F490858
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1151 | 420 | 1111 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10005450|Ga0065714_100054505 |
| Length | 279 |
| Sequence | LDNQKSEIEHPKSEMKIITYNVNGIRSAINKNWLAWLQAADADVVCLQEIKATPDVLTDLGLVDQLGYKHYWFPAEKKGYSGTAIFCKQTPKHIEYGCGIPDFDREGRCIRVDFEEVSVMSVYFPSGSSGDERQIFKYRFLDEFGKYLTLLKTEYPKLVVCGDYNICHRPIDIHNPKSNANSSGFLPEEREWMEKFIEGGFIDTFRHLNKEPHNYTWWSFRANSRAKNLGWRIDYTMASTELENNIKRASILPEAKHSDHCPVLLELEFTPQPPSGGAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 5 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 6 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 7 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 8 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 9 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 10 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 11 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 12 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 13 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 14 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 15 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 16 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 17 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 18 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 19 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 20 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 21 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 22 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 23 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 24 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 25 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 26 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 27 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 28 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 29 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 30 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 31 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 32 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 33 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 34 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 35 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 36 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 37 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 38 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 39 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 40 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 41 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 42 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 43 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 47 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 48 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 50 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 51 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 52 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 53 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 54 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 55 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 56 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 57 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 58 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 59 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 60 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 61 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 62 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 66 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 104 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 247 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 248 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 249 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 250 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 256 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 260 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 261 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 262 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 270 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 271 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 277 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 284 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 287 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 290 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 295 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 296 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 297 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 380 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 382 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 397 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 399 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 400 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 407 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 410 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 412 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 415 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 416 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 419 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0.26 |
| Isolates | 3.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.17 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 86.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3456730 | 2162886007 | Bacteria | 9441 |
| 2 | SwRhRL2b_contig_650288 | 2162886007 | Bacteria | 2525 |
| 3 | MBSR1b_contig_11496357 | 2162886012 | Bacteria | 1404 |
| 4 | JGI24736J21556_1011527 | 3300001904 | Bacteria | 1437 |
| 5 | JGI24740J21852_10035509 | 3300001979 | Bacteria | 1558 |
| 6 | JGI24737J22298_10000851 | 3300001990 | Bacteria | 10884 |
| 7 | JGI24737J22298_10005505 | 3300001990 | Bacteria | 4369 |
| 8 | JGI24735J21928_10000093 | 3300002067 | Bacteria | 33623 |
| 9 | JGI24033J26618_1007771 | 3300002155 | Bacteria | 1224 |
| 10 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 11 | JGI25162J39368_1000097 | 3300002737 | Bacteria | 96520 |
| 12 | JGI25162J39368_1003452 | 3300002737 | Bacteria | 4558 |
| 13 | JGI25154J39366_1004687 | 3300002738 | Bacteria | 2372 |
| 14 | JGI25157J39369_1006945 | 3300002741 | Bacteria | 1675 |
| 15 | JGI25164J39214_1002202 | 3300002772 | Bacteria | 3217 |
| 16 | JGI25152J39213_1000044 | 3300002773 | Bacteria | 87213 |
| 17 | JGI25150J39212_1000006 | 3300002774 | Bacteria | 257228 |
| 18 | JGI25151J46595_10000024 | 3300003187 | Bacteria | 217596 |
| 19 | JGI25165J46597_1000891 | 3300003214 | Bacteria | 21022 |
| 20 | JGI25153J46596_10000026 | 3300003215 | Bacteria | 217245 |
| 21 | rootH1_10102873 | 3300003316 | Unclassified | 2234 |
| 22 | rootH2_10007161 | 3300003320 | Bacteria | 44535 |
| 23 | rootH2_10007960 | 3300003320 | Bacteria | 49899 |
| 24 | rootH2_10061124 | 3300003320 | Bacteria | 4895 |
| 25 | rootH2_10089828 | 3300003320 | Bacteria | 2318 |
| 26 | rootH2_10184756 | 3300003320 | Bacteria | 7299 |
| 27 | rootL2_10094458 | 3300003322 | Bacteria | 1510 |
| 28 | rootL2_10198285 | 3300003322 | Bacteria | 2164 |
| 29 | rootL2_10240312 | 3300003322 | Bacteria | 4931 |
| 30 | rootH1_10035781 | 3300003323 | Bacteria | 3127 |
| 31 | rootH1_10050923 | 3300003323 | Bacteria | 6133 |
| 32 | rootH1_10088396 | 3300003323 | Bacteria | 6140 |
| 33 | rootH1_10131059 | 3300003323 | Bacteria | 5673 |
| 34 | rootH1_10240758 | 3300003323 | Bacteria | 1675 |
| 35 | JGI25160J50197_1001108 | 3300003354 | Bacteria | 13762 |
| 36 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 37 | Ga0065714_10005450 | 3300005288 | Bacteria | 4931 |
| 38 | Ga0065714_10064557 | 3300005288 | Bacteria | 36424 |
| 39 | Ga0065714_10067802 | 3300005288 | Bacteria | 5187 |
| 40 | Ga0065714_10069902 | 3300005288 | Bacteria | 4041 |
| 41 | Ga0065714_10072850 | 3300005288 | Bacteria | 3288 |
| 42 | Ga0065714_10098959 | 3300005288 | Bacteria | 1697 |
| 43 | Ga0065704_10000218 | 3300005289 | Bacteria | 76484 |
| 44 | Ga0065704_10077810 | 3300005289 | Bacteria | 4613 |
| 45 | Ga0065704_10190854 | 3300005289 | Bacteria | 1190 |
| 46 | Ga0065704_10219819 | 3300005289 | Bacteria | 1072 |
| 47 | Ga0065712_10002703 | 3300005290 | Bacteria | 5522 |
| 48 | Ga0065712_10074233 | 3300005290 | Bacteria | 4148 |
| 49 | Ga0065712_10199717 | 3300005290 | Bacteria | 1113 |
| 50 | Ga0065715_10270193 | 3300005293 | Unclassified | 1113 |
| 51 | Ga0065707_10143673 | 3300005295 | Unclassified | 1740 |
| 52 | Ga0070658_10000113 | 3300005327 | Bacteria | 72221 |
| 53 | Ga0070658_10001765 | 3300005327 | Bacteria | 18211 |
| 54 | Ga0070658_10757163 | 3300005327 | Bacteria | 843 |
| 55 | Ga0070676_10000205 | 3300005328 | Bacteria | 25133 |
| 56 | Ga0070676_10004348 | 3300005328 | Bacteria | 7442 |
| 57 | Ga0070676_10015311 | 3300005328 | Bacteria | 4230 |
| 58 | Ga0070676_10041152 | 3300005328 | Bacteria | 2678 |
| 59 | Ga0070676_10166487 | 3300005328 | Bacteria | 1423 |
| 60 | Ga0070683_100036133 | 3300005329 | Bacteria | 4519 |
| 61 | Ga0070690_100053377 | 3300005330 | Bacteria | 2586 |
| 62 | Ga0070690_100094008 | 3300005330 | Bacteria | 1978 |
| 63 | Ga0070690_100146863 | 3300005330 | Bacteria | 1605 |
| 64 | Ga0070670_100027378 | 3300005331 | Bacteria | 4905 |
| 65 | Ga0070670_100031040 | 3300005331 | Bacteria | 4602 |
| 66 | Ga0070670_100052324 | 3300005331 | Unclassified | 3507 |
| 67 | Ga0070670_100255751 | 3300005331 | Bacteria | 1526 |
| 68 | Ga0070677_10024926 | 3300005333 | Bacteria | 2229 |
| 69 | Ga0070677_10038588 | 3300005333 | Bacteria | 1870 |
| 70 | Ga0068869_100003737 | 3300005334 | Bacteria | 9370 |
| 71 | Ga0068869_100006757 | 3300005334 | Bacteria | 7289 |
| 72 | Ga0068869_100021858 | 3300005334 | Bacteria | 4402 |
| 73 | Ga0068869_100068253 | 3300005334 | Bacteria | 2626 |
| 74 | Ga0068869_100245495 | 3300005334 | Bacteria | 1428 |
| 75 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 76 | Ga0070666_10000856 | 3300005335 | Bacteria | 18437 |
| 77 | Ga0070666_10010262 | 3300005335 | Bacteria | 5854 |
| 78 | Ga0070666_10024067 | 3300005335 | Bacteria | 3965 |
| 79 | Ga0070666_10408838 | 3300005335 | Bacteria | 976 |
| 80 | Ga0070680_100001822 | 3300005336 | Bacteria | 15659 |
| 81 | Ga0070682_100000041 | 3300005337 | Bacteria | 142152 |
| 82 | Ga0070682_100001992 | 3300005337 | Bacteria | 11388 |
| 83 | Ga0070682_100140391 | 3300005337 | Bacteria | 1646 |
| 84 | Ga0068868_100002491 | 3300005338 | Bacteria | 12787 |
| 85 | Ga0068868_100007394 | 3300005338 | Bacteria | 7824 |
| 86 | Ga0068868_100066227 | 3300005338 | Bacteria | 2871 |
| 87 | Ga0068868_100095762 | 3300005338 | Unclassified | 2396 |
| 88 | Ga0068868_100218724 | 3300005338 | Unclassified | 1594 |
| 89 | Ga0070660_100064037 | 3300005339 | Bacteria | 2860 |
| 90 | Ga0070660_100226946 | 3300005339 | Bacteria | 1519 |
| 91 | Ga0070689_100077847 | 3300005340 | Bacteria | 2599 |
| 92 | Ga0070691_10009617 | 3300005341 | Bacteria | 4413 |
| 93 | Ga0070691_10187779 | 3300005341 | Bacteria | 1079 |
| 94 | Ga0070687_100008339 | 3300005343 | Bacteria | 4382 |
| 95 | Ga0070687_100058866 | 3300005343 | Bacteria | 2020 |
| 96 | Ga0070661_100061111 | 3300005344 | Bacteria | 2765 |
| 97 | Ga0070668_100004192 | 3300005347 | Bacteria | 10686 |
| 98 | Ga0070668_100022027 | 3300005347 | Bacteria | 4816 |
| 99 | Ga0070668_100029190 | 3300005347 | Bacteria | 4188 |
| 100 | Ga0070668_100272610 | 3300005347 | Bacteria | 1411 |
| 101 | Ga0070668_100327614 | 3300005347 | Bacteria | 1291 |
| 102 | Ga0070669_100019580 | 3300005353 | Bacteria | 4834 |
| 103 | Ga0070669_100067601 | 3300005353 | Bacteria | 2637 |
| 104 | Ga0070669_100090023 | 3300005353 | Bacteria | 2299 |
| 105 | Ga0070675_100011810 | 3300005354 | Bacteria | 6844 |
| 106 | Ga0070675_100052152 | 3300005354 | Bacteria | 3362 |
| 107 | Ga0070675_100070805 | 3300005354 | Bacteria | 2891 |
| 108 | Ga0070675_100071251 | 3300005354 | Bacteria | 2883 |
| 109 | Ga0070675_100103942 | 3300005354 | Bacteria | 2395 |
| 110 | Ga0070671_100067613 | 3300005355 | Bacteria | 2979 |
| 111 | Ga0070671_100070322 | 3300005355 | Unclassified | 2919 |
| 112 | Ga0070671_100095808 | 3300005355 | Bacteria | 2488 |
| 113 | Ga0070671_100308249 | 3300005355 | Bacteria | 1348 |
| 114 | Ga0070674_100187387 | 3300005356 | Bacteria | 1589 |
| 115 | Ga0070674_100192412 | 3300005356 | Bacteria | 1570 |
| 116 | Ga0070674_100413987 | 3300005356 | Bacteria | 1104 |
| 117 | Ga0070673_100001930 | 3300005364 | Bacteria | 12471 |
| 118 | Ga0070673_100004765 | 3300005364 | Bacteria | 8622 |
| 119 | Ga0070673_100017257 | 3300005364 | Bacteria | 5126 |
| 120 | Ga0070673_100023510 | 3300005364 | Bacteria | 4503 |
| 121 | Ga0070673_100027647 | 3300005364 | Bacteria | 4207 |
| 122 | Ga0070673_100059643 | 3300005364 | Bacteria | 3021 |
| 123 | Ga0070673_100096617 | 3300005364 | Bacteria | 2424 |
| 124 | Ga0070673_100228490 | 3300005364 | Bacteria | 1613 |
| 125 | Ga0070673_100446374 | 3300005364 | Unclassified | 1163 |
| 126 | Ga0070688_100001768 | 3300005365 | Bacteria | 10813 |
| 127 | Ga0070688_100044922 | 3300005365 | Bacteria | 2727 |
| 128 | Ga0070688_100111182 | 3300005365 | Bacteria | 1822 |
| 129 | Ga0070659_100000199 | 3300005366 | Bacteria | 46342 |
| 130 | Ga0070659_100005494 | 3300005366 | Bacteria | 9107 |
| 131 | Ga0070659_100008229 | 3300005366 | Bacteria | 7615 |
| 132 | Ga0070659_100036212 | 3300005366 | Bacteria | 3846 |
| 133 | Ga0070659_100267958 | 3300005366 | Unclassified | 1418 |
| 134 | Ga0070667_100003102 | 3300005367 | Bacteria | 14296 |
| 135 | Ga0070667_100077424 | 3300005367 | Bacteria | 2840 |
| 136 | Ga0070667_100087633 | 3300005367 | Bacteria | 2672 |
| 137 | Ga0070700_100024503 | 3300005441 | Bacteria | 3544 |
| 138 | Ga0070663_100005053 | 3300005455 | Bacteria | 7794 |
| 139 | Ga0070663_100182436 | 3300005455 | Bacteria | 1629 |
| 140 | Ga0070678_100011513 | 3300005456 | Bacteria | 5463 |
| 141 | Ga0070678_100060730 | 3300005456 | Bacteria | 2783 |
| 142 | Ga0070678_100331526 | 3300005456 | Bacteria | 1302 |
| 143 | Ga0070662_100000772 | 3300005457 | Bacteria | 19707 |
| 144 | Ga0070662_100074082 | 3300005457 | Bacteria | 2518 |
| 145 | Ga0070681_10025021 | 3300005458 | Bacteria | 6007 |
| 146 | Ga0070681_10108996 | 3300005458 | Bacteria | 2709 |
| 147 | Ga0068867_100000809 | 3300005459 | Bacteria | 21093 |
| 148 | Ga0068867_100005280 | 3300005459 | Bacteria | 9125 |
| 149 | Ga0068867_100053647 | 3300005459 | Bacteria | 2978 |
| 150 | Ga0068867_100076943 | 3300005459 | Bacteria | 2506 |
| 151 | Ga0068867_100172069 | 3300005459 | Bacteria | 1716 |
| 152 | Ga0068867_100281531 | 3300005459 | Bacteria | 1364 |
| 153 | Ga0068867_100444756 | 3300005459 | Unclassified | 1103 |
| 154 | Ga0068867_100560372 | 3300005459 | Bacteria | 991 |
| 155 | Ga0070685_10025086 | 3300005466 | Bacteria | 3281 |
| 156 | Ga0070685_10040270 | 3300005466 | Bacteria | 2658 |
| 157 | Ga0070685_10091082 | 3300005466 | Bacteria | 1845 |
| 158 | Ga0070685_10356252 | 3300005466 | Bacteria | 1002 |
| 159 | Ga0070698_100002009 | 3300005471 | Bacteria | 22594 |
| 160 | Ga0070698_100005327 | 3300005471 | Bacteria | 14081 |
| 161 | Ga0070698_100048986 | 3300005471 | Bacteria | 4315 |
| 162 | Ga0070699_100057554 | 3300005518 | Bacteria | 3367 |
| 163 | Ga0070699_100472201 | 3300005518 | Bacteria | 1138 |
| 164 | Ga0070679_100013537 | 3300005530 | Bacteria | 7815 |
| 165 | Ga0070679_100464348 | 3300005530 | Bacteria | 1210 |
| 166 | Ga0068853_100005414 | 3300005539 | Bacteria | 10003 |
| 167 | Ga0068853_100012933 | 3300005539 | Bacteria | 6802 |
| 168 | Ga0068853_100024008 | 3300005539 | Bacteria | 5110 |
| 169 | Ga0068853_100089658 | 3300005539 | Bacteria | 2701 |
| 170 | Ga0068853_100140645 | 3300005539 | Bacteria | 2166 |
| 171 | Ga0068853_100151022 | 3300005539 | Unclassified | 2091 |
| 172 | Ga0068853_100158131 | 3300005539 | Bacteria | 2043 |
| 173 | Ga0068853_100179807 | 3300005539 | Bacteria | 1918 |
| 174 | Ga0068853_100248421 | 3300005539 | Bacteria | 1632 |
| 175 | Ga0068853_100374623 | 3300005539 | Bacteria | 1328 |
| 176 | Ga0068853_100421669 | 3300005539 | Unclassified | 1251 |
| 177 | Ga0068853_100575633 | 3300005539 | Unclassified | 1068 |
| 178 | Ga0068853_100578860 | 3300005539 | Bacteria | 1065 |
| 179 | Ga0068853_100844927 | 3300005539 | Bacteria | 878 |
| 180 | Ga0070672_100003625 | 3300005543 | Bacteria | 10020 |
| 181 | Ga0070672_100004263 | 3300005543 | Bacteria | 9352 |
| 182 | Ga0070672_100045387 | 3300005543 | Bacteria | 3398 |
| 183 | Ga0070672_100051032 | 3300005543 | Bacteria | 3224 |
| 184 | Ga0070672_100120475 | 3300005543 | Bacteria | 2147 |
| 185 | Ga0070672_100157644 | 3300005543 | Bacteria | 1881 |
| 186 | Ga0070672_100199695 | 3300005543 | Unclassified | 1672 |
| 187 | Ga0070672_100748815 | 3300005543 | Bacteria | 857 |
| 188 | Ga0070686_100129013 | 3300005544 | Bacteria | 1746 |
| 189 | Ga0070695_100222520 | 3300005545 | Unclassified | 1360 |
| 190 | Ga0070693_100018363 | 3300005547 | Bacteria | 3652 |
| 191 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 192 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 193 | Ga0070665_100003483 | 3300005548 | Bacteria | 16764 |
| 194 | Ga0070665_100023328 | 3300005548 | Bacteria | 6229 |
| 195 | Ga0070704_100141484 | 3300005549 | Bacteria | 1879 |
| 196 | Ga0068855_100000074 | 3300005563 | Bacteria | 119759 |
| 197 | Ga0068855_100000958 | 3300005563 | Bacteria | 35849 |
| 198 | Ga0068855_100030343 | 3300005563 | Bacteria | 6467 |
| 199 | Ga0068855_100093980 | 3300005563 | Bacteria | 3457 |
| 200 | Ga0068855_100170531 | 3300005563 | Bacteria | 2465 |
| 201 | Ga0068855_100304027 | 3300005563 | Bacteria | 1766 |
| 202 | Ga0068855_100396803 | 3300005563 | Bacteria | 1512 |
| 203 | Ga0068855_100707052 | 3300005563 | Bacteria | 1078 |
| 204 | Ga0068857_100004236 | 3300005577 | Bacteria | 12092 |
| 205 | Ga0068857_100054498 | 3300005577 | Bacteria | 3548 |
| 206 | Ga0068857_100067223 | 3300005577 | Bacteria | 3190 |
| 207 | Ga0068857_100092630 | 3300005577 | Bacteria | 2706 |
| 208 | Ga0068854_100148514 | 3300005578 | Bacteria | 1805 |
| 209 | Ga0068854_100182933 | 3300005578 | Bacteria | 1638 |
| 210 | Ga0068856_100000040 | 3300005614 | Bacteria | 114443 |
| 211 | Ga0068856_100015577 | 3300005614 | Bacteria | 7350 |
| 212 | Ga0068856_100017756 | 3300005614 | Bacteria | 6898 |
| 213 | Ga0068856_100025193 | 3300005614 | Bacteria | 5796 |
| 214 | Ga0068856_100032371 | 3300005614 | Bacteria | 5119 |
| 215 | Ga0068856_100321567 | 3300005614 | Bacteria | 1564 |
| 216 | Ga0068856_100792708 | 3300005614 | Bacteria | 967 |
| 217 | Ga0070702_100016339 | 3300005615 | Bacteria | 3806 |
| 218 | Ga0070702_100288736 | 3300005615 | Bacteria | 1129 |
| 219 | Ga0068852_100000720 | 3300005616 | Bacteria | 21705 |
| 220 | Ga0068852_100002922 | 3300005616 | Bacteria | 11871 |
| 221 | Ga0068852_100011729 | 3300005616 | Bacteria | 6615 |
| 222 | Ga0068852_100234714 | 3300005616 | Bacteria | 1750 |
| 223 | Ga0068852_100647032 | 3300005616 | Bacteria | 1064 |
| 224 | Ga0068852_100826874 | 3300005616 | Bacteria | 941 |
| 225 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 226 | Ga0068859_100000710 | 3300005617 | Bacteria | 33516 |
| 227 | Ga0068859_100029400 | 3300005617 | Bacteria | 5513 |
| 228 | Ga0068859_100033372 | 3300005617 | Bacteria | 5168 |
| 229 | Ga0068859_100039276 | 3300005617 | Bacteria | 4748 |
| 230 | Ga0068864_100000469 | 3300005618 | Bacteria | 34957 |
| 231 | Ga0068864_100004006 | 3300005618 | Bacteria | 12124 |
| 232 | Ga0068864_100025199 | 3300005618 | Bacteria | 5007 |
| 233 | Ga0068864_100070475 | 3300005618 | Bacteria | 3042 |
| 234 | Ga0068864_100078723 | 3300005618 | Bacteria | 2885 |
| 235 | Ga0068861_100004575 | 3300005719 | Bacteria | 9286 |
| 236 | Ga0068861_100032792 | 3300005719 | Bacteria | 3827 |
| 237 | Ga0068861_100040662 | 3300005719 | Bacteria | 3479 |
| 238 | Ga0068861_100058903 | 3300005719 | Bacteria | 2939 |
| 239 | Ga0068851_10006291 | 3300005834 | Bacteria | 5419 |
| 240 | Ga0068851_10045235 | 3300005834 | Bacteria | 2224 |
| 241 | Ga0068851_10104294 | 3300005834 | Bacteria | 1507 |
| 242 | Ga0068851_10229126 | 3300005834 | Bacteria | 1047 |
| 243 | Ga0068870_10049060 | 3300005840 | Bacteria | 2225 |
| 244 | Ga0068870_10234124 | 3300005840 | Bacteria | 1131 |
| 245 | Ga0068863_100002075 | 3300005841 | Bacteria | 19871 |
| 246 | Ga0068863_100002232 | 3300005841 | Bacteria | 19223 |
| 247 | Ga0068863_100011017 | 3300005841 | Bacteria | 8769 |
| 248 | Ga0068863_100067774 | 3300005841 | Bacteria | 3376 |
| 249 | Ga0068863_100085429 | 3300005841 | Bacteria | 2990 |
| 250 | Ga0068863_100284546 | 3300005841 | Bacteria | 1602 |
| 251 | Ga0068858_100000978 | 3300005842 | Bacteria | 29516 |
| 252 | Ga0068858_100000982 | 3300005842 | Bacteria | 29441 |
| 253 | Ga0068858_100474363 | 3300005842 | Unclassified | 1207 |
| 254 | Ga0068860_100005506 | 3300005843 | Bacteria | 12821 |
| 255 | Ga0068860_100008211 | 3300005843 | Bacteria | 10392 |
| 256 | Ga0068860_100042291 | 3300005843 | Bacteria | 4353 |
| 257 | Ga0068860_100108924 | 3300005843 | Bacteria | 2647 |
| 258 | Ga0068860_100182869 | 3300005843 | Bacteria | 2026 |
| 259 | Ga0068860_100263671 | 3300005843 | Bacteria | 1680 |
| 260 | Ga0068860_100375898 | 3300005843 | Bacteria | 1402 |
| 261 | Ga0068862_100012568 | 3300005844 | Bacteria | 7011 |
| 262 | Ga0068862_100122457 | 3300005844 | Unclassified | 2294 |
| 263 | Ga0068862_100372308 | 3300005844 | Bacteria | 1330 |
| 264 | Ga0075366_10000435 | 3300006195 | Bacteria | 19478 |
| 265 | Ga0075366_10000779 | 3300006195 | Bacteria | 15223 |
| 266 | Ga0075366_10002507 | 3300006195 | Bacteria | 9426 |
| 267 | Ga0075366_10348083 | 3300006195 | Bacteria | 909 |
| 268 | Ga0097621_100000285 | 3300006237 | Bacteria | 34046 |
| 269 | Ga0097621_100001174 | 3300006237 | Bacteria | 18148 |
| 270 | Ga0097621_100001598 | 3300006237 | Bacteria | 15497 |
| 271 | Ga0097621_100015672 | 3300006237 | Bacteria | 5711 |
| 272 | Ga0097621_100070912 | 3300006237 | Bacteria | 2878 |
| 273 | Ga0097621_100528583 | 3300006237 | Unclassified | 1071 |
| 274 | Ga0097621_100587488 | 3300006237 | Bacteria | 1017 |
| 275 | Ga0068871_100000080 | 3300006358 | Bacteria | 53930 |
| 276 | Ga0068871_100001193 | 3300006358 | Bacteria | 17357 |
| 277 | Ga0068871_100002679 | 3300006358 | Bacteria | 12153 |
| 278 | Ga0068871_100019800 | 3300006358 | Bacteria | 5143 |
| 279 | Ga0068871_100031523 | 3300006358 | Bacteria | 4182 |
| 280 | Ga0068871_100048996 | 3300006358 | Bacteria | 3413 |
| 281 | Ga0068871_100058614 | 3300006358 | Bacteria | 3135 |
| 282 | Ga0068871_100307763 | 3300006358 | Bacteria | 1392 |
| 283 | Ga0068871_100326853 | 3300006358 | Bacteria | 1352 |
| 284 | Ga0075428_100015265 | 3300006844 | Bacteria | 8519 |
| 285 | Ga0075430_100054183 | 3300006846 | Bacteria | 3375 |
| 286 | Ga0075429_100004785 | 3300006880 | Bacteria | 11657 |
| 287 | Ga0075429_100060953 | 3300006880 | Bacteria | 3286 |
| 288 | Ga0075429_100084913 | 3300006880 | Bacteria | 2759 |
| 289 | Ga0068865_100000218 | 3300006881 | Bacteria | 31890 |
| 290 | Ga0068865_100001197 | 3300006881 | Bacteria | 15094 |
| 291 | Ga0068865_100008116 | 3300006881 | Bacteria | 6479 |
| 292 | Ga0068865_100084017 | 3300006881 | Bacteria | 2293 |
| 293 | Ga0068865_100133605 | 3300006881 | Unclassified | 1861 |
| 294 | Ga0068865_100308013 | 3300006881 | Bacteria | 1270 |
| 295 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 296 | Ga0097620_100000710 | 3300006931 | Bacteria | 33516 |
| 297 | Ga0097620_100029399 | 3300006931 | Bacteria | 5513 |
| 298 | Ga0097620_100033374 | 3300006931 | Bacteria | 5168 |
| 299 | Ga0097620_100039276 | 3300006931 | Bacteria | 4748 |
| 300 | Ga0105244_10025480 | 3300009036 | Bacteria | 3215 |
| 301 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 302 | Ga0105240_10001189 | 3300009093 | Bacteria | 45474 |
| 303 | Ga0105240_10003157 | 3300009093 | Bacteria | 25925 |
| 304 | Ga0105240_10003164 | 3300009093 | Bacteria | 25888 |
| 305 | Ga0105240_10003566 | 3300009093 | Bacteria | 24139 |
| 306 | Ga0105240_10016999 | 3300009093 | Bacteria | 9826 |
| 307 | Ga0105240_10036054 | 3300009093 | Bacteria | 6368 |
| 308 | Ga0105240_10060030 | 3300009093 | Bacteria | 4742 |
| 309 | Ga0105240_10102820 | 3300009093 | Bacteria | 3472 |
| 310 | Ga0105240_10332692 | 3300009093 | Bacteria | 1728 |
| 311 | Ga0105240_10652633 | 3300009093 | Bacteria | 1153 |
| 312 | Ga0111539_11064710 | 3300009094 | Unclassified | 940 |
| 313 | Ga0105247_10004101 | 3300009101 | Bacteria | 9361 |
| 314 | Ga0114129_10001062 | 3300009147 | Bacteria | 36084 |
| 315 | Ga0114129_10294403 | 3300009147 | Bacteria | 2165 |
| 316 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 317 | Ga0105243_10150831 | 3300009148 | Bacteria | 1994 |
| 318 | Ga0105243_10209191 | 3300009148 | Bacteria | 1717 |
| 319 | Ga0105241_10000324 | 3300009174 | Bacteria | 36128 |
| 320 | Ga0105241_10000620 | 3300009174 | Bacteria | 26735 |
| 321 | Ga0105241_10005957 | 3300009174 | Bacteria | 8989 |
| 322 | Ga0105241_10007142 | 3300009174 | Bacteria | 8220 |
| 323 | Ga0105241_10008209 | 3300009174 | Bacteria | 7686 |
| 324 | Ga0105241_10011880 | 3300009174 | Bacteria | 6399 |
| 325 | Ga0105241_10031123 | 3300009174 | Bacteria | 3994 |
| 326 | Ga0105241_10052711 | 3300009174 | Bacteria | 3108 |
| 327 | Ga0105241_10059451 | 3300009174 | Bacteria | 2939 |
| 328 | Ga0105241_10322771 | 3300009174 | Bacteria | 1332 |
| 329 | Ga0105242_10005785 | 3300009176 | Bacteria | 9521 |
| 330 | Ga0105242_10026804 | 3300009176 | Bacteria | 4570 |
| 331 | Ga0105242_10031334 | 3300009176 | Bacteria | 4245 |
| 332 | Ga0105242_10050764 | 3300009176 | Bacteria | 3378 |
| 333 | Ga0105242_10061209 | 3300009176 | Bacteria | 3096 |
| 334 | Ga0105242_10130639 | 3300009176 | Bacteria | 2168 |
| 335 | Ga0105242_10318202 | 3300009176 | Unclassified | 1426 |
| 336 | Ga0105248_10016968 | 3300009177 | Bacteria | 8018 |
| 337 | Ga0105248_10723808 | 3300009177 | Unclassified | 1123 |
| 338 | Ga0105237_10000138 | 3300009545 | Bacteria | 102411 |
| 339 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 340 | Ga0105237_10000429 | 3300009545 | Bacteria | 59643 |
| 341 | Ga0105237_10001681 | 3300009545 | Bacteria | 28643 |
| 342 | Ga0105237_10003760 | 3300009545 | Bacteria | 17868 |
| 343 | Ga0105237_10005021 | 3300009545 | Bacteria | 15061 |
| 344 | Ga0105237_10005145 | 3300009545 | Bacteria | 14812 |
| 345 | Ga0105237_10011015 | 3300009545 | Bacteria | 9594 |
| 346 | Ga0105237_10020681 | 3300009545 | Bacteria | 6778 |
| 347 | Ga0105237_10024357 | 3300009545 | Bacteria | 6193 |
| 348 | Ga0105237_10076228 | 3300009545 | Bacteria | 3344 |
| 349 | Ga0105237_10122598 | 3300009545 | Bacteria | 2593 |
| 350 | Ga0105237_10136395 | 3300009545 | Bacteria | 2448 |
| 351 | Ga0105237_10287549 | 3300009545 | Bacteria | 1647 |
| 352 | Ga0105237_10451876 | 3300009545 | Bacteria | 1291 |
| 353 | Ga0105237_10526682 | 3300009545 | Bacteria | 1188 |
| 354 | Ga0105238_10005010 | 3300009551 | Bacteria | 13090 |
| 355 | Ga0105238_10020232 | 3300009551 | Bacteria | 6774 |
| 356 | Ga0105238_10022704 | 3300009551 | Bacteria | 6395 |
| 357 | Ga0105238_10116189 | 3300009551 | Bacteria | 2655 |
| 358 | Ga0105238_10296136 | 3300009551 | Unclassified | 1601 |
| 359 | Ga0105238_10486506 | 3300009551 | Bacteria | 1234 |
| 360 | Ga0105249_10001056 | 3300009553 | Bacteria | 24413 |
| 361 | Ga0105249_10007464 | 3300009553 | Bacteria | 9540 |
| 362 | Ga0105249_10007493 | 3300009553 | Bacteria | 9521 |
| 363 | Ga0105249_10008209 | 3300009553 | Bacteria | 9098 |
| 364 | Ga0105249_10016792 | 3300009553 | Bacteria | 6495 |
| 365 | Ga0105249_10066289 | 3300009553 | Bacteria | 3324 |
| 366 | Ga0105249_10152867 | 3300009553 | Bacteria | 2223 |
| 367 | Ga0105249_10224571 | 3300009553 | Bacteria | 1849 |
| 368 | Ga0105249_10301172 | 3300009553 | Bacteria | 1608 |
| 369 | Ga0105249_10661755 | 3300009553 | Bacteria | 1102 |
| 370 | Ga0105249_11294907 | 3300009553 | Bacteria | 800 |
| 371 | Ga0105239_10000026 | 3300010375 | Bacteria | 248302 |
| 372 | Ga0105239_10000392 | 3300010375 | Bacteria | 64144 |
| 373 | Ga0105239_10002143 | 3300010375 | Bacteria | 25398 |
| 374 | Ga0105239_10003890 | 3300010375 | Bacteria | 18093 |
| 375 | Ga0105239_10006488 | 3300010375 | Bacteria | 13566 |
| 376 | Ga0105239_10006793 | 3300010375 | Bacteria | 13207 |
| 377 | Ga0105239_10008812 | 3300010375 | Bacteria | 11416 |
| 378 | Ga0105239_10010461 | 3300010375 | Bacteria | 10371 |
| 379 | Ga0105239_10017011 | 3300010375 | Bacteria | 8040 |
| 380 | Ga0105239_10020600 | 3300010375 | Bacteria | 7276 |
| 381 | Ga0105239_10035575 | 3300010375 | Bacteria | 5469 |
| 382 | Ga0105239_10092212 | 3300010375 | Bacteria | 3344 |
| 383 | Ga0105239_10389838 | 3300010375 | Unclassified | 1576 |
| 384 | Ga0105239_10427981 | 3300010375 | Bacteria | 1500 |
| 385 | Ga0105246_10026192 | 3300011119 | Bacteria | 3806 |
| 386 | Ga0105246_10342534 | 3300011119 | Bacteria | 1222 |
| 387 | Ga0157373_10000167 | 3300013100 | Bacteria | 53611 |
| 388 | Ga0157373_10001288 | 3300013100 | Bacteria | 19138 |
| 389 | Ga0157373_10018692 | 3300013100 | Bacteria | 5044 |
| 390 | Ga0157373_10064052 | 3300013100 | Bacteria | 2602 |
| 391 | Ga0157373_10144870 | 3300013100 | Bacteria | 1671 |
| 392 | Ga0157371_10000286 | 3300013102 | Bacteria | 68502 |
| 393 | Ga0157371_10000748 | 3300013102 | Bacteria | 37610 |
| 394 | Ga0157371_10001037 | 3300013102 | Bacteria | 30465 |
| 395 | Ga0157371_10001713 | 3300013102 | Bacteria | 22319 |
| 396 | Ga0157371_10002211 | 3300013102 | Bacteria | 18838 |
| 397 | Ga0157371_10011893 | 3300013102 | Bacteria | 6679 |
| 398 | Ga0157371_10104223 | 3300013102 | Bacteria | 2013 |
| 399 | Ga0157371_10164428 | 3300013102 | Bacteria | 1585 |
| 400 | Ga0157371_10346355 | 3300013102 | Bacteria | 1081 |
| 401 | Ga0157370_10000419 | 3300013104 | Bacteria | 53608 |
| 402 | Ga0157370_10000681 | 3300013104 | Bacteria | 42275 |
| 403 | Ga0157370_10002658 | 3300013104 | Bacteria | 21448 |
| 404 | Ga0157370_10006839 | 3300013104 | Bacteria | 12493 |
| 405 | Ga0157370_10007099 | 3300013104 | Bacteria | 12229 |
| 406 | Ga0157370_10008287 | 3300013104 | Bacteria | 11216 |
| 407 | Ga0157370_10012590 | 3300013104 | Bacteria | 8767 |
| 408 | Ga0157370_10022935 | 3300013104 | Bacteria | 6204 |
| 409 | Ga0157370_10027084 | 3300013104 | Bacteria | 5652 |
| 410 | Ga0157370_10044025 | 3300013104 | Bacteria | 4294 |
| 411 | Ga0157370_10053904 | 3300013104 | Bacteria | 3834 |
| 412 | Ga0157370_10081166 | 3300013104 | Bacteria | 3052 |
| 413 | Ga0157370_10081249 | 3300013104 | Bacteria | 3050 |
| 414 | Ga0157370_10297224 | 3300013104 | Bacteria | 1491 |
| 415 | Ga0157370_10540126 | 3300013104 | Bacteria | 1069 |
| 416 | Ga0157370_10663800 | 3300013104 | Bacteria | 953 |
| 417 | Ga0157369_10000301 | 3300013105 | Bacteria | 66010 |
| 418 | Ga0157369_10055266 | 3300013105 | Unclassified | 4286 |
| 419 | Ga0157369_10140197 | 3300013105 | Bacteria | 2559 |
| 420 | Ga0157369_10184926 | 3300013105 | Bacteria | 2191 |
| 421 | Ga0157369_10191609 | 3300013105 | Bacteria | 2148 |
| 422 | Ga0157374_10000180 | 3300013296 | Bacteria | 58547 |
| 423 | Ga0157374_10001208 | 3300013296 | Bacteria | 22108 |
| 424 | Ga0157374_10001936 | 3300013296 | Bacteria | 17362 |
| 425 | Ga0157374_10037158 | 3300013296 | Bacteria | 4467 |
| 426 | Ga0157374_10064009 | 3300013296 | Bacteria | 3450 |
| 427 | Ga0157374_10454911 | 3300013296 | Bacteria | 1282 |
| 428 | Ga0157374_10919633 | 3300013296 | Bacteria | 893 |
| 429 | Ga0157378_10002934 | 3300013297 | Bacteria | 15160 |
| 430 | Ga0157378_10016682 | 3300013297 | Bacteria | 6435 |
| 431 | Ga0157378_10025378 | 3300013297 | Bacteria | 5219 |
| 432 | Ga0157378_10027671 | 3300013297 | Bacteria | 5001 |
| 433 | Ga0157378_10038789 | 3300013297 | Bacteria | 4223 |
| 434 | Ga0157378_10109920 | 3300013297 | Bacteria | 2526 |
| 435 | Ga0157378_10176020 | 3300013297 | Bacteria | 2010 |
| 436 | Ga0157378_10385147 | 3300013297 | Unclassified | 1378 |
| 437 | Ga0157378_10421939 | 3300013297 | Bacteria | 1319 |
| 438 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 439 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 440 | Ga0163162_10000112 | 3300013306 | Bacteria | 72032 |
| 441 | Ga0163162_10000253 | 3300013306 | Bacteria | 48450 |
| 442 | Ga0163162_10002340 | 3300013306 | Bacteria | 17794 |
| 443 | Ga0163162_10002412 | 3300013306 | Bacteria | 17588 |
| 444 | Ga0163162_10002447 | 3300013306 | Bacteria | 17518 |
| 445 | Ga0163162_10003028 | 3300013306 | Bacteria | 16055 |
| 446 | Ga0163162_10008696 | 3300013306 | Bacteria | 9881 |
| 447 | Ga0163162_10073125 | 3300013306 | Bacteria | 3484 |
| 448 | Ga0163162_10074712 | 3300013306 | Unclassified | 3448 |
| 449 | Ga0163162_10137644 | 3300013306 | Bacteria | 2553 |
| 450 | Ga0163162_10184710 | 3300013306 | Bacteria | 2212 |
| 451 | Ga0163162_10240591 | 3300013306 | Bacteria | 1941 |
| 452 | Ga0163162_10255593 | 3300013306 | Bacteria | 1884 |
| 453 | Ga0163162_10492222 | 3300013306 | Bacteria | 1357 |
| 454 | Ga0163162_10577749 | 3300013306 | Unclassified | 1251 |
| 455 | Ga0163162_10705389 | 3300013306 | Unclassified | 1130 |
| 456 | Ga0163162_10729264 | 3300013306 | Bacteria | 1111 |
| 457 | Ga0157372_10000037 | 3300013307 | Bacteria | 172444 |
| 458 | Ga0157372_10003686 | 3300013307 | Bacteria | 16465 |
| 459 | Ga0157372_10006375 | 3300013307 | Bacteria | 12552 |
| 460 | Ga0157372_10009703 | 3300013307 | Bacteria | 10235 |
| 461 | Ga0157372_10013991 | 3300013307 | Bacteria | 8572 |
| 462 | Ga0157372_10033278 | 3300013307 | Bacteria | 5660 |
| 463 | Ga0157372_10037248 | 3300013307 | Bacteria | 5363 |
| 464 | Ga0157372_10089205 | 3300013307 | Bacteria | 3503 |
| 465 | Ga0157372_10118957 | 3300013307 | Bacteria | 3032 |
| 466 | Ga0157372_10207209 | 3300013307 | Bacteria | 2272 |
| 467 | Ga0157372_10239976 | 3300013307 | Bacteria | 2103 |
| 468 | Ga0157372_10464309 | 3300013307 | Bacteria | 1475 |
| 469 | Ga0157372_10482209 | 3300013307 | Viruses | 1446 |
| 470 | Ga0157375_10002970 | 3300013308 | Bacteria | 14733 |
| 471 | Ga0157375_10017528 | 3300013308 | Bacteria | 6466 |
| 472 | Ga0157375_10032194 | 3300013308 | Bacteria | 4971 |
| 473 | Ga0157375_10055544 | 3300013308 | Bacteria | 3905 |
| 474 | Ga0157375_10076232 | 3300013308 | Bacteria | 3379 |
| 475 | Ga0157375_10089080 | 3300013308 | Bacteria | 3142 |
| 476 | Ga0157375_10113118 | 3300013308 | Bacteria | 2815 |
| 477 | Ga0157375_10177058 | 3300013308 | Bacteria | 2283 |
| 478 | Ga0157375_10222544 | 3300013308 | Bacteria | 2046 |
| 479 | Ga0157375_10373600 | 3300013308 | Unclassified | 1592 |
| 480 | Ga0163163_10001606 | 3300014325 | Bacteria | 19003 |
| 481 | Ga0163163_10079320 | 3300014325 | Bacteria | 3281 |
| 482 | Ga0163163_10279568 | 3300014325 | Bacteria | 1721 |
| 483 | Ga0163163_10317084 | 3300014325 | Bacteria | 1612 |
| 484 | Ga0163163_10442936 | 3300014325 | Unclassified | 1359 |
| 485 | Ga0157380_10006320 | 3300014326 | Bacteria | 8325 |
| 486 | Ga0157380_10015530 | 3300014326 | Bacteria | 5598 |
| 487 | Ga0157380_10103530 | 3300014326 | Bacteria | 2376 |
| 488 | Ga0157380_10117290 | 3300014326 | Bacteria | 2248 |
| 489 | Ga0157380_10210758 | 3300014326 | Bacteria | 1731 |
| 490 | Ga0157380_10244889 | 3300014326 | Unclassified | 1619 |
| 491 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 492 | Ga0182008_10000058 | 3300014497 | Bacteria | 100175 |
| 493 | Ga0182008_10000059 | 3300014497 | Bacteria | 100173 |
| 494 | Ga0182008_10059196 | 3300014497 | Bacteria | 1890 |
| 495 | Ga0157377_10006497 | 3300014745 | Bacteria | 5581 |
| 496 | Ga0157377_10012719 | 3300014745 | Unclassified | 4240 |
| 497 | Ga0157377_10015027 | 3300014745 | Bacteria | 3949 |
| 498 | Ga0157377_10132954 | 3300014745 | Bacteria | 1522 |
| 499 | Ga0157379_10001508 | 3300014968 | Bacteria | 19154 |
| 500 | Ga0157379_10065702 | 3300014968 | Bacteria | 3243 |
| 501 | Ga0157379_10268978 | 3300014968 | Bacteria | 1550 |
| 502 | Ga0157379_10677845 | 3300014968 | Bacteria | 966 |
| 503 | Ga0157376_10000583 | 3300014969 | Bacteria | 23527 |
| 504 | Ga0157376_10001570 | 3300014969 | Bacteria | 15087 |
| 505 | Ga0157376_10010576 | 3300014969 | Bacteria | 6756 |
| 506 | Ga0157376_10063914 | 3300014969 | Bacteria | 3102 |
| 507 | Ga0157376_10104584 | 3300014969 | Unclassified | 2481 |
| 508 | Ga0157376_10107570 | 3300014969 | Bacteria | 2448 |
| 509 | Ga0157376_10149443 | 3300014969 | Bacteria | 2105 |
| 510 | Ga0157376_10234554 | 3300014969 | Bacteria | 1706 |
| 511 | Ga0157376_10239273 | 3300014969 | Bacteria | 1691 |
| 512 | Ga0182006_1000156 | 3300015261 | Bacteria | 72868 |
| 513 | Ga0182006_1000470 | 3300015261 | Bacteria | 31499 |
| 514 | Ga0182006_1000482 | 3300015261 | Bacteria | 31213 |
| 515 | Ga0182006_1001296 | 3300015261 | Bacteria | 15423 |
| 516 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 517 | Ga0182007_10034751 | 3300015262 | Bacteria | 1701 |
| 518 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 519 | Ga0163161_10000305 | 3300017792 | Bacteria | 42845 |
| 520 | Ga0163161_10000502 | 3300017792 | Bacteria | 31881 |
| 521 | Ga0163161_10000778 | 3300017792 | Bacteria | 25045 |
| 522 | Ga0163161_10005925 | 3300017792 | Bacteria | 8473 |
| 523 | Ga0163161_10020128 | 3300017792 | Bacteria | 4679 |
| 524 | Ga0163161_10023052 | 3300017792 | Bacteria | 4387 |
| 525 | Ga0163161_10029926 | 3300017792 | Bacteria | 3872 |
| 526 | Ga0163161_10043127 | 3300017792 | Bacteria | 3248 |
| 527 | Ga0163161_10284885 | 3300017792 | Bacteria | 1297 |
| 528 | Ga0163161_10471388 | 3300017792 | Bacteria | 1018 |
| 529 | Ga0206351_10474630 | 3300020077 | Bacteria | 2333 |
| 530 | Ga0206350_10768666 | 3300020080 | Bacteria | 1744 |
| 531 | Ga0154015_1561766 | 3300020610 | Bacteria | 1450 |
| 532 | Ga0207427_100071 | 3300025231 | Bacteria | 159974 |
| 533 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 534 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 535 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 536 | Ga0209646_1001778 | 3300025246 | Bacteria | 5402 |
| 537 | Ga0209026_1000325 | 3300025250 | Bacteria | 49667 |
| 538 | Ga0209026_1001703 | 3300025250 | Bacteria | 9175 |
| 539 | Ga0209026_1003864 | 3300025250 | Bacteria | 4724 |
| 540 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 541 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 542 | Ga0209233_1002101 | 3300025261 | Bacteria | 7511 |
| 543 | Ga0207666_1003197 | 3300025271 | Bacteria | 2002 |
| 544 | Ga0209455_1003029 | 3300025272 | Bacteria | 6152 |
| 545 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 546 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 547 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 548 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 549 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 550 | Ga0207697_10032559 | 3300025315 | Bacteria | 2134 |
| 551 | Ga0207656_10006221 | 3300025321 | Bacteria | 4277 |
| 552 | Ga0207656_10022813 | 3300025321 | Bacteria | 2514 |
| 553 | Ga0207656_10062601 | 3300025321 | Bacteria | 1636 |
| 554 | Ga0207682_10155806 | 3300025893 | Bacteria | 1032 |
| 555 | Ga0207642_10043526 | 3300025899 | Bacteria | 1981 |
| 556 | Ga0207688_10071862 | 3300025901 | Bacteria | 1965 |
| 557 | Ga0207680_10000037 | 3300025903 | Bacteria | 72773 |
| 558 | Ga0207680_10005905 | 3300025903 | Bacteria | 5880 |
| 559 | Ga0207680_10016302 | 3300025903 | Bacteria | 3898 |
| 560 | Ga0207647_10000453 | 3300025904 | Bacteria | 33344 |
| 561 | Ga0207647_10000687 | 3300025904 | Bacteria | 26558 |
| 562 | Ga0207647_10024864 | 3300025904 | Bacteria | 3944 |
| 563 | Ga0207647_10060271 | 3300025904 | Bacteria | 2320 |
| 564 | Ga0207647_10123929 | 3300025904 | Unclassified | 1522 |
| 565 | Ga0207647_10317003 | 3300025904 | Viruses | 886 |
| 566 | Ga0207645_10000398 | 3300025907 | Bacteria | 35913 |
| 567 | Ga0207645_10005743 | 3300025907 | Bacteria | 8954 |
| 568 | Ga0207645_10006151 | 3300025907 | Bacteria | 8622 |
| 569 | Ga0207645_10038499 | 3300025907 | Unclassified | 3066 |
| 570 | Ga0207645_10080239 | 3300025907 | Bacteria | 2091 |
| 571 | Ga0207643_10156670 | 3300025908 | Bacteria | 1368 |
| 572 | Ga0207643_10236906 | 3300025908 | Bacteria | 1121 |
| 573 | Ga0207705_10000160 | 3300025909 | Bacteria | 72235 |
| 574 | Ga0207705_10012389 | 3300025909 | Bacteria | 6161 |
| 575 | Ga0207654_10002936 | 3300025911 | Bacteria | 8647 |
| 576 | Ga0207654_10003611 | 3300025911 | Bacteria | 7809 |
| 577 | Ga0207654_10004664 | 3300025911 | Bacteria | 6930 |
| 578 | Ga0207654_10007347 | 3300025911 | Bacteria | 5548 |
| 579 | Ga0207654_10042681 | 3300025911 | Bacteria | 2568 |
| 580 | Ga0207654_10074444 | 3300025911 | Bacteria | 2027 |
| 581 | Ga0207654_10128702 | 3300025911 | Bacteria | 1600 |
| 582 | Ga0207654_10180921 | 3300025911 | Unclassified | 1375 |
| 583 | Ga0207707_10000620 | 3300025912 | Bacteria | 35314 |
| 584 | Ga0207707_10063196 | 3300025912 | Bacteria | 3222 |
| 585 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 586 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 587 | Ga0207695_10001122 | 3300025913 | Bacteria | 46534 |
| 588 | Ga0207695_10011093 | 3300025913 | Bacteria | 10942 |
| 589 | Ga0207695_10012480 | 3300025913 | Bacteria | 10197 |
| 590 | Ga0207695_10030736 | 3300025913 | Bacteria | 5909 |
| 591 | Ga0207695_10031676 | 3300025913 | Bacteria | 5795 |
| 592 | Ga0207695_10056221 | 3300025913 | Bacteria | 4096 |
| 593 | Ga0207695_10135664 | 3300025913 | Bacteria | 2414 |
| 594 | Ga0207695_10194858 | 3300025913 | Bacteria | 1942 |
| 595 | Ga0207695_10258714 | 3300025913 | Bacteria | 1638 |
| 596 | Ga0207671_10000453 | 3300025914 | Bacteria | 56447 |
| 597 | Ga0207671_10001040 | 3300025914 | Bacteria | 33728 |
| 598 | Ga0207671_10001502 | 3300025914 | Bacteria | 26900 |
| 599 | Ga0207671_10001511 | 3300025914 | Bacteria | 26769 |
| 600 | Ga0207671_10003253 | 3300025914 | Bacteria | 16345 |
| 601 | Ga0207671_10003463 | 3300025914 | Bacteria | 15704 |
| 602 | Ga0207671_10003548 | 3300025914 | Bacteria | 15461 |
| 603 | Ga0207671_10011669 | 3300025914 | Bacteria | 7128 |
| 604 | Ga0207671_10012109 | 3300025914 | Bacteria | 6965 |
| 605 | Ga0207671_10017185 | 3300025914 | Bacteria | 5587 |
| 606 | Ga0207671_10142456 | 3300025914 | Bacteria | 1848 |
| 607 | Ga0207671_10156194 | 3300025914 | Bacteria | 1765 |
| 608 | Ga0207671_10335022 | 3300025914 | Bacteria | 1198 |
| 609 | Ga0207660_10002359 | 3300025917 | Bacteria | 12433 |
| 610 | Ga0207662_10007392 | 3300025918 | Bacteria | 5981 |
| 611 | Ga0207662_10039148 | 3300025918 | Bacteria | 2780 |
| 612 | Ga0207662_10042443 | 3300025918 | Bacteria | 2681 |
| 613 | Ga0207657_10026795 | 3300025919 | Bacteria | 5288 |
| 614 | Ga0207657_10214952 | 3300025919 | Bacteria | 1542 |
| 615 | Ga0207652_10003265 | 3300025921 | Bacteria | 13432 |
| 616 | Ga0207646_10459911 | 3300025922 | Bacteria | 1148 |
| 617 | Ga0207681_10015111 | 3300025923 | Bacteria | 4813 |
| 618 | Ga0207681_10045442 | 3300025923 | Bacteria | 2949 |
| 619 | Ga0207681_10063095 | 3300025923 | Bacteria | 2554 |
| 620 | Ga0207694_10095992 | 3300025924 | Unclassified | 2344 |
| 621 | Ga0207694_10165901 | 3300025924 | Bacteria | 1786 |
| 622 | Ga0207650_10020030 | 3300025925 | Bacteria | 4711 |
| 623 | Ga0207650_10022410 | 3300025925 | Unclassified | 4470 |
| 624 | Ga0207650_10034354 | 3300025925 | Bacteria | 3677 |
| 625 | Ga0207650_10095484 | 3300025925 | Bacteria | 2279 |
| 626 | Ga0207659_10004571 | 3300025926 | Bacteria | 8368 |
| 627 | Ga0207659_10014816 | 3300025926 | Bacteria | 5039 |
| 628 | Ga0207659_10034950 | 3300025926 | Bacteria | 3470 |
| 629 | Ga0207659_10044057 | 3300025926 | Bacteria | 3137 |
| 630 | Ga0207659_10158200 | 3300025926 | Bacteria | 1776 |
| 631 | Ga0207687_10052204 | 3300025927 | Bacteria | 2852 |
| 632 | Ga0207644_10030894 | 3300025931 | Bacteria | 3729 |
| 633 | Ga0207644_10067370 | 3300025931 | Bacteria | 2609 |
| 634 | Ga0207644_10159093 | 3300025931 | Bacteria | 1754 |
| 635 | Ga0207690_10003371 | 3300025932 | Bacteria | 9552 |
| 636 | Ga0207690_10003707 | 3300025932 | Bacteria | 9082 |
| 637 | Ga0207690_10057474 | 3300025932 | Bacteria | 2628 |
| 638 | Ga0207690_10321768 | 3300025932 | Bacteria | 1216 |
| 639 | Ga0207706_10001940 | 3300025933 | Bacteria | 20308 |
| 640 | Ga0207706_10007446 | 3300025933 | Bacteria | 10123 |
| 641 | Ga0207706_10033616 | 3300025933 | Bacteria | 4563 |
| 642 | Ga0207686_10000351 | 3300025934 | Bacteria | 32797 |
| 643 | Ga0207686_10012335 | 3300025934 | Bacteria | 4698 |
| 644 | Ga0207686_10013758 | 3300025934 | Bacteria | 4487 |
| 645 | Ga0207686_10282594 | 3300025934 | Bacteria | 1226 |
| 646 | Ga0207686_10332271 | 3300025934 | Bacteria | 1139 |
| 647 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 648 | Ga0207669_10167621 | 3300025937 | Bacteria | 1559 |
| 649 | Ga0207669_10229995 | 3300025937 | Bacteria | 1367 |
| 650 | Ga0207669_10426146 | 3300025937 | Unclassified | 1045 |
| 651 | Ga0207669_10480642 | 3300025937 | Bacteria | 990 |
| 652 | Ga0207704_10000065 | 3300025938 | Bacteria | 69867 |
| 653 | Ga0207704_10004767 | 3300025938 | Bacteria | 6226 |
| 654 | Ga0207704_10297326 | 3300025938 | Bacteria | 1235 |
| 655 | Ga0207704_10407983 | 3300025938 | Bacteria | 1074 |
| 656 | Ga0207691_10002638 | 3300025940 | Bacteria | 17515 |
| 657 | Ga0207691_10004182 | 3300025940 | Bacteria | 14018 |
| 658 | Ga0207691_10028719 | 3300025940 | Bacteria | 5205 |
| 659 | Ga0207691_10082245 | 3300025940 | Bacteria | 2893 |
| 660 | Ga0207691_10163024 | 3300025940 | Bacteria | 1955 |
| 661 | Ga0207691_10239007 | 3300025940 | Unclassified | 1571 |
| 662 | Ga0207691_10336233 | 3300025940 | Bacteria | 1293 |
| 663 | Ga0207711_10110463 | 3300025941 | Bacteria | 2445 |
| 664 | Ga0207689_10001492 | 3300025942 | Bacteria | 22339 |
| 665 | Ga0207689_10005311 | 3300025942 | Bacteria | 11544 |
| 666 | Ga0207689_10011795 | 3300025942 | Bacteria | 7487 |
| 667 | Ga0207689_10018345 | 3300025942 | Bacteria | 5904 |
| 668 | Ga0207689_10020602 | 3300025942 | Bacteria | 5548 |
| 669 | Ga0207689_10054081 | 3300025942 | Bacteria | 3307 |
| 670 | Ga0207689_10508787 | 3300025942 | Bacteria | 1009 |
| 671 | Ga0207679_10233984 | 3300025945 | Bacteria | 1553 |
| 672 | Ga0207667_10000014 | 3300025949 | Bacteria | 421261 |
| 673 | Ga0207667_10006330 | 3300025949 | Bacteria | 14348 |
| 674 | Ga0207667_10008556 | 3300025949 | Bacteria | 12145 |
| 675 | Ga0207667_10029491 | 3300025949 | Bacteria | 5950 |
| 676 | Ga0207667_10070639 | 3300025949 | Bacteria | 3634 |
| 677 | Ga0207667_10170911 | 3300025949 | Bacteria | 2234 |
| 678 | Ga0207667_10367336 | 3300025949 | Bacteria | 1467 |
| 679 | Ga0207667_10717871 | 3300025949 | Bacteria | 1001 |
| 680 | Ga0207651_10003185 | 3300025960 | Bacteria | 8013 |
| 681 | Ga0207651_10011676 | 3300025960 | Bacteria | 4929 |
| 682 | Ga0207651_10030165 | 3300025960 | Bacteria | 3448 |
| 683 | Ga0207651_10033439 | 3300025960 | Bacteria | 3317 |
| 684 | Ga0207651_10094061 | 3300025960 | Bacteria | 2203 |
| 685 | Ga0207712_10003635 | 3300025961 | Bacteria | 9725 |
| 686 | Ga0207712_10005438 | 3300025961 | Bacteria | 8039 |
| 687 | Ga0207712_10010167 | 3300025961 | Bacteria | 5966 |
| 688 | Ga0207712_10016429 | 3300025961 | Bacteria | 4792 |
| 689 | Ga0207712_10753190 | 3300025961 | Bacteria | 853 |
| 690 | Ga0207668_10000337 | 3300025972 | Bacteria | 30364 |
| 691 | Ga0207668_10022400 | 3300025972 | Bacteria | 4044 |
| 692 | Ga0207668_10183172 | 3300025972 | Bacteria | 1654 |
| 693 | Ga0207668_10284016 | 3300025972 | Bacteria | 1358 |
| 694 | Ga0207640_10019820 | 3300025981 | Bacteria | 3981 |
| 695 | Ga0207640_10031441 | 3300025981 | Bacteria | 3280 |
| 696 | Ga0207640_10065577 | 3300025981 | Bacteria | 2423 |
| 697 | Ga0207658_10032567 | 3300025986 | Bacteria | 3711 |
| 698 | Ga0207658_10055696 | 3300025986 | Bacteria | 2932 |
| 699 | Ga0207677_10003172 | 3300026023 | Bacteria | 8681 |
| 700 | Ga0207677_10094632 | 3300026023 | Bacteria | 2181 |
| 701 | Ga0207677_10202498 | 3300026023 | Unclassified | 1579 |
| 702 | Ga0207677_10251581 | 3300026023 | Unclassified | 1435 |
| 703 | Ga0207703_10012935 | 3300026035 | Bacteria | 6504 |
| 704 | Ga0207703_10092614 | 3300026035 | Bacteria | 2544 |
| 705 | Ga0207639_10006123 | 3300026041 | Bacteria | 8165 |
| 706 | Ga0207639_10030028 | 3300026041 | Bacteria | 3984 |
| 707 | Ga0207639_10035558 | 3300026041 | Bacteria | 3687 |
| 708 | Ga0207639_10044982 | 3300026041 | Bacteria | 3323 |
| 709 | Ga0207639_10137080 | 3300026041 | Bacteria | 2034 |
| 710 | Ga0207639_10196336 | 3300026041 | Bacteria | 1727 |
| 711 | Ga0207639_10212634 | 3300026041 | Bacteria | 1666 |
| 712 | Ga0207639_10241198 | 3300026041 | Bacteria | 1572 |
| 713 | Ga0207639_10294220 | 3300026041 | Unclassified | 1433 |
| 714 | Ga0207639_10369581 | 3300026041 | Bacteria | 1285 |
| 715 | Ga0207639_10441118 | 3300026041 | Bacteria | 1180 |
| 716 | Ga0207639_10675531 | 3300026041 | Bacteria | 957 |
| 717 | Ga0207678_10012592 | 3300026067 | Bacteria | 7431 |
| 718 | Ga0207678_10144732 | 3300026067 | Bacteria | 2029 |
| 719 | Ga0207708_10049372 | 3300026075 | Unclassified | 3203 |
| 720 | Ga0207708_10057831 | 3300026075 | Bacteria | 2958 |
| 721 | Ga0207702_10000042 | 3300026078 | Bacteria | 150673 |
| 722 | Ga0207702_10121103 | 3300026078 | Bacteria | 2342 |
| 723 | Ga0207702_10175128 | 3300026078 | Bacteria | 1971 |
| 724 | Ga0207702_10180036 | 3300026078 | Bacteria | 1946 |
| 725 | Ga0207702_10267933 | 3300026078 | Unclassified | 1610 |
| 726 | Ga0207702_10276991 | 3300026078 | Bacteria | 1584 |
| 727 | Ga0207702_10577303 | 3300026078 | Bacteria | 1102 |
| 728 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 729 | Ga0207641_10000191 | 3300026088 | Bacteria | 84147 |
| 730 | Ga0207641_10003523 | 3300026088 | Bacteria | 13855 |
| 731 | Ga0207641_10047477 | 3300026088 | Bacteria | 3621 |
| 732 | Ga0207641_10087811 | 3300026088 | Bacteria | 2713 |
| 733 | Ga0207641_10615024 | 3300026088 | Bacteria | 1065 |
| 734 | Ga0207648_10000215 | 3300026089 | Bacteria | 62218 |
| 735 | Ga0207648_10000886 | 3300026089 | Bacteria | 33749 |
| 736 | Ga0207648_10001688 | 3300026089 | Bacteria | 24183 |
| 737 | Ga0207648_10031663 | 3300026089 | Bacteria | 4675 |
| 738 | Ga0207648_10035766 | 3300026089 | Bacteria | 4376 |
| 739 | Ga0207648_10040646 | 3300026089 | Bacteria | 4086 |
| 740 | Ga0207648_10050875 | 3300026089 | Bacteria | 3622 |
| 741 | Ga0207648_10123566 | 3300026089 | Bacteria | 2276 |
| 742 | Ga0207676_10001501 | 3300026095 | Bacteria | 17229 |
| 743 | Ga0207676_10002935 | 3300026095 | Bacteria | 12148 |
| 744 | Ga0207676_10046678 | 3300026095 | Bacteria | 3353 |
| 745 | Ga0207676_10068839 | 3300026095 | Bacteria | 2833 |
| 746 | Ga0207676_10364317 | 3300026095 | Bacteria | 1340 |
| 747 | Ga0207674_10008410 | 3300026116 | Bacteria | 11925 |
| 748 | Ga0207674_10008703 | 3300026116 | Bacteria | 11683 |
| 749 | Ga0207674_10011877 | 3300026116 | Bacteria | 9764 |
| 750 | Ga0207674_10037214 | 3300026116 | Bacteria | 5064 |
| 751 | Ga0207674_10272260 | 3300026116 | Bacteria | 1641 |
| 752 | Ga0207674_10484973 | 3300026116 | Bacteria | 1195 |
| 753 | Ga0207675_100000153 | 3300026118 | Bacteria | 60593 |
| 754 | Ga0207675_100008612 | 3300026118 | Bacteria | 9591 |
| 755 | Ga0207675_100033909 | 3300026118 | Bacteria | 4758 |
| 756 | Ga0207675_100036980 | 3300026118 | Bacteria | 4555 |
| 757 | Ga0207675_100060380 | 3300026118 | Bacteria | 3539 |
| 758 | Ga0207675_100290291 | 3300026118 | Bacteria | 1591 |
| 759 | Ga0207683_10002748 | 3300026121 | Bacteria | 15366 |
| 760 | Ga0207683_10011891 | 3300026121 | Bacteria | 7428 |
| 761 | Ga0207683_10037765 | 3300026121 | Unclassified | 4207 |
| 762 | Ga0207683_10079670 | 3300026121 | Bacteria | 2904 |
| 763 | Ga0207683_10679434 | 3300026121 | Bacteria | 954 |
| 764 | Ga0207683_10683869 | 3300026121 | Bacteria | 951 |
| 765 | Ga0207698_10004214 | 3300026142 | Bacteria | 8744 |
| 766 | Ga0207698_10005575 | 3300026142 | Bacteria | 7784 |
| 767 | Ga0207698_10072982 | 3300026142 | Bacteria | 2730 |
| 768 | Ga0207698_10946465 | 3300026142 | Bacteria | 870 |
| 769 | Ga0209974_10021005 | 3300027876 | Bacteria | 2164 |
| 770 | Ga0207428_10100857 | 3300027907 | Bacteria | 2231 |
| 771 | Ga0207428_10572975 | 3300027907 | Bacteria | 815 |
| 772 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 773 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 774 | Ga0268266_10016895 | 3300028379 | Bacteria | 6235 |
| 775 | Ga0268266_10045725 | 3300028379 | Bacteria | 3745 |
| 776 | Ga0268266_10209181 | 3300028379 | Bacteria | 1788 |
| 777 | Ga0268265_10006773 | 3300028380 | Bacteria | 7752 |
| 778 | Ga0268265_10090278 | 3300028380 | Unclassified | 2447 |
| 779 | Ga0268265_10102288 | 3300028380 | Bacteria | 2317 |
| 780 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 781 | Ga0268264_10000726 | 3300028381 | Bacteria | 37807 |
| 782 | Ga0268264_10008612 | 3300028381 | Bacteria | 8474 |
| 783 | Ga0268264_10013525 | 3300028381 | Bacteria | 6721 |
| 784 | Ga0268264_10016166 | 3300028381 | Bacteria | 6112 |
| 785 | Ga0268264_10742149 | 3300028381 | Bacteria | 977 |
| 786 | Ga0265323_10000199 | 3300028653 | Bacteria | 36122 |
| 787 | Ga0307517_10000212 | 3300028786 | Bacteria | 99215 |
| 788 | Ga0307517_10066423 | 3300028786 | Bacteria | 3319 |
| 789 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 790 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 791 | Ga0307515_10000224 | 3300028794 | Bacteria | 140276 |
| 792 | Ga0307515_10000318 | 3300028794 | Bacteria | 118891 |
| 793 | Ga0307515_10019542 | 3300028794 | Bacteria | 12180 |
| 794 | Ga0307515_10096065 | 3300028794 | Bacteria | 3639 |
| 795 | Ga0265338_10188569 | 3300028800 | Bacteria | 1565 |
| 796 | Ga0265338_10323807 | 3300028800 | Bacteria | 1115 |
| 797 | Ga0316177_1017133 | 3300030731 | Bacteria | 2693 |
| 798 | Ga0316176_1014596 | 3300030732 | Bacteria | 15075 |
| 799 | Ga0316183_1003890 | 3300030742 | Bacteria | 25813 |
| 800 | Ga0316182_1151228 | 3300030745 | Bacteria | 2924 |
| 801 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 802 | Ga0265327_10037835 | 3300031251 | Bacteria | 2637 |
| 803 | Ga0265316_10000566 | 3300031344 | Bacteria | 41362 |
| 804 | Ga0307513_10158011 | 3300031456 | Bacteria | 2164 |
| 805 | Ga0307509_10013918 | 3300031507 | Bacteria | 9490 |
| 806 | Ga0307509_10052661 | 3300031507 | Bacteria | 4344 |
| 807 | Ga0307509_10116179 | 3300031507 | Bacteria | 2666 |
| 808 | Ga0307408_100000209 | 3300031548 | Bacteria | 62437 |
| 809 | Ga0307408_100000487 | 3300031548 | Bacteria | 34716 |
| 810 | Ga0316576_10017565 | 3300031727 | Bacteria | 4865 |
| 811 | Ga0316576_10150285 | 3300031727 | Bacteria | 1755 |
| 812 | Ga0316578_10124307 | 3300031728 | Bacteria | 1551 |
| 813 | Ga0307516_10003216 | 3300031730 | Bacteria | 21192 |
| 814 | Ga0307405_10000341 | 3300031731 | Bacteria | 17410 |
| 815 | Ga0307405_10109604 | 3300031731 | Bacteria | 1868 |
| 816 | Ga0316577_10009604 | 3300031733 | Bacteria | 5208 |
| 817 | Ga0307410_10408929 | 3300031852 | Bacteria | 1098 |
| 818 | Ga0307406_10381965 | 3300031901 | Bacteria | 1111 |
| 819 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 820 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 821 | Ga0307412_10000724 | 3300031911 | Bacteria | 19071 |
| 822 | Ga0307412_10115103 | 3300031911 | Bacteria | 1927 |
| 823 | Ga0307412_10240019 | 3300031911 | Bacteria | 1401 |
| 824 | Ga0307412_10259443 | 3300031911 | Bacteria | 1354 |
| 825 | Ga0307409_100090130 | 3300031995 | Bacteria | 2509 |
| 826 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 827 | Ga0307414_10000655 | 3300032004 | Bacteria | 17690 |
| 828 | Ga0307414_10002342 | 3300032004 | Bacteria | 9897 |
| 829 | Ga0307414_10017828 | 3300032004 | Bacteria | 4354 |
| 830 | Ga0307414_10043401 | 3300032004 | Unclassified | 3063 |
| 831 | Ga0307414_10056253 | 3300032004 | Bacteria | 2758 |
| 832 | Ga0307414_10187346 | 3300032004 | Bacteria | 1671 |
| 833 | Ga0307414_10279656 | 3300032004 | Bacteria | 1402 |
| 834 | Ga0307414_10281211 | 3300032004 | Bacteria | 1398 |
| 835 | Ga0307411_10361010 | 3300032005 | Unclassified | 1188 |
| 836 | Ga0307415_100058428 | 3300032126 | Bacteria | 2656 |
| 837 | Ga0307507_10000111 | 3300033179 | Bacteria | 134722 |
| 838 | Ga0307510_10000156 | 3300033180 | Bacteria | 56919 |
| 839 | Ga0307510_10000249 | 3300033180 | Bacteria | 48754 |
| 840 | Ga0316574_0057908 | 3300035398 | Bacteria | 2427 |
| 841 | Ga0373924_0120792 | 3300035410 | Bacteria | 1137 |
| 842 | Ga0373935_0260614 | 3300035692 | Bacteria | 1216 |
| 843 | Ga0373927_0059830 | 3300035695 | Bacteria | 2464 |
| 844 | Ga0373937_0643736 | 3300036401 | Bacteria | 1005 |
| 845 | Ga0316582_0027620 | 3300036647 | Bacteria | 3430 |
| 846 | Ga0316584_0000012 | 3300036712 | Bacteria | 63927 |
| 847 | Ga0316584_0087146 | 3300036712 | Bacteria | 2337 |
| 848 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 849 | Ga0395899_0000280 | 3300037312 | Bacteria | 66580 |
| 850 | Ga0395899_0016189 | 3300037312 | Bacteria | 5683 |
| 851 | Ga0395899_0016320 | 3300037312 | Bacteria | 5660 |
| 852 | Ga0395899_0204332 | 3300037312 | Bacteria | 1376 |
| 853 | Ga0395900_0000204 | 3300037418 | Bacteria | 92834 |
| 854 | Ga0395900_0006199 | 3300037418 | Bacteria | 12487 |
| 855 | Ga0395900_0066255 | 3300037418 | Bacteria | 3711 |
| 856 | Ga0395900_0113554 | 3300037418 | Unclassified | 2780 |
| 857 | Ga0395900_0226119 | 3300037418 | Bacteria | 1884 |
| 858 | Ga0395898_0058793 | 3300037466 | Bacteria | 3742 |
| 859 | Ga0395905_0000327 | 3300037471 | Bacteria | 68334 |
| 860 | Ga0395905_0017279 | 3300037471 | Bacteria | 6852 |
| 861 | Ga0395905_0075046 | 3300037471 | Bacteria | 3169 |
| 862 | Ga0395905_0296906 | 3300037471 | Bacteria | 1503 |
| 863 | Ga0395905_0565956 | 3300037471 | Bacteria | 1038 |
| 864 | Ga0395905_0606915 | 3300037471 | Bacteria | 996 |
| 865 | Ga0395905_0615314 | 3300037471 | Bacteria | 988 |
| 866 | Ga0395901_0000895 | 3300038443 | Bacteria | 32740 |
| 867 | Ga0395901_0001405 | 3300038443 | Bacteria | 25148 |
| 868 | Ga0395901_0075824 | 3300038443 | Bacteria | 3508 |
| 869 | Ga0395901_0250108 | 3300038443 | Bacteria | 1847 |
| 870 | Ga0400483_132838 | 3300039062 | Unclassified | 1411 |
| 871 | Ga0400489_26798 | 3300039093 | Bacteria | 1371 |
| 872 | Ga0400489_51907 | 3300039093 | Bacteria | 6269 |
| 873 | Ga0436361_0762305 | 3300039447 | Bacteria | 18071 |
| 874 | Ga0439436_0004969 | 3300041404 | Bacteria | 4076 |
| 875 | Ga0451795_1361413 | 3300041456 | Unclassified | 1495 |
| 876 | Ga0451807_0800094 | 3300041486 | Bacteria | 2344 |
| 877 | Ga0451807_0937824 | 3300041486 | Bacteria | 1157 |
| 878 | Ga0451837_0007994 | 3300041494 | Bacteria | 932 |
| 879 | Ga0451841_1340210 | 3300041498 | Bacteria | 1007 |
| 880 | Ga0451853_2563909 | 3300041512 | Bacteria | 7170 |
| 881 | Ga0451853_3484866 | 3300041512 | Bacteria | 1144 |
| 882 | Ga0439457_000277 | 3300042014 | Bacteria | 14123 |
| 883 | Ga0439462_0026853 | 3300042015 | Bacteria | 1518 |
| 884 | Ga0439434_0054191 | 3300042435 | Unclassified | 1247 |
| 885 | Ga0466969_0000190 | 3300044656 | Bacteria | 33133 |
| 886 | Ga0466969_0059284 | 3300044656 | Bacteria | 1861 |
| 887 | Ga0466972_0000676 | 3300044658 | Bacteria | 16399 |
| 888 | Ga0453683_0023888 | 3300044673 | Bacteria | 3893 |
| 889 | Ga0453683_0129324 | 3300044673 | Bacteria | 1591 |
| 890 | Ga0466961_0015564 | 3300044693 | Bacteria | 4882 |
| 891 | Ga0466964_0019940 | 3300044706 | Bacteria | 2580 |
| 892 | Ga0453684_0004859 | 3300044712 | Bacteria | 27578 |
| 893 | Ga0453684_0040298 | 3300044712 | Bacteria | 6346 |
| 894 | Ga0453684_0085544 | 3300044712 | Bacteria | 3917 |
| 895 | Ga0453684_0346247 | 3300044712 | Bacteria | 1677 |
| 896 | Ga0453684_0573803 | 3300044712 | Unclassified | 1240 |
| 897 | Ga0453684_1010385 | 3300044712 | Bacteria | 884 |
| 898 | Ga0453684_1026963 | 3300044712 | Bacteria | 875 |
| 899 | Ga0466971_0024021 | 3300044719 | Bacteria | 2718 |
| 900 | Ga0466968_0054956 | 3300044735 | Bacteria | 1708 |
| 901 | Ga0466968_0072352 | 3300044735 | Unclassified | 1503 |
| 902 | Ga0466968_0230653 | 3300044735 | Bacteria | 874 |
| 903 | Ga0466957_0001546 | 3300044842 | Bacteria | 12103 |
| 904 | Ga0466957_0001652 | 3300044842 | Bacteria | 11702 |
| 905 | Ga0466957_0256075 | 3300044842 | Bacteria | 1165 |
| 906 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 907 | Ga0466959_0000488 | 3300045049 | Bacteria | 23122 |
| 908 | Ga0466959_0168455 | 3300045049 | Bacteria | 1537 |
| 909 | Ga0451576_0001978 | 3300045051 | Bacteria | 32556 |
| 910 | Ga0466958_0030207 | 3300045836 | Bacteria | 3217 |
| 911 | Ga0495638_0019512 | 3300046460 | Bacteria | 4486 |
| 912 | Ga0495651_0155366 | 3300046462 | Bacteria | 1645 |
| 913 | Ga0495650_0000268 | 3300046471 | Bacteria | 99891 |
| 914 | Ga0495650_0033044 | 3300046471 | Bacteria | 2307 |
| 915 | Ga0495580_0112580 | 3300046472 | Bacteria | 1890 |
| 916 | Ga0495585_0000034 | 3300046492 | Bacteria | 143120 |
| 917 | Ga0495585_0000785 | 3300046492 | Bacteria | 28010 |
| 918 | Ga0495594_0172213 | 3300046499 | Bacteria | 1232 |
| 919 | Ga0495596_0017038 | 3300046500 | Bacteria | 3014 |
| 920 | Ga0495607_0221045 | 3300046501 | Bacteria | 926 |
| 921 | Ga0495583_0025110 | 3300046506 | Bacteria | 2982 |
| 922 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 923 | Ga0495606_0003806 | 3300046507 | Bacteria | 15677 |
| 924 | Ga0495606_0003961 | 3300046507 | Bacteria | 15192 |
| 925 | Ga0495606_0026886 | 3300046507 | Bacteria | 4089 |
| 926 | Ga0495606_0028027 | 3300046507 | Bacteria | 3981 |
| 927 | Ga0495606_0031240 | 3300046507 | Bacteria | 3706 |
| 928 | Ga0495606_0144048 | 3300046507 | Bacteria | 1405 |
| 929 | Ga0495610_0000084 | 3300046512 | Bacteria | 112459 |
| 930 | Ga0495610_0001784 | 3300046512 | Bacteria | 18806 |
| 931 | Ga0495610_0058527 | 3300046512 | Bacteria | 1843 |
| 932 | Ga0495610_0165173 | 3300046512 | Bacteria | 932 |
| 933 | Ga0495616_0000907 | 3300046513 | Bacteria | 21368 |
| 934 | Ga0495616_0128305 | 3300046513 | Bacteria | 1164 |
| 935 | Ga0495618_0239537 | 3300046514 | Bacteria | 1141 |
| 936 | Ga0495631_0036513 | 3300046518 | Bacteria | 2194 |
| 937 | Ga0495631_0155858 | 3300046518 | Bacteria | 980 |
| 938 | Ga0495632_0071972 | 3300046519 | Bacteria | 1660 |
| 939 | Ga0495632_0150796 | 3300046519 | Bacteria | 1075 |
| 940 | Ga0495637_0008861 | 3300046520 | Bacteria | 4924 |
| 941 | Ga0495644_0004309 | 3300046523 | Bacteria | 5591 |
| 942 | Ga0495648_0003762 | 3300046524 | Bacteria | 13208 |
| 943 | Ga0495648_0016466 | 3300046524 | Bacteria | 5332 |
| 944 | Ga0495648_0022677 | 3300046524 | Bacteria | 4315 |
| 945 | Ga0495648_0076075 | 3300046524 | Bacteria | 1928 |
| 946 | Ga0495648_0212462 | 3300046524 | Bacteria | 960 |
| 947 | Ga0495652_0269295 | 3300046529 | Bacteria | 1253 |
| 948 | Ga0495654_0042615 | 3300046530 | Bacteria | 2252 |
| 949 | Ga0495609_0034564 | 3300046538 | Bacteria | 2291 |
| 950 | Ga0495609_0034960 | 3300046538 | Bacteria | 2276 |
| 951 | Ga0495622_0192670 | 3300046557 | Bacteria | 911 |
| 952 | Ga0495633_0000785 | 3300046558 | Bacteria | 28402 |
| 953 | Ga0495633_0163455 | 3300046558 | Bacteria | 1027 |
| 954 | Ga0495668_0000055 | 3300046616 | Bacteria | 199412 |
| 955 | Ga0495611_0000061 | 3300046648 | Bacteria | 77533 |
| 956 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 957 | Ga0495625_0000761 | 3300046660 | Bacteria | 44882 |
| 958 | Ga0495625_0001500 | 3300046660 | Bacteria | 28046 |
| 959 | Ga0495625_0003990 | 3300046660 | Bacteria | 14143 |
| 960 | Ga0495625_0034276 | 3300046660 | Bacteria | 3748 |
| 961 | Ga0495625_0047405 | 3300046660 | Bacteria | 3098 |
| 962 | Ga0495625_0061832 | 3300046660 | Bacteria | 2648 |
| 963 | Ga0495625_0187500 | 3300046660 | Bacteria | 1372 |
| 964 | Ga0495625_0376184 | 3300046660 | Bacteria | 892 |
| 965 | Ga0495635_0324186 | 3300046663 | Bacteria | 1030 |
| 966 | Ga0495661_0001101 | 3300046665 | Bacteria | 23675 |
| 967 | Ga0495661_0002357 | 3300046665 | Bacteria | 14578 |
| 968 | Ga0495661_0071867 | 3300046665 | Bacteria | 2020 |
| 969 | Ga0495661_0093349 | 3300046665 | Bacteria | 1708 |
| 970 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 971 | Ga0495660_0015258 | 3300046810 | Bacteria | 4439 |
| 972 | Ga0495660_0098012 | 3300046810 | Bacteria | 1513 |
| 973 | Ga0495672_0009824 | 3300047320 | Bacteria | 6885 |
| 974 | Ga0495672_0035104 | 3300047320 | Bacteria | 3090 |
| 975 | Ga0495672_0062090 | 3300047320 | Bacteria | 2151 |
| 976 | Ga0495676_0083444 | 3300047321 | Unclassified | 2415 |
| 977 | Ga0495683_0097950 | 3300047323 | Bacteria | 1413 |
| 978 | Ga0495687_001497 | 3300047443 | Bacteria | 21340 |
| 979 | Ga0495687_004528 | 3300047443 | Bacteria | 9335 |
| 980 | Ga0495687_069141 | 3300047443 | Bacteria | 1423 |
| 981 | Ga0495673_0123554 | 3300047469 | Bacteria | 1023 |
| 982 | Ga0495684_0039358 | 3300047471 | Bacteria | 3624 |
| 983 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 984 | Ga0495686_0000965 | 3300047472 | Bacteria | 35434 |
| 985 | Ga0495686_0001146 | 3300047472 | Bacteria | 31183 |
| 986 | Ga0495686_0027599 | 3300047472 | Bacteria | 3705 |
| 987 | Ga0495686_0093581 | 3300047472 | Unclassified | 1822 |
| 988 | Ga0495686_0152669 | 3300047472 | Bacteria | 1355 |
| 989 | Ga0495686_0197383 | 3300047472 | Bacteria | 1157 |
| 990 | Ga0495686_0335059 | 3300047472 | Bacteria | 826 |
| 991 | Ga0495602_0187154 | 3300048088 | Bacteria | 1591 |
| 992 | Ga0496101_0079607 | 3300048904 | Bacteria | 2419 |
| 993 | Ga0496102_0632528 | 3300048905 | Unclassified | 993 |
| 994 | Ga0496104_0185735 | 3300048907 | Bacteria | 1990 |
| 995 | Ga0496109_0035289 | 3300048912 | Bacteria | 4510 |
| 996 | Ga0496114_0294857 | 3300048917 | Bacteria | 1431 |
| 997 | Ga0496114_0349697 | 3300048917 | Bacteria | 1307 |
| 998 | Ga0496114_0586328 | 3300048917 | Bacteria | 984 |
| 999 | Ga0496115_0054596 | 3300048918 | Bacteria | 3208 |
| 1000 | Ga0496115_0115819 | 3300048918 | Archaea | 2204 |
| 1001 | Ga0496116_0002140 | 3300048919 | Bacteria | 21021 |
| 1002 | Ga0496117_0001774 | 3300048920 | Bacteria | 29604 |
| 1003 | Ga0496122_0000783 | 3300048925 | Bacteria | 61156 |
| 1004 | Ga0496122_0003563 | 3300048925 | Bacteria | 20343 |
| 1005 | Ga0496123_0000586 | 3300048926 | Bacteria | 62082 |
| 1006 | Ga0496123_0111706 | 3300048926 | Bacteria | 1560 |
| 1007 | Ga0496125_0034972 | 3300048928 | Bacteria | 4419 |
| 1008 | Ga0495678_042611 | 3300049459 | Bacteria | 1808 |
| 1009 | Ga0501031_0002263 | 3300049568 | Bacteria | 12196 |
| 1010 | Ga0501032_0010324 | 3300049569 | Bacteria | 6737 |
| 1011 | Ga0501032_0114378 | 3300049569 | Bacteria | 1784 |
| 1012 | Ga0501033_0010409 | 3300049570 | Bacteria | 7134 |
| 1013 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 1014 | Ga0501034_0026263 | 3300049571 | Bacteria | 5931 |
| 1015 | Ga0501034_0035864 | 3300049571 | Bacteria | 5028 |
| 1016 | Ga0501036_0001446 | 3300049572 | Bacteria | 18239 |
| 1017 | Ga0501036_0022006 | 3300049572 | Bacteria | 5361 |
| 1018 | Ga0501037_0007204 | 3300049573 | Bacteria | 8126 |
| 1019 | Ga0501038_0003270 | 3300049574 | Bacteria | 15111 |
| 1020 | Ga0501038_0015262 | 3300049574 | Bacteria | 6984 |
| 1021 | Ga0501039_0009680 | 3300049575 | Bacteria | 7344 |
| 1022 | Ga0501039_0042353 | 3300049575 | Bacteria | 3518 |
| 1023 | Ga0501043_0010690 | 3300049579 | Bacteria | 7189 |
| 1024 | Ga0501043_0424297 | 3300049579 | Unclassified | 1002 |
| 1025 | Ga0501046_0016366 | 3300049580 | Bacteria | 6212 |
| 1026 | Ga0501047_0009030 | 3300049581 | Bacteria | 9412 |
| 1027 | Ga0501047_0054326 | 3300049581 | Bacteria | 3874 |
| 1028 | Ga0501047_0568911 | 3300049581 | Bacteria | 957 |
| 1029 | Ga0501048_0023532 | 3300049582 | Bacteria | 4501 |
| 1030 | Ga0501067_0037603 | 3300049583 | Unclassified | 2688 |
| 1031 | Ga0501068_0238384 | 3300049584 | Bacteria | 1157 |
| 1032 | Ga0501070_0006613 | 3300049586 | Bacteria | 9866 |
| 1033 | Ga0501070_0108613 | 3300049586 | Bacteria | 2292 |
| 1034 | Ga0501072_0138330 | 3300049588 | Bacteria | 1942 |
| 1035 | Ga0501073_0027520 | 3300049589 | Bacteria | 4065 |
| 1036 | Ga0501073_0412582 | 3300049589 | Bacteria | 933 |
| 1037 | Ga0501074_0012286 | 3300049590 | Bacteria | 6224 |
| 1038 | Ga0501077_0289592 | 3300049593 | Bacteria | 1043 |
| 1039 | Ga0501198_009024 | 3300049649 | Bacteria | 1457 |
| 1040 | Ga0501223_008443 | 3300049663 | Unclassified | 2100 |
| 1041 | Ga0501233_031841 | 3300049668 | Bacteria | 1196 |
| 1042 | Ga0501252_006347 | 3300049682 | Bacteria | 1313 |
| 1043 | Ga0501261_010340 | 3300049690 | Bacteria | 1228 |
| 1044 | Ga0501221_006925 | 3300049704 | Bacteria | 1929 |
| 1045 | Ga0501225_0001601 | 3300049705 | Bacteria | 7072 |
| 1046 | Ga0501080_0164554 | 3300049742 | Bacteria | 2047 |
| 1047 | Ga0501083_0042934 | 3300049744 | Bacteria | 3064 |
| 1048 | Ga0501241_012071 | 3300049758 | Bacteria | 1569 |
| 1049 | Ga0501035_0005853 | 3300049822 | Bacteria | 11596 |
| 1050 | Ga0501035_0039105 | 3300049822 | Unclassified | 4294 |
| 1051 | Ga0501035_0390602 | 3300049822 | Bacteria | 1159 |
| 1052 | Ga0501044_0068107 | 3300049823 | Bacteria | 3626 |
| 1053 | Ga0501044_0574614 | 3300049823 | Bacteria | 1022 |
| 1054 | Ga0501045_0057147 | 3300049824 | Bacteria | 2855 |
| 1055 | nmdc:mga0k408_11130_c1 | 3300050493 | Bacteria | 4890 |
| 1056 | nmdc:mga0k408_120_c1 | 3300050493 | Bacteria | 38359 |
| 1057 | nmdc:mga0k408_217666_c1 | 3300050493 | Bacteria | 1140 |
| 1058 | nmdc:mga0k408_245849_c1 | 3300050493 | Bacteria | 1068 |
| 1059 | nmdc:mga0k408_26107_c1 | 3300050493 | Bacteria | 3311 |
| 1060 | nmdc:mga0k408_364_c1 | 3300050493 | Bacteria | 24845 |
| 1061 | nmdc:mga0k408_52941_c1 | 3300050493 | Bacteria | 2352 |
| 1062 | nmdc:mga05p37_286222_c1 | 3300050507 | Bacteria | 1963 |
| 1063 | nmdc:mga05p37_482_c1 | 3300050507 | Bacteria | 43621 |
| 1064 | nmdc:mga09592_5311_c1 | 3300050508 | Bacteria | 10470 |
| 1065 | nmdc:mga09592_674267_c1 | 3300050508 | Bacteria | 881 |
| 1066 | nmdc:mga09592_85887_c1 | 3300050508 | Bacteria | 2685 |
| 1067 | nmdc:mga09592_92423_c1 | 3300050508 | Bacteria | 2586 |
| 1068 | nmdc:mga0qj67_134949_c1 | 3300050509 | Bacteria | 2000 |
| 1069 | nmdc:mga06r32_36625_c1 | 3300050510 | Bacteria | 4638 |
| 1070 | nmdc:mga08y16_62717_c1 | 3300050511 | Bacteria | 3882 |
| 1071 | nmdc:mga08y16_967371_c1 | 3300050511 | Unclassified | 833 |
| 1072 | Ga0500635_0001085 | 3300053080 | Bacteria | 6499 |
| 1073 | Ga0500578_0001568 | 3300053086 | Bacteria | 22320 |
| 1074 | Ga0500644_0035720 | 3300053088 | Bacteria | 1612 |
| 1075 | Ga0500644_0079193 | 3300053088 | Bacteria | 1204 |
| 1076 | Ga0500646_0000772 | 3300053090 | Bacteria | 8994 |
| 1077 | Ga0500646_0004874 | 3300053090 | Bacteria | 3399 |
| 1078 | Ga0500646_0011068 | 3300053090 | Bacteria | 2318 |
| 1079 | Ga0500646_0013394 | 3300053090 | Bacteria | 2122 |
| 1080 | Ga0500583_0000019 | 3300053092 | Bacteria | 130534 |
| 1081 | Ga0500583_0004003 | 3300053092 | Bacteria | 4736 |
| 1082 | Ga0500583_0004520 | 3300053092 | Bacteria | 4547 |
| 1083 | Ga0500650_0013159 | 3300053098 | Bacteria | 3463 |
| 1084 | Ga0500556_0065227 | 3300053104 | Bacteria | 1350 |
| 1085 | Ga0500562_000034 | 3300053108 | Bacteria | 83634 |
| 1086 | Ga0500562_018478 | 3300053108 | Bacteria | 1801 |
| 1087 | Ga0500608_048215 | 3300053122 | Bacteria | 2046 |
| 1088 | Ga0500614_015999 | 3300053123 | Bacteria | 1678 |
| 1089 | Ga0500618_000006 | 3300053125 | Bacteria | 239188 |
| 1090 | Ga0500642_0015283 | 3300053130 | Bacteria | 2882 |
| 1091 | Ga0500642_0030869 | 3300053130 | Bacteria | 2234 |
| 1092 | Ga0500642_0050257 | 3300053130 | Bacteria | 1837 |
| 1093 | Ga0500652_025738 | 3300053131 | Bacteria | 2258 |
| 1094 | Ga0500568_0000208 | 3300053139 | Bacteria | 51266 |
| 1095 | Ga0500568_0010529 | 3300053139 | Unclassified | 4325 |
| 1096 | Ga0500579_181385 | 3300053143 | Bacteria | 828 |
| 1097 | Ga0500588_0059628 | 3300053146 | Bacteria | 1218 |
| 1098 | Ga0500589_023513 | 3300053147 | Bacteria | 2841 |
| 1099 | Ga0500603_005882 | 3300053150 | Bacteria | 2656 |
| 1100 | Ga0500616_0037550 | 3300053153 | Bacteria | 2622 |
| 1101 | Ga0500616_0063716 | 3300053153 | Bacteria | 1900 |
| 1102 | Ga0500622_0009240 | 3300053156 | Bacteria | 5468 |
| 1103 | Ga0500622_0017330 | 3300053156 | Bacteria | 3832 |
| 1104 | Ga0500622_0225171 | 3300053156 | Bacteria | 838 |
| 1105 | Ga0500624_000567 | 3300053157 | Bacteria | 10211 |
| 1106 | Ga0500639_058120 | 3300053163 | Bacteria | 1999 |
| 1107 | Ga0501084_0014521 | 3300054114 | Bacteria | 6529 |
| 1108 | Ga0500661_016255 | 3300055283 | Bacteria | 1331 |
| 1109 | Ga0501082_0046092 | 3300060353 | Bacteria | 3759 |
| 1110 | Ga0501082_0212638 | 3300060353 | Bacteria | 1682 |
| 1111 | Ga0466962_0007910 | 3300061719 | Bacteria | 5098 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041494 | Ga0451837_0007994 | Ga0451837_0007994_185_895 | 235 |
| 2 | 3300048917 | Ga0496114_0586328 | Ga0496114_0586328_18_728 | 235 |
| 3 | 3300053108 | Ga0500562_018478 | Ga0500562_018478_721_1434 | 235 |
| 4 | 3300053143 | Ga0500579_181385 | Ga0500579_181385_74_784 | 236 |
| 5 | 3300009147 | Ga0114129_10001062 | Ga0114129_1000106217 | 239 |
| 6 | 3300031507 | Ga0307509_10013918 | Ga0307509_1001391813 | 239 |
| 7 | 3300039447 | Ga0436361_0762305 | Ga0436361_0762305_8004_8723 | 239 |
| 8 | 3300044712 | Ga0453684_0004859 | Ga0453684_0004859_3957_4721 | 239 |
| 9 | 3300050493 | nmdc:mga0k408_26107_c1 | nmdc:mga0k408_26107_c1_1238_1960 | 239 |
| 10 | 3300053156 | Ga0500622_0225171 | Ga0500622_0225171_97_819 | 239 |
| 11 | 3300005539 | Ga0068853_100140645 | Ga0068853_1001406452 | 240 |
| 12 | 3300005578 | Ga0068854_100182933 | Ga0068854_1001829332 | 240 |
| 13 | 3300005843 | Ga0068860_100005506 | Ga0068860_1000055066 | 240 |
| 14 | 3300009093 | Ga0105240_10003157 | Ga0105240_1000315719 | 240 |
| 15 | 3300009148 | Ga0105243_10209191 | Ga0105243_102091914 | 240 |
| 16 | 3300010375 | Ga0105239_10092212 | Ga0105239_100922123 | 240 |
| 17 | 3300025913 | Ga0207695_10000066 | Ga0207695_10000066294 | 240 |
| 18 | 3300025913 | Ga0207695_10135664 | Ga0207695_101356642 | 240 |
| 19 | 3300026041 | Ga0207639_10137080 | Ga0207639_101370802 | 240 |
| 20 | 3300044712 | Ga0453684_1010385 | Ga0453684_1010385_33_758 | 240 |
| 21 | 3300045051 | Ga0451576_0001978 | Ga0451576_0001978_24700_25464 | 240 |
| 22 | 3300047320 | Ga0495672_0009824 | Ga0495672_0009824_4824_5549 | 240 |
| 23 | 3300048918 | Ga0496115_0115819 | Ga0496115_0115819_1046_1774 | 240 |
| 24 | 3300049584 | Ga0501068_0238384 | Ga0501068_0238384_35_760 | 240 |
| 25 | 3300013307 | Ga0157372_10006375 | Ga0157372_1000637511 | 241 |
| 26 | 3300020077 | Ga0206351_10474630 | Ga0206351_104746302 | 241 |
| 27 | 3300020080 | Ga0206350_10768666 | Ga0206350_107686662 | 241 |
| 28 | 3300020610 | Ga0154015_1561766 | Ga0154015_15617662 | 241 |
| 29 | 3300050507 | nmdc:mga05p37_482_c1 | nmdc:mga05p37_482_c1_24022_24765 | 246 |
| 30 | 3300053092 | Ga0500583_0000019 | Ga0500583_0000019_67386_68150 | 246 |
| 31 | 3300009553 | Ga0105249_10007464 | Ga0105249_1000746414 | 247 |
| 32 | 3300013306 | Ga0163162_10002340 | Ga0163162_1000234016 | 247 |
| 33 | 3300013308 | Ga0157375_10113118 | Ga0157375_101131186 | 247 |
| 34 | 3300014968 | Ga0157379_10065702 | Ga0157379_100657023 | 247 |
| 35 | 3300017792 | Ga0163161_10029926 | Ga0163161_100299268 | 247 |
| 36 | 3300025961 | Ga0207712_10753190 | Ga0207712_107531901 | 247 |
| 37 | 3300046519 | Ga0495632_0071972 | Ga0495632_0071972_886_1650 | 247 |
| 38 | 3300049822 | Ga0501035_0390602 | Ga0501035_0390602_14_757 | 247 |
| 39 | 3300049668 | Ga0501233_031841 | Ga0501233_031841_43_819 | 248 |
| 40 | 3300049690 | Ga0501261_010340 | Ga0501261_010340_149_925 | 248 |
| 41 | 3300049704 | Ga0501221_006925 | Ga0501221_006925_659_1435 | 248 |
| 42 | iso_pu_bacteria | 2833640130 | 2833641368 | 249 |
| 43 | iso_pu_bacteria | 2839989709 | 2839990581 | 249 |
| 44 | iso_pu_bacteria | 2890737413 | 2890739079 | 249 |
| 45 | iso_pu_bacteria | 2929154850 | 2929159730 | 249 |
| 46 | iso_pu_bacteria | 2738541278 | 2738725036 | 250 |
| 47 | iso_pu_bacteria | 2898713307 | 2898714354 | 250 |
| 48 | iso_pu_bacteria | 2910245624 | 2910250683 | 250 |
| 49 | iso_pu_bacteria | 3003233435 | 3003234915 | 250 |
| 50 | iso_pu_bacteria | 2585427687 | 2586206512 | 251 |
| 51 | iso_pu_bacteria | 2599185184 | 2599480759 | 251 |
| 52 | iso_pu_bacteria | 2721755487 | 2722730882 | 251 |
| 53 | iso_pu_bacteria | 2738541302 | 2738852789 | 251 |
| 54 | iso_pu_bacteria | 2739367651 | 2739586730 | 251 |
| 55 | iso_pu_bacteria | 2739367663 | 2739645826 | 251 |
| 56 | iso_pu_bacteria | 2818991437 | 2819547153 | 251 |
| 57 | iso_pu_bacteria | 2842722452 | 2842727078 | 251 |
| 58 | iso_pu_bacteria | 2842909656 | 2842910920 | 251 |
| 59 | iso_pu_bacteria | 2849281842 | 2849284129 | 251 |
| 60 | iso_pu_bacteria | 2852623160 | 2852626383 | 251 |
| 61 | iso_pu_bacteria | 2857627736 | 2857628011 | 251 |
| 62 | iso_pu_bacteria | 2884933994 | 2884934835 | 251 |
| 63 | iso_pu_bacteria | 2895498888 | 2895501088 | 251 |
| 64 | iso_pu_bacteria | 2902048731 | 2902050600 | 251 |
| 65 | iso_pu_bacteria | 2904445276 | 2904447630 | 251 |
| 66 | iso_pu_bacteria | 2904780799 | 2904783584 | 251 |
| 67 | iso_pu_bacteria | 2919177583 | 2919181446 | 251 |
| 68 | iso_pu_bacteria | 2919437846 | 2919439935 | 251 |
| 69 | iso_pu_bacteria | 2928078545 | 2928081651 | 251 |
| 70 | iso_pu_bacteria | 2928147474 | 2928150321 | 251 |
| 71 | iso_pu_bacteria | 2932082852 | 2932085144 | 251 |
| 72 | iso_pu_bacteria | 2945997725 | 2945997974 | 251 |
| 73 | iso_pu_bacteria | 2977232053 | 2977234695 | 251 |
| 74 | iso_pu_bacteria | 2738541283 | 2738755808 | 252 |
| 75 | iso_pu_bacteria | 2738541284 | 2738761528 | 252 |
| 76 | iso_pu_bacteria | 2738543023 | 2739302953 | 252 |
| 77 | iso_pu_bacteria | 2775506987 | 2776615836 | 252 |
| 78 | iso_pu_bacteria | 2842903701 | 2842904992 | 252 |
| 79 | iso_pu_bacteria | 2852627209 | 2852628046 | 252 |
| 80 | iso_pu_bacteria | 2919186247 | 2919188404 | 252 |
| 81 | iso_pu_bacteria | 2939664404 | 2939667511 | 252 |
| 82 | 3300003322 | rootL2_10198285 | rootL2_101982853 | 253 |
| 83 | 3300005337 | Ga0070682_100000041 | Ga0070682_10000004130 | 253 |
| 84 | 3300005364 | Ga0070673_100059643 | Ga0070673_1000596434 | 253 |
| 85 | 3300005539 | Ga0068853_100151022 | Ga0068853_1001510222 | 253 |
| 86 | 3300005548 | Ga0070665_100023328 | Ga0070665_1000233285 | 253 |
| 87 | 3300005834 | Ga0068851_10104294 | Ga0068851_101042941 | 253 |
| 88 | 3300005841 | Ga0068863_100011017 | Ga0068863_10001101710 | 253 |
| 89 | 3300005842 | Ga0068858_100474363 | Ga0068858_1004743632 | 253 |
| 90 | 3300006358 | Ga0068871_100326853 | Ga0068871_1003268532 | 253 |
| 91 | 3300010375 | Ga0105239_10020600 | Ga0105239_100206002 | 253 |
| 92 | 3300010375 | Ga0105239_10389838 | Ga0105239_103898382 | 253 |
| 93 | 3300013296 | Ga0157374_10454911 | Ga0157374_104549111 | 253 |
| 94 | 3300013297 | Ga0157378_10027671 | Ga0157378_100276717 | 253 |
| 95 | 3300013307 | Ga0157372_10464309 | Ga0157372_104643092 | 253 |
| 96 | 3300014325 | Ga0163163_10279568 | Ga0163163_102795682 | 253 |
| 97 | 3300025321 | Ga0207656_10022813 | Ga0207656_100228135 | 253 |
| 98 | 3300025904 | Ga0207647_10024864 | Ga0207647_100248643 | 253 |
| 99 | 3300025913 | Ga0207695_10056221 | Ga0207695_100562213 | 253 |
| 100 | 3300026023 | Ga0207677_10094632 | Ga0207677_100946322 | 253 |
| 101 | 3300026088 | Ga0207641_10003523 | Ga0207641_100035236 | 253 |
| 102 | 3300026095 | Ga0207676_10046678 | Ga0207676_100466782 | 253 |
| 103 | 3300028379 | Ga0268266_10016895 | Ga0268266_100168952 | 253 |
| 104 | 3300028653 | Ga0265323_10000199 | Ga0265323_1000019931 | 253 |
| 105 | 3300031251 | Ga0265327_10037835 | Ga0265327_100378351 | 253 |
| 106 | 3300031344 | Ga0265316_10000566 | Ga0265316_100005663 | 253 |
| 107 | 3300031727 | Ga0316576_10017565 | Ga0316576_100175652 | 253 |
| 108 | 3300031727 | Ga0316576_10150285 | Ga0316576_101502852 | 253 |
| 109 | 3300031728 | Ga0316578_10124307 | Ga0316578_101243071 | 253 |
| 110 | 3300031733 | Ga0316577_10009604 | Ga0316577_100096043 | 253 |
| 111 | 3300032126 | Ga0307415_100058428 | Ga0307415_1000584282 | 253 |
| 112 | 3300035398 | Ga0316574_0057908 | Ga0316574_0057908_580_1344 | 253 |
| 113 | 3300035695 | Ga0373927_0059830 | Ga0373927_0059830_1234_1998 | 253 |
| 114 | 3300036647 | Ga0316582_0027620 | Ga0316582_0027620_1879_2649 | 253 |
| 115 | 3300036712 | Ga0316584_0000012 | Ga0316584_0000012_41497_42267 | 253 |
| 116 | 3300036712 | Ga0316584_0087146 | Ga0316584_0087146_12_776 | 253 |
| 117 | 3300037418 | Ga0395900_0226119 | Ga0395900_0226119_464_1225 | 253 |
| 118 | 3300038443 | Ga0395901_0001405 | Ga0395901_0001405_3072_3833 | 253 |
| 119 | 3300038443 | Ga0395901_0250108 | Ga0395901_0250108_130_891 | 253 |
| 120 | 3300039062 | Ga0400483_132838 | Ga0400483_132838_324_1094 | 253 |
| 121 | 3300041404 | Ga0439436_0004969 | Ga0439436_0004969_1988_2752 | 253 |
| 122 | 3300041456 | Ga0451795_1361413 | Ga0451795_1361413_588_1352 | 253 |
| 123 | 3300042014 | Ga0439457_000277 | Ga0439457_000277_3641_4405 | 253 |
| 124 | 3300042015 | Ga0439462_0026853 | Ga0439462_0026853_491_1255 | 253 |
| 125 | 3300044656 | Ga0466969_0000190 | Ga0466969_0000190_17029_17793 | 253 |
| 126 | 3300044673 | Ga0453683_0129324 | Ga0453683_0129324_805_1569 | 253 |
| 127 | 3300044706 | Ga0466964_0019940 | Ga0466964_0019940_609_1373 | 253 |
| 128 | 3300044712 | Ga0453684_0085544 | Ga0453684_0085544_925_1689 | 253 |
| 129 | 3300044712 | Ga0453684_1026963 | Ga0453684_1026963_90_860 | 253 |
| 130 | 3300044735 | Ga0466968_0054956 | Ga0466968_0054956_399_1163 | 253 |
| 131 | 3300044842 | Ga0466957_0001652 | Ga0466957_0001652_9739_10503 | 253 |
| 132 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_144897_145661 | 253 |
| 133 | 3300049705 | Ga0501225_0001601 | Ga0501225_0001601_4636_5400 | 253 |
| 134 | 3300050493 | nmdc:mga0k408_217666_c1 | nmdc:mga0k408_217666_c1_284_1048 | 253 |
| 135 | 3300053088 | Ga0500644_0035720 | Ga0500644_0035720_295_1092 | 253 |
| 136 | 3300053090 | Ga0500646_0004874 | Ga0500646_0004874_1506_2270 | 253 |
| 137 | 3300053092 | Ga0500583_0004520 | Ga0500583_0004520_1889_2653 | 253 |
| 138 | 3300053108 | Ga0500562_000034 | Ga0500562_000034_53949_54746 | 253 |
| 139 | 3300053130 | Ga0500642_0030869 | Ga0500642_0030869_171_935 | 253 |
| 140 | 3300053131 | Ga0500652_025738 | Ga0500652_025738_286_1050 | 253 |
| 141 | 3300053139 | Ga0500568_0000208 | Ga0500568_0000208_17593_18357 | 253 |
| 142 | 3300053147 | Ga0500589_023513 | Ga0500589_023513_194_958 | 253 |
| 143 | 3300053150 | Ga0500603_005882 | Ga0500603_005882_467_1231 | 253 |
| 144 | 3300053153 | Ga0500616_0063716 | Ga0500616_0063716_853_1650 | 253 |
| 145 | 3300053156 | Ga0500622_0009240 | Ga0500622_0009240_2432_3229 | 253 |
| 146 | 3300053163 | Ga0500639_058120 | Ga0500639_058120_884_1648 | 253 |
| 147 | 3300055283 | Ga0500661_016255 | Ga0500661_016255_440_1237 | 253 |
| 148 | 2162886012 | MBSR1b_contig_11496357 | MBSR1b_0760.00003440 | 254 |
| 149 | 3300001904 | JGI24736J21556_1011527 | JGI24736J21556_10115272 | 254 |
| 150 | 3300002155 | JGI24033J26618_1007771 | JGI24033J26618_10077711 | 254 |
| 151 | 3300002738 | JGI25154J39366_1004687 | JGI25154J39366_10046874 | 254 |
| 152 | 3300003316 | rootH1_10102873 | rootH1_101028732 | 254 |
| 153 | 3300003320 | rootH2_10007161 | rootH2_1000716132 | 254 |
| 154 | 3300003320 | rootH2_10089828 | rootH2_100898282 | 254 |
| 155 | 3300003322 | rootL2_10094458 | rootL2_100944582 | 254 |
| 156 | 3300003354 | JGI25160J50197_1001108 | JGI25160J50197_10011089 | 254 |
| 157 | 3300005288 | Ga0065714_10072850 | Ga0065714_100728502 | 254 |
| 158 | 3300005290 | Ga0065712_10002703 | Ga0065712_100027033 | 254 |
| 159 | 3300005290 | Ga0065712_10074233 | Ga0065712_100742335 | 254 |
| 160 | 3300005290 | Ga0065712_10199717 | Ga0065712_101997172 | 254 |
| 161 | 3300005293 | Ga0065715_10270193 | Ga0065715_102701932 | 254 |
| 162 | 3300005295 | Ga0065707_10143673 | Ga0065707_101436733 | 254 |
| 163 | 3300005327 | Ga0070658_10001765 | Ga0070658_1000176512 | 254 |
| 164 | 3300005328 | Ga0070676_10004348 | Ga0070676_100043484 | 254 |
| 165 | 3300005328 | Ga0070676_10015311 | Ga0070676_100153113 | 254 |
| 166 | 3300005328 | Ga0070676_10041152 | Ga0070676_100411522 | 254 |
| 167 | 3300005328 | Ga0070676_10166487 | Ga0070676_101664871 | 254 |
| 168 | 3300005330 | Ga0070690_100053377 | Ga0070690_1000533772 | 254 |
| 169 | 3300005330 | Ga0070690_100094008 | Ga0070690_1000940081 | 254 |
| 170 | 3300005330 | Ga0070690_100146863 | Ga0070690_1001468631 | 254 |
| 171 | 3300005331 | Ga0070670_100027378 | Ga0070670_1000273785 | 254 |
| 172 | 3300005331 | Ga0070670_100031040 | Ga0070670_1000310404 | 254 |
| 173 | 3300005331 | Ga0070670_100052324 | Ga0070670_1000523244 | 254 |
| 174 | 3300005331 | Ga0070670_100255751 | Ga0070670_1002557511 | 254 |
| 175 | 3300005333 | Ga0070677_10024926 | Ga0070677_100249263 | 254 |
| 176 | 3300005333 | Ga0070677_10038588 | Ga0070677_100385882 | 254 |
| 177 | 3300005334 | Ga0068869_100003737 | Ga0068869_1000037377 | 254 |
| 178 | 3300005334 | Ga0068869_100006757 | Ga0068869_1000067577 | 254 |
| 179 | 3300005334 | Ga0068869_100021858 | Ga0068869_1000218582 | 254 |
| 180 | 3300005334 | Ga0068869_100068253 | Ga0068869_1000682531 | 254 |
| 181 | 3300005334 | Ga0068869_100245495 | Ga0068869_1002454951 | 254 |
| 182 | 3300005335 | Ga0070666_10000072 | Ga0070666_1000007269 | 254 |
| 183 | 3300005335 | Ga0070666_10000856 | Ga0070666_1000085613 | 254 |
| 184 | 3300005335 | Ga0070666_10010262 | Ga0070666_100102625 | 254 |
| 185 | 3300005335 | Ga0070666_10024067 | Ga0070666_100240674 | 254 |
| 186 | 3300005335 | Ga0070666_10408838 | Ga0070666_104088381 | 254 |
| 187 | 3300005336 | Ga0070680_100001822 | Ga0070680_1000018228 | 254 |
| 188 | 3300005337 | Ga0070682_100001992 | Ga0070682_1000019924 | 254 |
| 189 | 3300005337 | Ga0070682_100140391 | Ga0070682_1001403912 | 254 |
| 190 | 3300005338 | Ga0068868_100002491 | Ga0068868_1000024915 | 254 |
| 191 | 3300005338 | Ga0068868_100066227 | Ga0068868_1000662274 | 254 |
| 192 | 3300005338 | Ga0068868_100095762 | Ga0068868_1000957621 | 254 |
| 193 | 3300005338 | Ga0068868_100218724 | Ga0068868_1002187242 | 254 |
| 194 | 3300005340 | Ga0070689_100077847 | Ga0070689_1000778472 | 254 |
| 195 | 3300005341 | Ga0070691_10009617 | Ga0070691_100096174 | 254 |
| 196 | 3300005341 | Ga0070691_10187779 | Ga0070691_101877791 | 254 |
| 197 | 3300005343 | Ga0070687_100008339 | Ga0070687_1000083391 | 254 |
| 198 | 3300005343 | Ga0070687_100058866 | Ga0070687_1000588662 | 254 |
| 199 | 3300005344 | Ga0070661_100061111 | Ga0070661_1000611113 | 254 |
| 200 | 3300005347 | Ga0070668_100004192 | Ga0070668_1000041925 | 254 |
| 201 | 3300005347 | Ga0070668_100022027 | Ga0070668_1000220273 | 254 |
| 202 | 3300005347 | Ga0070668_100029190 | Ga0070668_1000291902 | 254 |
| 203 | 3300005347 | Ga0070668_100272610 | Ga0070668_1002726102 | 254 |
| 204 | 3300005347 | Ga0070668_100327614 | Ga0070668_1003276141 | 254 |
| 205 | 3300005353 | Ga0070669_100019580 | Ga0070669_1000195805 | 254 |
| 206 | 3300005353 | Ga0070669_100067601 | Ga0070669_1000676012 | 254 |
| 207 | 3300005353 | Ga0070669_100090023 | Ga0070669_1000900232 | 254 |
| 208 | 3300005354 | Ga0070675_100011810 | Ga0070675_1000118103 | 254 |
| 209 | 3300005354 | Ga0070675_100052152 | Ga0070675_1000521521 | 254 |
| 210 | 3300005354 | Ga0070675_100070805 | Ga0070675_1000708053 | 254 |
| 211 | 3300005354 | Ga0070675_100071251 | Ga0070675_1000712511 | 254 |
| 212 | 3300005354 | Ga0070675_100103942 | Ga0070675_1001039422 | 254 |
| 213 | 3300005355 | Ga0070671_100067613 | Ga0070671_1000676132 | 254 |
| 214 | 3300005355 | Ga0070671_100070322 | Ga0070671_1000703221 | 254 |
| 215 | 3300005355 | Ga0070671_100308249 | Ga0070671_1003082492 | 254 |
| 216 | 3300005356 | Ga0070674_100187387 | Ga0070674_1001873871 | 254 |
| 217 | 3300005356 | Ga0070674_100192412 | Ga0070674_1001924122 | 254 |
| 218 | 3300005356 | Ga0070674_100413987 | Ga0070674_1004139871 | 254 |
| 219 | 3300005364 | Ga0070673_100001930 | Ga0070673_10000193012 | 254 |
| 220 | 3300005364 | Ga0070673_100004765 | Ga0070673_1000047652 | 254 |
| 221 | 3300005364 | Ga0070673_100017257 | Ga0070673_1000172572 | 254 |
| 222 | 3300005364 | Ga0070673_100023510 | Ga0070673_1000235103 | 254 |
| 223 | 3300005364 | Ga0070673_100027647 | Ga0070673_1000276472 | 254 |
| 224 | 3300005364 | Ga0070673_100096617 | Ga0070673_1000966172 | 254 |
| 225 | 3300005364 | Ga0070673_100228490 | Ga0070673_1002284902 | 254 |
| 226 | 3300005364 | Ga0070673_100446374 | Ga0070673_1004463741 | 254 |
| 227 | 3300005365 | Ga0070688_100001768 | Ga0070688_10000176810 | 254 |
| 228 | 3300005365 | Ga0070688_100044922 | Ga0070688_1000449222 | 254 |
| 229 | 3300005365 | Ga0070688_100111182 | Ga0070688_1001111822 | 254 |
| 230 | 3300005366 | Ga0070659_100008229 | Ga0070659_1000082292 | 254 |
| 231 | 3300005366 | Ga0070659_100267958 | Ga0070659_1002679582 | 254 |
| 232 | 3300005367 | Ga0070667_100003102 | Ga0070667_1000031026 | 254 |
| 233 | 3300005367 | Ga0070667_100077424 | Ga0070667_1000774242 | 254 |
| 234 | 3300005367 | Ga0070667_100087633 | Ga0070667_1000876333 | 254 |
| 235 | 3300005441 | Ga0070700_100024503 | Ga0070700_1000245031 | 254 |
| 236 | 3300005455 | Ga0070663_100182436 | Ga0070663_1001824361 | 254 |
| 237 | 3300005456 | Ga0070678_100060730 | Ga0070678_1000607301 | 254 |
| 238 | 3300005456 | Ga0070678_100331526 | Ga0070678_1003315262 | 254 |
| 239 | 3300005457 | Ga0070662_100074082 | Ga0070662_1000740821 | 254 |
| 240 | 3300005458 | Ga0070681_10025021 | Ga0070681_100250215 | 254 |
| 241 | 3300005459 | Ga0068867_100005280 | Ga0068867_1000052805 | 254 |
| 242 | 3300005459 | Ga0068867_100053647 | Ga0068867_1000536473 | 254 |
| 243 | 3300005459 | Ga0068867_100076943 | Ga0068867_1000769433 | 254 |
| 244 | 3300005459 | Ga0068867_100172069 | Ga0068867_1001720692 | 254 |
| 245 | 3300005459 | Ga0068867_100281531 | Ga0068867_1002815312 | 254 |
| 246 | 3300005459 | Ga0068867_100444756 | Ga0068867_1004447562 | 254 |
| 247 | 3300005459 | Ga0068867_100560372 | Ga0068867_1005603721 | 254 |
| 248 | 3300005466 | Ga0070685_10025086 | Ga0070685_100250863 | 254 |
| 249 | 3300005466 | Ga0070685_10040270 | Ga0070685_100402702 | 254 |
| 250 | 3300005466 | Ga0070685_10091082 | Ga0070685_100910821 | 254 |
| 251 | 3300005466 | Ga0070685_10356252 | Ga0070685_103562521 | 254 |
| 252 | 3300005471 | Ga0070698_100002009 | Ga0070698_10000200915 | 254 |
| 253 | 3300005471 | Ga0070698_100005327 | Ga0070698_1000053278 | 254 |
| 254 | 3300005471 | Ga0070698_100048986 | Ga0070698_1000489862 | 254 |
| 255 | 3300005518 | Ga0070699_100057554 | Ga0070699_1000575544 | 254 |
| 256 | 3300005518 | Ga0070699_100472201 | Ga0070699_1004722012 | 254 |
| 257 | 3300005530 | Ga0070679_100464348 | Ga0070679_1004643482 | 254 |
| 258 | 3300005539 | Ga0068853_100005414 | Ga0068853_10000541412 | 254 |
| 259 | 3300005539 | Ga0068853_100012933 | Ga0068853_1000129334 | 254 |
| 260 | 3300005539 | Ga0068853_100158131 | Ga0068853_1001581312 | 254 |
| 261 | 3300005539 | Ga0068853_100179807 | Ga0068853_1001798071 | 254 |
| 262 | 3300005539 | Ga0068853_100421669 | Ga0068853_1004216692 | 254 |
| 263 | 3300005539 | Ga0068853_100575633 | Ga0068853_1005756331 | 254 |
| 264 | 3300005539 | Ga0068853_100844927 | Ga0068853_1008449271 | 254 |
| 265 | 3300005543 | Ga0070672_100003625 | Ga0070672_10000362511 | 254 |
| 266 | 3300005543 | Ga0070672_100004263 | Ga0070672_1000042638 | 254 |
| 267 | 3300005543 | Ga0070672_100045387 | Ga0070672_1000453875 | 254 |
| 268 | 3300005543 | Ga0070672_100051032 | Ga0070672_1000510323 | 254 |
| 269 | 3300005543 | Ga0070672_100120475 | Ga0070672_1001204752 | 254 |
| 270 | 3300005543 | Ga0070672_100199695 | Ga0070672_1001996952 | 254 |
| 271 | 3300005543 | Ga0070672_100748815 | Ga0070672_1007488151 | 254 |
| 272 | 3300005544 | Ga0070686_100129013 | Ga0070686_1001290132 | 254 |
| 273 | 3300005545 | Ga0070695_100222520 | Ga0070695_1002225202 | 254 |
| 274 | 3300005547 | Ga0070693_100018363 | Ga0070693_1000183633 | 254 |
| 275 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002629 | 254 |
| 276 | 3300005548 | Ga0070665_100003483 | Ga0070665_1000034835 | 254 |
| 277 | 3300005549 | Ga0070704_100141484 | Ga0070704_1001414842 | 254 |
| 278 | 3300005563 | Ga0068855_100030343 | Ga0068855_1000303435 | 254 |
| 279 | 3300005563 | Ga0068855_100170531 | Ga0068855_1001705312 | 254 |
| 280 | 3300005563 | Ga0068855_100707052 | Ga0068855_1007070521 | 254 |
| 281 | 3300005577 | Ga0068857_100004236 | Ga0068857_1000042367 | 254 |
| 282 | 3300005577 | Ga0068857_100054498 | Ga0068857_1000544985 | 254 |
| 283 | 3300005577 | Ga0068857_100067223 | Ga0068857_1000672232 | 254 |
| 284 | 3300005577 | Ga0068857_100092630 | Ga0068857_1000926302 | 254 |
| 285 | 3300005578 | Ga0068854_100148514 | Ga0068854_1001485142 | 254 |
| 286 | 3300005614 | Ga0068856_100015577 | Ga0068856_1000155778 | 254 |
| 287 | 3300005614 | Ga0068856_100025193 | Ga0068856_1000251936 | 254 |
| 288 | 3300005615 | Ga0070702_100016339 | Ga0070702_1000163393 | 254 |
| 289 | 3300005615 | Ga0070702_100288736 | Ga0070702_1002887362 | 254 |
| 290 | 3300005616 | Ga0068852_100002922 | Ga0068852_1000029229 | 254 |
| 291 | 3300005616 | Ga0068852_100011729 | Ga0068852_1000117298 | 254 |
| 292 | 3300005616 | Ga0068852_100647032 | Ga0068852_1006470322 | 254 |
| 293 | 3300005616 | Ga0068852_100826874 | Ga0068852_1008268741 | 254 |
| 294 | 3300005617 | Ga0068859_100000006 | Ga0068859_10000000672 | 254 |
| 295 | 3300005617 | Ga0068859_100000710 | Ga0068859_10000071026 | 254 |
| 296 | 3300005617 | Ga0068859_100029400 | Ga0068859_1000294006 | 254 |
| 297 | 3300005617 | Ga0068859_100033372 | Ga0068859_1000333728 | 254 |
| 298 | 3300005617 | Ga0068859_100039276 | Ga0068859_1000392763 | 254 |
| 299 | 3300005618 | Ga0068864_100000469 | Ga0068864_10000046920 | 254 |
| 300 | 3300005618 | Ga0068864_100004006 | Ga0068864_1000040064 | 254 |
| 301 | 3300005618 | Ga0068864_100025199 | Ga0068864_1000251996 | 254 |
| 302 | 3300005618 | Ga0068864_100070475 | Ga0068864_1000704752 | 254 |
| 303 | 3300005618 | Ga0068864_100078723 | Ga0068864_1000787232 | 254 |
| 304 | 3300005719 | Ga0068861_100004575 | Ga0068861_1000045753 | 254 |
| 305 | 3300005719 | Ga0068861_100032792 | Ga0068861_1000327923 | 254 |
| 306 | 3300005719 | Ga0068861_100040662 | Ga0068861_1000406622 | 254 |
| 307 | 3300005719 | Ga0068861_100058903 | Ga0068861_1000589032 | 254 |
| 308 | 3300005834 | Ga0068851_10006291 | Ga0068851_100062912 | 254 |
| 309 | 3300005834 | Ga0068851_10045235 | Ga0068851_100452352 | 254 |
| 310 | 3300005834 | Ga0068851_10229126 | Ga0068851_102291261 | 254 |
| 311 | 3300005840 | Ga0068870_10049060 | Ga0068870_100490604 | 254 |
| 312 | 3300005840 | Ga0068870_10234124 | Ga0068870_102341241 | 254 |
| 313 | 3300005841 | Ga0068863_100002075 | Ga0068863_10000207518 | 254 |
| 314 | 3300005841 | Ga0068863_100002232 | Ga0068863_1000022329 | 254 |
| 315 | 3300005841 | Ga0068863_100067774 | Ga0068863_1000677743 | 254 |
| 316 | 3300005841 | Ga0068863_100085429 | Ga0068863_1000854292 | 254 |
| 317 | 3300005841 | Ga0068863_100284546 | Ga0068863_1002845462 | 254 |
| 318 | 3300005842 | Ga0068858_100000978 | Ga0068858_10000097829 | 254 |
| 319 | 3300005842 | Ga0068858_100000982 | Ga0068858_10000098212 | 254 |
| 320 | 3300005843 | Ga0068860_100008211 | Ga0068860_1000082114 | 254 |
| 321 | 3300005843 | Ga0068860_100042291 | Ga0068860_1000422915 | 254 |
| 322 | 3300005843 | Ga0068860_100108924 | Ga0068860_1001089242 | 254 |
| 323 | 3300005843 | Ga0068860_100182869 | Ga0068860_1001828692 | 254 |
| 324 | 3300005843 | Ga0068860_100263671 | Ga0068860_1002636712 | 254 |
| 325 | 3300005843 | Ga0068860_100375898 | Ga0068860_1003758982 | 254 |
| 326 | 3300005844 | Ga0068862_100012568 | Ga0068862_1000125689 | 254 |
| 327 | 3300005844 | Ga0068862_100122457 | Ga0068862_1001224572 | 254 |
| 328 | 3300005844 | Ga0068862_100372308 | Ga0068862_1003723082 | 254 |
| 329 | 3300006237 | Ga0097621_100001174 | Ga0097621_10000117412 | 254 |
| 330 | 3300006237 | Ga0097621_100001598 | Ga0097621_1000015983 | 254 |
| 331 | 3300006237 | Ga0097621_100015672 | Ga0097621_1000156724 | 254 |
| 332 | 3300006237 | Ga0097621_100070912 | Ga0097621_1000709122 | 254 |
| 333 | 3300006237 | Ga0097621_100528583 | Ga0097621_1005285831 | 254 |
| 334 | 3300006237 | Ga0097621_100587488 | Ga0097621_1005874881 | 254 |
| 335 | 3300006358 | Ga0068871_100001193 | Ga0068871_1000011933 | 254 |
| 336 | 3300006358 | Ga0068871_100002679 | Ga0068871_1000026796 | 254 |
| 337 | 3300006358 | Ga0068871_100019800 | Ga0068871_1000198002 | 254 |
| 338 | 3300006358 | Ga0068871_100031523 | Ga0068871_1000315234 | 254 |
| 339 | 3300006358 | Ga0068871_100048996 | Ga0068871_1000489961 | 254 |
| 340 | 3300006358 | Ga0068871_100058614 | Ga0068871_1000586142 | 254 |
| 341 | 3300006358 | Ga0068871_100307763 | Ga0068871_1003077632 | 254 |
| 342 | 3300006844 | Ga0075428_100015265 | Ga0075428_1000152651 | 254 |
| 343 | 3300006846 | Ga0075430_100054183 | Ga0075430_1000541832 | 254 |
| 344 | 3300006880 | Ga0075429_100004785 | Ga0075429_1000047852 | 254 |
| 345 | 3300006880 | Ga0075429_100060953 | Ga0075429_1000609533 | 254 |
| 346 | 3300006880 | Ga0075429_100084913 | Ga0075429_1000849133 | 254 |
| 347 | 3300006881 | Ga0068865_100001197 | Ga0068865_1000011978 | 254 |
| 348 | 3300006881 | Ga0068865_100008116 | Ga0068865_1000081165 | 254 |
| 349 | 3300006881 | Ga0068865_100084017 | Ga0068865_1000840172 | 254 |
| 350 | 3300006881 | Ga0068865_100133605 | Ga0068865_1001336053 | 254 |
| 351 | 3300006881 | Ga0068865_100308013 | Ga0068865_1003080131 | 254 |
| 352 | 3300006931 | Ga0097620_100000006 | Ga0097620_10000000672 | 254 |
| 353 | 3300006931 | Ga0097620_100000710 | Ga0097620_10000071026 | 254 |
| 354 | 3300006931 | Ga0097620_100029399 | Ga0097620_1000293993 | 254 |
| 355 | 3300006931 | Ga0097620_100033374 | Ga0097620_1000333748 | 254 |
| 356 | 3300006931 | Ga0097620_100039276 | Ga0097620_1000392763 | 254 |
| 357 | 3300009093 | Ga0105240_10001189 | Ga0105240_100011899 | 254 |
| 358 | 3300009093 | Ga0105240_10003164 | Ga0105240_1000316423 | 254 |
| 359 | 3300009093 | Ga0105240_10016999 | Ga0105240_1001699910 | 254 |
| 360 | 3300009093 | Ga0105240_10060030 | Ga0105240_100600303 | 254 |
| 361 | 3300009094 | Ga0111539_11064710 | Ga0111539_110647101 | 254 |
| 362 | 3300009101 | Ga0105247_10004101 | Ga0105247_100041019 | 254 |
| 363 | 3300009147 | Ga0114129_10294403 | Ga0114129_102944033 | 254 |
| 364 | 3300009148 | Ga0105243_10150831 | Ga0105243_101508312 | 254 |
| 365 | 3300009174 | Ga0105241_10000324 | Ga0105241_1000032420 | 254 |
| 366 | 3300009174 | Ga0105241_10000620 | Ga0105241_1000062018 | 254 |
| 367 | 3300009174 | Ga0105241_10007142 | Ga0105241_100071423 | 254 |
| 368 | 3300009174 | Ga0105241_10052711 | Ga0105241_100527113 | 254 |
| 369 | 3300009174 | Ga0105241_10059451 | Ga0105241_100594515 | 254 |
| 370 | 3300009174 | Ga0105241_10322771 | Ga0105241_103227711 | 254 |
| 371 | 3300009176 | Ga0105242_10005785 | Ga0105242_100057854 | 254 |
| 372 | 3300009176 | Ga0105242_10026804 | Ga0105242_100268047 | 254 |
| 373 | 3300009176 | Ga0105242_10050764 | Ga0105242_100507643 | 254 |
| 374 | 3300009176 | Ga0105242_10061209 | Ga0105242_100612092 | 254 |
| 375 | 3300009176 | Ga0105242_10130639 | Ga0105242_101306392 | 254 |
| 376 | 3300009176 | Ga0105242_10318202 | Ga0105242_103182022 | 254 |
| 377 | 3300009177 | Ga0105248_10016968 | Ga0105248_100169687 | 254 |
| 378 | 3300009177 | Ga0105248_10723808 | Ga0105248_107238082 | 254 |
| 379 | 3300009545 | Ga0105237_10000144 | Ga0105237_1000014417 | 254 |
| 380 | 3300009545 | Ga0105237_10005021 | Ga0105237_100050219 | 254 |
| 381 | 3300009545 | Ga0105237_10005145 | Ga0105237_100051456 | 254 |
| 382 | 3300009545 | Ga0105237_10011015 | Ga0105237_100110157 | 254 |
| 383 | 3300009545 | Ga0105237_10122598 | Ga0105237_101225981 | 254 |
| 384 | 3300009545 | Ga0105237_10136395 | Ga0105237_101363953 | 254 |
| 385 | 3300009551 | Ga0105238_10005010 | Ga0105238_100050104 | 254 |
| 386 | 3300009551 | Ga0105238_10022704 | Ga0105238_100227044 | 254 |
| 387 | 3300009551 | Ga0105238_10296136 | Ga0105238_102961362 | 254 |
| 388 | 3300009553 | Ga0105249_10001056 | Ga0105249_100010566 | 254 |
| 389 | 3300009553 | Ga0105249_10007493 | Ga0105249_1000749310 | 254 |
| 390 | 3300009553 | Ga0105249_10008209 | Ga0105249_100082095 | 254 |
| 391 | 3300009553 | Ga0105249_10016792 | Ga0105249_100167927 | 254 |
| 392 | 3300009553 | Ga0105249_10066289 | Ga0105249_100662891 | 254 |
| 393 | 3300009553 | Ga0105249_10152867 | Ga0105249_101528672 | 254 |
| 394 | 3300009553 | Ga0105249_10224571 | Ga0105249_102245713 | 254 |
| 395 | 3300009553 | Ga0105249_10301172 | Ga0105249_103011722 | 254 |
| 396 | 3300009553 | Ga0105249_10661755 | Ga0105249_106617551 | 254 |
| 397 | 3300009553 | Ga0105249_11294907 | Ga0105249_112949071 | 254 |
| 398 | 3300010375 | Ga0105239_10003890 | Ga0105239_1000389011 | 254 |
| 399 | 3300010375 | Ga0105239_10006793 | Ga0105239_100067934 | 254 |
| 400 | 3300010375 | Ga0105239_10010461 | Ga0105239_100104614 | 254 |
| 401 | 3300010375 | Ga0105239_10035575 | Ga0105239_100355754 | 254 |
| 402 | 3300010375 | Ga0105239_10427981 | Ga0105239_104279812 | 254 |
| 403 | 3300011119 | Ga0105246_10026192 | Ga0105246_100261925 | 254 |
| 404 | 3300011119 | Ga0105246_10342534 | Ga0105246_103425341 | 254 |
| 405 | 3300013102 | Ga0157371_10164428 | Ga0157371_101644282 | 254 |
| 406 | 3300013102 | Ga0157371_10346355 | Ga0157371_103463551 | 254 |
| 407 | 3300013104 | Ga0157370_10000419 | Ga0157370_1000041919 | 254 |
| 408 | 3300013104 | Ga0157370_10006839 | Ga0157370_1000683910 | 254 |
| 409 | 3300013104 | Ga0157370_10012590 | Ga0157370_100125907 | 254 |
| 410 | 3300013104 | Ga0157370_10663800 | Ga0157370_106638001 | 254 |
| 411 | 3300013105 | Ga0157369_10055266 | Ga0157369_100552665 | 254 |
| 412 | 3300013105 | Ga0157369_10140197 | Ga0157369_101401973 | 254 |
| 413 | 3300013296 | Ga0157374_10037158 | Ga0157374_100371587 | 254 |
| 414 | 3300013296 | Ga0157374_10064009 | Ga0157374_100640092 | 254 |
| 415 | 3300013297 | Ga0157378_10002934 | Ga0157378_100029348 | 254 |
| 416 | 3300013297 | Ga0157378_10016682 | Ga0157378_100166827 | 254 |
| 417 | 3300013297 | Ga0157378_10025378 | Ga0157378_100253783 | 254 |
| 418 | 3300013297 | Ga0157378_10038789 | Ga0157378_100387894 | 254 |
| 419 | 3300013297 | Ga0157378_10109920 | Ga0157378_101099202 | 254 |
| 420 | 3300013297 | Ga0157378_10176020 | Ga0157378_101760203 | 254 |
| 421 | 3300013297 | Ga0157378_10385147 | Ga0157378_103851472 | 254 |
| 422 | 3300013306 | Ga0163162_10000112 | Ga0163162_1000011241 | 254 |
| 423 | 3300013306 | Ga0163162_10000253 | Ga0163162_100002536 | 254 |
| 424 | 3300013306 | Ga0163162_10002412 | Ga0163162_100024129 | 254 |
| 425 | 3300013306 | Ga0163162_10002447 | Ga0163162_100024477 | 254 |
| 426 | 3300013306 | Ga0163162_10003028 | Ga0163162_100030285 | 254 |
| 427 | 3300013306 | Ga0163162_10074712 | Ga0163162_100747123 | 254 |
| 428 | 3300013306 | Ga0163162_10137644 | Ga0163162_101376443 | 254 |
| 429 | 3300013306 | Ga0163162_10184710 | Ga0163162_101847102 | 254 |
| 430 | 3300013306 | Ga0163162_10255593 | Ga0163162_102555932 | 254 |
| 431 | 3300013306 | Ga0163162_10492222 | Ga0163162_104922222 | 254 |
| 432 | 3300013306 | Ga0163162_10577749 | Ga0163162_105777492 | 254 |
| 433 | 3300013306 | Ga0163162_10705389 | Ga0163162_107053892 | 254 |
| 434 | 3300013306 | Ga0163162_10729264 | Ga0163162_107292642 | 254 |
| 435 | 3300013307 | Ga0157372_10003686 | Ga0157372_1000368617 | 254 |
| 436 | 3300013307 | Ga0157372_10033278 | Ga0157372_100332782 | 254 |
| 437 | 3300013307 | Ga0157372_10037248 | Ga0157372_100372482 | 254 |
| 438 | 3300013307 | Ga0157372_10089205 | Ga0157372_100892054 | 254 |
| 439 | 3300013307 | Ga0157372_10207209 | Ga0157372_102072092 | 254 |
| 440 | 3300013307 | Ga0157372_10482209 | Ga0157372_104822092 | 254 |
| 441 | 3300013308 | Ga0157375_10002970 | Ga0157375_1000297011 | 254 |
| 442 | 3300013308 | Ga0157375_10032194 | Ga0157375_100321946 | 254 |
| 443 | 3300013308 | Ga0157375_10089080 | Ga0157375_100890802 | 254 |
| 444 | 3300013308 | Ga0157375_10177058 | Ga0157375_101770582 | 254 |
| 445 | 3300013308 | Ga0157375_10373600 | Ga0157375_103736003 | 254 |
| 446 | 3300014325 | Ga0163163_10001606 | Ga0163163_100016069 | 254 |
| 447 | 3300014325 | Ga0163163_10079320 | Ga0163163_100793206 | 254 |
| 448 | 3300014325 | Ga0163163_10317084 | Ga0163163_103170842 | 254 |
| 449 | 3300014325 | Ga0163163_10442936 | Ga0163163_104429362 | 254 |
| 450 | 3300014326 | Ga0157380_10006320 | Ga0157380_100063207 | 254 |
| 451 | 3300014326 | Ga0157380_10015530 | Ga0157380_100155305 | 254 |
| 452 | 3300014326 | Ga0157380_10103530 | Ga0157380_101035302 | 254 |
| 453 | 3300014326 | Ga0157380_10117290 | Ga0157380_101172902 | 254 |
| 454 | 3300014326 | Ga0157380_10210758 | Ga0157380_102107582 | 254 |
| 455 | 3300014326 | Ga0157380_10244889 | Ga0157380_102448892 | 254 |
| 456 | 3300014745 | Ga0157377_10006497 | Ga0157377_100064974 | 254 |
| 457 | 3300014745 | Ga0157377_10012719 | Ga0157377_100127192 | 254 |
| 458 | 3300014745 | Ga0157377_10132954 | Ga0157377_101329542 | 254 |
| 459 | 3300014968 | Ga0157379_10001508 | Ga0157379_1000150811 | 254 |
| 460 | 3300014968 | Ga0157379_10268978 | Ga0157379_102689783 | 254 |
| 461 | 3300014968 | Ga0157379_10677845 | Ga0157379_106778451 | 254 |
| 462 | 3300014969 | Ga0157376_10000583 | Ga0157376_1000058311 | 254 |
| 463 | 3300014969 | Ga0157376_10001570 | Ga0157376_1000157017 | 254 |
| 464 | 3300014969 | Ga0157376_10010576 | Ga0157376_100105764 | 254 |
| 465 | 3300014969 | Ga0157376_10063914 | Ga0157376_100639145 | 254 |
| 466 | 3300014969 | Ga0157376_10104584 | Ga0157376_101045842 | 254 |
| 467 | 3300014969 | Ga0157376_10107570 | Ga0157376_101075703 | 254 |
| 468 | 3300014969 | Ga0157376_10149443 | Ga0157376_101494432 | 254 |
| 469 | 3300014969 | Ga0157376_10234554 | Ga0157376_102345541 | 254 |
| 470 | 3300014969 | Ga0157376_10239273 | Ga0157376_102392732 | 254 |
| 471 | 3300017792 | Ga0163161_10020128 | Ga0163161_100201284 | 254 |
| 472 | 3300017792 | Ga0163161_10023052 | Ga0163161_100230525 | 254 |
| 473 | 3300017792 | Ga0163161_10284885 | Ga0163161_102848852 | 254 |
| 474 | 3300017792 | Ga0163161_10471388 | Ga0163161_104713881 | 254 |
| 475 | 3300025246 | Ga0209646_1001778 | Ga0209646_10017786 | 254 |
| 476 | 3300025271 | Ga0207666_1003197 | Ga0207666_10031972 | 254 |
| 477 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059185 | 254 |
| 478 | 3300025315 | Ga0207697_10032559 | Ga0207697_100325594 | 254 |
| 479 | 3300025321 | Ga0207656_10006221 | Ga0207656_100062213 | 254 |
| 480 | 3300025321 | Ga0207656_10062601 | Ga0207656_100626011 | 254 |
| 481 | 3300025893 | Ga0207682_10155806 | Ga0207682_101558061 | 254 |
| 482 | 3300025901 | Ga0207688_10071862 | Ga0207688_100718622 | 254 |
| 483 | 3300025903 | Ga0207680_10000037 | Ga0207680_100000377 | 254 |
| 484 | 3300025903 | Ga0207680_10005905 | Ga0207680_100059051 | 254 |
| 485 | 3300025903 | Ga0207680_10016302 | Ga0207680_100163023 | 254 |
| 486 | 3300025904 | Ga0207647_10123929 | Ga0207647_101239292 | 254 |
| 487 | 3300025904 | Ga0207647_10317003 | Ga0207647_103170031 | 254 |
| 488 | 3300025907 | Ga0207645_10005743 | Ga0207645_100057435 | 254 |
| 489 | 3300025907 | Ga0207645_10006151 | Ga0207645_100061517 | 254 |
| 490 | 3300025907 | Ga0207645_10038499 | Ga0207645_100384994 | 254 |
| 491 | 3300025907 | Ga0207645_10080239 | Ga0207645_100802391 | 254 |
| 492 | 3300025908 | Ga0207643_10156670 | Ga0207643_101566702 | 254 |
| 493 | 3300025908 | Ga0207643_10236906 | Ga0207643_102369061 | 254 |
| 494 | 3300025909 | Ga0207705_10012389 | Ga0207705_100123895 | 254 |
| 495 | 3300025911 | Ga0207654_10002936 | Ga0207654_100029367 | 254 |
| 496 | 3300025911 | Ga0207654_10007347 | Ga0207654_100073474 | 254 |
| 497 | 3300025911 | Ga0207654_10042681 | Ga0207654_100426812 | 254 |
| 498 | 3300025911 | Ga0207654_10180921 | Ga0207654_101809212 | 254 |
| 499 | 3300025912 | Ga0207707_10000620 | Ga0207707_100006208 | 254 |
| 500 | 3300025913 | Ga0207695_10001122 | Ga0207695_1000112242 | 254 |
| 501 | 3300025913 | Ga0207695_10011093 | Ga0207695_100110938 | 254 |
| 502 | 3300025913 | Ga0207695_10031676 | Ga0207695_100316762 | 254 |
| 503 | 3300025914 | Ga0207671_10000453 | Ga0207671_1000045337 | 254 |
| 504 | 3300025914 | Ga0207671_10001502 | Ga0207671_1000150210 | 254 |
| 505 | 3300025914 | Ga0207671_10001511 | Ga0207671_1000151121 | 254 |
| 506 | 3300025914 | Ga0207671_10011669 | Ga0207671_100116695 | 254 |
| 507 | 3300025914 | Ga0207671_10017185 | Ga0207671_100171852 | 254 |
| 508 | 3300025917 | Ga0207660_10002359 | Ga0207660_100023597 | 254 |
| 509 | 3300025918 | Ga0207662_10007392 | Ga0207662_100073927 | 254 |
| 510 | 3300025918 | Ga0207662_10039148 | Ga0207662_100391481 | 254 |
| 511 | 3300025918 | Ga0207662_10042443 | Ga0207662_100424432 | 254 |
| 512 | 3300025921 | Ga0207652_10003265 | Ga0207652_100032657 | 254 |
| 513 | 3300025922 | Ga0207646_10459911 | Ga0207646_104599111 | 254 |
| 514 | 3300025923 | Ga0207681_10015111 | Ga0207681_100151115 | 254 |
| 515 | 3300025923 | Ga0207681_10045442 | Ga0207681_100454423 | 254 |
| 516 | 3300025923 | Ga0207681_10063095 | Ga0207681_100630951 | 254 |
| 517 | 3300025924 | Ga0207694_10095992 | Ga0207694_100959922 | 254 |
| 518 | 3300025925 | Ga0207650_10020030 | Ga0207650_100200302 | 254 |
| 519 | 3300025925 | Ga0207650_10022410 | Ga0207650_100224102 | 254 |
| 520 | 3300025925 | Ga0207650_10034354 | Ga0207650_100343544 | 254 |
| 521 | 3300025925 | Ga0207650_10095484 | Ga0207650_100954842 | 254 |
| 522 | 3300025926 | Ga0207659_10004571 | Ga0207659_100045712 | 254 |
| 523 | 3300025926 | Ga0207659_10014816 | Ga0207659_100148163 | 254 |
| 524 | 3300025926 | Ga0207659_10034950 | Ga0207659_100349505 | 254 |
| 525 | 3300025926 | Ga0207659_10044057 | Ga0207659_100440571 | 254 |
| 526 | 3300025926 | Ga0207659_10158200 | Ga0207659_101582002 | 254 |
| 527 | 3300025927 | Ga0207687_10052204 | Ga0207687_100522043 | 254 |
| 528 | 3300025931 | Ga0207644_10030894 | Ga0207644_100308944 | 254 |
| 529 | 3300025931 | Ga0207644_10067370 | Ga0207644_100673705 | 254 |
| 530 | 3300025932 | Ga0207690_10003371 | Ga0207690_100033712 | 254 |
| 531 | 3300025933 | Ga0207706_10007446 | Ga0207706_100074464 | 254 |
| 532 | 3300025933 | Ga0207706_10033616 | Ga0207706_100336163 | 254 |
| 533 | 3300025934 | Ga0207686_10000351 | Ga0207686_1000035133 | 254 |
| 534 | 3300025934 | Ga0207686_10013758 | Ga0207686_100137583 | 254 |
| 535 | 3300025934 | Ga0207686_10282594 | Ga0207686_102825942 | 254 |
| 536 | 3300025934 | Ga0207686_10332271 | Ga0207686_103322712 | 254 |
| 537 | 3300025937 | Ga0207669_10167621 | Ga0207669_101676212 | 254 |
| 538 | 3300025937 | Ga0207669_10229995 | Ga0207669_102299951 | 254 |
| 539 | 3300025937 | Ga0207669_10426146 | Ga0207669_104261462 | 254 |
| 540 | 3300025937 | Ga0207669_10480642 | Ga0207669_104806422 | 254 |
| 541 | 3300025938 | Ga0207704_10004767 | Ga0207704_100047673 | 254 |
| 542 | 3300025938 | Ga0207704_10297326 | Ga0207704_102973262 | 254 |
| 543 | 3300025938 | Ga0207704_10407983 | Ga0207704_104079831 | 254 |
| 544 | 3300025940 | Ga0207691_10002638 | Ga0207691_1000263811 | 254 |
| 545 | 3300025940 | Ga0207691_10004182 | Ga0207691_100041825 | 254 |
| 546 | 3300025940 | Ga0207691_10028719 | Ga0207691_100287193 | 254 |
| 547 | 3300025940 | Ga0207691_10082245 | Ga0207691_100822452 | 254 |
| 548 | 3300025940 | Ga0207691_10239007 | Ga0207691_102390072 | 254 |
| 549 | 3300025940 | Ga0207691_10336233 | Ga0207691_103362332 | 254 |
| 550 | 3300025941 | Ga0207711_10110463 | Ga0207711_101104632 | 254 |
| 551 | 3300025942 | Ga0207689_10001492 | Ga0207689_1000149213 | 254 |
| 552 | 3300025942 | Ga0207689_10005311 | Ga0207689_100053115 | 254 |
| 553 | 3300025942 | Ga0207689_10011795 | Ga0207689_100117953 | 254 |
| 554 | 3300025942 | Ga0207689_10018345 | Ga0207689_100183451 | 254 |
| 555 | 3300025942 | Ga0207689_10020602 | Ga0207689_100206025 | 254 |
| 556 | 3300025942 | Ga0207689_10054081 | Ga0207689_100540816 | 254 |
| 557 | 3300025942 | Ga0207689_10508787 | Ga0207689_105087871 | 254 |
| 558 | 3300025945 | Ga0207679_10233984 | Ga0207679_102339841 | 254 |
| 559 | 3300025949 | Ga0207667_10006330 | Ga0207667_100063304 | 254 |
| 560 | 3300025949 | Ga0207667_10029491 | Ga0207667_100294915 | 254 |
| 561 | 3300025949 | Ga0207667_10070639 | Ga0207667_100706394 | 254 |
| 562 | 3300025949 | Ga0207667_10170911 | Ga0207667_101709111 | 254 |
| 563 | 3300025960 | Ga0207651_10003185 | Ga0207651_100031855 | 254 |
| 564 | 3300025960 | Ga0207651_10011676 | Ga0207651_100116762 | 254 |
| 565 | 3300025960 | Ga0207651_10030165 | Ga0207651_100301653 | 254 |
| 566 | 3300025960 | Ga0207651_10033439 | Ga0207651_100334392 | 254 |
| 567 | 3300025960 | Ga0207651_10094061 | Ga0207651_100940614 | 254 |
| 568 | 3300025961 | Ga0207712_10003635 | Ga0207712_100036356 | 254 |
| 569 | 3300025961 | Ga0207712_10005438 | Ga0207712_1000543812 | 254 |
| 570 | 3300025961 | Ga0207712_10010167 | Ga0207712_100101676 | 254 |
| 571 | 3300025961 | Ga0207712_10016429 | Ga0207712_100164292 | 254 |
| 572 | 3300025972 | Ga0207668_10000337 | Ga0207668_1000033725 | 254 |
| 573 | 3300025972 | Ga0207668_10022400 | Ga0207668_100224007 | 254 |
| 574 | 3300025972 | Ga0207668_10183172 | Ga0207668_101831722 | 254 |
| 575 | 3300025972 | Ga0207668_10284016 | Ga0207668_102840162 | 254 |
| 576 | 3300025981 | Ga0207640_10019820 | Ga0207640_100198202 | 254 |
| 577 | 3300025981 | Ga0207640_10065577 | Ga0207640_100655772 | 254 |
| 578 | 3300025986 | Ga0207658_10032567 | Ga0207658_100325672 | 254 |
| 579 | 3300025986 | Ga0207658_10055696 | Ga0207658_100556963 | 254 |
| 580 | 3300026023 | Ga0207677_10003172 | Ga0207677_100031726 | 254 |
| 581 | 3300026023 | Ga0207677_10202498 | Ga0207677_102024981 | 254 |
| 582 | 3300026023 | Ga0207677_10251581 | Ga0207677_102515812 | 254 |
| 583 | 3300026035 | Ga0207703_10012935 | Ga0207703_100129354 | 254 |
| 584 | 3300026035 | Ga0207703_10092614 | Ga0207703_100926142 | 254 |
| 585 | 3300026041 | Ga0207639_10035558 | Ga0207639_100355582 | 254 |
| 586 | 3300026041 | Ga0207639_10044982 | Ga0207639_100449824 | 254 |
| 587 | 3300026041 | Ga0207639_10196336 | Ga0207639_101963361 | 254 |
| 588 | 3300026041 | Ga0207639_10212634 | Ga0207639_102126342 | 254 |
| 589 | 3300026041 | Ga0207639_10294220 | Ga0207639_102942202 | 254 |
| 590 | 3300026041 | Ga0207639_10441118 | Ga0207639_104411182 | 254 |
| 591 | 3300026067 | Ga0207678_10144732 | Ga0207678_101447322 | 254 |
| 592 | 3300026075 | Ga0207708_10049372 | Ga0207708_100493721 | 254 |
| 593 | 3300026075 | Ga0207708_10057831 | Ga0207708_100578313 | 254 |
| 594 | 3300026078 | Ga0207702_10175128 | Ga0207702_101751282 | 254 |
| 595 | 3300026078 | Ga0207702_10267933 | Ga0207702_102679332 | 254 |
| 596 | 3300026088 | Ga0207641_10000058 | Ga0207641_100000589 | 254 |
| 597 | 3300026088 | Ga0207641_10000191 | Ga0207641_1000019155 | 254 |
| 598 | 3300026088 | Ga0207641_10047477 | Ga0207641_100474776 | 254 |
| 599 | 3300026088 | Ga0207641_10087811 | Ga0207641_100878112 | 254 |
| 600 | 3300026088 | Ga0207641_10615024 | Ga0207641_106150242 | 254 |
| 601 | 3300026089 | Ga0207648_10000215 | Ga0207648_1000021517 | 254 |
| 602 | 3300026089 | Ga0207648_10001688 | Ga0207648_100016885 | 254 |
| 603 | 3300026089 | Ga0207648_10031663 | Ga0207648_100316635 | 254 |
| 604 | 3300026089 | Ga0207648_10035766 | Ga0207648_100357665 | 254 |
| 605 | 3300026089 | Ga0207648_10040646 | Ga0207648_100406461 | 254 |
| 606 | 3300026089 | Ga0207648_10050875 | Ga0207648_100508754 | 254 |
| 607 | 3300026089 | Ga0207648_10123566 | Ga0207648_101235662 | 254 |
| 608 | 3300026095 | Ga0207676_10001501 | Ga0207676_100015016 | 254 |
| 609 | 3300026095 | Ga0207676_10002935 | Ga0207676_100029354 | 254 |
| 610 | 3300026095 | Ga0207676_10068839 | Ga0207676_100688391 | 254 |
| 611 | 3300026095 | Ga0207676_10364317 | Ga0207676_103643172 | 254 |
| 612 | 3300026116 | Ga0207674_10008410 | Ga0207674_1000841010 | 254 |
| 613 | 3300026116 | Ga0207674_10008703 | Ga0207674_1000870312 | 254 |
| 614 | 3300026116 | Ga0207674_10011877 | Ga0207674_100118771 | 254 |
| 615 | 3300026116 | Ga0207674_10037214 | Ga0207674_100372145 | 254 |
| 616 | 3300026116 | Ga0207674_10272260 | Ga0207674_102722601 | 254 |
| 617 | 3300026116 | Ga0207674_10484973 | Ga0207674_104849732 | 254 |
| 618 | 3300026118 | Ga0207675_100000153 | Ga0207675_10000015315 | 254 |
| 619 | 3300026118 | Ga0207675_100008612 | Ga0207675_10000861210 | 254 |
| 620 | 3300026118 | Ga0207675_100033909 | Ga0207675_1000339095 | 254 |
| 621 | 3300026118 | Ga0207675_100036980 | Ga0207675_1000369808 | 254 |
| 622 | 3300026118 | Ga0207675_100060380 | Ga0207675_1000603802 | 254 |
| 623 | 3300026118 | Ga0207675_100290291 | Ga0207675_1002902912 | 254 |
| 624 | 3300026121 | Ga0207683_10002748 | Ga0207683_100027488 | 254 |
| 625 | 3300026121 | Ga0207683_10011891 | Ga0207683_1001189110 | 254 |
| 626 | 3300026121 | Ga0207683_10037765 | Ga0207683_100377653 | 254 |
| 627 | 3300026121 | Ga0207683_10679434 | Ga0207683_106794341 | 254 |
| 628 | 3300026121 | Ga0207683_10683869 | Ga0207683_106838691 | 254 |
| 629 | 3300026142 | Ga0207698_10004214 | Ga0207698_100042149 | 254 |
| 630 | 3300026142 | Ga0207698_10005575 | Ga0207698_100055758 | 254 |
| 631 | 3300026142 | Ga0207698_10072982 | Ga0207698_100729821 | 254 |
| 632 | 3300027876 | Ga0209974_10021005 | Ga0209974_100210052 | 254 |
| 633 | 3300027907 | Ga0207428_10100857 | Ga0207428_101008572 | 254 |
| 634 | 3300027907 | Ga0207428_10572975 | Ga0207428_105729751 | 254 |
| 635 | 3300028379 | Ga0268266_10000073 | Ga0268266_10000073194 | 254 |
| 636 | 3300028379 | Ga0268266_10045725 | Ga0268266_100457251 | 254 |
| 637 | 3300028379 | Ga0268266_10209181 | Ga0268266_102091812 | 254 |
| 638 | 3300028380 | Ga0268265_10006773 | Ga0268265_100067738 | 254 |
| 639 | 3300028380 | Ga0268265_10090278 | Ga0268265_100902782 | 254 |
| 640 | 3300028380 | Ga0268265_10102288 | Ga0268265_101022883 | 254 |
| 641 | 3300028381 | Ga0268264_10000063 | Ga0268264_10000063168 | 254 |
| 642 | 3300028381 | Ga0268264_10000726 | Ga0268264_1000072634 | 254 |
| 643 | 3300028381 | Ga0268264_10008612 | Ga0268264_100086123 | 254 |
| 644 | 3300028381 | Ga0268264_10013525 | Ga0268264_100135251 | 254 |
| 645 | 3300028381 | Ga0268264_10016166 | Ga0268264_100161664 | 254 |
| 646 | 3300028381 | Ga0268264_10742149 | Ga0268264_107421491 | 254 |
| 647 | 3300028786 | Ga0307517_10066423 | Ga0307517_100664234 | 254 |
| 648 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012420 | 254 |
| 649 | 3300028794 | Ga0307515_10000059 | Ga0307515_10000059213 | 254 |
| 650 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013203 | 254 |
| 651 | 3300031456 | Ga0307513_10158011 | Ga0307513_101580112 | 254 |
| 652 | 3300031507 | Ga0307509_10052661 | Ga0307509_100526612 | 254 |
| 653 | 3300031730 | Ga0307516_10003216 | Ga0307516_1000321617 | 254 |
| 654 | 3300031852 | Ga0307410_10408929 | Ga0307410_104089292 | 254 |
| 655 | 3300031901 | Ga0307406_10381965 | Ga0307406_103819651 | 254 |
| 656 | 3300032004 | Ga0307414_10043401 | Ga0307414_100434012 | 254 |
| 657 | 3300032004 | Ga0307414_10279656 | Ga0307414_102796562 | 254 |
| 658 | 3300032005 | Ga0307411_10361010 | Ga0307411_103610102 | 254 |
| 659 | 3300033180 | Ga0307510_10000156 | Ga0307510_1000015615 | 254 |
| 660 | 3300035410 | Ga0373924_0120792 | Ga0373924_0120792_25_792 | 254 |
| 661 | 3300035692 | Ga0373935_0260614 | Ga0373935_0260614_212_991 | 254 |
| 662 | 3300036401 | Ga0373937_0643736 | Ga0373937_0643736_169_948 | 254 |
| 663 | 3300037418 | Ga0395900_0113554 | Ga0395900_0113554_1671_2441 | 254 |
| 664 | 3300037471 | Ga0395905_0017279 | Ga0395905_0017279_5464_6240 | 254 |
| 665 | 3300037471 | Ga0395905_0075046 | Ga0395905_0075046_511_1287 | 254 |
| 666 | 3300037471 | Ga0395905_0296906 | Ga0395905_0296906_628_1407 | 254 |
| 667 | 3300037471 | Ga0395905_0565956 | Ga0395905_0565956_208_987 | 254 |
| 668 | 3300037471 | Ga0395905_0615314 | Ga0395905_0615314_33_812 | 254 |
| 669 | 3300039093 | Ga0400489_26798 | Ga0400489_26798_275_1042 | 254 |
| 670 | 3300039093 | Ga0400489_51907 | Ga0400489_51907_3150_3947 | 254 |
| 671 | 3300041486 | Ga0451807_0800094 | Ga0451807_0800094_248_1015 | 254 |
| 672 | 3300041512 | Ga0451853_2563909 | Ga0451853_2563909_4220_4990 | 254 |
| 673 | 3300041512 | Ga0451853_3484866 | Ga0451853_3484866_220_987 | 254 |
| 674 | 3300042435 | Ga0439434_0054191 | Ga0439434_0054191_383_1150 | 254 |
| 675 | 3300044658 | Ga0466972_0000676 | Ga0466972_0000676_12413_13183 | 254 |
| 676 | 3300044673 | Ga0453683_0023888 | Ga0453683_0023888_75_854 | 254 |
| 677 | 3300044712 | Ga0453684_0040298 | Ga0453684_0040298_3905_4684 | 254 |
| 678 | 3300044712 | Ga0453684_0346247 | Ga0453684_0346247_683_1450 | 254 |
| 679 | 3300044712 | Ga0453684_0573803 | Ga0453684_0573803_442_1209 | 254 |
| 680 | 3300044719 | Ga0466971_0024021 | Ga0466971_0024021_1849_2628 | 254 |
| 681 | 3300044735 | Ga0466968_0072352 | Ga0466968_0072352_360_1139 | 254 |
| 682 | 3300044735 | Ga0466968_0230653 | Ga0466968_0230653_17_826 | 254 |
| 683 | 3300044842 | Ga0466957_0001546 | Ga0466957_0001546_886_1656 | 254 |
| 684 | 3300044842 | Ga0466957_0256075 | Ga0466957_0256075_340_1143 | 254 |
| 685 | 3300045049 | Ga0466959_0000488 | Ga0466959_0000488_8389_9168 | 254 |
| 686 | 3300045836 | Ga0466958_0030207 | Ga0466958_0030207_631_1410 | 254 |
| 687 | 3300046460 | Ga0495638_0019512 | Ga0495638_0019512_1272_2051 | 254 |
| 688 | 3300046472 | Ga0495580_0112580 | Ga0495580_0112580_920_1699 | 254 |
| 689 | 3300046499 | Ga0495594_0172213 | Ga0495594_0172213_201_968 | 254 |
| 690 | 3300046507 | Ga0495606_0003961 | Ga0495606_0003961_13239_14018 | 254 |
| 691 | 3300046524 | Ga0495648_0003762 | Ga0495648_0003762_1145_1924 | 254 |
| 692 | 3300046648 | Ga0495611_0000061 | Ga0495611_0000061_54195_54974 | 254 |
| 693 | 3300046660 | Ga0495625_0034276 | Ga0495625_0034276_171_938 | 254 |
| 694 | 3300046660 | Ga0495625_0187500 | Ga0495625_0187500_354_1133 | 254 |
| 695 | 3300046663 | Ga0495635_0324186 | Ga0495635_0324186_164_943 | 254 |
| 696 | 3300047320 | Ga0495672_0035104 | Ga0495672_0035104_1235_2002 | 254 |
| 697 | 3300047320 | Ga0495672_0062090 | Ga0495672_0062090_1067_1843 | 254 |
| 698 | 3300047321 | Ga0495676_0083444 | Ga0495676_0083444_1085_1864 | 254 |
| 699 | 3300047471 | Ga0495684_0039358 | Ga0495684_0039358_2002_2781 | 254 |
| 700 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_473553_474329 | 254 |
| 701 | 3300047472 | Ga0495686_0093581 | Ga0495686_0093581_359_1126 | 254 |
| 702 | 3300047472 | Ga0495686_0152669 | Ga0495686_0152669_258_1025 | 254 |
| 703 | 3300047472 | Ga0495686_0197383 | Ga0495686_0197383_156_920 | 254 |
| 704 | 3300047472 | Ga0495686_0335059 | Ga0495686_0335059_49_816 | 254 |
| 705 | 3300048088 | Ga0495602_0187154 | Ga0495602_0187154_749_1528 | 254 |
| 706 | 3300048904 | Ga0496101_0079607 | Ga0496101_0079607_1170_1937 | 254 |
| 707 | 3300048905 | Ga0496102_0632528 | Ga0496102_0632528_95_862 | 254 |
| 708 | 3300048907 | Ga0496104_0185735 | Ga0496104_0185735_1097_1876 | 254 |
| 709 | 3300048912 | Ga0496109_0035289 | Ga0496109_0035289_1505_2281 | 254 |
| 710 | 3300048917 | Ga0496114_0294857 | Ga0496114_0294857_120_887 | 254 |
| 711 | 3300049568 | Ga0501031_0002263 | Ga0501031_0002263_6545_7405 | 254 |
| 712 | 3300049569 | Ga0501032_0010324 | Ga0501032_0010324_5283_6050 | 254 |
| 713 | 3300049569 | Ga0501032_0114378 | Ga0501032_0114378_199_1059 | 254 |
| 714 | 3300049570 | Ga0501033_0010409 | Ga0501033_0010409_2637_3449 | 254 |
| 715 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_160314_161090 | 254 |
| 716 | 3300049571 | Ga0501034_0026263 | Ga0501034_0026263_2841_3608 | 254 |
| 717 | 3300049571 | Ga0501034_0035864 | Ga0501034_0035864_1081_1848 | 254 |
| 718 | 3300049572 | Ga0501036_0001446 | Ga0501036_0001446_12179_13039 | 254 |
| 719 | 3300049572 | Ga0501036_0022006 | Ga0501036_0022006_4161_4928 | 254 |
| 720 | 3300049573 | Ga0501037_0007204 | Ga0501037_0007204_5456_6316 | 254 |
| 721 | 3300049574 | Ga0501038_0003270 | Ga0501038_0003270_13395_14255 | 254 |
| 722 | 3300049574 | Ga0501038_0015262 | Ga0501038_0015262_5558_6325 | 254 |
| 723 | 3300049575 | Ga0501039_0009680 | Ga0501039_0009680_2791_3651 | 254 |
| 724 | 3300049575 | Ga0501039_0042353 | Ga0501039_0042353_245_1012 | 254 |
| 725 | 3300049579 | Ga0501043_0010690 | Ga0501043_0010690_5752_6519 | 254 |
| 726 | 3300049579 | Ga0501043_0424297 | Ga0501043_0424297_110_877 | 254 |
| 727 | 3300049580 | Ga0501046_0016366 | Ga0501046_0016366_4495_5262 | 254 |
| 728 | 3300049581 | Ga0501047_0009030 | Ga0501047_0009030_3970_4737 | 254 |
| 729 | 3300049581 | Ga0501047_0054326 | Ga0501047_0054326_696_1466 | 254 |
| 730 | 3300049581 | Ga0501047_0568911 | Ga0501047_0568911_13_780 | 254 |
| 731 | 3300049582 | Ga0501048_0023532 | Ga0501048_0023532_2792_3559 | 254 |
| 732 | 3300049583 | Ga0501067_0037603 | Ga0501067_0037603_871_1707 | 254 |
| 733 | 3300049586 | Ga0501070_0006613 | Ga0501070_0006613_7978_8745 | 254 |
| 734 | 3300049586 | Ga0501070_0108613 | Ga0501070_0108613_729_1496 | 254 |
| 735 | 3300049588 | Ga0501072_0138330 | Ga0501072_0138330_633_1469 | 254 |
| 736 | 3300049589 | Ga0501073_0027520 | Ga0501073_0027520_967_1734 | 254 |
| 737 | 3300049589 | Ga0501073_0412582 | Ga0501073_0412582_33_839 | 254 |
| 738 | 3300049590 | Ga0501074_0012286 | Ga0501074_0012286_1278_2045 | 254 |
| 739 | 3300049593 | Ga0501077_0289592 | Ga0501077_0289592_255_1022 | 254 |
| 740 | 3300049663 | Ga0501223_008443 | Ga0501223_008443_208_984 | 254 |
| 741 | 3300049682 | Ga0501252_006347 | Ga0501252_006347_419_1195 | 254 |
| 742 | 3300049742 | Ga0501080_0164554 | Ga0501080_0164554_118_885 | 254 |
| 743 | 3300049744 | Ga0501083_0042934 | Ga0501083_0042934_1259_2026 | 254 |
| 744 | 3300049822 | Ga0501035_0005853 | Ga0501035_0005853_8014_8826 | 254 |
| 745 | 3300049822 | Ga0501035_0039105 | Ga0501035_0039105_2136_2996 | 254 |
| 746 | 3300049823 | Ga0501044_0068107 | Ga0501044_0068107_1492_2259 | 254 |
| 747 | 3300049823 | Ga0501044_0574614 | Ga0501044_0574614_191_967 | 254 |
| 748 | 3300049824 | Ga0501045_0057147 | Ga0501045_0057147_1451_2218 | 254 |
| 749 | 3300050493 | nmdc:mga0k408_52941_c1 | nmdc:mga0k408_52941_c1_1508_2278 | 254 |
| 750 | 3300050507 | nmdc:mga05p37_286222_c1 | nmdc:mga05p37_286222_c1_799_1566 | 254 |
| 751 | 3300050508 | nmdc:mga09592_5311_c1 | nmdc:mga09592_5311_c1_8950_9717 | 254 |
| 752 | 3300050508 | nmdc:mga09592_674267_c1 | nmdc:mga09592_674267_c1_98_865 | 254 |
| 753 | 3300050508 | nmdc:mga09592_85887_c1 | nmdc:mga09592_85887_c1_1118_1885 | 254 |
| 754 | 3300050508 | nmdc:mga09592_92423_c1 | nmdc:mga09592_92423_c1_1236_2003 | 254 |
| 755 | 3300050509 | nmdc:mga0qj67_134949_c1 | nmdc:mga0qj67_134949_c1_344_1111 | 254 |
| 756 | 3300050510 | nmdc:mga06r32_36625_c1 | nmdc:mga06r32_36625_c1_2452_3219 | 254 |
| 757 | 3300050511 | nmdc:mga08y16_62717_c1 | nmdc:mga08y16_62717_c1_1076_1843 | 254 |
| 758 | 3300050511 | nmdc:mga08y16_967371_c1 | nmdc:mga08y16_967371_c1_30_809 | 254 |
| 759 | 3300053086 | Ga0500578_0001568 | Ga0500578_0001568_19330_20100 | 254 |
| 760 | 3300053088 | Ga0500644_0079193 | Ga0500644_0079193_216_995 | 254 |
| 761 | 3300053090 | Ga0500646_0000772 | Ga0500646_0000772_3380_4147 | 254 |
| 762 | 3300053090 | Ga0500646_0011068 | Ga0500646_0011068_599_1378 | 254 |
| 763 | 3300053090 | Ga0500646_0013394 | Ga0500646_0013394_80_847 | 254 |
| 764 | 3300053092 | Ga0500583_0004003 | Ga0500583_0004003_241_1020 | 254 |
| 765 | 3300053098 | Ga0500650_0013159 | Ga0500650_0013159_2561_3328 | 254 |
| 766 | 3300053104 | Ga0500556_0065227 | Ga0500556_0065227_479_1246 | 254 |
| 767 | 3300053130 | Ga0500642_0015283 | Ga0500642_0015283_1184_1963 | 254 |
| 768 | 3300053139 | Ga0500568_0010529 | Ga0500568_0010529_1001_1780 | 254 |
| 769 | 3300053146 | Ga0500588_0059628 | Ga0500588_0059628_326_1093 | 254 |
| 770 | 3300054114 | Ga0501084_0014521 | Ga0501084_0014521_2203_3039 | 254 |
| 771 | 3300060353 | Ga0501082_0046092 | Ga0501082_0046092_74_850 | 254 |
| 772 | 3300060353 | Ga0501082_0212638 | Ga0501082_0212638_349_1116 | 254 |
| 773 | 3300061719 | Ga0466962_0007910 | Ga0466962_0007910_733_1512 | 254 |
| 774 | 2162886007 | SwRhRL2b_contig_650288 | SwRhRL2b_0742.00006910 | 255 |
| 775 | 3300001979 | JGI24740J21852_10035509 | JGI24740J21852_100355091 | 255 |
| 776 | 3300001990 | JGI24737J22298_10000851 | JGI24737J22298_100008512 | 255 |
| 777 | 3300001990 | JGI24737J22298_10005505 | JGI24737J22298_100055052 | 255 |
| 778 | 3300002067 | JGI24735J21928_10000093 | JGI24735J21928_1000009318 | 255 |
| 779 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008354 | 255 |
| 780 | 3300002737 | JGI25162J39368_1000097 | JGI25162J39368_10000979 | 255 |
| 781 | 3300002737 | JGI25162J39368_1003452 | JGI25162J39368_10034522 | 255 |
| 782 | 3300002741 | JGI25157J39369_1006945 | JGI25157J39369_10069452 | 255 |
| 783 | 3300002772 | JGI25164J39214_1002202 | JGI25164J39214_10022025 | 255 |
| 784 | 3300002773 | JGI25152J39213_1000044 | JGI25152J39213_100004424 | 255 |
| 785 | 3300002774 | JGI25150J39212_1000006 | JGI25150J39212_100000658 | 255 |
| 786 | 3300003187 | JGI25151J46595_10000024 | JGI25151J46595_10000024131 | 255 |
| 787 | 3300003214 | JGI25165J46597_1000891 | JGI25165J46597_100089117 | 255 |
| 788 | 3300003215 | JGI25153J46596_10000026 | JGI25153J46596_1000002659 | 255 |
| 789 | 3300003320 | rootH2_10007960 | rootH2_100079605 | 255 |
| 790 | 3300003320 | rootH2_10061124 | rootH2_100611243 | 255 |
| 791 | 3300003320 | rootH2_10184756 | rootH2_101847565 | 255 |
| 792 | 3300003322 | rootL2_10240312 | rootL2_102403124 | 255 |
| 793 | 3300003323 | rootH1_10035781 | rootH1_100357812 | 255 |
| 794 | 3300003323 | rootH1_10050923 | rootH1_100509235 | 255 |
| 795 | 3300003323 | rootH1_10088396 | rootH1_100883967 | 255 |
| 796 | 3300003323 | rootH1_10131059 | rootH1_101310593 | 255 |
| 797 | 3300003323 | rootH1_10240758 | rootH1_102407582 | 255 |
| 798 | 3300003781 | Ga0055536_1000002 | Ga0055536_1000002139 | 255 |
| 799 | 3300005288 | Ga0065714_10005450 | Ga0065714_100054505 | 255 |
| 800 | 3300005288 | Ga0065714_10064557 | Ga0065714_1006455710 | 255 |
| 801 | 3300005288 | Ga0065714_10067802 | Ga0065714_100678025 | 255 |
| 802 | 3300005288 | Ga0065714_10069902 | Ga0065714_100699023 | 255 |
| 803 | 3300005289 | Ga0065704_10219819 | Ga0065704_102198191 | 255 |
| 804 | 3300005327 | Ga0070658_10000113 | Ga0070658_1000011357 | 255 |
| 805 | 3300005327 | Ga0070658_10757163 | Ga0070658_107571631 | 255 |
| 806 | 3300005328 | Ga0070676_10000205 | Ga0070676_1000020527 | 255 |
| 807 | 3300005329 | Ga0070683_100036133 | Ga0070683_1000361333 | 255 |
| 808 | 3300005338 | Ga0068868_100007394 | Ga0068868_1000073942 | 255 |
| 809 | 3300005339 | Ga0070660_100064037 | Ga0070660_1000640372 | 255 |
| 810 | 3300005339 | Ga0070660_100226946 | Ga0070660_1002269462 | 255 |
| 811 | 3300005355 | Ga0070671_100095808 | Ga0070671_1000958084 | 255 |
| 812 | 3300005366 | Ga0070659_100000199 | Ga0070659_10000019944 | 255 |
| 813 | 3300005366 | Ga0070659_100005494 | Ga0070659_1000054943 | 255 |
| 814 | 3300005366 | Ga0070659_100036212 | Ga0070659_1000362125 | 255 |
| 815 | 3300005455 | Ga0070663_100005053 | Ga0070663_1000050535 | 255 |
| 816 | 3300005456 | Ga0070678_100011513 | Ga0070678_1000115136 | 255 |
| 817 | 3300005457 | Ga0070662_100000772 | Ga0070662_1000007725 | 255 |
| 818 | 3300005458 | Ga0070681_10108996 | Ga0070681_101089963 | 255 |
| 819 | 3300005459 | Ga0068867_100000809 | Ga0068867_10000080922 | 255 |
| 820 | 3300005530 | Ga0070679_100013537 | Ga0070679_1000135372 | 255 |
| 821 | 3300005539 | Ga0068853_100024008 | Ga0068853_1000240084 | 255 |
| 822 | 3300005539 | Ga0068853_100089658 | Ga0068853_1000896584 | 255 |
| 823 | 3300005539 | Ga0068853_100248421 | Ga0068853_1002484213 | 255 |
| 824 | 3300005539 | Ga0068853_100374623 | Ga0068853_1003746232 | 255 |
| 825 | 3300005539 | Ga0068853_100578860 | Ga0068853_1005788601 | 255 |
| 826 | 3300005543 | Ga0070672_100157644 | Ga0070672_1001576442 | 255 |
| 827 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017261 | 255 |
| 828 | 3300005563 | Ga0068855_100000074 | Ga0068855_10000007480 | 255 |
| 829 | 3300005563 | Ga0068855_100000958 | Ga0068855_1000009588 | 255 |
| 830 | 3300005563 | Ga0068855_100093980 | Ga0068855_1000939802 | 255 |
| 831 | 3300005563 | Ga0068855_100304027 | Ga0068855_1003040272 | 255 |
| 832 | 3300005563 | Ga0068855_100396803 | Ga0068855_1003968032 | 255 |
| 833 | 3300005614 | Ga0068856_100000040 | Ga0068856_10000004058 | 255 |
| 834 | 3300005614 | Ga0068856_100017756 | Ga0068856_1000177562 | 255 |
| 835 | 3300005614 | Ga0068856_100032371 | Ga0068856_1000323712 | 255 |
| 836 | 3300005614 | Ga0068856_100321567 | Ga0068856_1003215671 | 255 |
| 837 | 3300005614 | Ga0068856_100792708 | Ga0068856_1007927081 | 255 |
| 838 | 3300005616 | Ga0068852_100000720 | Ga0068852_10000072019 | 255 |
| 839 | 3300005616 | Ga0068852_100234714 | Ga0068852_1002347141 | 255 |
| 840 | 3300006195 | Ga0075366_10000435 | Ga0075366_1000043510 | 255 |
| 841 | 3300006195 | Ga0075366_10000779 | Ga0075366_1000077910 | 255 |
| 842 | 3300006195 | Ga0075366_10002507 | Ga0075366_100025077 | 255 |
| 843 | 3300006195 | Ga0075366_10348083 | Ga0075366_103480831 | 255 |
| 844 | 3300006237 | Ga0097621_100000285 | Ga0097621_10000028523 | 255 |
| 845 | 3300006358 | Ga0068871_100000080 | Ga0068871_10000008034 | 255 |
| 846 | 3300006881 | Ga0068865_100000218 | Ga0068865_10000021811 | 255 |
| 847 | 3300009036 | Ga0105244_10025480 | Ga0105244_100254805 | 255 |
| 848 | 3300009093 | Ga0105240_10000083 | Ga0105240_10000083119 | 255 |
| 849 | 3300009093 | Ga0105240_10003566 | Ga0105240_100035667 | 255 |
| 850 | 3300009093 | Ga0105240_10036054 | Ga0105240_100360545 | 255 |
| 851 | 3300009093 | Ga0105240_10102820 | Ga0105240_101028203 | 255 |
| 852 | 3300009093 | Ga0105240_10332692 | Ga0105240_103326922 | 255 |
| 853 | 3300009093 | Ga0105240_10652633 | Ga0105240_106526332 | 255 |
| 854 | 3300009148 | Ga0105243_10000003 | Ga0105243_10000003264 | 255 |
| 855 | 3300009174 | Ga0105241_10005957 | Ga0105241_100059571 | 255 |
| 856 | 3300009174 | Ga0105241_10008209 | Ga0105241_100082095 | 255 |
| 857 | 3300009174 | Ga0105241_10011880 | Ga0105241_100118808 | 255 |
| 858 | 3300009174 | Ga0105241_10031123 | Ga0105241_100311234 | 255 |
| 859 | 3300009176 | Ga0105242_10031334 | Ga0105242_100313342 | 255 |
| 860 | 3300009545 | Ga0105237_10000138 | Ga0105237_100001385 | 255 |
| 861 | 3300009545 | Ga0105237_10001681 | Ga0105237_100016817 | 255 |
| 862 | 3300009545 | Ga0105237_10003760 | Ga0105237_1000376010 | 255 |
| 863 | 3300009545 | Ga0105237_10020681 | Ga0105237_100206818 | 255 |
| 864 | 3300009545 | Ga0105237_10024357 | Ga0105237_100243572 | 255 |
| 865 | 3300009545 | Ga0105237_10076228 | Ga0105237_100762284 | 255 |
| 866 | 3300009545 | Ga0105237_10287549 | Ga0105237_102875492 | 255 |
| 867 | 3300009545 | Ga0105237_10451876 | Ga0105237_104518761 | 255 |
| 868 | 3300009545 | Ga0105237_10526682 | Ga0105237_105266821 | 255 |
| 869 | 3300009551 | Ga0105238_10020232 | Ga0105238_100202322 | 255 |
| 870 | 3300009551 | Ga0105238_10116189 | Ga0105238_101161893 | 255 |
| 871 | 3300009551 | Ga0105238_10486506 | Ga0105238_104865062 | 255 |
| 872 | 3300010375 | Ga0105239_10000026 | Ga0105239_10000026153 | 255 |
| 873 | 3300010375 | Ga0105239_10000392 | Ga0105239_1000039218 | 255 |
| 874 | 3300010375 | Ga0105239_10002143 | Ga0105239_100021439 | 255 |
| 875 | 3300010375 | Ga0105239_10006488 | Ga0105239_1000648814 | 255 |
| 876 | 3300010375 | Ga0105239_10008812 | Ga0105239_100088125 | 255 |
| 877 | 3300010375 | Ga0105239_10017011 | Ga0105239_100170113 | 255 |
| 878 | 3300013100 | Ga0157373_10001288 | Ga0157373_1000128815 | 255 |
| 879 | 3300013100 | Ga0157373_10018692 | Ga0157373_100186926 | 255 |
| 880 | 3300013100 | Ga0157373_10064052 | Ga0157373_100640522 | 255 |
| 881 | 3300013100 | Ga0157373_10144870 | Ga0157373_101448702 | 255 |
| 882 | 3300013102 | Ga0157371_10000286 | Ga0157371_1000028617 | 255 |
| 883 | 3300013102 | Ga0157371_10000748 | Ga0157371_1000074820 | 255 |
| 884 | 3300013102 | Ga0157371_10002211 | Ga0157371_100022113 | 255 |
| 885 | 3300013102 | Ga0157371_10011893 | Ga0157371_100118935 | 255 |
| 886 | 3300013102 | Ga0157371_10104223 | Ga0157371_101042232 | 255 |
| 887 | 3300013104 | Ga0157370_10002658 | Ga0157370_1000265818 | 255 |
| 888 | 3300013104 | Ga0157370_10007099 | Ga0157370_1000709912 | 255 |
| 889 | 3300013104 | Ga0157370_10022935 | Ga0157370_100229352 | 255 |
| 890 | 3300013104 | Ga0157370_10027084 | Ga0157370_100270842 | 255 |
| 891 | 3300013104 | Ga0157370_10044025 | Ga0157370_100440252 | 255 |
| 892 | 3300013104 | Ga0157370_10053904 | Ga0157370_100539043 | 255 |
| 893 | 3300013104 | Ga0157370_10081166 | Ga0157370_100811663 | 255 |
| 894 | 3300013104 | Ga0157370_10297224 | Ga0157370_102972242 | 255 |
| 895 | 3300013104 | Ga0157370_10540126 | Ga0157370_105401261 | 255 |
| 896 | 3300013105 | Ga0157369_10000301 | Ga0157369_1000030115 | 255 |
| 897 | 3300013105 | Ga0157369_10184926 | Ga0157369_101849262 | 255 |
| 898 | 3300013105 | Ga0157369_10191609 | Ga0157369_101916094 | 255 |
| 899 | 3300013296 | Ga0157374_10000180 | Ga0157374_100001803 | 255 |
| 900 | 3300013296 | Ga0157374_10001208 | Ga0157374_1000120819 | 255 |
| 901 | 3300013296 | Ga0157374_10001936 | Ga0157374_1000193610 | 255 |
| 902 | 3300013296 | Ga0157374_10919633 | Ga0157374_109196331 | 255 |
| 903 | 3300013297 | Ga0157378_10421939 | Ga0157378_104219392 | 255 |
| 904 | 3300013306 | Ga0163162_10000011 | Ga0163162_10000011147 | 255 |
| 905 | 3300013306 | Ga0163162_10000051 | Ga0163162_1000005130 | 255 |
| 906 | 3300013306 | Ga0163162_10008696 | Ga0163162_100086968 | 255 |
| 907 | 3300013306 | Ga0163162_10073125 | Ga0163162_100731253 | 255 |
| 908 | 3300013306 | Ga0163162_10240591 | Ga0163162_102405912 | 255 |
| 909 | 3300013307 | Ga0157372_10000037 | Ga0157372_10000037133 | 255 |
| 910 | 3300013307 | Ga0157372_10009703 | Ga0157372_100097033 | 255 |
| 911 | 3300013307 | Ga0157372_10013991 | Ga0157372_100139912 | 255 |
| 912 | 3300013307 | Ga0157372_10118957 | Ga0157372_101189575 | 255 |
| 913 | 3300013307 | Ga0157372_10239976 | Ga0157372_102399762 | 255 |
| 914 | 3300013308 | Ga0157375_10017528 | Ga0157375_100175286 | 255 |
| 915 | 3300013308 | Ga0157375_10076232 | Ga0157375_100762325 | 255 |
| 916 | 3300013308 | Ga0157375_10222544 | Ga0157375_102225444 | 255 |
| 917 | 3300014497 | Ga0182008_10000059 | Ga0182008_1000005981 | 255 |
| 918 | 3300014745 | Ga0157377_10015027 | Ga0157377_100150273 | 255 |
| 919 | 3300015261 | Ga0182006_1000156 | Ga0182006_100015621 | 255 |
| 920 | 3300015261 | Ga0182006_1000482 | Ga0182006_100048230 | 255 |
| 921 | 3300015262 | Ga0182007_10000008 | Ga0182007_10000008144 | 255 |
| 922 | 3300015682 | Ga0183373_1002 | Ga0183373_1002413 | 255 |
| 923 | 3300017792 | Ga0163161_10000305 | Ga0163161_1000030520 | 255 |
| 924 | 3300017792 | Ga0163161_10000502 | Ga0163161_1000050213 | 255 |
| 925 | 3300017792 | Ga0163161_10005925 | Ga0163161_100059255 | 255 |
| 926 | 3300017792 | Ga0163161_10043127 | Ga0163161_100431272 | 255 |
| 927 | 3300025231 | Ga0207427_100071 | Ga0207427_10007185 | 255 |
| 928 | 3300025233 | Ga0209437_100021 | Ga0209437_100021175 | 255 |
| 929 | 3300025233 | Ga0209437_100030 | Ga0209437_10003091 | 255 |
| 930 | 3300025245 | Ga0207425_1000003 | Ga0207425_100000358 | 255 |
| 931 | 3300025250 | Ga0209026_1000325 | Ga0209026_100032512 | 255 |
| 932 | 3300025250 | Ga0209026_1001703 | Ga0209026_10017032 | 255 |
| 933 | 3300025250 | Ga0209026_1003864 | Ga0209026_10038642 | 255 |
| 934 | 3300025258 | Ga0209129_1000022 | Ga0209129_100002258 | 255 |
| 935 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035463 | 255 |
| 936 | 3300025261 | Ga0209233_1002101 | Ga0209233_10021016 | 255 |
| 937 | 3300025272 | Ga0209455_1003029 | Ga0209455_10030294 | 255 |
| 938 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022401 | 255 |
| 939 | 3300025294 | Ga0209025_1000007 | Ga0209025_100000757 | 255 |
| 940 | 3300025297 | Ga0209758_1000012 | Ga0209758_100001258 | 255 |
| 941 | 3300025298 | Ga0209050_1000020 | Ga0209050_1000020138 | 255 |
| 942 | 3300025899 | Ga0207642_10043526 | Ga0207642_100435262 | 255 |
| 943 | 3300025904 | Ga0207647_10000453 | Ga0207647_100004535 | 255 |
| 944 | 3300025904 | Ga0207647_10000687 | Ga0207647_1000068716 | 255 |
| 945 | 3300025904 | Ga0207647_10060271 | Ga0207647_100602711 | 255 |
| 946 | 3300025907 | Ga0207645_10000398 | Ga0207645_1000039820 | 255 |
| 947 | 3300025909 | Ga0207705_10000160 | Ga0207705_1000016019 | 255 |
| 948 | 3300025911 | Ga0207654_10003611 | Ga0207654_100036115 | 255 |
| 949 | 3300025911 | Ga0207654_10004664 | Ga0207654_100046645 | 255 |
| 950 | 3300025911 | Ga0207654_10074444 | Ga0207654_100744442 | 255 |
| 951 | 3300025911 | Ga0207654_10128702 | Ga0207654_101287023 | 255 |
| 952 | 3300025912 | Ga0207707_10063196 | Ga0207707_100631962 | 255 |
| 953 | 3300025913 | Ga0207695_10000127 | Ga0207695_10000127118 | 255 |
| 954 | 3300025913 | Ga0207695_10012480 | Ga0207695_1001248011 | 255 |
| 955 | 3300025913 | Ga0207695_10030736 | Ga0207695_100307365 | 255 |
| 956 | 3300025913 | Ga0207695_10194858 | Ga0207695_101948581 | 255 |
| 957 | 3300025913 | Ga0207695_10258714 | Ga0207695_102587142 | 255 |
| 958 | 3300025914 | Ga0207671_10001040 | Ga0207671_1000104025 | 255 |
| 959 | 3300025914 | Ga0207671_10003253 | Ga0207671_100032537 | 255 |
| 960 | 3300025914 | Ga0207671_10003548 | Ga0207671_100035488 | 255 |
| 961 | 3300025914 | Ga0207671_10012109 | Ga0207671_100121097 | 255 |
| 962 | 3300025914 | Ga0207671_10142456 | Ga0207671_101424562 | 255 |
| 963 | 3300025914 | Ga0207671_10156194 | Ga0207671_101561941 | 255 |
| 964 | 3300025914 | Ga0207671_10335022 | Ga0207671_103350221 | 255 |
| 965 | 3300025919 | Ga0207657_10026795 | Ga0207657_100267953 | 255 |
| 966 | 3300025919 | Ga0207657_10214952 | Ga0207657_102149522 | 255 |
| 967 | 3300025924 | Ga0207694_10165901 | Ga0207694_101659013 | 255 |
| 968 | 3300025931 | Ga0207644_10159093 | Ga0207644_101590931 | 255 |
| 969 | 3300025932 | Ga0207690_10003707 | Ga0207690_100037071 | 255 |
| 970 | 3300025932 | Ga0207690_10057474 | Ga0207690_100574742 | 255 |
| 971 | 3300025932 | Ga0207690_10321768 | Ga0207690_103217681 | 255 |
| 972 | 3300025933 | Ga0207706_10001940 | Ga0207706_100019405 | 255 |
| 973 | 3300025934 | Ga0207686_10012335 | Ga0207686_100123355 | 255 |
| 974 | 3300025935 | Ga0207709_10000008 | Ga0207709_10000008310 | 255 |
| 975 | 3300025938 | Ga0207704_10000065 | Ga0207704_1000006518 | 255 |
| 976 | 3300025940 | Ga0207691_10163024 | Ga0207691_101630243 | 255 |
| 977 | 3300025949 | Ga0207667_10000014 | Ga0207667_1000001428 | 255 |
| 978 | 3300025949 | Ga0207667_10008556 | Ga0207667_100085565 | 255 |
| 979 | 3300025949 | Ga0207667_10367336 | Ga0207667_103673362 | 255 |
| 980 | 3300025949 | Ga0207667_10717871 | Ga0207667_107178711 | 255 |
| 981 | 3300025981 | Ga0207640_10031441 | Ga0207640_100314411 | 255 |
| 982 | 3300026041 | Ga0207639_10006123 | Ga0207639_100061238 | 255 |
| 983 | 3300026041 | Ga0207639_10030028 | Ga0207639_100300285 | 255 |
| 984 | 3300026041 | Ga0207639_10241198 | Ga0207639_102411983 | 255 |
| 985 | 3300026041 | Ga0207639_10369581 | Ga0207639_103695812 | 255 |
| 986 | 3300026041 | Ga0207639_10675531 | Ga0207639_106755311 | 255 |
| 987 | 3300026067 | Ga0207678_10012592 | Ga0207678_100125925 | 255 |
| 988 | 3300026078 | Ga0207702_10000042 | Ga0207702_1000004231 | 255 |
| 989 | 3300026078 | Ga0207702_10121103 | Ga0207702_101211033 | 255 |
| 990 | 3300026078 | Ga0207702_10180036 | Ga0207702_101800362 | 255 |
| 991 | 3300026078 | Ga0207702_10276991 | Ga0207702_102769911 | 255 |
| 992 | 3300026078 | Ga0207702_10577303 | Ga0207702_105773031 | 255 |
| 993 | 3300026089 | Ga0207648_10000886 | Ga0207648_100008862 | 255 |
| 994 | 3300026121 | Ga0207683_10079670 | Ga0207683_100796703 | 255 |
| 995 | 3300026142 | Ga0207698_10946465 | Ga0207698_109464651 | 255 |
| 996 | 3300028379 | Ga0268266_10000037 | Ga0268266_1000003757 | 255 |
| 997 | 3300028786 | Ga0307517_10000212 | Ga0307517_1000021280 | 255 |
| 998 | 3300028794 | Ga0307515_10000224 | Ga0307515_1000022462 | 255 |
| 999 | 3300028794 | Ga0307515_10000318 | Ga0307515_1000031820 | 255 |
| 1000 | 3300028794 | Ga0307515_10019542 | Ga0307515_100195429 | 255 |
| 1001 | 3300028794 | Ga0307515_10096065 | Ga0307515_100960653 | 255 |
| 1002 | 3300028800 | Ga0265338_10188569 | Ga0265338_101885692 | 255 |
| 1003 | 3300028800 | Ga0265338_10323807 | Ga0265338_103238072 | 255 |
| 1004 | 3300030731 | Ga0316177_1017133 | Ga0316177_10171333 | 255 |
| 1005 | 3300030732 | Ga0316176_1014596 | Ga0316176_101459613 | 255 |
| 1006 | 3300030742 | Ga0316183_1003890 | Ga0316183_10038904 | 255 |
| 1007 | 3300030745 | Ga0316182_1151228 | Ga0316182_11512284 | 255 |
| 1008 | 3300031507 | Ga0307509_10116179 | Ga0307509_101161793 | 255 |
| 1009 | 3300031548 | Ga0307408_100000209 | Ga0307408_10000020944 | 255 |
| 1010 | 3300031548 | Ga0307408_100000487 | Ga0307408_1000004875 | 255 |
| 1011 | 3300031731 | Ga0307405_10000341 | Ga0307405_1000034111 | 255 |
| 1012 | 3300031903 | Ga0307407_10000002 | Ga0307407_10000002117 | 255 |
| 1013 | 3300031911 | Ga0307412_10000724 | Ga0307412_100007242 | 255 |
| 1014 | 3300031995 | Ga0307409_100090130 | Ga0307409_1000901302 | 255 |
| 1015 | 3300032002 | Ga0307416_100000005 | Ga0307416_100000005117 | 255 |
| 1016 | 3300032004 | Ga0307414_10000655 | Ga0307414_100006555 | 255 |
| 1017 | 3300032004 | Ga0307414_10056253 | Ga0307414_100562532 | 255 |
| 1018 | 3300032004 | Ga0307414_10187346 | Ga0307414_101873462 | 255 |
| 1019 | 3300032004 | Ga0307414_10281211 | Ga0307414_102812112 | 255 |
| 1020 | 3300033179 | Ga0307507_10000111 | Ga0307507_1000011160 | 255 |
| 1021 | 3300033180 | Ga0307510_10000249 | Ga0307510_1000024949 | 255 |
| 1022 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_331404_332174 | 255 |
| 1023 | 3300037312 | Ga0395899_0000280 | Ga0395899_0000280_48807_49574 | 255 |
| 1024 | 3300037312 | Ga0395899_0016189 | Ga0395899_0016189_1969_2742 | 255 |
| 1025 | 3300037312 | Ga0395899_0016320 | Ga0395899_0016320_4568_5392 | 255 |
| 1026 | 3300037312 | Ga0395899_0204332 | Ga0395899_0204332_200_976 | 255 |
| 1027 | 3300037418 | Ga0395900_0000204 | Ga0395900_0000204_9806_10582 | 255 |
| 1028 | 3300037418 | Ga0395900_0006199 | Ga0395900_0006199_879_1652 | 255 |
| 1029 | 3300037418 | Ga0395900_0066255 | Ga0395900_0066255_894_1718 | 255 |
| 1030 | 3300037466 | Ga0395898_0058793 | Ga0395898_0058793_664_1437 | 255 |
| 1031 | 3300037471 | Ga0395905_0000327 | Ga0395905_0000327_58791_59564 | 255 |
| 1032 | 3300037471 | Ga0395905_0606915 | Ga0395905_0606915_40_807 | 255 |
| 1033 | 3300038443 | Ga0395901_0000895 | Ga0395901_0000895_17846_18619 | 255 |
| 1034 | 3300038443 | Ga0395901_0075824 | Ga0395901_0075824_2036_2803 | 255 |
| 1035 | 3300041486 | Ga0451807_0937824 | Ga0451807_0937824_223_990 | 255 |
| 1036 | 3300041498 | Ga0451841_1340210 | Ga0451841_1340210_125_892 | 255 |
| 1037 | 3300044656 | Ga0466969_0059284 | Ga0466969_0059284_439_1206 | 255 |
| 1038 | 3300044693 | Ga0466961_0015564 | Ga0466961_0015564_3431_4198 | 255 |
| 1039 | 3300045049 | Ga0466959_0168455 | Ga0466959_0168455_262_1029 | 255 |
| 1040 | 3300046462 | Ga0495651_0155366 | Ga0495651_0155366_631_1398 | 255 |
| 1041 | 3300046471 | Ga0495650_0000268 | Ga0495650_0000268_19416_20183 | 255 |
| 1042 | 3300046471 | Ga0495650_0033044 | Ga0495650_0033044_1148_1930 | 255 |
| 1043 | 3300046492 | Ga0495585_0000034 | Ga0495585_0000034_91023_91790 | 255 |
| 1044 | 3300046492 | Ga0495585_0000785 | Ga0495585_0000785_1911_2678 | 255 |
| 1045 | 3300046500 | Ga0495596_0017038 | Ga0495596_0017038_45_812 | 255 |
| 1046 | 3300046506 | Ga0495583_0025110 | Ga0495583_0025110_441_1208 | 255 |
| 1047 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_8788_9555 | 255 |
| 1048 | 3300046507 | Ga0495606_0003806 | Ga0495606_0003806_3228_4001 | 255 |
| 1049 | 3300046507 | Ga0495606_0026886 | Ga0495606_0026886_1599_2366 | 255 |
| 1050 | 3300046507 | Ga0495606_0028027 | Ga0495606_0028027_2518_3285 | 255 |
| 1051 | 3300046507 | Ga0495606_0031240 | Ga0495606_0031240_1643_2410 | 255 |
| 1052 | 3300046507 | Ga0495606_0144048 | Ga0495606_0144048_259_1026 | 255 |
| 1053 | 3300046512 | Ga0495610_0000084 | Ga0495610_0000084_15968_16735 | 255 |
| 1054 | 3300046512 | Ga0495610_0001784 | Ga0495610_0001784_7655_8422 | 255 |
| 1055 | 3300046512 | Ga0495610_0058527 | Ga0495610_0058527_722_1489 | 255 |
| 1056 | 3300046512 | Ga0495610_0165173 | Ga0495610_0165173_141_908 | 255 |
| 1057 | 3300046513 | Ga0495616_0000907 | Ga0495616_0000907_16304_17071 | 255 |
| 1058 | 3300046513 | Ga0495616_0128305 | Ga0495616_0128305_121_888 | 255 |
| 1059 | 3300046514 | Ga0495618_0239537 | Ga0495618_0239537_133_900 | 255 |
| 1060 | 3300046518 | Ga0495631_0036513 | Ga0495631_0036513_172_939 | 255 |
| 1061 | 3300046518 | Ga0495631_0155858 | Ga0495631_0155858_102_869 | 255 |
| 1062 | 3300046519 | Ga0495632_0150796 | Ga0495632_0150796_55_822 | 255 |
| 1063 | 3300046520 | Ga0495637_0008861 | Ga0495637_0008861_141_908 | 255 |
| 1064 | 3300046523 | Ga0495644_0004309 | Ga0495644_0004309_3247_4014 | 255 |
| 1065 | 3300046524 | Ga0495648_0016466 | Ga0495648_0016466_4317_5099 | 255 |
| 1066 | 3300046524 | Ga0495648_0022677 | Ga0495648_0022677_287_1054 | 255 |
| 1067 | 3300046524 | Ga0495648_0076075 | Ga0495648_0076075_291_1058 | 255 |
| 1068 | 3300046524 | Ga0495648_0212462 | Ga0495648_0212462_69_851 | 255 |
| 1069 | 3300046529 | Ga0495652_0269295 | Ga0495652_0269295_135_923 | 255 |
| 1070 | 3300046530 | Ga0495654_0042615 | Ga0495654_0042615_1435_2202 | 255 |
| 1071 | 3300046538 | Ga0495609_0034960 | Ga0495609_0034960_1054_1821 | 255 |
| 1072 | 3300046557 | Ga0495622_0192670 | Ga0495622_0192670_77_844 | 255 |
| 1073 | 3300046558 | Ga0495633_0000785 | Ga0495633_0000785_19214_19981 | 255 |
| 1074 | 3300046558 | Ga0495633_0163455 | Ga0495633_0163455_220_987 | 255 |
| 1075 | 3300046616 | Ga0495668_0000055 | Ga0495668_0000055_7749_8516 | 255 |
| 1076 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_349317_350084 | 255 |
| 1077 | 3300046660 | Ga0495625_0000761 | Ga0495625_0000761_13851_14618 | 255 |
| 1078 | 3300046660 | Ga0495625_0001500 | Ga0495625_0001500_9489_10256 | 255 |
| 1079 | 3300046660 | Ga0495625_0003990 | Ga0495625_0003990_3997_4764 | 255 |
| 1080 | 3300046660 | Ga0495625_0047405 | Ga0495625_0047405_1656_2426 | 255 |
| 1081 | 3300046660 | Ga0495625_0061832 | Ga0495625_0061832_818_1585 | 255 |
| 1082 | 3300046660 | Ga0495625_0376184 | Ga0495625_0376184_12_779 | 255 |
| 1083 | 3300046665 | Ga0495661_0001101 | Ga0495661_0001101_4248_5015 | 255 |
| 1084 | 3300046665 | Ga0495661_0002357 | Ga0495661_0002357_2515_3282 | 255 |
| 1085 | 3300046665 | Ga0495661_0071867 | Ga0495661_0071867_1078_1845 | 255 |
| 1086 | 3300046665 | Ga0495661_0093349 | Ga0495661_0093349_223_990 | 255 |
| 1087 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_87429_88196 | 255 |
| 1088 | 3300046810 | Ga0495660_0015258 | Ga0495660_0015258_2740_3507 | 255 |
| 1089 | 3300046810 | Ga0495660_0098012 | Ga0495660_0098012_193_960 | 255 |
| 1090 | 3300047323 | Ga0495683_0097950 | Ga0495683_0097950_456_1223 | 255 |
| 1091 | 3300047443 | Ga0495687_001497 | Ga0495687_001497_10800_11567 | 255 |
| 1092 | 3300047443 | Ga0495687_004528 | Ga0495687_004528_2286_3053 | 255 |
| 1093 | 3300047443 | Ga0495687_069141 | Ga0495687_069141_185_952 | 255 |
| 1094 | 3300047469 | Ga0495673_0123554 | Ga0495673_0123554_80_847 | 255 |
| 1095 | 3300047472 | Ga0495686_0000965 | Ga0495686_0000965_6398_7165 | 255 |
| 1096 | 3300047472 | Ga0495686_0001146 | Ga0495686_0001146_11461_12228 | 255 |
| 1097 | 3300047472 | Ga0495686_0027599 | Ga0495686_0027599_2434_3201 | 255 |
| 1098 | 3300048917 | Ga0496114_0349697 | Ga0496114_0349697_99_866 | 255 |
| 1099 | 3300048918 | Ga0496115_0054596 | Ga0496115_0054596_737_1504 | 255 |
| 1100 | 3300048919 | Ga0496116_0002140 | Ga0496116_0002140_5404_6171 | 255 |
| 1101 | 3300048920 | Ga0496117_0001774 | Ga0496117_0001774_17482_18249 | 255 |
| 1102 | 3300048925 | Ga0496122_0003563 | Ga0496122_0003563_1905_2672 | 255 |
| 1103 | 3300048926 | Ga0496123_0111706 | Ga0496123_0111706_584_1351 | 255 |
| 1104 | 3300049459 | Ga0495678_042611 | Ga0495678_042611_864_1631 | 255 |
| 1105 | 3300050493 | nmdc:mga0k408_11130_c1 | nmdc:mga0k408_11130_c1_3551_4318 | 255 |
| 1106 | 3300050493 | nmdc:mga0k408_120_c1 | nmdc:mga0k408_120_c1_29008_29775 | 255 |
| 1107 | 3300050493 | nmdc:mga0k408_245849_c1 | nmdc:mga0k408_245849_c1_45_812 | 255 |
| 1108 | 3300050493 | nmdc:mga0k408_364_c1 | nmdc:mga0k408_364_c1_1705_2475 | 255 |
| 1109 | 3300053080 | Ga0500635_0001085 | Ga0500635_0001085_503_1270 | 255 |
| 1110 | 3300053122 | Ga0500608_048215 | Ga0500608_048215_249_1016 | 255 |
| 1111 | 3300053123 | Ga0500614_015999 | Ga0500614_015999_724_1491 | 255 |
| 1112 | 3300053125 | Ga0500618_000006 | Ga0500618_000006_176372_177139 | 255 |
| 1113 | 3300053130 | Ga0500642_0050257 | Ga0500642_0050257_350_1117 | 255 |
| 1114 | 3300053153 | Ga0500616_0037550 | Ga0500616_0037550_1302_2069 | 255 |
| 1115 | 3300053156 | Ga0500622_0017330 | Ga0500622_0017330_2979_3749 | 255 |
| 1116 | 3300053157 | Ga0500624_000567 | Ga0500624_000567_2883_3650 | 255 |
| 1117 | 2162886007 | SwRhRL2b_contig_3456730 | SwRhRL2b_0596.00005760 | 256 |
| 1118 | 3300005288 | Ga0065714_10098959 | Ga0065714_100989592 | 256 |
| 1119 | 3300005289 | Ga0065704_10000218 | Ga0065704_1000021834 | 256 |
| 1120 | 3300005289 | Ga0065704_10077810 | Ga0065704_100778101 | 256 |
| 1121 | 3300005289 | Ga0065704_10190854 | Ga0065704_101908542 | 256 |
| 1122 | 3300009545 | Ga0105237_10000429 | Ga0105237_100004298 | 256 |
| 1123 | 3300013100 | Ga0157373_10000167 | Ga0157373_1000016726 | 256 |
| 1124 | 3300013102 | Ga0157371_10001037 | Ga0157371_1000103728 | 256 |
| 1125 | 3300013102 | Ga0157371_10001713 | Ga0157371_1000171315 | 256 |
| 1126 | 3300013104 | Ga0157370_10000681 | Ga0157370_1000068112 | 256 |
| 1127 | 3300013104 | Ga0157370_10008287 | Ga0157370_100082875 | 256 |
| 1128 | 3300013104 | Ga0157370_10081249 | Ga0157370_100812493 | 256 |
| 1129 | 3300013308 | Ga0157375_10055544 | Ga0157375_100555442 | 256 |
| 1130 | 3300014497 | Ga0182008_10000025 | Ga0182008_1000002560 | 256 |
| 1131 | 3300014497 | Ga0182008_10000058 | Ga0182008_1000005813 | 256 |
| 1132 | 3300014497 | Ga0182008_10059196 | Ga0182008_100591961 | 256 |
| 1133 | 3300015261 | Ga0182006_1000470 | Ga0182006_100047012 | 256 |
| 1134 | 3300015261 | Ga0182006_1001296 | Ga0182006_10012965 | 256 |
| 1135 | 3300015262 | Ga0182007_10034751 | Ga0182007_100347512 | 256 |
| 1136 | 3300017792 | Ga0163161_10000778 | Ga0163161_100007787 | 256 |
| 1137 | 3300025914 | Ga0207671_10003463 | Ga0207671_100034638 | 256 |
| 1138 | 3300031731 | Ga0307405_10109604 | Ga0307405_101096042 | 256 |
| 1139 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001513 | 256 |
| 1140 | 3300031911 | Ga0307412_10115103 | Ga0307412_101151032 | 256 |
| 1141 | 3300031911 | Ga0307412_10240019 | Ga0307412_102400192 | 256 |
| 1142 | 3300031911 | Ga0307412_10259443 | Ga0307412_102594432 | 256 |
| 1143 | 3300032004 | Ga0307414_10002342 | Ga0307414_100023429 | 256 |
| 1144 | 3300032004 | Ga0307414_10017828 | Ga0307414_100178285 | 256 |
| 1145 | 3300046501 | Ga0495607_0221045 | Ga0495607_0221045_62_832 | 256 |
| 1146 | 3300046538 | Ga0495609_0034564 | Ga0495609_0034564_1022_1792 | 256 |
| 1147 | 3300048925 | Ga0496122_0000783 | Ga0496122_0000783_55800_56570 | 256 |
| 1148 | 3300048926 | Ga0496123_0000586 | Ga0496123_0000586_33793_34563 | 256 |
| 1149 | 3300048928 | Ga0496125_0034972 | Ga0496125_0034972_691_1461 | 256 |
| 1150 | 3300049649 | Ga0501198_009024 | Ga0501198_009024_283_1053 | 256 |
| 1151 | 3300049758 | Ga0501241_012071 | Ga0501241_012071_181_951 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g91-assembly1.cif.gz_A | 1.2 angstrom structure of the exonuclease iii homologue mth0212 | 0.9713 | 1 | 256 |
| 3w2y-assembly2.cif.gz_D | crystal structure of dna uridine endonuclease mth212 mutant w205s | 0.9704 | 1 | 256 |
| 3g4t-assembly1.cif.gz_A | mth0212 (wt) in complex with a 7bp dsdna | 0.9691 | 1 | 255 |
| 3g0r-assembly1.cif.gz_A | complex of mth0212 and an 8bp dsdna with distorted ends | 0.9683 | 1 | 256 |
| 3g4t-assembly1.cif.gz_A | mth0212 (wt) in complex with a 7bp dsdna | 0.9617 | 1 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3g3cB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9696 | 1 | 256 | 3.60.10.10 |
| af_P27864_388_678_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9614 | 1 | 255 | 3.60.10.10 |
| 3g3cB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9585 | 1 | 256 | 3.60.10.10 |
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9542 | 1 | 256 | 3.60.10.10 |
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.947 | 1 | 256 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520ACK7-F1-model_v4 | Exodeoxyribonuclease III | 0.9995 | 1 | 76 |
GO:0003677
GO:0003906 GO:0004519 GO:0006284 GO:0008081 GO:0008311 |
| AF-A0A519V5N6-F1-model_v4 | Exodeoxyribonuclease III | 0.9991 | 1 | 102 |
GO:0003677
GO:0003906 GO:0004519 GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
| AF-A0A519V5N6-F1-model_v4 | Exodeoxyribonuclease III | 0.9894 | 1 | 102 |
GO:0003677
GO:0003906 GO:0004519 GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
| AF-A0A2E9DNT6-F1-model_v4 | deleted | 0.9882 | 1 | 193 |
|
| AF-A0A520ACK7-F1-model_v4 | Exodeoxyribonuclease III | 0.9866 | 1 | 76 |
GO:0003677
GO:0003906 GO:0004519 GO:0006284 GO:0008081 GO:0008311 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar