | Ga0495665_0000128 | |||
| 1878 | Ga0495665_0070660 | |||
| 1879 | Ga0495665_0266706 | |||
| 1880 | Ga0495665_0276537 | |||
| 1881 | Ga0495640_0042109 | |||
| 1882 | Ga0495586_0225914 | |||
| 1883 | Ga0495587_0017095 | |||
| 1884 | Ga0495609_0112730 | |||
| 1885 | Ga0495645_0058917 | |||
| 1886 | Ga0495645_0143023 | |||
| 1887 | Ga0495622_0002649 | |||
| 1888 | Ga0495622_0229209 | |||
| 1889 | Ga0495667_0045386 | |||
| 1890 | Ga0495667_0092318 | |||
| 1891 | Ga0495667_0293849 | |||
| 1892 | Ga0495656_0056008 | |||
| 1893 | Ga0495656_0091280 | |||
| 1894 | Ga0495668_0152135 | |||
| 1895 | Ga0495668_0305656 | |||
| 1896 | Ga0495634_0004246 | |||
| 1897 | Ga0495634_0021251 | |||
| 1898 | Ga0495634_0267807 | |||
| 1899 | Ga0495634_0485616 | |||
| 1900 | Ga0495635_0000564 | |||
| 1901 | Ga0495635_0019084 | |||
| 1902 | Ga0495659_0142610 | |||
| 1903 | Ga0495588_0007923 | |||
| 1904 | Ga0495588_0199531 | |||
| 1905 | Ga0495588_0380568 | |||
| 1906 | Ga0495588_0465807 | |||
| 1907 | Ga0495657_0008385 | |||
| 1908 | Ga0495599_0063269 | |||
| 1909 | Ga0495623_0087451 | |||
| 1910 | Ga0495646_0003182 | |||
| 1911 | Ga0495647_0002893 | |||
| 1912 | Ga0495647_0164970 | |||
| 1913 | Ga0495658_0000707 | |||
| 1914 | Ga0495658_0017267 | |||
| 1915 | Ga0495658_0057106 | |||
| 1916 | Ga0495658_0620831 | |||
| 1917 | Ga0495669_0142667 | |||
| 1918 | Ga0495669_0165011 | |||
| 1919 | Ga0495613_0197986 | |||
| 1920 | Ga0495613_0396047 | |||
| 1921 | Ga0495613_0455611 | |||
| 1922 | Ga0495613_0499379 | |||
| 1923 | Ga0495624_0007718 | |||
| 1924 | Ga0495624_0011115 | |||
| 1925 | Ga0495624_0093997 | |||
| 1926 | Ga0495624_0095840 | |||
| 1927 | Ga0495624_0663570 | |||
| 1928 | Ga0495589_0116157 | |||
| 1929 | Ga0495600_0303587 | |||
| 1930 | Ga0495581_0000030 | |||
| 1931 | Ga0495581_0115188 | |||
| 1932 | Ga0495581_0123942 | |||
| 1933 | Ga0495581_0903406 | |||
| 1934 | Ga0495604_0231500 | |||
| 1935 | Ga0495604_0407544 | |||
| 1936 | Ga0495636_0379968 | |||
| 1937 | Ga0495674_0010478 | |||
| 1938 | Ga0495674_0057472 | |||
| 1939 | Ga0495674_1080358 | |||
| 1940 | Ga0495672_0041241 | |||
| 1941 | Ga0495672_0044248 | |||
| 1942 | Ga0495672_0067834 | |||
| 1943 | Ga0495672_0198780 | |||
| 1944 | Ga0495672_0251413 | |||
| 1945 | Ga0495676_0597770 | |||
| 1946 | Ga0495680_0404230 | |||
| 1947 | Ga0495675_0559047 | |||
| 1948 | Ga0495677_0143494 | |||
| 1949 | Ga0495673_0216853 | |||
| 1950 | Ga0495684_0001760 | |||
| 1951 | Ga0495684_0005411 | |||
| 1952 | Ga0495684_0014071 | |||
| 1953 | Ga0495684_0060045 | |||
| 1954 | Ga0495684_0479522 | |||
| 1955 | Ga0495686_0364035 | |||
| 1956 | Ga0495686_0465043 | |||
| 1957 | Ga0495593_0003034 | |||
| 1958 | Ga0495593_0056442 | |||
| 1959 | Ga0495593_0219375 | |||
| 1960 | Ga0495602_0760132 | |||
| 1961 | Ga0495614_0017309 | |||
| 1962 | Ga0495626_0334815 | |||
| 1963 | Ga0496100_0289001 | |||
| 1964 | Ga0496100_0830230 | |||
| 1965 | Ga0496100_1019075 | |||
| 1966 | Ga0496100_1547431 | |||
| 1967 | Ga0496101_0035354 | |||
| 1968 | Ga0496101_0348283 | |||
| 1969 | Ga0496101_0484922 | |||
| 1970 | Ga0496101_0503800 | |||
| 1971 | Ga0496101_0533848 | |||
| 1972 | Ga0496101_1111307 | |||
| 1973 | Ga0496101_1236865 | |||
| 1974 | Ga0496102_0224740 | |||
| 1975 | Ga0496102_0377466 | |||
| 1976 | Ga0496102_0611236 | |||
| 1977 | Ga0496103_0316057 | |||
| 1978 | Ga0496104_0001202 | |||
| 1979 | Ga0496104_0036601 | |||
| 1980 | Ga0496105_0018940 | |||
| 1981 | Ga0496105_0130174 | |||
| 1982 | Ga0496105_0169587 | |||
| 1983 | Ga0496106_0064052 | |||
| 1984 | Ga0496106_0828128 | |||
| 1985 | Ga0496106_0893478 | |||
| 1986 | Ga0496106_1478705 | |||
| 1987 | Ga0496107_0183784 | |||
| 1988 | Ga0496108_0985894 | |||
| 1989 | Ga0496108_1143321 | |||
| 1990 | Ga0496108_1710467 | |||
| 1991 | Ga0496109_0105036 | |||
| 1992 | Ga0496109_0205702 | |||
| 1993 | Ga0496109_0752362 | |||
| 1994 | Ga0496109_1749107 | |||
| 1995 | Ga0496110_0554662 | |||
| 1996 | Ga0496110_0647649 | |||
| 1997 | Ga0496112_0126959 | |||
| 1998 | Ga0496112_0159292 | |||
| 1999 | Ga0496112_0189832 | |||
| 2000 | Ga0496112_1208213 | |||
| 2001 | Ga0496113_0172727 | |||
| 2002 | Ga0496113_0410815 | |||
| 2003 | Ga0496113_0569454 | |||
| 2004 | Ga0496113_1115101 | |||
| 2005 | Ga0496113_1287522 | |||
| 2006 | Ga0496114_0272621 | |||
| 2007 | Ga0496114_0311513 | |||
| 2008 | Ga0496114_0362703 | |||
| 2009 | Ga0496114_1001883 | |||
| 2010 | Ga0496114_1718153 | |||
| 2011 | Ga0496115_0195321 | |||
| 2012 | Ga0496115_0221492 | |||
| 2013 | Ga0496115_0608827 | |||
| 2014 | Ga0496115_0825330 | |||
| 2015 | Ga0496115_0932849 | |||
| 2016 | Ga0496115_1122224 | |||
| 2017 | Ga0496117_0309225 | |||
| 2018 | Ga0496118_0037063 | |||
| 2019 | Ga0496118_0234669 | |||
| 2020 | Ga0496119_0104795 | |||
| 2021 | Ga0496120_0088659 | |||
| 2022 | Ga0496121_0000278 | |||
| 2023 | Ga0496121_0000654 | |||
| 2024 | Ga0496121_0018630 | |||
| 2025 | Ga0496121_0197090 | |||
| 2026 | Ga0496122_0158680 | |||
| 2027 | Ga0496124_0428665 | |||
| 2028 | Ga0496126_0005056 | |||
| 2029 | Ga0496126_0014598 | |||
| 2030 | Ga0496126_0038863 | |||
| 2031 | Ga0496126_0064357 | |||
| 2032 | Ga0496126_0098767 | |||
| 2033 | Ga0496126_0132213 | |||
| 2034 | Ga0496126_0330191 | |||
| 2035 | Ga0496126_0349592 | |||
| 2036 | Ga0496126_0365809 | |||
| 2037 | Ga0496126_0421770 | |||
| 2038 | Ga0496126_0648549 | |||
| 2039 | Ga0501031_0000207 | |||
| 2040 | Ga0501031_0193337 | |||
| 2041 | Ga0501032_0005539 | |||
| 2042 | Ga0501032_0174703 | |||
| 2043 | Ga0501032_0254903 | |||
| 2044 | Ga0501032_0340392 | |||
| 2045 | Ga0501032_0379657 | |||
| 2046 | Ga0501032_0591508 | |||
| 2047 | Ga0501033_0000082 | |||
| 2048 | Ga0501033_0035113 | |||
| 2049 | Ga0501033_0205835 | |||
| 2050 | Ga0501033_0655015 | |||
| 2051 | Ga0501034_0000198 | |||
| 2052 | Ga0501034_0000374 | |||
| 2053 | Ga0501034_0010525 | |||
| 2054 | Ga0501034_0025723 | |||
| 2055 | Ga0501034_0046257 | |||
| 2056 | Ga0501034_0078922 | |||
| 2057 | Ga0501034_0707810 | |||
| 2058 | Ga0501036_0001033 | |||
| 2059 | Ga0501036_0001435 | |||
| 2060 | Ga0501036_0032297 | |||
| 2061 | Ga0501036_0092628 | |||
| 2062 | Ga0501036_0305562 | |||
| 2063 | Ga0501036_0835499 | |||
| 2064 | Ga0501036_1127562 | |||
| 2065 | Ga0501037_0000050 | |||
| 2066 | Ga0501037_0219185 | |||
| 2067 | Ga0501037_0319746 | |||
| 2068 | Ga0501038_0000538 | |||
| 2069 | Ga0501038_0009770 | |||
| 2070 | Ga0501038_0127917 | |||
| 2071 | Ga0501038_0154740 | |||
| 2072 | Ga0501038_1155675 | |||
| 2073 | Ga0501039_0000366 | |||
| 2074 | Ga0501041_0077354 | |||
| 2075 | Ga0501041_0264939 | |||
| 2076 | Ga0501041_0290432 | |||
| 2077 | Ga0501042_0307741 | |||
| 2078 | Ga0501042_0940246 | |||
| 2079 | Ga0501043_0001664 | |||
| 2080 | Ga0501043_0002453 | |||
| 2081 | Ga0501043_0047182 | |||
| 2082 | Ga0501043_0071832 | |||
| 2083 | Ga0501043_0349189 | |||
| 2084 | Ga0501046_0028312 | |||
| 2085 | Ga0501046_0034979 | |||
| 2086 | Ga0501046_0038152 | |||
| 2087 | Ga0501046_0387002 | |||
| 2088 | Ga0501046_1209992 | |||
| 2089 | Ga0501047_0000131 | |||
| 2090 | Ga0501047_0002756 | |||
| 2091 | Ga0501047_0011978 | |||
| 2092 | Ga0501047_0024774 | |||
| 2093 | Ga0501047_0062952 | |||
| 2094 | Ga0501047_0133509 | |||
| 2095 | Ga0501047_0426355 | |||
| 2096 | Ga0501047_0453385 | |||
| 2097 | Ga0501048_0000531 | |||
| 2098 | Ga0501067_0000101 | |||
| 2099 | Ga0501067_0069015 | |||
| 2100 | Ga0501067_0073658 | |||
| 2101 | Ga0501068_0000988 | |||
| 2102 | Ga0501068_0267791 | |||
| 2103 | Ga0501068_0322657 | |||
| 2104 | Ga0501069_0001211 | |||
| 2105 | Ga0501069_0278180 | |||
| 2106 | Ga0501070_0001845 | |||
| 2107 | Ga0501070_0025512 | |||
| 2108 | Ga0501070_0036820 | |||
| 2109 | Ga0501070_0488791 | |||
| 2110 | Ga0501070_1015912 | |||
| 2111 | Ga0501071_0101944 | |||
| 2112 | Ga0501071_0117240 | |||
| 2113 | Ga0501071_0658585 | |||
| 2114 | Ga0501072_0000378 | |||
| 2115 | Ga0501072_0120095 | |||
| 2116 | Ga0501073_0000230 | |||
| 2117 | Ga0501073_0006293 | |||
| 2118 | Ga0501073_0159305 | |||
| 2119 | Ga0501074_0000141 | |||
| 2120 | Ga0501074_0040096 | |||
| 2121 | Ga0501074_0422054 | |||
| 2122 | Ga0501075_0041655 | |||
| 2123 | Ga0501075_1528447 | |||
| 2124 | Ga0501076_0007746 | |||
| 2125 | Ga0501076_0248308 | |||
| 2126 | Ga0501076_0381156 | |||
| 2127 | Ga0501077_0014321 | |||
| 2128 | Ga0501077_0864856 | |||
| 2129 | Ga0501079_0003847 | |||
| 2130 | Ga0501079_0335323 | |||
| 2131 | Ga0501079_0410914 | |||
| 2132 | Ga0501079_1168128 | |||
| 2133 | Ga0501080_0000383 | |||
| 2134 | Ga0501080_0019207 | |||
| 2135 | Ga0501080_0046554 | |||
| 2136 | Ga0501080_0276796 | |||
| 2137 | Ga0501080_0545595 | |||
| 2138 | Ga0501081_0001105 | |||
| 2139 | Ga0501081_0156885 | |||
| 2140 | Ga0501081_0710629 | |||
| 2141 | Ga0501083_0000341 | |||
| 2142 | Ga0501083_0008290 | |||
| 2143 | Ga0501083_0109505 | |||
| 2144 | Ga0501083_0207770 | |||
| 2145 | Ga0501083_0991926 | |||
| 2146 | Ga0501035_0000123 | |||
| 2147 | Ga0501035_0035937 | |||
| 2148 | Ga0501035_0084773 | |||
| 2149 | Ga0501035_0261056 | |||
| 2150 | Ga0501035_0262481 | |||
| 2151 | Ga0501035_0568375 | |||
| 2152 | Ga0501035_0741728 | |||
| 2153 | Ga0501044_0000100 | |||
| 2154 | Ga0501044_0066736 | |||
| 2155 | Ga0501044_0078775 | |||
| 2156 | Ga0501044_0091785 | |||
| 2157 | Ga0501044_0157290 | |||
| 2158 | Ga0501044_0195949 | |||
| 2159 | Ga0501044_0236656 | |||
| 2160 | Ga0501044_0320980 | |||
| 2161 | Ga0501044_0451935 | |||
| 2162 | Ga0501044_1065661 | |||
| 2163 | Ga0501045_0016159 | |||
| 2164 | Ga0501045_0097861 | |||
| 2165 | Ga0501045_0559518 | |||
| 2166 | nmdc:mga03683_64937_c1 | |||
| 2167 | nmdc:mga03n38_618880_c1 | |||
| 2168 | nmdc:mga03n38_69835_c1 | |||
| 2169 | nmdc:mga00v17_475262_c1 | |||
| 2170 | nmdc:mga00v17_74556_c1 | |||
| 2171 | nmdc:mga0yw44_386868_c1 | |||
| 2172 | nmdc:mga0yw44_773758_c1 | |||
| 2173 | nmdc:mga06z11_172327_c1 | |||
| 2174 | nmdc:mga06z11_414261_c1 | |||
| 2175 | nmdc:mga06z11_528630_c1 | |||
| 2176 | nmdc:mga04h51_113359_c1 | |||
| 2177 | nmdc:mga04h51_34349_c1 | |||
| 2178 | nmdc:mga04h51_483862_c1 | |||
| 2179 | nmdc:mga05p37_1695412_c1 | |||
| 2180 | nmdc:mga05p37_172846_c1 | |||
| 2181 | nmdc:mga05p37_367324_c1 | |||
| 2182 | nmdc:mga09592_501130_c1 | |||
| 2183 | nmdc:mga09592_60724_c1 | |||
| 2184 | nmdc:mga09592_664666_c1 | |||
| 2185 | nmdc:mga0qj67_1526_c1 | |||
| 2186 | nmdc:mga0qj67_25789_c1 | |||
| 2187 | nmdc:mga0qj67_696359_c1 | |||
| 2188 | nmdc:mga06r32_1722422_c1 | |||
| 2189 | nmdc:mga06r32_1760000_c1 | |||
| 2190 | nmdc:mga06r32_213319_c1 | |||
| 2191 | nmdc:mga06r32_222504_c1 | |||
| 2192 | nmdc:mga08y16_1630265_c1 | |||
| 2193 | nmdc:mga08y16_32617_c1 | |||
| 2194 | nmdc:mga08y16_453180_c1 | |||
| 2195 | nmdc:mga0n895_148282_c1 | |||
| 2196 | nmdc:mga0n895_41309_c1 | |||
| 2197 | nmdc:mga0n895_57163_c1 | |||
| 2198 | nmdc:mga0rr50_101477_c1 | |||
| 2199 | nmdc:mga0rr50_49311_c1 | |||
| 2200 | nmdc:mga08x19_18_c1 | |||
| 2201 | nmdc:mga08x19_6179_c1 | |||
| 2202 | nmdc:mga0a205_1006435_c1 | |||
| 2203 | nmdc:mga0a205_739594_c1 | |||
| 2204 | nmdc:mga0sz30_175232_c1 | |||
| 2205 | Ga0495601_0075387 | |||
| 2206 | Ga0495601_0085540 | |||
| 2207 | Ga0495601_0243250 | |||
| 2208 | Ga0495601_0701822 | |||
| 2209 | Ga0495601_0816671 | |||
| 2210 | Ga0495612_0108457 | |||
| 2211 | Ga0495612_0346256 | |||
| 2212 | Ga0495655_0097702 | |||
| 2213 | Ga0495655_0308239 | |||
| 2214 | Ga0495595_0052600 | |||
| 2215 | Ga0495595_0309539 | |||
| 2216 | Ga0495619_0057366 | |||
| 2217 | Ga0495619_0132713 | |||
| 2218 | Ga0495619_0386963 | |||
| 2219 | Ga0495619_0515335 | |||
| 2220 | Ga0500643_029258 | |||
| 2221 | Ga0500646_0285690 | |||
| 2222 | Ga0500647_0104063 | |||
| 2223 | Ga0500583_0596915 | |||
| 2224 | Ga0500651_0432608 | |||
| 2225 | Ga0500566_0000107 | |||
| 2226 | Ga0500566_0137806 | |||
| 2227 | Ga0500640_025401 | |||
| 2228 | Ga0500641_0304479 | |||
| 2229 | Ga0500572_003532 | |||
| 2230 | Ga0500591_158649 | |||
| 2231 | Ga0500594_0050483 | |||
| 2232 | Ga0500595_001968 | |||
| 2233 | Ga0500595_002941 | |||
| 2234 | Ga0500595_003169 | |||
| 2235 | Ga0500608_133305 | |||
| 2236 | Ga0500614_034737 | |||
| 2237 | Ga0500614_259499 | |||
| 2238 | Ga0500617_296604 | |||
| 2239 | Ga0500618_020181 | |||
| 2240 | Ga0500642_0020919 | |||
| 2241 | Ga0500652_000091 | |||
| 2242 | Ga0500561_0079170 | |||
| 2243 | Ga0500568_0004292 | |||
| 2244 | Ga0500568_0014374 | |||
| 2245 | Ga0500577_0005334 | |||
| 2246 | Ga0500589_174716 | |||
| 2247 | Ga0500590_089533 | |||
| 2248 | Ga0500603_015136 | |||
| 2249 | Ga0500616_0000244 | |||
| 2250 | Ga0500630_096978 | |||
| 2251 | Ga0500634_0211943 | |||
| 2252 | Ga0500638_049043 | |||
| 2253 | Ga0500638_062202 | |||
| 2254 | Ga0500639_033217 | |||
| 2255 | Ga0500637_0493734 | |||
| 2256 | Ga0500611_074670 | |||
| 2257 | Ga0500657_181975 | |||
| 2258 | Ga0500596_000997 | |||
| 2259 | Ga0500601_006033 | |||
| 2260 | Ga0501084_0003563 | |||
| 2261 | Ga0501084_0012059 | |||
| 2262 | Ga0501084_0535253 | |||
| 2263 | Ga0587083_0232800 | |||
| 2264 | Ga0587107_119996 | |||
| 2265 | Ga0501082_0001776 | |||
| 2266 | Ga0501082_0012968 | |||
| 2267 | Ga0501082_0372902 | |||
| 2268 | Ga0466962_0299836 | |||
| 2269 | Ga0530510_0074394 | |||
| 2270 | Ga0530510_1210358 | |||
| 2271 | Ga0530510_1420608 | |||
| 2272 | 2507505421 | |||
| 2273 | 2508539307 | |||
| 2274 | 2508695634 | |||
| 2275 | 2513659482 | |||
| 2276 | 2513888607 | |||
| 2277 | 2513921585 | |||
| 2278 | 2515627616 | |||
| 2279 | 2517889021 | |||
| 2280 | 2644291063 | |||
| 2281 | 2857526553 | |||
| 2282 | 2874591662 | |||
| 2283 | 2874646147 | |||
| 2284 | 2876771763 | |||
| 2285 | 2876819107 | |||
| 2286 | 2879075646 | |||
| 2287 | 2879128455 | |||
| 2288 | 2879143567 | |||
| 2289 | 2885382811 | |||
| 2290 | 2885388529 | |||
| 2291 | 2903775491 | |||
| 2292 | 2904691035 | |||
| 2293 | 2906641610 | |||
| 2294 | 2906668137 | |||
| 2295 | 2908747621 | |||
| 2296 | 2908757093 | |||
| 2297 | 2919073627 | |||
| 2298 | 2935654481 | |||
| 2299 | 2935663361 | |||
| 2300 | 2935915014 | |||
| 2301 | 2935918862 | |||
| 2302 | 2935931421 | |||
| 2303 | 2935940018 | |||
| 2304 | 2935947635 | |||
| 2305 | 2935956406 | |||
| 2306 | 2935973200 | |||
| 2307 | 2935980556 | |||
| 2308 | 2935990092 | |||
| 2309 | 2936017480 | |||
| 2310 | 2936026019 | |||
| 2311 | 2936034861 | |||
| 2312 | 2936052881 | |||
| 2313 | 2936060260 | |||
| 2314 | 8016635457 | |||
| 2315 | 8019623132 | |||
| 2316 | 8019629967 | |||
| 2317 | 8019640640 | |||
| 2318 | 8019666808 | |||
| 2319 | 8019676565 | |||
| 2320 | 8019696080 | |||
| 2321 | 8056682911 | |||
| 2322 | 8056691114 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_q | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9201 | 2 | 82 |
| 5mmm-assembly1.cif.gz_p | structure of the 70s chloroplast ribosome | 0.9195 | 3 | 82 |
| 7p6z-assembly1.cif.gz_O | mycoplasma pneumoniae 70s ribosome in untreated cells | 0.9176 | 3 | 82 |
| 7p7u-assembly1.cif.gz_q | e. faecalis 70s ribosome with p-trna, state iv | 0.9164 | 2 | 82 |
| 8cdv-assembly1.cif.gz_P | rnase r bound to a 30s degradation intermediate (state ii) | 0.9091 | 2 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P56806_1_79_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9187 | 3 | 82 | 3.30.1320.10 |
| af_Q2FZ45_1_91_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9055 | 1 | 82 | 3.30.1320.10 |
| 5x8rp00 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.8747 | 3 | 86 | 3.30.1320.10 |
| af_O43020_1_96_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.8716 | 1 | 89 | 3.30.1320.10 |
| af_P56806_1_79_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.8642 | 3 | 82 | 3.30.1320.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7DMT3-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9602 | 1 | 79 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-C6V405-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9553 | 3 | 79 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-O65686-F1-model_v4 | Small ribosomal subunit protein bS16cy (30S ribosomal protein S16-1, chloroplastic) (Small subunit ribosomal protein 16) | 0.9524 | 1 | 87 |
GO:0003729
GO:0003735 GO:0005840 GO:0005886 GO:0006412 GO:0009507 GO:0009536 GO:0009793 GO:0009941 GO:0019904 GO:1990904 |
| AF-Q2GES3-F1-model_v4 | Small ribosomal subunit protein bS16 (30S ribosomal protein S16) | 0.9497 | 1 | 79 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A382VIJ6-F1-model_v4 | 30S ribosomal protein S16 | 0.9488 | 1 | 90 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |