F490858

General Info

Members Datasets Scaffolds Average Seq Length
1151 420 1111 256

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10005450|Ga0065714_100054505
Length 279
Sequence LDNQKSEIEHPKSEMKIITYNVNGIRSAINKNWLAWLQAADADVVCLQEIKATPDVLTDLGLVDQLGYKHYWFPAEKKGYSGTAIFCKQTPKHIEYGCGIPDFDREGRCIRVDFEEVSVMSVYFPSGSSGDERQIFKYRFLDEFGKYLTLLKTEYPKLVVCGDYNICHRPIDIHNPKSNANSSGFLPEEREWMEKFIEGGFIDTFRHLNKEPHNYTWWSFRANSRAKNLGWRIDYTMASTELENNIKRASILPEAKHSDHCPVLLELEFTPQPPSGGAF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541278 Niastella sp. CF465 Isolate Unclassified
7 2738541283 Pedobacter sp. OK701 Isolate Unclassified
8 2738541284 Pedobacter sp. YR016 Isolate Unclassified
9 2738541302 Pedobacter sp. CF074 Isolate Unclassified
10 2738543023 Pedobacter sp. OK628 Isolate Unclassified
11 2739367651 Pedobacter sp. OK291 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
18 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
19 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
20 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
21 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
24 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
25 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
26 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
27 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
28 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
29 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
30 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
31 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
32 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
33 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
34 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
35 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
36 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
37 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
38 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
39 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
40 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
41 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
42 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
43 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
47 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
66 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
81 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
106 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
247 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
248 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
249 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
277 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
284 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
287 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
290 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
297 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
327 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
377 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
378 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
379 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
380 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
381 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
382 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
399 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
400 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
403 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
404 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
408 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
409 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
410 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
411 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
412 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
415 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
416 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.26
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 0
Rhizoplane 1.13
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3456730 2162886007 Bacteria 9441
2 SwRhRL2b_contig_650288 2162886007 Bacteria 2525
3 MBSR1b_contig_11496357 2162886012 Bacteria 1404
4 JGI24736J21556_1011527 3300001904 Bacteria 1437
5 JGI24740J21852_10035509 3300001979 Bacteria 1558
6 JGI24737J22298_10000851 3300001990 Bacteria 10884
7 JGI24737J22298_10005505 3300001990 Bacteria 4369
8 JGI24735J21928_10000093 3300002067 Bacteria 33623
9 JGI24033J26618_1007771 3300002155 Bacteria 1224
10 JGI25162J39368_1000008 3300002737 Bacteria 397212
11 JGI25162J39368_1000097 3300002737 Bacteria 96520
12 JGI25162J39368_1003452 3300002737 Bacteria 4558
13 JGI25154J39366_1004687 3300002738 Bacteria 2372
14 JGI25157J39369_1006945 3300002741 Bacteria 1675
15 JGI25164J39214_1002202 3300002772 Bacteria 3217
16 JGI25152J39213_1000044 3300002773 Bacteria 87213
17 JGI25150J39212_1000006 3300002774 Bacteria 257228
18 JGI25151J46595_10000024 3300003187 Bacteria 217596
19 JGI25165J46597_1000891 3300003214 Bacteria 21022
20 JGI25153J46596_10000026 3300003215 Bacteria 217245
21 rootH1_10102873 3300003316 Unclassified 2234
22 rootH2_10007161 3300003320 Bacteria 44535
23 rootH2_10007960 3300003320 Bacteria 49899
24 rootH2_10061124 3300003320 Bacteria 4895
25 rootH2_10089828 3300003320 Bacteria 2318
26 rootH2_10184756 3300003320 Bacteria 7299
27 rootL2_10094458 3300003322 Bacteria 1510
28 rootL2_10198285 3300003322 Bacteria 2164
29 rootL2_10240312 3300003322 Bacteria 4931
30 rootH1_10035781 3300003323 Bacteria 3127
31 rootH1_10050923 3300003323 Bacteria 6133
32 rootH1_10088396 3300003323 Bacteria 6140
33 rootH1_10131059 3300003323 Bacteria 5673
34 rootH1_10240758 3300003323 Bacteria 1675
35 JGI25160J50197_1001108 3300003354 Bacteria 13762
36 Ga0055536_1000002 3300003781 Bacteria 605605
37 Ga0065714_10005450 3300005288 Bacteria 4931
38 Ga0065714_10064557 3300005288 Bacteria 36424
39 Ga0065714_10067802 3300005288 Bacteria 5187
40 Ga0065714_10069902 3300005288 Bacteria 4041
41 Ga0065714_10072850 3300005288 Bacteria 3288
42 Ga0065714_10098959 3300005288 Bacteria 1697
43 Ga0065704_10000218 3300005289 Bacteria 76484
44 Ga0065704_10077810 3300005289 Bacteria 4613
45 Ga0065704_10190854 3300005289 Bacteria 1190
46 Ga0065704_10219819 3300005289 Bacteria 1072
47 Ga0065712_10002703 3300005290 Bacteria 5522
48 Ga0065712_10074233 3300005290 Bacteria 4148
49 Ga0065712_10199717 3300005290 Bacteria 1113
50 Ga0065715_10270193 3300005293 Unclassified 1113
51 Ga0065707_10143673 3300005295 Unclassified 1740
52 Ga0070658_10000113 3300005327 Bacteria 72221
53 Ga0070658_10001765 3300005327 Bacteria 18211
54 Ga0070658_10757163 3300005327 Bacteria 843
55 Ga0070676_10000205 3300005328 Bacteria 25133
56 Ga0070676_10004348 3300005328 Bacteria 7442
57 Ga0070676_10015311 3300005328 Bacteria 4230
58 Ga0070676_10041152 3300005328 Bacteria 2678
59 Ga0070676_10166487 3300005328 Bacteria 1423
60 Ga0070683_100036133 3300005329 Bacteria 4519
61 Ga0070690_100053377 3300005330 Bacteria 2586
62 Ga0070690_100094008 3300005330 Bacteria 1978
63 Ga0070690_100146863 3300005330 Bacteria 1605
64 Ga0070670_100027378 3300005331 Bacteria 4905
65 Ga0070670_100031040 3300005331 Bacteria 4602
66 Ga0070670_100052324 3300005331 Unclassified 3507
67 Ga0070670_100255751 3300005331 Bacteria 1526
68 Ga0070677_10024926 3300005333 Bacteria 2229
69 Ga0070677_10038588 3300005333 Bacteria 1870
70 Ga0068869_100003737 3300005334 Bacteria 9370
71 Ga0068869_100006757 3300005334 Bacteria 7289
72 Ga0068869_100021858 3300005334 Bacteria 4402
73 Ga0068869_100068253 3300005334 Bacteria 2626
74 Ga0068869_100245495 3300005334 Bacteria 1428
75 Ga0070666_10000072 3300005335 Bacteria 75356
76 Ga0070666_10000856 3300005335 Bacteria 18437
77 Ga0070666_10010262 3300005335 Bacteria 5854
78 Ga0070666_10024067 3300005335 Bacteria 3965
79 Ga0070666_10408838 3300005335 Bacteria 976
80 Ga0070680_100001822 3300005336 Bacteria 15659
81 Ga0070682_100000041 3300005337 Bacteria 142152
82 Ga0070682_100001992 3300005337 Bacteria 11388
83 Ga0070682_100140391 3300005337 Bacteria 1646
84 Ga0068868_100002491 3300005338 Bacteria 12787
85 Ga0068868_100007394 3300005338 Bacteria 7824
86 Ga0068868_100066227 3300005338 Bacteria 2871
87 Ga0068868_100095762 3300005338 Unclassified 2396
88 Ga0068868_100218724 3300005338 Unclassified 1594
89 Ga0070660_100064037 3300005339 Bacteria 2860
90 Ga0070660_100226946 3300005339 Bacteria 1519
91 Ga0070689_100077847 3300005340 Bacteria 2599
92 Ga0070691_10009617 3300005341 Bacteria 4413
93 Ga0070691_10187779 3300005341 Bacteria 1079
94 Ga0070687_100008339 3300005343 Bacteria 4382
95 Ga0070687_100058866 3300005343 Bacteria 2020
96 Ga0070661_100061111 3300005344 Bacteria 2765
97 Ga0070668_100004192 3300005347 Bacteria 10686
98 Ga0070668_100022027 3300005347 Bacteria 4816
99 Ga0070668_100029190 3300005347 Bacteria 4188
100 Ga0070668_100272610 3300005347 Bacteria 1411
101 Ga0070668_100327614 3300005347 Bacteria 1291
102 Ga0070669_100019580 3300005353 Bacteria 4834
103 Ga0070669_100067601 3300005353 Bacteria 2637
104 Ga0070669_100090023 3300005353 Bacteria 2299
105 Ga0070675_100011810 3300005354 Bacteria 6844
106 Ga0070675_100052152 3300005354 Bacteria 3362
107 Ga0070675_100070805 3300005354 Bacteria 2891
108 Ga0070675_100071251 3300005354 Bacteria 2883
109 Ga0070675_100103942 3300005354 Bacteria 2395
110 Ga0070671_100067613 3300005355 Bacteria 2979
111 Ga0070671_100070322 3300005355 Unclassified 2919
112 Ga0070671_100095808 3300005355 Bacteria 2488
113 Ga0070671_100308249 3300005355 Bacteria 1348
114 Ga0070674_100187387 3300005356 Bacteria 1589
115 Ga0070674_100192412 3300005356 Bacteria 1570
116 Ga0070674_100413987 3300005356 Bacteria 1104
117 Ga0070673_100001930 3300005364 Bacteria 12471
118 Ga0070673_100004765 3300005364 Bacteria 8622
119 Ga0070673_100017257 3300005364 Bacteria 5126
120 Ga0070673_100023510 3300005364 Bacteria 4503
121 Ga0070673_100027647 3300005364 Bacteria 4207
122 Ga0070673_100059643 3300005364 Bacteria 3021
123 Ga0070673_100096617 3300005364 Bacteria 2424
124 Ga0070673_100228490 3300005364 Bacteria 1613
125 Ga0070673_100446374 3300005364 Unclassified 1163
126 Ga0070688_100001768 3300005365 Bacteria 10813
127 Ga0070688_100044922 3300005365 Bacteria 2727
128 Ga0070688_100111182 3300005365 Bacteria 1822
129 Ga0070659_100000199 3300005366 Bacteria 46342
130 Ga0070659_100005494 3300005366 Bacteria 9107
131 Ga0070659_100008229 3300005366 Bacteria 7615
132 Ga0070659_100036212 3300005366 Bacteria 3846
133 Ga0070659_100267958 3300005366 Unclassified 1418
134 Ga0070667_100003102 3300005367 Bacteria 14296
135 Ga0070667_100077424 3300005367 Bacteria 2840
136 Ga0070667_100087633 3300005367 Bacteria 2672
137 Ga0070700_100024503 3300005441 Bacteria 3544
138 Ga0070663_100005053 3300005455 Bacteria 7794
139 Ga0070663_100182436 3300005455 Bacteria 1629
140 Ga0070678_100011513 3300005456 Bacteria 5463
141 Ga0070678_100060730 3300005456 Bacteria 2783
142 Ga0070678_100331526 3300005456 Bacteria 1302
143 Ga0070662_100000772 3300005457 Bacteria 19707
144 Ga0070662_100074082 3300005457 Bacteria 2518
145 Ga0070681_10025021 3300005458 Bacteria 6007
146 Ga0070681_10108996 3300005458 Bacteria 2709
147 Ga0068867_100000809 3300005459 Bacteria 21093
148 Ga0068867_100005280 3300005459 Bacteria 9125
149 Ga0068867_100053647 3300005459 Bacteria 2978
150 Ga0068867_100076943 3300005459 Bacteria 2506
151 Ga0068867_100172069 3300005459 Bacteria 1716
152 Ga0068867_100281531 3300005459 Bacteria 1364
153 Ga0068867_100444756 3300005459 Unclassified 1103
154 Ga0068867_100560372 3300005459 Bacteria 991
155 Ga0070685_10025086 3300005466 Bacteria 3281
156 Ga0070685_10040270 3300005466 Bacteria 2658
157 Ga0070685_10091082 3300005466 Bacteria 1845
158 Ga0070685_10356252 3300005466 Bacteria 1002
159 Ga0070698_100002009 3300005471 Bacteria 22594
160 Ga0070698_100005327 3300005471 Bacteria 14081
161 Ga0070698_100048986 3300005471 Bacteria 4315
162 Ga0070699_100057554 3300005518 Bacteria 3367
163 Ga0070699_100472201 3300005518 Bacteria 1138
164 Ga0070679_100013537 3300005530 Bacteria 7815
165 Ga0070679_100464348 3300005530 Bacteria 1210
166 Ga0068853_100005414 3300005539 Bacteria 10003
167 Ga0068853_100012933 3300005539 Bacteria 6802
168 Ga0068853_100024008 3300005539 Bacteria 5110
169 Ga0068853_100089658 3300005539 Bacteria 2701
170 Ga0068853_100140645 3300005539 Bacteria 2166
171 Ga0068853_100151022 3300005539 Unclassified 2091
172 Ga0068853_100158131 3300005539 Bacteria 2043
173 Ga0068853_100179807 3300005539 Bacteria 1918
174 Ga0068853_100248421 3300005539 Bacteria 1632
175 Ga0068853_100374623 3300005539 Bacteria 1328
176 Ga0068853_100421669 3300005539 Unclassified 1251
177 Ga0068853_100575633 3300005539 Unclassified 1068
178 Ga0068853_100578860 3300005539 Bacteria 1065
179 Ga0068853_100844927 3300005539 Bacteria 878
180 Ga0070672_100003625 3300005543 Bacteria 10020
181 Ga0070672_100004263 3300005543 Bacteria 9352
182 Ga0070672_100045387 3300005543 Bacteria 3398
183 Ga0070672_100051032 3300005543 Bacteria 3224
184 Ga0070672_100120475 3300005543 Bacteria 2147
185 Ga0070672_100157644 3300005543 Bacteria 1881
186 Ga0070672_100199695 3300005543 Unclassified 1672
187 Ga0070672_100748815 3300005543 Bacteria 857
188 Ga0070686_100129013 3300005544 Bacteria 1746
189 Ga0070695_100222520 3300005545 Unclassified 1360
190 Ga0070693_100018363 3300005547 Bacteria 3652
191 Ga0070665_100000002 3300005548 Bacteria 849037
192 Ga0070665_100000017 3300005548 Bacteria 448013
193 Ga0070665_100003483 3300005548 Bacteria 16764
194 Ga0070665_100023328 3300005548 Bacteria 6229
195 Ga0070704_100141484 3300005549 Bacteria 1879
196 Ga0068855_100000074 3300005563 Bacteria 119759
197 Ga0068855_100000958 3300005563 Bacteria 35849
198 Ga0068855_100030343 3300005563 Bacteria 6467
199 Ga0068855_100093980 3300005563 Bacteria 3457
200 Ga0068855_100170531 3300005563 Bacteria 2465
201 Ga0068855_100304027 3300005563 Bacteria 1766
202 Ga0068855_100396803 3300005563 Bacteria 1512
203 Ga0068855_100707052 3300005563 Bacteria 1078
204 Ga0068857_100004236 3300005577 Bacteria 12092
205 Ga0068857_100054498 3300005577 Bacteria 3548
206 Ga0068857_100067223 3300005577 Bacteria 3190
207 Ga0068857_100092630 3300005577 Bacteria 2706
208 Ga0068854_100148514 3300005578 Bacteria 1805
209 Ga0068854_100182933 3300005578 Bacteria 1638
210 Ga0068856_100000040 3300005614 Bacteria 114443
211 Ga0068856_100015577 3300005614 Bacteria 7350
212 Ga0068856_100017756 3300005614 Bacteria 6898
213 Ga0068856_100025193 3300005614 Bacteria 5796
214 Ga0068856_100032371 3300005614 Bacteria 5119
215 Ga0068856_100321567 3300005614 Bacteria 1564
216 Ga0068856_100792708 3300005614 Bacteria 967
217 Ga0070702_100016339 3300005615 Bacteria 3806
218 Ga0070702_100288736 3300005615 Bacteria 1129
219 Ga0068852_100000720 3300005616 Bacteria 21705
220 Ga0068852_100002922 3300005616 Bacteria 11871
221 Ga0068852_100011729 3300005616 Bacteria 6615
222 Ga0068852_100234714 3300005616 Bacteria 1750
223 Ga0068852_100647032 3300005616 Bacteria 1064
224 Ga0068852_100826874 3300005616 Bacteria 941
225 Ga0068859_100000006 3300005617 Bacteria 421509
226 Ga0068859_100000710 3300005617 Bacteria 33516
227 Ga0068859_100029400 3300005617 Bacteria 5513
228 Ga0068859_100033372 3300005617 Bacteria 5168
229 Ga0068859_100039276 3300005617 Bacteria 4748
230 Ga0068864_100000469 3300005618 Bacteria 34957
231 Ga0068864_100004006 3300005618 Bacteria 12124
232 Ga0068864_100025199 3300005618 Bacteria 5007
233 Ga0068864_100070475 3300005618 Bacteria 3042
234 Ga0068864_100078723 3300005618 Bacteria 2885
235 Ga0068861_100004575 3300005719 Bacteria 9286
236 Ga0068861_100032792 3300005719 Bacteria 3827
237 Ga0068861_100040662 3300005719 Bacteria 3479
238 Ga0068861_100058903 3300005719 Bacteria 2939
239 Ga0068851_10006291 3300005834 Bacteria 5419
240 Ga0068851_10045235 3300005834 Bacteria 2224
241 Ga0068851_10104294 3300005834 Bacteria 1507
242 Ga0068851_10229126 3300005834 Bacteria 1047
243 Ga0068870_10049060 3300005840 Bacteria 2225
244 Ga0068870_10234124 3300005840 Bacteria 1131
245 Ga0068863_100002075 3300005841 Bacteria 19871
246 Ga0068863_100002232 3300005841 Bacteria 19223
247 Ga0068863_100011017 3300005841 Bacteria 8769
248 Ga0068863_100067774 3300005841 Bacteria 3376
249 Ga0068863_100085429 3300005841 Bacteria 2990
250 Ga0068863_100284546 3300005841 Bacteria 1602
251 Ga0068858_100000978 3300005842 Bacteria 29516
252 Ga0068858_100000982 3300005842 Bacteria 29441
253 Ga0068858_100474363 3300005842 Unclassified 1207
254 Ga0068860_100005506 3300005843 Bacteria 12821
255 Ga0068860_100008211 3300005843 Bacteria 10392
256 Ga0068860_100042291 3300005843 Bacteria 4353
257 Ga0068860_100108924 3300005843 Bacteria 2647
258 Ga0068860_100182869 3300005843 Bacteria 2026
259 Ga0068860_100263671 3300005843 Bacteria 1680
260 Ga0068860_100375898 3300005843 Bacteria 1402
261 Ga0068862_100012568 3300005844 Bacteria 7011
262 Ga0068862_100122457 3300005844 Unclassified 2294
263 Ga0068862_100372308 3300005844 Bacteria 1330
264 Ga0075366_10000435 3300006195 Bacteria 19478
265 Ga0075366_10000779 3300006195 Bacteria 15223
266 Ga0075366_10002507 3300006195 Bacteria 9426
267 Ga0075366_10348083 3300006195 Bacteria 909
268 Ga0097621_100000285 3300006237 Bacteria 34046
269 Ga0097621_100001174 3300006237 Bacteria 18148
270 Ga0097621_100001598 3300006237 Bacteria 15497
271 Ga0097621_100015672 3300006237 Bacteria 5711
272 Ga0097621_100070912 3300006237 Bacteria 2878
273 Ga0097621_100528583 3300006237 Unclassified 1071
274 Ga0097621_100587488 3300006237 Bacteria 1017
275 Ga0068871_100000080 3300006358 Bacteria 53930
276 Ga0068871_100001193 3300006358 Bacteria 17357
277 Ga0068871_100002679 3300006358 Bacteria 12153
278 Ga0068871_100019800 3300006358 Bacteria 5143
279 Ga0068871_100031523 3300006358 Bacteria 4182
280 Ga0068871_100048996 3300006358 Bacteria 3413
281 Ga0068871_100058614 3300006358 Bacteria 3135
282 Ga0068871_100307763 3300006358 Bacteria 1392
283 Ga0068871_100326853 3300006358 Bacteria 1352
284 Ga0075428_100015265 3300006844 Bacteria 8519
285 Ga0075430_100054183 3300006846 Bacteria 3375
286 Ga0075429_100004785 3300006880 Bacteria 11657
287 Ga0075429_100060953 3300006880 Bacteria 3286
288 Ga0075429_100084913 3300006880 Bacteria 2759
289 Ga0068865_100000218 3300006881 Bacteria 31890
290 Ga0068865_100001197 3300006881 Bacteria 15094
291 Ga0068865_100008116 3300006881 Bacteria 6479
292 Ga0068865_100084017 3300006881 Bacteria 2293
293 Ga0068865_100133605 3300006881 Unclassified 1861
294 Ga0068865_100308013 3300006881 Bacteria 1270
295 Ga0097620_100000006 3300006931 Bacteria 421509
296 Ga0097620_100000710 3300006931 Bacteria 33516
297 Ga0097620_100029399 3300006931 Bacteria 5513
298 Ga0097620_100033374 3300006931 Bacteria 5168
299 Ga0097620_100039276 3300006931 Bacteria 4748
300 Ga0105244_10025480 3300009036 Bacteria 3215
301 Ga0105240_10000083 3300009093 Bacteria 192934
302 Ga0105240_10001189 3300009093 Bacteria 45474
303 Ga0105240_10003157 3300009093 Bacteria 25925
304 Ga0105240_10003164 3300009093 Bacteria 25888
305 Ga0105240_10003566 3300009093 Bacteria 24139
306 Ga0105240_10016999 3300009093 Bacteria 9826
307 Ga0105240_10036054 3300009093 Bacteria 6368
308 Ga0105240_10060030 3300009093 Bacteria 4742
309 Ga0105240_10102820 3300009093 Bacteria 3472
310 Ga0105240_10332692 3300009093 Bacteria 1728
311 Ga0105240_10652633 3300009093 Bacteria 1153
312 Ga0111539_11064710 3300009094 Unclassified 940
313 Ga0105247_10004101 3300009101 Bacteria 9361
314 Ga0114129_10001062 3300009147 Bacteria 36084
315 Ga0114129_10294403 3300009147 Bacteria 2165
316 Ga0105243_10000003 3300009148 Bacteria 712931
317 Ga0105243_10150831 3300009148 Bacteria 1994
318 Ga0105243_10209191 3300009148 Bacteria 1717
319 Ga0105241_10000324 3300009174 Bacteria 36128
320 Ga0105241_10000620 3300009174 Bacteria 26735
321 Ga0105241_10005957 3300009174 Bacteria 8989
322 Ga0105241_10007142 3300009174 Bacteria 8220
323 Ga0105241_10008209 3300009174 Bacteria 7686
324 Ga0105241_10011880 3300009174 Bacteria 6399
325 Ga0105241_10031123 3300009174 Bacteria 3994
326 Ga0105241_10052711 3300009174 Bacteria 3108
327 Ga0105241_10059451 3300009174 Bacteria 2939
328 Ga0105241_10322771 3300009174 Bacteria 1332
329 Ga0105242_10005785 3300009176 Bacteria 9521
330 Ga0105242_10026804 3300009176 Bacteria 4570
331 Ga0105242_10031334 3300009176 Bacteria 4245
332 Ga0105242_10050764 3300009176 Bacteria 3378
333 Ga0105242_10061209 3300009176 Bacteria 3096
334 Ga0105242_10130639 3300009176 Bacteria 2168
335 Ga0105242_10318202 3300009176 Unclassified 1426
336 Ga0105248_10016968 3300009177 Bacteria 8018
337 Ga0105248_10723808 3300009177 Unclassified 1123
338 Ga0105237_10000138 3300009545 Bacteria 102411
339 Ga0105237_10000144 3300009545 Bacteria 100105
340 Ga0105237_10000429 3300009545 Bacteria 59643
341 Ga0105237_10001681 3300009545 Bacteria 28643
342 Ga0105237_10003760 3300009545 Bacteria 17868
343 Ga0105237_10005021 3300009545 Bacteria 15061
344 Ga0105237_10005145 3300009545 Bacteria 14812
345 Ga0105237_10011015 3300009545 Bacteria 9594
346 Ga0105237_10020681 3300009545 Bacteria 6778
347 Ga0105237_10024357 3300009545 Bacteria 6193
348 Ga0105237_10076228 3300009545 Bacteria 3344
349 Ga0105237_10122598 3300009545 Bacteria 2593
350 Ga0105237_10136395 3300009545 Bacteria 2448
351 Ga0105237_10287549 3300009545 Bacteria 1647
352 Ga0105237_10451876 3300009545 Bacteria 1291
353 Ga0105237_10526682 3300009545 Bacteria 1188
354 Ga0105238_10005010 3300009551 Bacteria 13090
355 Ga0105238_10020232 3300009551 Bacteria 6774
356 Ga0105238_10022704 3300009551 Bacteria 6395
357 Ga0105238_10116189 3300009551 Bacteria 2655
358 Ga0105238_10296136 3300009551 Unclassified 1601
359 Ga0105238_10486506 3300009551 Bacteria 1234
360 Ga0105249_10001056 3300009553 Bacteria 24413
361 Ga0105249_10007464 3300009553 Bacteria 9540
362 Ga0105249_10007493 3300009553 Bacteria 9521
363 Ga0105249_10008209 3300009553 Bacteria 9098
364 Ga0105249_10016792 3300009553 Bacteria 6495
365 Ga0105249_10066289 3300009553 Bacteria 3324
366 Ga0105249_10152867 3300009553 Bacteria 2223
367 Ga0105249_10224571 3300009553 Bacteria 1849
368 Ga0105249_10301172 3300009553 Bacteria 1608
369 Ga0105249_10661755 3300009553 Bacteria 1102
370 Ga0105249_11294907 3300009553 Bacteria 800
371 Ga0105239_10000026 3300010375 Bacteria 248302
372 Ga0105239_10000392 3300010375 Bacteria 64144
373 Ga0105239_10002143 3300010375 Bacteria 25398
374 Ga0105239_10003890 3300010375 Bacteria 18093
375 Ga0105239_10006488 3300010375 Bacteria 13566
376 Ga0105239_10006793 3300010375 Bacteria 13207
377 Ga0105239_10008812 3300010375 Bacteria 11416
378 Ga0105239_10010461 3300010375 Bacteria 10371
379 Ga0105239_10017011 3300010375 Bacteria 8040
380 Ga0105239_10020600 3300010375 Bacteria 7276
381 Ga0105239_10035575 3300010375 Bacteria 5469
382 Ga0105239_10092212 3300010375 Bacteria 3344
383 Ga0105239_10389838 3300010375 Unclassified 1576
384 Ga0105239_10427981 3300010375 Bacteria 1500
385 Ga0105246_10026192 3300011119 Bacteria 3806
386 Ga0105246_10342534 3300011119 Bacteria 1222
387 Ga0157373_10000167 3300013100 Bacteria 53611
388 Ga0157373_10001288 3300013100 Bacteria 19138
389 Ga0157373_10018692 3300013100 Bacteria 5044
390 Ga0157373_10064052 3300013100 Bacteria 2602
391 Ga0157373_10144870 3300013100 Bacteria 1671
392 Ga0157371_10000286 3300013102 Bacteria 68502
393 Ga0157371_10000748 3300013102 Bacteria 37610
394 Ga0157371_10001037 3300013102 Bacteria 30465
395 Ga0157371_10001713 3300013102 Bacteria 22319
396 Ga0157371_10002211 3300013102 Bacteria 18838
397 Ga0157371_10011893 3300013102 Bacteria 6679
398 Ga0157371_10104223 3300013102 Bacteria 2013
399 Ga0157371_10164428 3300013102 Bacteria 1585
400 Ga0157371_10346355 3300013102 Bacteria 1081
401 Ga0157370_10000419 3300013104 Bacteria 53608
402 Ga0157370_10000681 3300013104 Bacteria 42275
403 Ga0157370_10002658 3300013104 Bacteria 21448
404 Ga0157370_10006839 3300013104 Bacteria 12493
405 Ga0157370_10007099 3300013104 Bacteria 12229
406 Ga0157370_10008287 3300013104 Bacteria 11216
407 Ga0157370_10012590 3300013104 Bacteria 8767
408 Ga0157370_10022935 3300013104 Bacteria 6204
409 Ga0157370_10027084 3300013104 Bacteria 5652
410 Ga0157370_10044025 3300013104 Bacteria 4294
411 Ga0157370_10053904 3300013104 Bacteria 3834
412 Ga0157370_10081166 3300013104 Bacteria 3052
413 Ga0157370_10081249 3300013104 Bacteria 3050
414 Ga0157370_10297224 3300013104 Bacteria 1491
415 Ga0157370_10540126 3300013104 Bacteria 1069
416 Ga0157370_10663800 3300013104 Bacteria 953
417 Ga0157369_10000301 3300013105 Bacteria 66010
418 Ga0157369_10055266 3300013105 Unclassified 4286
419 Ga0157369_10140197 3300013105 Bacteria 2559
420 Ga0157369_10184926 3300013105 Bacteria 2191
421 Ga0157369_10191609 3300013105 Bacteria 2148
422 Ga0157374_10000180 3300013296 Bacteria 58547
423 Ga0157374_10001208 3300013296 Bacteria 22108
424 Ga0157374_10001936 3300013296 Bacteria 17362
425 Ga0157374_10037158 3300013296 Bacteria 4467
426 Ga0157374_10064009 3300013296 Bacteria 3450
427 Ga0157374_10454911 3300013296 Bacteria 1282
428 Ga0157374_10919633 3300013296 Bacteria 893
429 Ga0157378_10002934 3300013297 Bacteria 15160
430 Ga0157378_10016682 3300013297 Bacteria 6435
431 Ga0157378_10025378 3300013297 Bacteria 5219
432 Ga0157378_10027671 3300013297 Bacteria 5001
433 Ga0157378_10038789 3300013297 Bacteria 4223
434 Ga0157378_10109920 3300013297 Bacteria 2526
435 Ga0157378_10176020 3300013297 Bacteria 2010
436 Ga0157378_10385147 3300013297 Unclassified 1378
437 Ga0157378_10421939 3300013297 Bacteria 1319
438 Ga0163162_10000011 3300013306 Bacteria 299877
439 Ga0163162_10000051 3300013306 Bacteria 117695
440 Ga0163162_10000112 3300013306 Bacteria 72032
441 Ga0163162_10000253 3300013306 Bacteria 48450
442 Ga0163162_10002340 3300013306 Bacteria 17794
443 Ga0163162_10002412 3300013306 Bacteria 17588
444 Ga0163162_10002447 3300013306 Bacteria 17518
445 Ga0163162_10003028 3300013306 Bacteria 16055
446 Ga0163162_10008696 3300013306 Bacteria 9881
447 Ga0163162_10073125 3300013306 Bacteria 3484
448 Ga0163162_10074712 3300013306 Unclassified 3448
449 Ga0163162_10137644 3300013306 Bacteria 2553
450 Ga0163162_10184710 3300013306 Bacteria 2212
451 Ga0163162_10240591 3300013306 Bacteria 1941
452 Ga0163162_10255593 3300013306 Bacteria 1884
453 Ga0163162_10492222 3300013306 Bacteria 1357
454 Ga0163162_10577749 3300013306 Unclassified 1251
455 Ga0163162_10705389 3300013306 Unclassified 1130
456 Ga0163162_10729264 3300013306 Bacteria 1111
457 Ga0157372_10000037 3300013307 Bacteria 172444
458 Ga0157372_10003686 3300013307 Bacteria 16465
459 Ga0157372_10006375 3300013307 Bacteria 12552
460 Ga0157372_10009703 3300013307 Bacteria 10235
461 Ga0157372_10013991 3300013307 Bacteria 8572
462 Ga0157372_10033278 3300013307 Bacteria 5660
463 Ga0157372_10037248 3300013307 Bacteria 5363
464 Ga0157372_10089205 3300013307 Bacteria 3503
465 Ga0157372_10118957 3300013307 Bacteria 3032
466 Ga0157372_10207209 3300013307 Bacteria 2272
467 Ga0157372_10239976 3300013307 Bacteria 2103
468 Ga0157372_10464309 3300013307 Bacteria 1475
469 Ga0157372_10482209 3300013307 Viruses 1446
470 Ga0157375_10002970 3300013308 Bacteria 14733
471 Ga0157375_10017528 3300013308 Bacteria 6466
472 Ga0157375_10032194 3300013308 Bacteria 4971
473 Ga0157375_10055544 3300013308 Bacteria 3905
474 Ga0157375_10076232 3300013308 Bacteria 3379
475 Ga0157375_10089080 3300013308 Bacteria 3142
476 Ga0157375_10113118 3300013308 Bacteria 2815
477 Ga0157375_10177058 3300013308 Bacteria 2283
478 Ga0157375_10222544 3300013308 Bacteria 2046
479 Ga0157375_10373600 3300013308 Unclassified 1592
480 Ga0163163_10001606 3300014325 Bacteria 19003
481 Ga0163163_10079320 3300014325 Bacteria 3281
482 Ga0163163_10279568 3300014325 Bacteria 1721
483 Ga0163163_10317084 3300014325 Bacteria 1612
484 Ga0163163_10442936 3300014325 Unclassified 1359
485 Ga0157380_10006320 3300014326 Bacteria 8325
486 Ga0157380_10015530 3300014326 Bacteria 5598
487 Ga0157380_10103530 3300014326 Bacteria 2376
488 Ga0157380_10117290 3300014326 Bacteria 2248
489 Ga0157380_10210758 3300014326 Bacteria 1731
490 Ga0157380_10244889 3300014326 Unclassified 1619
491 Ga0182008_10000025 3300014497 Bacteria 191222
492 Ga0182008_10000058 3300014497 Bacteria 100175
493 Ga0182008_10000059 3300014497 Bacteria 100173
494 Ga0182008_10059196 3300014497 Bacteria 1890
495 Ga0157377_10006497 3300014745 Bacteria 5581
496 Ga0157377_10012719 3300014745 Unclassified 4240
497 Ga0157377_10015027 3300014745 Bacteria 3949
498 Ga0157377_10132954 3300014745 Bacteria 1522
499 Ga0157379_10001508 3300014968 Bacteria 19154
500 Ga0157379_10065702 3300014968 Bacteria 3243
501 Ga0157379_10268978 3300014968 Bacteria 1550
502 Ga0157379_10677845 3300014968 Bacteria 966
503 Ga0157376_10000583 3300014969 Bacteria 23527
504 Ga0157376_10001570 3300014969 Bacteria 15087
505 Ga0157376_10010576 3300014969 Bacteria 6756
506 Ga0157376_10063914 3300014969 Bacteria 3102
507 Ga0157376_10104584 3300014969 Unclassified 2481
508 Ga0157376_10107570 3300014969 Bacteria 2448
509 Ga0157376_10149443 3300014969 Bacteria 2105
510 Ga0157376_10234554 3300014969 Bacteria 1706
511 Ga0157376_10239273 3300014969 Bacteria 1691
512 Ga0182006_1000156 3300015261 Bacteria 72868
513 Ga0182006_1000470 3300015261 Bacteria 31499
514 Ga0182006_1000482 3300015261 Bacteria 31213
515 Ga0182006_1001296 3300015261 Bacteria 15423
516 Ga0182007_10000008 3300015262 Bacteria 332953
517 Ga0182007_10034751 3300015262 Bacteria 1701
518 Ga0183373_1002 3300015682 Bacteria 990153
519 Ga0163161_10000305 3300017792 Bacteria 42845
520 Ga0163161_10000502 3300017792 Bacteria 31881
521 Ga0163161_10000778 3300017792 Bacteria 25045
522 Ga0163161_10005925 3300017792 Bacteria 8473
523 Ga0163161_10020128 3300017792 Bacteria 4679
524 Ga0163161_10023052 3300017792 Bacteria 4387
525 Ga0163161_10029926 3300017792 Bacteria 3872
526 Ga0163161_10043127 3300017792 Bacteria 3248
527 Ga0163161_10284885 3300017792 Bacteria 1297
528 Ga0163161_10471388 3300017792 Bacteria 1018
529 Ga0206351_10474630 3300020077 Bacteria 2333
530 Ga0206350_10768666 3300020080 Bacteria 1744
531 Ga0154015_1561766 3300020610 Bacteria 1450
532 Ga0207427_100071 3300025231 Bacteria 159974
533 Ga0209437_100021 3300025233 Bacteria 646400
534 Ga0209437_100030 3300025233 Bacteria 532466
535 Ga0207425_1000003 3300025245 Bacteria 1145342
536 Ga0209646_1001778 3300025246 Bacteria 5402
537 Ga0209026_1000325 3300025250 Bacteria 49667
538 Ga0209026_1001703 3300025250 Bacteria 9175
539 Ga0209026_1003864 3300025250 Bacteria 4724
540 Ga0209129_1000022 3300025258 Bacteria 440876
541 Ga0209233_1000035 3300025261 Bacteria 568478
542 Ga0209233_1002101 3300025261 Bacteria 7511
543 Ga0207666_1003197 3300025271 Bacteria 2002
544 Ga0209455_1003029 3300025272 Bacteria 6152
545 Ga0209676_1000022 3300025292 Bacteria 605659
546 Ga0209025_1000007 3300025294 Bacteria 1145109
547 Ga0209758_1000012 3300025297 Bacteria 949866
548 Ga0209050_1000020 3300025298 Bacteria 605671
549 Ga0207426_1000059 3300025302 Bacteria 363842
550 Ga0207697_10032559 3300025315 Bacteria 2134
551 Ga0207656_10006221 3300025321 Bacteria 4277
552 Ga0207656_10022813 3300025321 Bacteria 2514
553 Ga0207656_10062601 3300025321 Bacteria 1636
554 Ga0207682_10155806 3300025893 Bacteria 1032
555 Ga0207642_10043526 3300025899 Bacteria 1981
556 Ga0207688_10071862 3300025901 Bacteria 1965
557 Ga0207680_10000037 3300025903 Bacteria 72773
558 Ga0207680_10005905 3300025903 Bacteria 5880
559 Ga0207680_10016302 3300025903 Bacteria 3898
560 Ga0207647_10000453 3300025904 Bacteria 33344
561 Ga0207647_10000687 3300025904 Bacteria 26558
562 Ga0207647_10024864 3300025904 Bacteria 3944
563 Ga0207647_10060271 3300025904 Bacteria 2320
564 Ga0207647_10123929 3300025904 Unclassified 1522
565 Ga0207647_10317003 3300025904 Viruses 886
566 Ga0207645_10000398 3300025907 Bacteria 35913
567 Ga0207645_10005743 3300025907 Bacteria 8954
568 Ga0207645_10006151 3300025907 Bacteria 8622
569 Ga0207645_10038499 3300025907 Unclassified 3066
570 Ga0207645_10080239 3300025907 Bacteria 2091
571 Ga0207643_10156670 3300025908 Bacteria 1368
572 Ga0207643_10236906 3300025908 Bacteria 1121
573 Ga0207705_10000160 3300025909 Bacteria 72235
574 Ga0207705_10012389 3300025909 Bacteria 6161
575 Ga0207654_10002936 3300025911 Bacteria 8647
576 Ga0207654_10003611 3300025911 Bacteria 7809
577 Ga0207654_10004664 3300025911 Bacteria 6930
578 Ga0207654_10007347 3300025911 Bacteria 5548
579 Ga0207654_10042681 3300025911 Bacteria 2568
580 Ga0207654_10074444 3300025911 Bacteria 2027
581 Ga0207654_10128702 3300025911 Bacteria 1600
582 Ga0207654_10180921 3300025911 Unclassified 1375
583 Ga0207707_10000620 3300025912 Bacteria 35314
584 Ga0207707_10063196 3300025912 Bacteria 3222
585 Ga0207695_10000066 3300025913 Bacteria 334103
586 Ga0207695_10000127 3300025913 Bacteria 227338
587 Ga0207695_10001122 3300025913 Bacteria 46534
588 Ga0207695_10011093 3300025913 Bacteria 10942
589 Ga0207695_10012480 3300025913 Bacteria 10197
590 Ga0207695_10030736 3300025913 Bacteria 5909
591 Ga0207695_10031676 3300025913 Bacteria 5795
592 Ga0207695_10056221 3300025913 Bacteria 4096
593 Ga0207695_10135664 3300025913 Bacteria 2414
594 Ga0207695_10194858 3300025913 Bacteria 1942
595 Ga0207695_10258714 3300025913 Bacteria 1638
596 Ga0207671_10000453 3300025914 Bacteria 56447
597 Ga0207671_10001040 3300025914 Bacteria 33728
598 Ga0207671_10001502 3300025914 Bacteria 26900
599 Ga0207671_10001511 3300025914 Bacteria 26769
600 Ga0207671_10003253 3300025914 Bacteria 16345
601 Ga0207671_10003463 3300025914 Bacteria 15704
602 Ga0207671_10003548 3300025914 Bacteria 15461
603 Ga0207671_10011669 3300025914 Bacteria 7128
604 Ga0207671_10012109 3300025914 Bacteria 6965
605 Ga0207671_10017185 3300025914 Bacteria 5587
606 Ga0207671_10142456 3300025914 Bacteria 1848
607 Ga0207671_10156194 3300025914 Bacteria 1765
608 Ga0207671_10335022 3300025914 Bacteria 1198
609 Ga0207660_10002359 3300025917 Bacteria 12433
610 Ga0207662_10007392 3300025918 Bacteria 5981
611 Ga0207662_10039148 3300025918 Bacteria 2780
612 Ga0207662_10042443 3300025918 Bacteria 2681
613 Ga0207657_10026795 3300025919 Bacteria 5288
614 Ga0207657_10214952 3300025919 Bacteria 1542
615 Ga0207652_10003265 3300025921 Bacteria 13432
616 Ga0207646_10459911 3300025922 Bacteria 1148
617 Ga0207681_10015111 3300025923 Bacteria 4813
618 Ga0207681_10045442 3300025923 Bacteria 2949
619 Ga0207681_10063095 3300025923 Bacteria 2554
620 Ga0207694_10095992 3300025924 Unclassified 2344
621 Ga0207694_10165901 3300025924 Bacteria 1786
622 Ga0207650_10020030 3300025925 Bacteria 4711
623 Ga0207650_10022410 3300025925 Unclassified 4470
624 Ga0207650_10034354 3300025925 Bacteria 3677
625 Ga0207650_10095484 3300025925 Bacteria 2279
626 Ga0207659_10004571 3300025926 Bacteria 8368
627 Ga0207659_10014816 3300025926 Bacteria 5039
628 Ga0207659_10034950 3300025926 Bacteria 3470
629 Ga0207659_10044057 3300025926 Bacteria 3137
630 Ga0207659_10158200 3300025926 Bacteria 1776
631 Ga0207687_10052204 3300025927 Bacteria 2852
632 Ga0207644_10030894 3300025931 Bacteria 3729
633 Ga0207644_10067370 3300025931 Bacteria 2609
634 Ga0207644_10159093 3300025931 Bacteria 1754
635 Ga0207690_10003371 3300025932 Bacteria 9552
636 Ga0207690_10003707 3300025932 Bacteria 9082
637 Ga0207690_10057474 3300025932 Bacteria 2628
638 Ga0207690_10321768 3300025932 Bacteria 1216
639 Ga0207706_10001940 3300025933 Bacteria 20308
640 Ga0207706_10007446 3300025933 Bacteria 10123
641 Ga0207706_10033616 3300025933 Bacteria 4563
642 Ga0207686_10000351 3300025934 Bacteria 32797
643 Ga0207686_10012335 3300025934 Bacteria 4698
644 Ga0207686_10013758 3300025934 Bacteria 4487
645 Ga0207686_10282594 3300025934 Bacteria 1226
646 Ga0207686_10332271 3300025934 Bacteria 1139
647 Ga0207709_10000008 3300025935 Bacteria 713099
648 Ga0207669_10167621 3300025937 Bacteria 1559
649 Ga0207669_10229995 3300025937 Bacteria 1367
650 Ga0207669_10426146 3300025937 Unclassified 1045
651 Ga0207669_10480642 3300025937 Bacteria 990
652 Ga0207704_10000065 3300025938 Bacteria 69867
653 Ga0207704_10004767 3300025938 Bacteria 6226
654 Ga0207704_10297326 3300025938 Bacteria 1235
655 Ga0207704_10407983 3300025938 Bacteria 1074
656 Ga0207691_10002638 3300025940 Bacteria 17515
657 Ga0207691_10004182 3300025940 Bacteria 14018
658 Ga0207691_10028719 3300025940 Bacteria 5205
659 Ga0207691_10082245 3300025940 Bacteria 2893
660 Ga0207691_10163024 3300025940 Bacteria 1955
661 Ga0207691_10239007 3300025940 Unclassified 1571
662 Ga0207691_10336233 3300025940 Bacteria 1293
663 Ga0207711_10110463 3300025941 Bacteria 2445
664 Ga0207689_10001492 3300025942 Bacteria 22339
665 Ga0207689_10005311 3300025942 Bacteria 11544
666 Ga0207689_10011795 3300025942 Bacteria 7487
667 Ga0207689_10018345 3300025942 Bacteria 5904
668 Ga0207689_10020602 3300025942 Bacteria 5548
669 Ga0207689_10054081 3300025942 Bacteria 3307
670 Ga0207689_10508787 3300025942 Bacteria 1009
671 Ga0207679_10233984 3300025945 Bacteria 1553
672 Ga0207667_10000014 3300025949 Bacteria 421261
673 Ga0207667_10006330 3300025949 Bacteria 14348
674 Ga0207667_10008556 3300025949 Bacteria 12145
675 Ga0207667_10029491 3300025949 Bacteria 5950
676 Ga0207667_10070639 3300025949 Bacteria 3634
677 Ga0207667_10170911 3300025949 Bacteria 2234
678 Ga0207667_10367336 3300025949 Bacteria 1467
679 Ga0207667_10717871 3300025949 Bacteria 1001
680 Ga0207651_10003185 3300025960 Bacteria 8013
681 Ga0207651_10011676 3300025960 Bacteria 4929
682 Ga0207651_10030165 3300025960 Bacteria 3448
683 Ga0207651_10033439 3300025960 Bacteria 3317
684 Ga0207651_10094061 3300025960 Bacteria 2203
685 Ga0207712_10003635 3300025961 Bacteria 9725
686 Ga0207712_10005438 3300025961 Bacteria 8039
687 Ga0207712_10010167 3300025961 Bacteria 5966
688 Ga0207712_10016429 3300025961 Bacteria 4792
689 Ga0207712_10753190 3300025961 Bacteria 853
690 Ga0207668_10000337 3300025972 Bacteria 30364
691 Ga0207668_10022400 3300025972 Bacteria 4044
692 Ga0207668_10183172 3300025972 Bacteria 1654
693 Ga0207668_10284016 3300025972 Bacteria 1358
694 Ga0207640_10019820 3300025981 Bacteria 3981
695 Ga0207640_10031441 3300025981 Bacteria 3280
696 Ga0207640_10065577 3300025981 Bacteria 2423
697 Ga0207658_10032567 3300025986 Bacteria 3711
698 Ga0207658_10055696 3300025986 Bacteria 2932
699 Ga0207677_10003172 3300026023 Bacteria 8681
700 Ga0207677_10094632 3300026023 Bacteria 2181
701 Ga0207677_10202498 3300026023 Unclassified 1579
702 Ga0207677_10251581 3300026023 Unclassified 1435
703 Ga0207703_10012935 3300026035 Bacteria 6504
704 Ga0207703_10092614 3300026035 Bacteria 2544
705 Ga0207639_10006123 3300026041 Bacteria 8165
706 Ga0207639_10030028 3300026041 Bacteria 3984
707 Ga0207639_10035558 3300026041 Bacteria 3687
708 Ga0207639_10044982 3300026041 Bacteria 3323
709 Ga0207639_10137080 3300026041 Bacteria 2034
710 Ga0207639_10196336 3300026041 Bacteria 1727
711 Ga0207639_10212634 3300026041 Bacteria 1666
712 Ga0207639_10241198 3300026041 Bacteria 1572
713 Ga0207639_10294220 3300026041 Unclassified 1433
714 Ga0207639_10369581 3300026041 Bacteria 1285
715 Ga0207639_10441118 3300026041 Bacteria 1180
716 Ga0207639_10675531 3300026041 Bacteria 957
717 Ga0207678_10012592 3300026067 Bacteria 7431
718 Ga0207678_10144732 3300026067 Bacteria 2029
719 Ga0207708_10049372 3300026075 Unclassified 3203
720 Ga0207708_10057831 3300026075 Bacteria 2958
721 Ga0207702_10000042 3300026078 Bacteria 150673
722 Ga0207702_10121103 3300026078 Bacteria 2342
723 Ga0207702_10175128 3300026078 Bacteria 1971
724 Ga0207702_10180036 3300026078 Bacteria 1946
725 Ga0207702_10267933 3300026078 Unclassified 1610
726 Ga0207702_10276991 3300026078 Bacteria 1584
727 Ga0207702_10577303 3300026078 Bacteria 1102
728 Ga0207641_10000058 3300026088 Bacteria 166385
729 Ga0207641_10000191 3300026088 Bacteria 84147
730 Ga0207641_10003523 3300026088 Bacteria 13855
731 Ga0207641_10047477 3300026088 Bacteria 3621
732 Ga0207641_10087811 3300026088 Bacteria 2713
733 Ga0207641_10615024 3300026088 Bacteria 1065
734 Ga0207648_10000215 3300026089 Bacteria 62218
735 Ga0207648_10000886 3300026089 Bacteria 33749
736 Ga0207648_10001688 3300026089 Bacteria 24183
737 Ga0207648_10031663 3300026089 Bacteria 4675
738 Ga0207648_10035766 3300026089 Bacteria 4376
739 Ga0207648_10040646 3300026089 Bacteria 4086
740 Ga0207648_10050875 3300026089 Bacteria 3622
741 Ga0207648_10123566 3300026089 Bacteria 2276
742 Ga0207676_10001501 3300026095 Bacteria 17229
743 Ga0207676_10002935 3300026095 Bacteria 12148
744 Ga0207676_10046678 3300026095 Bacteria 3353
745 Ga0207676_10068839 3300026095 Bacteria 2833
746 Ga0207676_10364317 3300026095 Bacteria 1340
747 Ga0207674_10008410 3300026116 Bacteria 11925
748 Ga0207674_10008703 3300026116 Bacteria 11683
749 Ga0207674_10011877 3300026116 Bacteria 9764
750 Ga0207674_10037214 3300026116 Bacteria 5064
751 Ga0207674_10272260 3300026116 Bacteria 1641
752 Ga0207674_10484973 3300026116 Bacteria 1195
753 Ga0207675_100000153 3300026118 Bacteria 60593
754 Ga0207675_100008612 3300026118 Bacteria 9591
755 Ga0207675_100033909 3300026118 Bacteria 4758
756 Ga0207675_100036980 3300026118 Bacteria 4555
757 Ga0207675_100060380 3300026118 Bacteria 3539
758 Ga0207675_100290291 3300026118 Bacteria 1591
759 Ga0207683_10002748 3300026121 Bacteria 15366
760 Ga0207683_10011891 3300026121 Bacteria 7428
761 Ga0207683_10037765 3300026121 Unclassified 4207
762 Ga0207683_10079670 3300026121 Bacteria 2904
763 Ga0207683_10679434 3300026121 Bacteria 954
764 Ga0207683_10683869 3300026121 Bacteria 951
765 Ga0207698_10004214 3300026142 Bacteria 8744
766 Ga0207698_10005575 3300026142 Bacteria 7784
767 Ga0207698_10072982 3300026142 Bacteria 2730
768 Ga0207698_10946465 3300026142 Bacteria 870
769 Ga0209974_10021005 3300027876 Bacteria 2164
770 Ga0207428_10100857 3300027907 Bacteria 2231
771 Ga0207428_10572975 3300027907 Bacteria 815
772 Ga0268266_10000037 3300028379 Bacteria 342368
773 Ga0268266_10000073 3300028379 Bacteria 232074
774 Ga0268266_10016895 3300028379 Bacteria 6235
775 Ga0268266_10045725 3300028379 Bacteria 3745
776 Ga0268266_10209181 3300028379 Bacteria 1788
777 Ga0268265_10006773 3300028380 Bacteria 7752
778 Ga0268265_10090278 3300028380 Unclassified 2447
779 Ga0268265_10102288 3300028380 Bacteria 2317
780 Ga0268264_10000063 3300028381 Bacteria 301702
781 Ga0268264_10000726 3300028381 Bacteria 37807
782 Ga0268264_10008612 3300028381 Bacteria 8474
783 Ga0268264_10013525 3300028381 Bacteria 6721
784 Ga0268264_10016166 3300028381 Bacteria 6112
785 Ga0268264_10742149 3300028381 Bacteria 977
786 Ga0265323_10000199 3300028653 Bacteria 36122
787 Ga0307517_10000212 3300028786 Bacteria 99215
788 Ga0307517_10066423 3300028786 Bacteria 3319
789 Ga0307515_10000001 3300028794 Bacteria 4259510
790 Ga0307515_10000059 3300028794 Bacteria 257520
791 Ga0307515_10000224 3300028794 Bacteria 140276
792 Ga0307515_10000318 3300028794 Bacteria 118891
793 Ga0307515_10019542 3300028794 Bacteria 12180
794 Ga0307515_10096065 3300028794 Bacteria 3639
795 Ga0265338_10188569 3300028800 Bacteria 1565
796 Ga0265338_10323807 3300028800 Bacteria 1115
797 Ga0316177_1017133 3300030731 Bacteria 2693
798 Ga0316176_1014596 3300030732 Bacteria 15075
799 Ga0316183_1003890 3300030742 Bacteria 25813
800 Ga0316182_1151228 3300030745 Bacteria 2924
801 Ga0265327_10000013 3300031251 Bacteria 519549
802 Ga0265327_10037835 3300031251 Bacteria 2637
803 Ga0265316_10000566 3300031344 Bacteria 41362
804 Ga0307513_10158011 3300031456 Bacteria 2164
805 Ga0307509_10013918 3300031507 Bacteria 9490
806 Ga0307509_10052661 3300031507 Bacteria 4344
807 Ga0307509_10116179 3300031507 Bacteria 2666
808 Ga0307408_100000209 3300031548 Bacteria 62437
809 Ga0307408_100000487 3300031548 Bacteria 34716
810 Ga0316576_10017565 3300031727 Bacteria 4865
811 Ga0316576_10150285 3300031727 Bacteria 1755
812 Ga0316578_10124307 3300031728 Bacteria 1551
813 Ga0307516_10003216 3300031730 Bacteria 21192
814 Ga0307405_10000341 3300031731 Bacteria 17410
815 Ga0307405_10109604 3300031731 Bacteria 1868
816 Ga0316577_10009604 3300031733 Bacteria 5208
817 Ga0307410_10408929 3300031852 Bacteria 1098
818 Ga0307406_10381965 3300031901 Bacteria 1111
819 Ga0307407_10000002 3300031903 Bacteria 323084
820 Ga0307412_10000001 3300031911 Bacteria 822691
821 Ga0307412_10000724 3300031911 Bacteria 19071
822 Ga0307412_10115103 3300031911 Bacteria 1927
823 Ga0307412_10240019 3300031911 Bacteria 1401
824 Ga0307412_10259443 3300031911 Bacteria 1354
825 Ga0307409_100090130 3300031995 Bacteria 2509
826 Ga0307416_100000005 3300032002 Bacteria 477728
827 Ga0307414_10000655 3300032004 Bacteria 17690
828 Ga0307414_10002342 3300032004 Bacteria 9897
829 Ga0307414_10017828 3300032004 Bacteria 4354
830 Ga0307414_10043401 3300032004 Unclassified 3063
831 Ga0307414_10056253 3300032004 Bacteria 2758
832 Ga0307414_10187346 3300032004 Bacteria 1671
833 Ga0307414_10279656 3300032004 Bacteria 1402
834 Ga0307414_10281211 3300032004 Bacteria 1398
835 Ga0307411_10361010 3300032005 Unclassified 1188
836 Ga0307415_100058428 3300032126 Bacteria 2656
837 Ga0307507_10000111 3300033179 Bacteria 134722
838 Ga0307510_10000156 3300033180 Bacteria 56919
839 Ga0307510_10000249 3300033180 Bacteria 48754
840 Ga0316574_0057908 3300035398 Bacteria 2427
841 Ga0373924_0120792 3300035410 Bacteria 1137
842 Ga0373935_0260614 3300035692 Bacteria 1216
843 Ga0373927_0059830 3300035695 Bacteria 2464
844 Ga0373937_0643736 3300036401 Bacteria 1005
845 Ga0316582_0027620 3300036647 Bacteria 3430
846 Ga0316584_0000012 3300036712 Bacteria 63927
847 Ga0316584_0087146 3300036712 Bacteria 2337
848 Ga0395899_0000017 3300037312 Bacteria 440179
849 Ga0395899_0000280 3300037312 Bacteria 66580
850 Ga0395899_0016189 3300037312 Bacteria 5683
851 Ga0395899_0016320 3300037312 Bacteria 5660
852 Ga0395899_0204332 3300037312 Bacteria 1376
853 Ga0395900_0000204 3300037418 Bacteria 92834
854 Ga0395900_0006199 3300037418 Bacteria 12487
855 Ga0395900_0066255 3300037418 Bacteria 3711
856 Ga0395900_0113554 3300037418 Unclassified 2780
857 Ga0395900_0226119 3300037418 Bacteria 1884
858 Ga0395898_0058793 3300037466 Bacteria 3742
859 Ga0395905_0000327 3300037471 Bacteria 68334
860 Ga0395905_0017279 3300037471 Bacteria 6852
861 Ga0395905_0075046 3300037471 Bacteria 3169
862 Ga0395905_0296906 3300037471 Bacteria 1503
863 Ga0395905_0565956 3300037471 Bacteria 1038
864 Ga0395905_0606915 3300037471 Bacteria 996
865 Ga0395905_0615314 3300037471 Bacteria 988
866 Ga0395901_0000895 3300038443 Bacteria 32740
867 Ga0395901_0001405 3300038443 Bacteria 25148
868 Ga0395901_0075824 3300038443 Bacteria 3508
869 Ga0395901_0250108 3300038443 Bacteria 1847
870 Ga0400483_132838 3300039062 Unclassified 1411
871 Ga0400489_26798 3300039093 Bacteria 1371
872 Ga0400489_51907 3300039093 Bacteria 6269
873 Ga0436361_0762305 3300039447 Bacteria 18071
874 Ga0439436_0004969 3300041404 Bacteria 4076
875 Ga0451795_1361413 3300041456 Unclassified 1495
876 Ga0451807_0800094 3300041486 Bacteria 2344
877 Ga0451807_0937824 3300041486 Bacteria 1157
878 Ga0451837_0007994 3300041494 Bacteria 932
879 Ga0451841_1340210 3300041498 Bacteria 1007
880 Ga0451853_2563909 3300041512 Bacteria 7170
881 Ga0451853_3484866 3300041512 Bacteria 1144
882 Ga0439457_000277 3300042014 Bacteria 14123
883 Ga0439462_0026853 3300042015 Bacteria 1518
884 Ga0439434_0054191 3300042435 Unclassified 1247
885 Ga0466969_0000190 3300044656 Bacteria 33133
886 Ga0466969_0059284 3300044656 Bacteria 1861
887 Ga0466972_0000676 3300044658 Bacteria 16399
888 Ga0453683_0023888 3300044673 Bacteria 3893
889 Ga0453683_0129324 3300044673 Bacteria 1591
890 Ga0466961_0015564 3300044693 Bacteria 4882
891 Ga0466964_0019940 3300044706 Bacteria 2580
892 Ga0453684_0004859 3300044712 Bacteria 27578
893 Ga0453684_0040298 3300044712 Bacteria 6346
894 Ga0453684_0085544 3300044712 Bacteria 3917
895 Ga0453684_0346247 3300044712 Bacteria 1677
896 Ga0453684_0573803 3300044712 Unclassified 1240
897 Ga0453684_1010385 3300044712 Bacteria 884
898 Ga0453684_1026963 3300044712 Bacteria 875
899 Ga0466971_0024021 3300044719 Bacteria 2718
900 Ga0466968_0054956 3300044735 Bacteria 1708
901 Ga0466968_0072352 3300044735 Unclassified 1503
902 Ga0466968_0230653 3300044735 Bacteria 874
903 Ga0466957_0001546 3300044842 Bacteria 12103
904 Ga0466957_0001652 3300044842 Bacteria 11702
905 Ga0466957_0256075 3300044842 Bacteria 1165
906 Ga0466959_0000003 3300045049 Bacteria 285164
907 Ga0466959_0000488 3300045049 Bacteria 23122
908 Ga0466959_0168455 3300045049 Bacteria 1537
909 Ga0451576_0001978 3300045051 Bacteria 32556
910 Ga0466958_0030207 3300045836 Bacteria 3217
911 Ga0495638_0019512 3300046460 Bacteria 4486
912 Ga0495651_0155366 3300046462 Bacteria 1645
913 Ga0495650_0000268 3300046471 Bacteria 99891
914 Ga0495650_0033044 3300046471 Bacteria 2307
915 Ga0495580_0112580 3300046472 Bacteria 1890
916 Ga0495585_0000034 3300046492 Bacteria 143120
917 Ga0495585_0000785 3300046492 Bacteria 28010
918 Ga0495594_0172213 3300046499 Bacteria 1232
919 Ga0495596_0017038 3300046500 Bacteria 3014
920 Ga0495607_0221045 3300046501 Bacteria 926
921 Ga0495583_0025110 3300046506 Bacteria 2982
922 Ga0495606_0000009 3300046507 Bacteria 306313
923 Ga0495606_0003806 3300046507 Bacteria 15677
924 Ga0495606_0003961 3300046507 Bacteria 15192
925 Ga0495606_0026886 3300046507 Bacteria 4089
926 Ga0495606_0028027 3300046507 Bacteria 3981
927 Ga0495606_0031240 3300046507 Bacteria 3706
928 Ga0495606_0144048 3300046507 Bacteria 1405
929 Ga0495610_0000084 3300046512 Bacteria 112459
930 Ga0495610_0001784 3300046512 Bacteria 18806
931 Ga0495610_0058527 3300046512 Bacteria 1843
932 Ga0495610_0165173 3300046512 Bacteria 932
933 Ga0495616_0000907 3300046513 Bacteria 21368
934 Ga0495616_0128305 3300046513 Bacteria 1164
935 Ga0495618_0239537 3300046514 Bacteria 1141
936 Ga0495631_0036513 3300046518 Bacteria 2194
937 Ga0495631_0155858 3300046518 Bacteria 980
938 Ga0495632_0071972 3300046519 Bacteria 1660
939 Ga0495632_0150796 3300046519 Bacteria 1075
940 Ga0495637_0008861 3300046520 Bacteria 4924
941 Ga0495644_0004309 3300046523 Bacteria 5591
942 Ga0495648_0003762 3300046524 Bacteria 13208
943 Ga0495648_0016466 3300046524 Bacteria 5332
944 Ga0495648_0022677 3300046524 Bacteria 4315
945 Ga0495648_0076075 3300046524 Bacteria 1928
946 Ga0495648_0212462 3300046524 Bacteria 960
947 Ga0495652_0269295 3300046529 Bacteria 1253
948 Ga0495654_0042615 3300046530 Bacteria 2252
949 Ga0495609_0034564 3300046538 Bacteria 2291
950 Ga0495609_0034960 3300046538 Bacteria 2276
951 Ga0495622_0192670 3300046557 Bacteria 911
952 Ga0495633_0000785 3300046558 Bacteria 28402
953 Ga0495633_0163455 3300046558 Bacteria 1027
954 Ga0495668_0000055 3300046616 Bacteria 199412
955 Ga0495611_0000061 3300046648 Bacteria 77533
956 Ga0495625_0000007 3300046660 Bacteria 565749
957 Ga0495625_0000761 3300046660 Bacteria 44882
958 Ga0495625_0001500 3300046660 Bacteria 28046
959 Ga0495625_0003990 3300046660 Bacteria 14143
960 Ga0495625_0034276 3300046660 Bacteria 3748
961 Ga0495625_0047405 3300046660 Bacteria 3098
962 Ga0495625_0061832 3300046660 Bacteria 2648
963 Ga0495625_0187500 3300046660 Bacteria 1372
964 Ga0495625_0376184 3300046660 Bacteria 892
965 Ga0495635_0324186 3300046663 Bacteria 1030
966 Ga0495661_0001101 3300046665 Bacteria 23675
967 Ga0495661_0002357 3300046665 Bacteria 14578
968 Ga0495661_0071867 3300046665 Bacteria 2020
969 Ga0495661_0093349 3300046665 Bacteria 1708
970 Ga0495649_0000007 3300046694 Bacteria 518037
971 Ga0495660_0015258 3300046810 Bacteria 4439
972 Ga0495660_0098012 3300046810 Bacteria 1513
973 Ga0495672_0009824 3300047320 Bacteria 6885
974 Ga0495672_0035104 3300047320 Bacteria 3090
975 Ga0495672_0062090 3300047320 Bacteria 2151
976 Ga0495676_0083444 3300047321 Unclassified 2415
977 Ga0495683_0097950 3300047323 Bacteria 1413
978 Ga0495687_001497 3300047443 Bacteria 21340
979 Ga0495687_004528 3300047443 Bacteria 9335
980 Ga0495687_069141 3300047443 Bacteria 1423
981 Ga0495673_0123554 3300047469 Bacteria 1023
982 Ga0495684_0039358 3300047471 Bacteria 3624
983 Ga0495686_0000010 3300047472 Bacteria 573229
984 Ga0495686_0000965 3300047472 Bacteria 35434
985 Ga0495686_0001146 3300047472 Bacteria 31183
986 Ga0495686_0027599 3300047472 Bacteria 3705
987 Ga0495686_0093581 3300047472 Unclassified 1822
988 Ga0495686_0152669 3300047472 Bacteria 1355
989 Ga0495686_0197383 3300047472 Bacteria 1157
990 Ga0495686_0335059 3300047472 Bacteria 826
991 Ga0495602_0187154 3300048088 Bacteria 1591
992 Ga0496101_0079607 3300048904 Bacteria 2419
993 Ga0496102_0632528 3300048905 Unclassified 993
994 Ga0496104_0185735 3300048907 Bacteria 1990
995 Ga0496109_0035289 3300048912 Bacteria 4510
996 Ga0496114_0294857 3300048917 Bacteria 1431
997 Ga0496114_0349697 3300048917 Bacteria 1307
998 Ga0496114_0586328 3300048917 Bacteria 984
999 Ga0496115_0054596 3300048918 Bacteria 3208
1000 Ga0496115_0115819 3300048918 Archaea 2204
1001 Ga0496116_0002140 3300048919 Bacteria 21021
1002 Ga0496117_0001774 3300048920 Bacteria 29604
1003 Ga0496122_0000783 3300048925 Bacteria 61156
1004 Ga0496122_0003563 3300048925 Bacteria 20343
1005 Ga0496123_0000586 3300048926 Bacteria 62082
1006 Ga0496123_0111706 3300048926 Bacteria 1560
1007 Ga0496125_0034972 3300048928 Bacteria 4419
1008 Ga0495678_042611 3300049459 Bacteria 1808
1009 Ga0501031_0002263 3300049568 Bacteria 12196
1010 Ga0501032_0010324 3300049569 Bacteria 6737
1011 Ga0501032_0114378 3300049569 Bacteria 1784
1012 Ga0501033_0010409 3300049570 Bacteria 7134
1013 Ga0501034_0000004 3300049571 Bacteria 382255
1014 Ga0501034_0026263 3300049571 Bacteria 5931
1015 Ga0501034_0035864 3300049571 Bacteria 5028
1016 Ga0501036_0001446 3300049572 Bacteria 18239
1017 Ga0501036_0022006 3300049572 Bacteria 5361
1018 Ga0501037_0007204 3300049573 Bacteria 8126
1019 Ga0501038_0003270 3300049574 Bacteria 15111
1020 Ga0501038_0015262 3300049574 Bacteria 6984
1021 Ga0501039_0009680 3300049575 Bacteria 7344
1022 Ga0501039_0042353 3300049575 Bacteria 3518
1023 Ga0501043_0010690 3300049579 Bacteria 7189
1024 Ga0501043_0424297 3300049579 Unclassified 1002
1025 Ga0501046_0016366 3300049580 Bacteria 6212
1026 Ga0501047_0009030 3300049581 Bacteria 9412
1027 Ga0501047_0054326 3300049581 Bacteria 3874
1028 Ga0501047_0568911 3300049581 Bacteria 957
1029 Ga0501048_0023532 3300049582 Bacteria 4501
1030 Ga0501067_0037603 3300049583 Unclassified 2688
1031 Ga0501068_0238384 3300049584 Bacteria 1157
1032 Ga0501070_0006613 3300049586 Bacteria 9866
1033 Ga0501070_0108613 3300049586 Bacteria 2292
1034 Ga0501072_0138330 3300049588 Bacteria 1942
1035 Ga0501073_0027520 3300049589 Bacteria 4065
1036 Ga0501073_0412582 3300049589 Bacteria 933
1037 Ga0501074_0012286 3300049590 Bacteria 6224
1038 Ga0501077_0289592 3300049593 Bacteria 1043
1039 Ga0501198_009024 3300049649 Bacteria 1457
1040 Ga0501223_008443 3300049663 Unclassified 2100
1041 Ga0501233_031841 3300049668 Bacteria 1196
1042 Ga0501252_006347 3300049682 Bacteria 1313
1043 Ga0501261_010340 3300049690 Bacteria 1228
1044 Ga0501221_006925 3300049704 Bacteria 1929
1045 Ga0501225_0001601 3300049705 Bacteria 7072
1046 Ga0501080_0164554 3300049742 Bacteria 2047
1047 Ga0501083_0042934 3300049744 Bacteria 3064
1048 Ga0501241_012071 3300049758 Bacteria 1569
1049 Ga0501035_0005853 3300049822 Bacteria 11596
1050 Ga0501035_0039105 3300049822 Unclassified 4294
1051 Ga0501035_0390602 3300049822 Bacteria 1159
1052 Ga0501044_0068107 3300049823 Bacteria 3626
1053 Ga0501044_0574614 3300049823 Bacteria 1022
1054 Ga0501045_0057147 3300049824 Bacteria 2855
1055 nmdc:mga0k408_11130_c1 3300050493 Bacteria 4890
1056 nmdc:mga0k408_120_c1 3300050493 Bacteria 38359
1057 nmdc:mga0k408_217666_c1 3300050493 Bacteria 1140
1058 nmdc:mga0k408_245849_c1 3300050493 Bacteria 1068
1059 nmdc:mga0k408_26107_c1 3300050493 Bacteria 3311
1060 nmdc:mga0k408_364_c1 3300050493 Bacteria 24845
1061 nmdc:mga0k408_52941_c1 3300050493 Bacteria 2352
1062 nmdc:mga05p37_286222_c1 3300050507 Bacteria 1963
1063 nmdc:mga05p37_482_c1 3300050507 Bacteria 43621
1064 nmdc:mga09592_5311_c1 3300050508 Bacteria 10470
1065 nmdc:mga09592_674267_c1 3300050508 Bacteria 881
1066 nmdc:mga09592_85887_c1 3300050508 Bacteria 2685
1067 nmdc:mga09592_92423_c1 3300050508 Bacteria 2586
1068 nmdc:mga0qj67_134949_c1 3300050509 Bacteria 2000
1069 nmdc:mga06r32_36625_c1 3300050510 Bacteria 4638
1070 nmdc:mga08y16_62717_c1 3300050511 Bacteria 3882
1071 nmdc:mga08y16_967371_c1 3300050511 Unclassified 833
1072 Ga0500635_0001085 3300053080 Bacteria 6499
1073 Ga0500578_0001568 3300053086 Bacteria 22320
1074 Ga0500644_0035720 3300053088 Bacteria 1612
1075 Ga0500644_0079193 3300053088 Bacteria 1204
1076 Ga0500646_0000772 3300053090 Bacteria 8994
1077 Ga0500646_0004874 3300053090 Bacteria 3399
1078 Ga0500646_0011068 3300053090 Bacteria 2318
1079 Ga0500646_0013394 3300053090 Bacteria 2122
1080 Ga0500583_0000019 3300053092 Bacteria 130534
1081 Ga0500583_0004003 3300053092 Bacteria 4736
1082 Ga0500583_0004520 3300053092 Bacteria 4547
1083 Ga0500650_0013159 3300053098 Bacteria 3463
1084 Ga0500556_0065227 3300053104 Bacteria 1350
1085 Ga0500562_000034 3300053108 Bacteria 83634
1086 Ga0500562_018478 3300053108 Bacteria 1801
1087 Ga0500608_048215 3300053122 Bacteria 2046
1088 Ga0500614_015999 3300053123 Bacteria 1678
1089 Ga0500618_000006 3300053125 Bacteria 239188
1090 Ga0500642_0015283 3300053130 Bacteria 2882
1091 Ga0500642_0030869 3300053130 Bacteria 2234
1092 Ga0500642_0050257 3300053130 Bacteria 1837
1093 Ga0500652_025738 3300053131 Bacteria 2258
1094 Ga0500568_0000208 3300053139 Bacteria 51266
1095 Ga0500568_0010529 3300053139 Unclassified 4325
1096 Ga0500579_181385 3300053143 Bacteria 828
1097 Ga0500588_0059628 3300053146 Bacteria 1218
1098 Ga0500589_023513 3300053147 Bacteria 2841
1099 Ga0500603_005882 3300053150 Bacteria 2656
1100 Ga0500616_0037550 3300053153 Bacteria 2622
1101 Ga0500616_0063716 3300053153 Bacteria 1900
1102 Ga0500622_0009240 3300053156 Bacteria 5468
1103 Ga0500622_0017330 3300053156 Bacteria 3832
1104 Ga0500622_0225171 3300053156 Bacteria 838
1105 Ga0500624_000567 3300053157 Bacteria 10211
1106 Ga0500639_058120 3300053163 Bacteria 1999
1107 Ga0501084_0014521 3300054114 Bacteria 6529
1108 Ga0500661_016255 3300055283 Bacteria 1331
1109 Ga0501082_0046092 3300060353 Bacteria 3759
1110 Ga0501082_0212638 3300060353 Bacteria 1682
1111 Ga0466962_0007910 3300061719 Bacteria 5098

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0007994 Ga0451837_0007994_185_895 235
2 3300048917 Ga0496114_0586328 Ga0496114_0586328_18_728 235
3 3300053108 Ga0500562_018478 Ga0500562_018478_721_1434 235
4 3300053143 Ga0500579_181385 Ga0500579_181385_74_784 236
5 3300009147 Ga0114129_10001062 Ga0114129_1000106217 239
6 3300031507 Ga0307509_10013918 Ga0307509_1001391813 239
7 3300039447 Ga0436361_0762305 Ga0436361_0762305_8004_8723 239
8 3300044712 Ga0453684_0004859 Ga0453684_0004859_3957_4721 239
9 3300050493 nmdc:mga0k408_26107_c1 nmdc:mga0k408_26107_c1_1238_1960 239
10 3300053156 Ga0500622_0225171 Ga0500622_0225171_97_819 239
11 3300005539 Ga0068853_100140645 Ga0068853_1001406452 240
12 3300005578 Ga0068854_100182933 Ga0068854_1001829332 240
13 3300005843 Ga0068860_100005506 Ga0068860_1000055066 240
14 3300009093 Ga0105240_10003157 Ga0105240_1000315719 240
15 3300009148 Ga0105243_10209191 Ga0105243_102091914 240
16 3300010375 Ga0105239_10092212 Ga0105239_100922123 240
17 3300025913 Ga0207695_10000066 Ga0207695_10000066294 240
18 3300025913 Ga0207695_10135664 Ga0207695_101356642 240
19 3300026041 Ga0207639_10137080 Ga0207639_101370802 240
20 3300044712 Ga0453684_1010385 Ga0453684_1010385_33_758 240
21 3300045051 Ga0451576_0001978 Ga0451576_0001978_24700_25464 240
22 3300047320 Ga0495672_0009824 Ga0495672_0009824_4824_5549 240
23 3300048918 Ga0496115_0115819 Ga0496115_0115819_1046_1774 240
24 3300049584 Ga0501068_0238384 Ga0501068_0238384_35_760 240
25 3300013307 Ga0157372_10006375 Ga0157372_1000637511 241
26 3300020077 Ga0206351_10474630 Ga0206351_104746302 241
27 3300020080 Ga0206350_10768666 Ga0206350_107686662 241
28 3300020610 Ga0154015_1561766 Ga0154015_15617662 241
29 3300050507 nmdc:mga05p37_482_c1 nmdc:mga05p37_482_c1_24022_24765 246
30 3300053092 Ga0500583_0000019 Ga0500583_0000019_67386_68150 246
31 3300009553 Ga0105249_10007464 Ga0105249_1000746414 247
32 3300013306 Ga0163162_10002340 Ga0163162_1000234016 247
33 3300013308 Ga0157375_10113118 Ga0157375_101131186 247
34 3300014968 Ga0157379_10065702 Ga0157379_100657023 247
35 3300017792 Ga0163161_10029926 Ga0163161_100299268 247
36 3300025961 Ga0207712_10753190 Ga0207712_107531901 247
37 3300046519 Ga0495632_0071972 Ga0495632_0071972_886_1650 247
38 3300049822 Ga0501035_0390602 Ga0501035_0390602_14_757 247
39 3300049668 Ga0501233_031841 Ga0501233_031841_43_819 248
40 3300049690 Ga0501261_010340 Ga0501261_010340_149_925 248
41 3300049704 Ga0501221_006925 Ga0501221_006925_659_1435 248
42 iso_pu_bacteria 2833640130 2833641368 249
43 iso_pu_bacteria 2839989709 2839990581 249
44 iso_pu_bacteria 2890737413 2890739079 249
45 iso_pu_bacteria 2929154850 2929159730 249
46 iso_pu_bacteria 2738541278 2738725036 250
47 iso_pu_bacteria 2898713307 2898714354 250
48 iso_pu_bacteria 2910245624 2910250683 250
49 iso_pu_bacteria 3003233435 3003234915 250
50 iso_pu_bacteria 2585427687 2586206512 251
51 iso_pu_bacteria 2599185184 2599480759 251
52 iso_pu_bacteria 2721755487 2722730882 251
53 iso_pu_bacteria 2738541302 2738852789 251
54 iso_pu_bacteria 2739367651 2739586730 251
55 iso_pu_bacteria 2739367663 2739645826 251
56 iso_pu_bacteria 2818991437 2819547153 251
57 iso_pu_bacteria 2842722452 2842727078 251
58 iso_pu_bacteria 2842909656 2842910920 251
59 iso_pu_bacteria 2849281842 2849284129 251
60 iso_pu_bacteria 2852623160 2852626383 251
61 iso_pu_bacteria 2857627736 2857628011 251
62 iso_pu_bacteria 2884933994 2884934835 251
63 iso_pu_bacteria 2895498888 2895501088 251
64 iso_pu_bacteria 2902048731 2902050600 251
65 iso_pu_bacteria 2904445276 2904447630 251
66 iso_pu_bacteria 2904780799 2904783584 251
67 iso_pu_bacteria 2919177583 2919181446 251
68 iso_pu_bacteria 2919437846 2919439935 251
69 iso_pu_bacteria 2928078545 2928081651 251
70 iso_pu_bacteria 2928147474 2928150321 251
71 iso_pu_bacteria 2932082852 2932085144 251
72 iso_pu_bacteria 2945997725 2945997974 251
73 iso_pu_bacteria 2977232053 2977234695 251
74 iso_pu_bacteria 2738541283 2738755808 252
75 iso_pu_bacteria 2738541284 2738761528 252
76 iso_pu_bacteria 2738543023 2739302953 252
77 iso_pu_bacteria 2775506987 2776615836 252
78 iso_pu_bacteria 2842903701 2842904992 252
79 iso_pu_bacteria 2852627209 2852628046 252
80 iso_pu_bacteria 2919186247 2919188404 252
81 iso_pu_bacteria 2939664404 2939667511 252
82 3300003322 rootL2_10198285 rootL2_101982853 253
83 3300005337 Ga0070682_100000041 Ga0070682_10000004130 253
84 3300005364 Ga0070673_100059643 Ga0070673_1000596434 253
85 3300005539 Ga0068853_100151022 Ga0068853_1001510222 253
86 3300005548 Ga0070665_100023328 Ga0070665_1000233285 253
87 3300005834 Ga0068851_10104294 Ga0068851_101042941 253
88 3300005841 Ga0068863_100011017 Ga0068863_10001101710 253
89 3300005842 Ga0068858_100474363 Ga0068858_1004743632 253
90 3300006358 Ga0068871_100326853 Ga0068871_1003268532 253
91 3300010375 Ga0105239_10020600 Ga0105239_100206002 253
92 3300010375 Ga0105239_10389838 Ga0105239_103898382 253
93 3300013296 Ga0157374_10454911 Ga0157374_104549111 253
94 3300013297 Ga0157378_10027671 Ga0157378_100276717 253
95 3300013307 Ga0157372_10464309 Ga0157372_104643092 253
96 3300014325 Ga0163163_10279568 Ga0163163_102795682 253
97 3300025321 Ga0207656_10022813 Ga0207656_100228135 253
98 3300025904 Ga0207647_10024864 Ga0207647_100248643 253
99 3300025913 Ga0207695_10056221 Ga0207695_100562213 253
100 3300026023 Ga0207677_10094632 Ga0207677_100946322 253
101 3300026088 Ga0207641_10003523 Ga0207641_100035236 253
102 3300026095 Ga0207676_10046678 Ga0207676_100466782 253
103 3300028379 Ga0268266_10016895 Ga0268266_100168952 253
104 3300028653 Ga0265323_10000199 Ga0265323_1000019931 253
105 3300031251 Ga0265327_10037835 Ga0265327_100378351 253
106 3300031344 Ga0265316_10000566 Ga0265316_100005663 253
107 3300031727 Ga0316576_10017565 Ga0316576_100175652 253
108 3300031727 Ga0316576_10150285 Ga0316576_101502852 253
109 3300031728 Ga0316578_10124307 Ga0316578_101243071 253
110 3300031733 Ga0316577_10009604 Ga0316577_100096043 253
111 3300032126 Ga0307415_100058428 Ga0307415_1000584282 253
112 3300035398 Ga0316574_0057908 Ga0316574_0057908_580_1344 253
113 3300035695 Ga0373927_0059830 Ga0373927_0059830_1234_1998 253
114 3300036647 Ga0316582_0027620 Ga0316582_0027620_1879_2649 253
115 3300036712 Ga0316584_0000012 Ga0316584_0000012_41497_42267 253
116 3300036712 Ga0316584_0087146 Ga0316584_0087146_12_776 253
117 3300037418 Ga0395900_0226119 Ga0395900_0226119_464_1225 253
118 3300038443 Ga0395901_0001405 Ga0395901_0001405_3072_3833 253
119 3300038443 Ga0395901_0250108 Ga0395901_0250108_130_891 253
120 3300039062 Ga0400483_132838 Ga0400483_132838_324_1094 253
121 3300041404 Ga0439436_0004969 Ga0439436_0004969_1988_2752 253
122 3300041456 Ga0451795_1361413 Ga0451795_1361413_588_1352 253
123 3300042014 Ga0439457_000277 Ga0439457_000277_3641_4405 253
124 3300042015 Ga0439462_0026853 Ga0439462_0026853_491_1255 253
125 3300044656 Ga0466969_0000190 Ga0466969_0000190_17029_17793 253
126 3300044673 Ga0453683_0129324 Ga0453683_0129324_805_1569 253
127 3300044706 Ga0466964_0019940 Ga0466964_0019940_609_1373 253
128 3300044712 Ga0453684_0085544 Ga0453684_0085544_925_1689 253
129 3300044712 Ga0453684_1026963 Ga0453684_1026963_90_860 253
130 3300044735 Ga0466968_0054956 Ga0466968_0054956_399_1163 253
131 3300044842 Ga0466957_0001652 Ga0466957_0001652_9739_10503 253
132 3300045049 Ga0466959_0000003 Ga0466959_0000003_144897_145661 253
133 3300049705 Ga0501225_0001601 Ga0501225_0001601_4636_5400 253
134 3300050493 nmdc:mga0k408_217666_c1 nmdc:mga0k408_217666_c1_284_1048 253
135 3300053088 Ga0500644_0035720 Ga0500644_0035720_295_1092 253
136 3300053090 Ga0500646_0004874 Ga0500646_0004874_1506_2270 253
137 3300053092 Ga0500583_0004520 Ga0500583_0004520_1889_2653 253
138 3300053108 Ga0500562_000034 Ga0500562_000034_53949_54746 253
139 3300053130 Ga0500642_0030869 Ga0500642_0030869_171_935 253
140 3300053131 Ga0500652_025738 Ga0500652_025738_286_1050 253
141 3300053139 Ga0500568_0000208 Ga0500568_0000208_17593_18357 253
142 3300053147 Ga0500589_023513 Ga0500589_023513_194_958 253
143 3300053150 Ga0500603_005882 Ga0500603_005882_467_1231 253
144 3300053153 Ga0500616_0063716 Ga0500616_0063716_853_1650 253
145 3300053156 Ga0500622_0009240 Ga0500622_0009240_2432_3229 253
146 3300053163 Ga0500639_058120 Ga0500639_058120_884_1648 253
147 3300055283 Ga0500661_016255 Ga0500661_016255_440_1237 253
148 2162886012 MBSR1b_contig_11496357 MBSR1b_0760.00003440 254
149 3300001904 JGI24736J21556_1011527 JGI24736J21556_10115272 254
150 3300002155 JGI24033J26618_1007771 JGI24033J26618_10077711 254
151 3300002738 JGI25154J39366_1004687 JGI25154J39366_10046874 254
152 3300003316 rootH1_10102873 rootH1_101028732 254
153 3300003320 rootH2_10007161 rootH2_1000716132 254
154 3300003320 rootH2_10089828 rootH2_100898282 254
155 3300003322 rootL2_10094458 rootL2_100944582 254
156 3300003354 JGI25160J50197_1001108 JGI25160J50197_10011089 254
157 3300005288 Ga0065714_10072850 Ga0065714_100728502 254
158 3300005290 Ga0065712_10002703 Ga0065712_100027033 254
159 3300005290 Ga0065712_10074233 Ga0065712_100742335 254
160 3300005290 Ga0065712_10199717 Ga0065712_101997172 254
161 3300005293 Ga0065715_10270193 Ga0065715_102701932 254
162 3300005295 Ga0065707_10143673 Ga0065707_101436733 254
163 3300005327 Ga0070658_10001765 Ga0070658_1000176512 254
164 3300005328 Ga0070676_10004348 Ga0070676_100043484 254
165 3300005328 Ga0070676_10015311 Ga0070676_100153113 254
166 3300005328 Ga0070676_10041152 Ga0070676_100411522 254
167 3300005328 Ga0070676_10166487 Ga0070676_101664871 254
168 3300005330 Ga0070690_100053377 Ga0070690_1000533772 254
169 3300005330 Ga0070690_100094008 Ga0070690_1000940081 254
170 3300005330 Ga0070690_100146863 Ga0070690_1001468631 254
171 3300005331 Ga0070670_100027378 Ga0070670_1000273785 254
172 3300005331 Ga0070670_100031040 Ga0070670_1000310404 254
173 3300005331 Ga0070670_100052324 Ga0070670_1000523244 254
174 3300005331 Ga0070670_100255751 Ga0070670_1002557511 254
175 3300005333 Ga0070677_10024926 Ga0070677_100249263 254
176 3300005333 Ga0070677_10038588 Ga0070677_100385882 254
177 3300005334 Ga0068869_100003737 Ga0068869_1000037377 254
178 3300005334 Ga0068869_100006757 Ga0068869_1000067577 254
179 3300005334 Ga0068869_100021858 Ga0068869_1000218582 254
180 3300005334 Ga0068869_100068253 Ga0068869_1000682531 254
181 3300005334 Ga0068869_100245495 Ga0068869_1002454951 254
182 3300005335 Ga0070666_10000072 Ga0070666_1000007269 254
183 3300005335 Ga0070666_10000856 Ga0070666_1000085613 254
184 3300005335 Ga0070666_10010262 Ga0070666_100102625 254
185 3300005335 Ga0070666_10024067 Ga0070666_100240674 254
186 3300005335 Ga0070666_10408838 Ga0070666_104088381 254
187 3300005336 Ga0070680_100001822 Ga0070680_1000018228 254
188 3300005337 Ga0070682_100001992 Ga0070682_1000019924 254
189 3300005337 Ga0070682_100140391 Ga0070682_1001403912 254
190 3300005338 Ga0068868_100002491 Ga0068868_1000024915 254
191 3300005338 Ga0068868_100066227 Ga0068868_1000662274 254
192 3300005338 Ga0068868_100095762 Ga0068868_1000957621 254
193 3300005338 Ga0068868_100218724 Ga0068868_1002187242 254
194 3300005340 Ga0070689_100077847 Ga0070689_1000778472 254
195 3300005341 Ga0070691_10009617 Ga0070691_100096174 254
196 3300005341 Ga0070691_10187779 Ga0070691_101877791 254
197 3300005343 Ga0070687_100008339 Ga0070687_1000083391 254
198 3300005343 Ga0070687_100058866 Ga0070687_1000588662 254
199 3300005344 Ga0070661_100061111 Ga0070661_1000611113 254
200 3300005347 Ga0070668_100004192 Ga0070668_1000041925 254
201 3300005347 Ga0070668_100022027 Ga0070668_1000220273 254
202 3300005347 Ga0070668_100029190 Ga0070668_1000291902 254
203 3300005347 Ga0070668_100272610 Ga0070668_1002726102 254
204 3300005347 Ga0070668_100327614 Ga0070668_1003276141 254
205 3300005353 Ga0070669_100019580 Ga0070669_1000195805 254
206 3300005353 Ga0070669_100067601 Ga0070669_1000676012 254
207 3300005353 Ga0070669_100090023 Ga0070669_1000900232 254
208 3300005354 Ga0070675_100011810 Ga0070675_1000118103 254
209 3300005354 Ga0070675_100052152 Ga0070675_1000521521 254
210 3300005354 Ga0070675_100070805 Ga0070675_1000708053 254
211 3300005354 Ga0070675_100071251 Ga0070675_1000712511 254
212 3300005354 Ga0070675_100103942 Ga0070675_1001039422 254
213 3300005355 Ga0070671_100067613 Ga0070671_1000676132 254
214 3300005355 Ga0070671_100070322 Ga0070671_1000703221 254
215 3300005355 Ga0070671_100308249 Ga0070671_1003082492 254
216 3300005356 Ga0070674_100187387 Ga0070674_1001873871 254
217 3300005356 Ga0070674_100192412 Ga0070674_1001924122 254
218 3300005356 Ga0070674_100413987 Ga0070674_1004139871 254
219 3300005364 Ga0070673_100001930 Ga0070673_10000193012 254
220 3300005364 Ga0070673_100004765 Ga0070673_1000047652 254
221 3300005364 Ga0070673_100017257 Ga0070673_1000172572 254
222 3300005364 Ga0070673_100023510 Ga0070673_1000235103 254
223 3300005364 Ga0070673_100027647 Ga0070673_1000276472 254
224 3300005364 Ga0070673_100096617 Ga0070673_1000966172 254
225 3300005364 Ga0070673_100228490 Ga0070673_1002284902 254
226 3300005364 Ga0070673_100446374 Ga0070673_1004463741 254
227 3300005365 Ga0070688_100001768 Ga0070688_10000176810 254
228 3300005365 Ga0070688_100044922 Ga0070688_1000449222 254
229 3300005365 Ga0070688_100111182 Ga0070688_1001111822 254
230 3300005366 Ga0070659_100008229 Ga0070659_1000082292 254
231 3300005366 Ga0070659_100267958 Ga0070659_1002679582 254
232 3300005367 Ga0070667_100003102 Ga0070667_1000031026 254
233 3300005367 Ga0070667_100077424 Ga0070667_1000774242 254
234 3300005367 Ga0070667_100087633 Ga0070667_1000876333 254
235 3300005441 Ga0070700_100024503 Ga0070700_1000245031 254
236 3300005455 Ga0070663_100182436 Ga0070663_1001824361 254
237 3300005456 Ga0070678_100060730 Ga0070678_1000607301 254
238 3300005456 Ga0070678_100331526 Ga0070678_1003315262 254
239 3300005457 Ga0070662_100074082 Ga0070662_1000740821 254
240 3300005458 Ga0070681_10025021 Ga0070681_100250215 254
241 3300005459 Ga0068867_100005280 Ga0068867_1000052805 254
242 3300005459 Ga0068867_100053647 Ga0068867_1000536473 254
243 3300005459 Ga0068867_100076943 Ga0068867_1000769433 254
244 3300005459 Ga0068867_100172069 Ga0068867_1001720692 254
245 3300005459 Ga0068867_100281531 Ga0068867_1002815312 254
246 3300005459 Ga0068867_100444756 Ga0068867_1004447562 254
247 3300005459 Ga0068867_100560372 Ga0068867_1005603721 254
248 3300005466 Ga0070685_10025086 Ga0070685_100250863 254
249 3300005466 Ga0070685_10040270 Ga0070685_100402702 254
250 3300005466 Ga0070685_10091082 Ga0070685_100910821 254
251 3300005466 Ga0070685_10356252 Ga0070685_103562521 254
252 3300005471 Ga0070698_100002009 Ga0070698_10000200915 254
253 3300005471 Ga0070698_100005327 Ga0070698_1000053278 254
254 3300005471 Ga0070698_100048986 Ga0070698_1000489862 254
255 3300005518 Ga0070699_100057554 Ga0070699_1000575544 254
256 3300005518 Ga0070699_100472201 Ga0070699_1004722012 254
257 3300005530 Ga0070679_100464348 Ga0070679_1004643482 254
258 3300005539 Ga0068853_100005414 Ga0068853_10000541412 254
259 3300005539 Ga0068853_100012933 Ga0068853_1000129334 254
260 3300005539 Ga0068853_100158131 Ga0068853_1001581312 254
261 3300005539 Ga0068853_100179807 Ga0068853_1001798071 254
262 3300005539 Ga0068853_100421669 Ga0068853_1004216692 254
263 3300005539 Ga0068853_100575633 Ga0068853_1005756331 254
264 3300005539 Ga0068853_100844927 Ga0068853_1008449271 254
265 3300005543 Ga0070672_100003625 Ga0070672_10000362511 254
266 3300005543 Ga0070672_100004263 Ga0070672_1000042638 254
267 3300005543 Ga0070672_100045387 Ga0070672_1000453875 254
268 3300005543 Ga0070672_100051032 Ga0070672_1000510323 254
269 3300005543 Ga0070672_100120475 Ga0070672_1001204752 254
270 3300005543 Ga0070672_100199695 Ga0070672_1001996952 254
271 3300005543 Ga0070672_100748815 Ga0070672_1007488151 254
272 3300005544 Ga0070686_100129013 Ga0070686_1001290132 254
273 3300005545 Ga0070695_100222520 Ga0070695_1002225202 254
274 3300005547 Ga0070693_100018363 Ga0070693_1000183633 254
275 3300005548 Ga0070665_100000002 Ga0070665_100000002629 254
276 3300005548 Ga0070665_100003483 Ga0070665_1000034835 254
277 3300005549 Ga0070704_100141484 Ga0070704_1001414842 254
278 3300005563 Ga0068855_100030343 Ga0068855_1000303435 254
279 3300005563 Ga0068855_100170531 Ga0068855_1001705312 254
280 3300005563 Ga0068855_100707052 Ga0068855_1007070521 254
281 3300005577 Ga0068857_100004236 Ga0068857_1000042367 254
282 3300005577 Ga0068857_100054498 Ga0068857_1000544985 254
283 3300005577 Ga0068857_100067223 Ga0068857_1000672232 254
284 3300005577 Ga0068857_100092630 Ga0068857_1000926302 254
285 3300005578 Ga0068854_100148514 Ga0068854_1001485142 254
286 3300005614 Ga0068856_100015577 Ga0068856_1000155778 254
287 3300005614 Ga0068856_100025193 Ga0068856_1000251936 254
288 3300005615 Ga0070702_100016339 Ga0070702_1000163393 254
289 3300005615 Ga0070702_100288736 Ga0070702_1002887362 254
290 3300005616 Ga0068852_100002922 Ga0068852_1000029229 254
291 3300005616 Ga0068852_100011729 Ga0068852_1000117298 254
292 3300005616 Ga0068852_100647032 Ga0068852_1006470322 254
293 3300005616 Ga0068852_100826874 Ga0068852_1008268741 254
294 3300005617 Ga0068859_100000006 Ga0068859_10000000672 254
295 3300005617 Ga0068859_100000710 Ga0068859_10000071026 254
296 3300005617 Ga0068859_100029400 Ga0068859_1000294006 254
297 3300005617 Ga0068859_100033372 Ga0068859_1000333728 254
298 3300005617 Ga0068859_100039276 Ga0068859_1000392763 254
299 3300005618 Ga0068864_100000469 Ga0068864_10000046920 254
300 3300005618 Ga0068864_100004006 Ga0068864_1000040064 254
301 3300005618 Ga0068864_100025199 Ga0068864_1000251996 254
302 3300005618 Ga0068864_100070475 Ga0068864_1000704752 254
303 3300005618 Ga0068864_100078723 Ga0068864_1000787232 254
304 3300005719 Ga0068861_100004575 Ga0068861_1000045753 254
305 3300005719 Ga0068861_100032792 Ga0068861_1000327923 254
306 3300005719 Ga0068861_100040662 Ga0068861_1000406622 254
307 3300005719 Ga0068861_100058903 Ga0068861_1000589032 254
308 3300005834 Ga0068851_10006291 Ga0068851_100062912 254
309 3300005834 Ga0068851_10045235 Ga0068851_100452352 254
310 3300005834 Ga0068851_10229126 Ga0068851_102291261 254
311 3300005840 Ga0068870_10049060 Ga0068870_100490604 254
312 3300005840 Ga0068870_10234124 Ga0068870_102341241 254
313 3300005841 Ga0068863_100002075 Ga0068863_10000207518 254
314 3300005841 Ga0068863_100002232 Ga0068863_1000022329 254
315 3300005841 Ga0068863_100067774 Ga0068863_1000677743 254
316 3300005841 Ga0068863_100085429 Ga0068863_1000854292 254
317 3300005841 Ga0068863_100284546 Ga0068863_1002845462 254
318 3300005842 Ga0068858_100000978 Ga0068858_10000097829 254
319 3300005842 Ga0068858_100000982 Ga0068858_10000098212 254
320 3300005843 Ga0068860_100008211 Ga0068860_1000082114 254
321 3300005843 Ga0068860_100042291 Ga0068860_1000422915 254
322 3300005843 Ga0068860_100108924 Ga0068860_1001089242 254
323 3300005843 Ga0068860_100182869 Ga0068860_1001828692 254
324 3300005843 Ga0068860_100263671 Ga0068860_1002636712 254
325 3300005843 Ga0068860_100375898 Ga0068860_1003758982 254
326 3300005844 Ga0068862_100012568 Ga0068862_1000125689 254
327 3300005844 Ga0068862_100122457 Ga0068862_1001224572 254
328 3300005844 Ga0068862_100372308 Ga0068862_1003723082 254
329 3300006237 Ga0097621_100001174 Ga0097621_10000117412 254
330 3300006237 Ga0097621_100001598 Ga0097621_1000015983 254
331 3300006237 Ga0097621_100015672 Ga0097621_1000156724 254
332 3300006237 Ga0097621_100070912 Ga0097621_1000709122 254
333 3300006237 Ga0097621_100528583 Ga0097621_1005285831 254
334 3300006237 Ga0097621_100587488 Ga0097621_1005874881 254
335 3300006358 Ga0068871_100001193 Ga0068871_1000011933 254
336 3300006358 Ga0068871_100002679 Ga0068871_1000026796 254
337 3300006358 Ga0068871_100019800 Ga0068871_1000198002 254
338 3300006358 Ga0068871_100031523 Ga0068871_1000315234 254
339 3300006358 Ga0068871_100048996 Ga0068871_1000489961 254
340 3300006358 Ga0068871_100058614 Ga0068871_1000586142 254
341 3300006358 Ga0068871_100307763 Ga0068871_1003077632 254
342 3300006844 Ga0075428_100015265 Ga0075428_1000152651 254
343 3300006846 Ga0075430_100054183 Ga0075430_1000541832 254
344 3300006880 Ga0075429_100004785 Ga0075429_1000047852 254
345 3300006880 Ga0075429_100060953 Ga0075429_1000609533 254
346 3300006880 Ga0075429_100084913 Ga0075429_1000849133 254
347 3300006881 Ga0068865_100001197 Ga0068865_1000011978 254
348 3300006881 Ga0068865_100008116 Ga0068865_1000081165 254
349 3300006881 Ga0068865_100084017 Ga0068865_1000840172 254
350 3300006881 Ga0068865_100133605 Ga0068865_1001336053 254
351 3300006881 Ga0068865_100308013 Ga0068865_1003080131 254
352 3300006931 Ga0097620_100000006 Ga0097620_10000000672 254
353 3300006931 Ga0097620_100000710 Ga0097620_10000071026 254
354 3300006931 Ga0097620_100029399 Ga0097620_1000293993 254
355 3300006931 Ga0097620_100033374 Ga0097620_1000333748 254
356 3300006931 Ga0097620_100039276 Ga0097620_1000392763 254
357 3300009093 Ga0105240_10001189 Ga0105240_100011899 254
358 3300009093 Ga0105240_10003164 Ga0105240_1000316423 254
359 3300009093 Ga0105240_10016999 Ga0105240_1001699910 254
360 3300009093 Ga0105240_10060030 Ga0105240_100600303 254
361 3300009094 Ga0111539_11064710 Ga0111539_110647101 254
362 3300009101 Ga0105247_10004101 Ga0105247_100041019 254
363 3300009147 Ga0114129_10294403 Ga0114129_102944033 254
364 3300009148 Ga0105243_10150831 Ga0105243_101508312 254
365 3300009174 Ga0105241_10000324 Ga0105241_1000032420 254
366 3300009174 Ga0105241_10000620 Ga0105241_1000062018 254
367 3300009174 Ga0105241_10007142 Ga0105241_100071423 254
368 3300009174 Ga0105241_10052711 Ga0105241_100527113 254
369 3300009174 Ga0105241_10059451 Ga0105241_100594515 254
370 3300009174 Ga0105241_10322771 Ga0105241_103227711 254
371 3300009176 Ga0105242_10005785 Ga0105242_100057854 254
372 3300009176 Ga0105242_10026804 Ga0105242_100268047 254
373 3300009176 Ga0105242_10050764 Ga0105242_100507643 254
374 3300009176 Ga0105242_10061209 Ga0105242_100612092 254
375 3300009176 Ga0105242_10130639 Ga0105242_101306392 254
376 3300009176 Ga0105242_10318202 Ga0105242_103182022 254
377 3300009177 Ga0105248_10016968 Ga0105248_100169687 254
378 3300009177 Ga0105248_10723808 Ga0105248_107238082 254
379 3300009545 Ga0105237_10000144 Ga0105237_1000014417 254
380 3300009545 Ga0105237_10005021 Ga0105237_100050219 254
381 3300009545 Ga0105237_10005145 Ga0105237_100051456 254
382 3300009545 Ga0105237_10011015 Ga0105237_100110157 254
383 3300009545 Ga0105237_10122598 Ga0105237_101225981 254
384 3300009545 Ga0105237_10136395 Ga0105237_101363953 254
385 3300009551 Ga0105238_10005010 Ga0105238_100050104 254
386 3300009551 Ga0105238_10022704 Ga0105238_100227044 254
387 3300009551 Ga0105238_10296136 Ga0105238_102961362 254
388 3300009553 Ga0105249_10001056 Ga0105249_100010566 254
389 3300009553 Ga0105249_10007493 Ga0105249_1000749310 254
390 3300009553 Ga0105249_10008209 Ga0105249_100082095 254
391 3300009553 Ga0105249_10016792 Ga0105249_100167927 254
392 3300009553 Ga0105249_10066289 Ga0105249_100662891 254
393 3300009553 Ga0105249_10152867 Ga0105249_101528672 254
394 3300009553 Ga0105249_10224571 Ga0105249_102245713 254
395 3300009553 Ga0105249_10301172 Ga0105249_103011722 254
396 3300009553 Ga0105249_10661755 Ga0105249_106617551 254
397 3300009553 Ga0105249_11294907 Ga0105249_112949071 254
398 3300010375 Ga0105239_10003890 Ga0105239_1000389011 254
399 3300010375 Ga0105239_10006793 Ga0105239_100067934 254
400 3300010375 Ga0105239_10010461 Ga0105239_100104614 254
401 3300010375 Ga0105239_10035575 Ga0105239_100355754 254
402 3300010375 Ga0105239_10427981 Ga0105239_104279812 254
403 3300011119 Ga0105246_10026192 Ga0105246_100261925 254
404 3300011119 Ga0105246_10342534 Ga0105246_103425341 254
405 3300013102 Ga0157371_10164428 Ga0157371_101644282 254
406 3300013102 Ga0157371_10346355 Ga0157371_103463551 254
407 3300013104 Ga0157370_10000419 Ga0157370_1000041919 254
408 3300013104 Ga0157370_10006839 Ga0157370_1000683910 254
409 3300013104 Ga0157370_10012590 Ga0157370_100125907 254
410 3300013104 Ga0157370_10663800 Ga0157370_106638001 254
411 3300013105 Ga0157369_10055266 Ga0157369_100552665 254
412 3300013105 Ga0157369_10140197 Ga0157369_101401973 254
413 3300013296 Ga0157374_10037158 Ga0157374_100371587 254
414 3300013296 Ga0157374_10064009 Ga0157374_100640092 254
415 3300013297 Ga0157378_10002934 Ga0157378_100029348 254
416 3300013297 Ga0157378_10016682 Ga0157378_100166827 254
417 3300013297 Ga0157378_10025378 Ga0157378_100253783 254
418 3300013297 Ga0157378_10038789 Ga0157378_100387894 254
419 3300013297 Ga0157378_10109920 Ga0157378_101099202 254
420 3300013297 Ga0157378_10176020 Ga0157378_101760203 254
421 3300013297 Ga0157378_10385147 Ga0157378_103851472 254
422 3300013306 Ga0163162_10000112 Ga0163162_1000011241 254
423 3300013306 Ga0163162_10000253 Ga0163162_100002536 254
424 3300013306 Ga0163162_10002412 Ga0163162_100024129 254
425 3300013306 Ga0163162_10002447 Ga0163162_100024477 254
426 3300013306 Ga0163162_10003028 Ga0163162_100030285 254
427 3300013306 Ga0163162_10074712 Ga0163162_100747123 254
428 3300013306 Ga0163162_10137644 Ga0163162_101376443 254
429 3300013306 Ga0163162_10184710 Ga0163162_101847102 254
430 3300013306 Ga0163162_10255593 Ga0163162_102555932 254
431 3300013306 Ga0163162_10492222 Ga0163162_104922222 254
432 3300013306 Ga0163162_10577749 Ga0163162_105777492 254
433 3300013306 Ga0163162_10705389 Ga0163162_107053892 254
434 3300013306 Ga0163162_10729264 Ga0163162_107292642 254
435 3300013307 Ga0157372_10003686 Ga0157372_1000368617 254
436 3300013307 Ga0157372_10033278 Ga0157372_100332782 254
437 3300013307 Ga0157372_10037248 Ga0157372_100372482 254
438 3300013307 Ga0157372_10089205 Ga0157372_100892054 254
439 3300013307 Ga0157372_10207209 Ga0157372_102072092 254
440 3300013307 Ga0157372_10482209 Ga0157372_104822092 254
441 3300013308 Ga0157375_10002970 Ga0157375_1000297011 254
442 3300013308 Ga0157375_10032194 Ga0157375_100321946 254
443 3300013308 Ga0157375_10089080 Ga0157375_100890802 254
444 3300013308 Ga0157375_10177058 Ga0157375_101770582 254
445 3300013308 Ga0157375_10373600 Ga0157375_103736003 254
446 3300014325 Ga0163163_10001606 Ga0163163_100016069 254
447 3300014325 Ga0163163_10079320 Ga0163163_100793206 254
448 3300014325 Ga0163163_10317084 Ga0163163_103170842 254
449 3300014325 Ga0163163_10442936 Ga0163163_104429362 254
450 3300014326 Ga0157380_10006320 Ga0157380_100063207 254
451 3300014326 Ga0157380_10015530 Ga0157380_100155305 254
452 3300014326 Ga0157380_10103530 Ga0157380_101035302 254
453 3300014326 Ga0157380_10117290 Ga0157380_101172902 254
454 3300014326 Ga0157380_10210758 Ga0157380_102107582 254
455 3300014326 Ga0157380_10244889 Ga0157380_102448892 254
456 3300014745 Ga0157377_10006497 Ga0157377_100064974 254
457 3300014745 Ga0157377_10012719 Ga0157377_100127192 254
458 3300014745 Ga0157377_10132954 Ga0157377_101329542 254
459 3300014968 Ga0157379_10001508 Ga0157379_1000150811 254
460 3300014968 Ga0157379_10268978 Ga0157379_102689783 254
461 3300014968 Ga0157379_10677845 Ga0157379_106778451 254
462 3300014969 Ga0157376_10000583 Ga0157376_1000058311 254
463 3300014969 Ga0157376_10001570 Ga0157376_1000157017 254
464 3300014969 Ga0157376_10010576 Ga0157376_100105764 254
465 3300014969 Ga0157376_10063914 Ga0157376_100639145 254
466 3300014969 Ga0157376_10104584 Ga0157376_101045842 254
467 3300014969 Ga0157376_10107570 Ga0157376_101075703 254
468 3300014969 Ga0157376_10149443 Ga0157376_101494432 254
469 3300014969 Ga0157376_10234554 Ga0157376_102345541 254
470 3300014969 Ga0157376_10239273 Ga0157376_102392732 254
471 3300017792 Ga0163161_10020128 Ga0163161_100201284 254
472 3300017792 Ga0163161_10023052 Ga0163161_100230525 254
473 3300017792 Ga0163161_10284885 Ga0163161_102848852 254
474 3300017792 Ga0163161_10471388 Ga0163161_104713881 254
475 3300025246 Ga0209646_1001778 Ga0209646_10017786 254
476 3300025271 Ga0207666_1003197 Ga0207666_10031972 254
477 3300025302 Ga0207426_1000059 Ga0207426_1000059185 254
478 3300025315 Ga0207697_10032559 Ga0207697_100325594 254
479 3300025321 Ga0207656_10006221 Ga0207656_100062213 254
480 3300025321 Ga0207656_10062601 Ga0207656_100626011 254
481 3300025893 Ga0207682_10155806 Ga0207682_101558061 254
482 3300025901 Ga0207688_10071862 Ga0207688_100718622 254
483 3300025903 Ga0207680_10000037 Ga0207680_100000377 254
484 3300025903 Ga0207680_10005905 Ga0207680_100059051 254
485 3300025903 Ga0207680_10016302 Ga0207680_100163023 254
486 3300025904 Ga0207647_10123929 Ga0207647_101239292 254
487 3300025904 Ga0207647_10317003 Ga0207647_103170031 254
488 3300025907 Ga0207645_10005743 Ga0207645_100057435 254
489 3300025907 Ga0207645_10006151 Ga0207645_100061517 254
490 3300025907 Ga0207645_10038499 Ga0207645_100384994 254
491 3300025907 Ga0207645_10080239 Ga0207645_100802391 254
492 3300025908 Ga0207643_10156670 Ga0207643_101566702 254
493 3300025908 Ga0207643_10236906 Ga0207643_102369061 254
494 3300025909 Ga0207705_10012389 Ga0207705_100123895 254
495 3300025911 Ga0207654_10002936 Ga0207654_100029367 254
496 3300025911 Ga0207654_10007347 Ga0207654_100073474 254
497 3300025911 Ga0207654_10042681 Ga0207654_100426812 254
498 3300025911 Ga0207654_10180921 Ga0207654_101809212 254
499 3300025912 Ga0207707_10000620 Ga0207707_100006208 254
500 3300025913 Ga0207695_10001122 Ga0207695_1000112242 254
501 3300025913 Ga0207695_10011093 Ga0207695_100110938 254
502 3300025913 Ga0207695_10031676 Ga0207695_100316762 254
503 3300025914 Ga0207671_10000453 Ga0207671_1000045337 254
504 3300025914 Ga0207671_10001502 Ga0207671_1000150210 254
505 3300025914 Ga0207671_10001511 Ga0207671_1000151121 254
506 3300025914 Ga0207671_10011669 Ga0207671_100116695 254
507 3300025914 Ga0207671_10017185 Ga0207671_100171852 254
508 3300025917 Ga0207660_10002359 Ga0207660_100023597 254
509 3300025918 Ga0207662_10007392 Ga0207662_100073927 254
510 3300025918 Ga0207662_10039148 Ga0207662_100391481 254
511 3300025918 Ga0207662_10042443 Ga0207662_100424432 254
512 3300025921 Ga0207652_10003265 Ga0207652_100032657 254
513 3300025922 Ga0207646_10459911 Ga0207646_104599111 254
514 3300025923 Ga0207681_10015111 Ga0207681_100151115 254
515 3300025923 Ga0207681_10045442 Ga0207681_100454423 254
516 3300025923 Ga0207681_10063095 Ga0207681_100630951 254
517 3300025924 Ga0207694_10095992 Ga0207694_100959922 254
518 3300025925 Ga0207650_10020030 Ga0207650_100200302 254
519 3300025925 Ga0207650_10022410 Ga0207650_100224102 254
520 3300025925 Ga0207650_10034354 Ga0207650_100343544 254
521 3300025925 Ga0207650_10095484 Ga0207650_100954842 254
522 3300025926 Ga0207659_10004571 Ga0207659_100045712 254
523 3300025926 Ga0207659_10014816 Ga0207659_100148163 254
524 3300025926 Ga0207659_10034950 Ga0207659_100349505 254
525 3300025926 Ga0207659_10044057 Ga0207659_100440571 254
526 3300025926 Ga0207659_10158200 Ga0207659_101582002 254
527 3300025927 Ga0207687_10052204 Ga0207687_100522043 254
528 3300025931 Ga0207644_10030894 Ga0207644_100308944 254
529 3300025931 Ga0207644_10067370 Ga0207644_100673705 254
530 3300025932 Ga0207690_10003371 Ga0207690_100033712 254
531 3300025933 Ga0207706_10007446 Ga0207706_100074464 254
532 3300025933 Ga0207706_10033616 Ga0207706_100336163 254
533 3300025934 Ga0207686_10000351 Ga0207686_1000035133 254
534 3300025934 Ga0207686_10013758 Ga0207686_100137583 254
535 3300025934 Ga0207686_10282594 Ga0207686_102825942 254
536 3300025934 Ga0207686_10332271 Ga0207686_103322712 254
537 3300025937 Ga0207669_10167621 Ga0207669_101676212 254
538 3300025937 Ga0207669_10229995 Ga0207669_102299951 254
539 3300025937 Ga0207669_10426146 Ga0207669_104261462 254
540 3300025937 Ga0207669_10480642 Ga0207669_104806422 254
541 3300025938 Ga0207704_10004767 Ga0207704_100047673 254
542 3300025938 Ga0207704_10297326 Ga0207704_102973262 254
543 3300025938 Ga0207704_10407983 Ga0207704_104079831 254
544 3300025940 Ga0207691_10002638 Ga0207691_1000263811 254
545 3300025940 Ga0207691_10004182 Ga0207691_100041825 254
546 3300025940 Ga0207691_10028719 Ga0207691_100287193 254
547 3300025940 Ga0207691_10082245 Ga0207691_100822452 254
548 3300025940 Ga0207691_10239007 Ga0207691_102390072 254
549 3300025940 Ga0207691_10336233 Ga0207691_103362332 254
550 3300025941 Ga0207711_10110463 Ga0207711_101104632 254
551 3300025942 Ga0207689_10001492 Ga0207689_1000149213 254
552 3300025942 Ga0207689_10005311 Ga0207689_100053115 254
553 3300025942 Ga0207689_10011795 Ga0207689_100117953 254
554 3300025942 Ga0207689_10018345 Ga0207689_100183451 254
555 3300025942 Ga0207689_10020602 Ga0207689_100206025 254
556 3300025942 Ga0207689_10054081 Ga0207689_100540816 254
557 3300025942 Ga0207689_10508787 Ga0207689_105087871 254
558 3300025945 Ga0207679_10233984 Ga0207679_102339841 254
559 3300025949 Ga0207667_10006330 Ga0207667_100063304 254
560 3300025949 Ga0207667_10029491 Ga0207667_100294915 254
561 3300025949 Ga0207667_10070639 Ga0207667_100706394 254
562 3300025949 Ga0207667_10170911 Ga0207667_101709111 254
563 3300025960 Ga0207651_10003185 Ga0207651_100031855 254
564 3300025960 Ga0207651_10011676 Ga0207651_100116762 254
565 3300025960 Ga0207651_10030165 Ga0207651_100301653 254
566 3300025960 Ga0207651_10033439 Ga0207651_100334392 254
567 3300025960 Ga0207651_10094061 Ga0207651_100940614 254
568 3300025961 Ga0207712_10003635 Ga0207712_100036356 254
569 3300025961 Ga0207712_10005438 Ga0207712_1000543812 254
570 3300025961 Ga0207712_10010167 Ga0207712_100101676 254
571 3300025961 Ga0207712_10016429 Ga0207712_100164292 254
572 3300025972 Ga0207668_10000337 Ga0207668_1000033725 254
573 3300025972 Ga0207668_10022400 Ga0207668_100224007 254
574 3300025972 Ga0207668_10183172 Ga0207668_101831722 254
575 3300025972 Ga0207668_10284016 Ga0207668_102840162 254
576 3300025981 Ga0207640_10019820 Ga0207640_100198202 254
577 3300025981 Ga0207640_10065577 Ga0207640_100655772 254
578 3300025986 Ga0207658_10032567 Ga0207658_100325672 254
579 3300025986 Ga0207658_10055696 Ga0207658_100556963 254
580 3300026023 Ga0207677_10003172 Ga0207677_100031726 254
581 3300026023 Ga0207677_10202498 Ga0207677_102024981 254
582 3300026023 Ga0207677_10251581 Ga0207677_102515812 254
583 3300026035 Ga0207703_10012935 Ga0207703_100129354 254
584 3300026035 Ga0207703_10092614 Ga0207703_100926142 254
585 3300026041 Ga0207639_10035558 Ga0207639_100355582 254
586 3300026041 Ga0207639_10044982 Ga0207639_100449824 254
587 3300026041 Ga0207639_10196336 Ga0207639_101963361 254
588 3300026041 Ga0207639_10212634 Ga0207639_102126342 254
589 3300026041 Ga0207639_10294220 Ga0207639_102942202 254
590 3300026041 Ga0207639_10441118 Ga0207639_104411182 254
591 3300026067 Ga0207678_10144732 Ga0207678_101447322 254
592 3300026075 Ga0207708_10049372 Ga0207708_100493721 254
593 3300026075 Ga0207708_10057831 Ga0207708_100578313 254
594 3300026078 Ga0207702_10175128 Ga0207702_101751282 254
595 3300026078 Ga0207702_10267933 Ga0207702_102679332 254
596 3300026088 Ga0207641_10000058 Ga0207641_100000589 254
597 3300026088 Ga0207641_10000191 Ga0207641_1000019155 254
598 3300026088 Ga0207641_10047477 Ga0207641_100474776 254
599 3300026088 Ga0207641_10087811 Ga0207641_100878112 254
600 3300026088 Ga0207641_10615024 Ga0207641_106150242 254
601 3300026089 Ga0207648_10000215 Ga0207648_1000021517 254
602 3300026089 Ga0207648_10001688 Ga0207648_100016885 254
603 3300026089 Ga0207648_10031663 Ga0207648_100316635 254
604 3300026089 Ga0207648_10035766 Ga0207648_100357665 254
605 3300026089 Ga0207648_10040646 Ga0207648_100406461 254
606 3300026089 Ga0207648_10050875 Ga0207648_100508754 254
607 3300026089 Ga0207648_10123566 Ga0207648_101235662 254
608 3300026095 Ga0207676_10001501 Ga0207676_100015016 254
609 3300026095 Ga0207676_10002935 Ga0207676_100029354 254
610 3300026095 Ga0207676_10068839 Ga0207676_100688391 254
611 3300026095 Ga0207676_10364317 Ga0207676_103643172 254
612 3300026116 Ga0207674_10008410 Ga0207674_1000841010 254
613 3300026116 Ga0207674_10008703 Ga0207674_1000870312 254
614 3300026116 Ga0207674_10011877 Ga0207674_100118771 254
615 3300026116 Ga0207674_10037214 Ga0207674_100372145 254
616 3300026116 Ga0207674_10272260 Ga0207674_102722601 254
617 3300026116 Ga0207674_10484973 Ga0207674_104849732 254
618 3300026118 Ga0207675_100000153 Ga0207675_10000015315 254
619 3300026118 Ga0207675_100008612 Ga0207675_10000861210 254
620 3300026118 Ga0207675_100033909 Ga0207675_1000339095 254
621 3300026118 Ga0207675_100036980 Ga0207675_1000369808 254
622 3300026118 Ga0207675_100060380 Ga0207675_1000603802 254
623 3300026118 Ga0207675_100290291 Ga0207675_1002902912 254
624 3300026121 Ga0207683_10002748 Ga0207683_100027488 254
625 3300026121 Ga0207683_10011891 Ga0207683_1001189110 254
626 3300026121 Ga0207683_10037765 Ga0207683_100377653 254
627 3300026121 Ga0207683_10679434 Ga0207683_106794341 254
628 3300026121 Ga0207683_10683869 Ga0207683_106838691 254
629 3300026142 Ga0207698_10004214 Ga0207698_100042149 254
630 3300026142 Ga0207698_10005575 Ga0207698_100055758 254
631 3300026142 Ga0207698_10072982 Ga0207698_100729821 254
632 3300027876 Ga0209974_10021005 Ga0209974_100210052 254
633 3300027907 Ga0207428_10100857 Ga0207428_101008572 254
634 3300027907 Ga0207428_10572975 Ga0207428_105729751 254
635 3300028379 Ga0268266_10000073 Ga0268266_10000073194 254
636 3300028379 Ga0268266_10045725 Ga0268266_100457251 254
637 3300028379 Ga0268266_10209181 Ga0268266_102091812 254
638 3300028380 Ga0268265_10006773 Ga0268265_100067738 254
639 3300028380 Ga0268265_10090278 Ga0268265_100902782 254
640 3300028380 Ga0268265_10102288 Ga0268265_101022883 254
641 3300028381 Ga0268264_10000063 Ga0268264_10000063168 254
642 3300028381 Ga0268264_10000726 Ga0268264_1000072634 254
643 3300028381 Ga0268264_10008612 Ga0268264_100086123 254
644 3300028381 Ga0268264_10013525 Ga0268264_100135251 254
645 3300028381 Ga0268264_10016166 Ga0268264_100161664 254
646 3300028381 Ga0268264_10742149 Ga0268264_107421491 254
647 3300028786 Ga0307517_10066423 Ga0307517_100664234 254
648 3300028794 Ga0307515_10000001 Ga0307515_100000012420 254
649 3300028794 Ga0307515_10000059 Ga0307515_10000059213 254
650 3300031251 Ga0265327_10000013 Ga0265327_10000013203 254
651 3300031456 Ga0307513_10158011 Ga0307513_101580112 254
652 3300031507 Ga0307509_10052661 Ga0307509_100526612 254
653 3300031730 Ga0307516_10003216 Ga0307516_1000321617 254
654 3300031852 Ga0307410_10408929 Ga0307410_104089292 254
655 3300031901 Ga0307406_10381965 Ga0307406_103819651 254
656 3300032004 Ga0307414_10043401 Ga0307414_100434012 254
657 3300032004 Ga0307414_10279656 Ga0307414_102796562 254
658 3300032005 Ga0307411_10361010 Ga0307411_103610102 254
659 3300033180 Ga0307510_10000156 Ga0307510_1000015615 254
660 3300035410 Ga0373924_0120792 Ga0373924_0120792_25_792 254
661 3300035692 Ga0373935_0260614 Ga0373935_0260614_212_991 254
662 3300036401 Ga0373937_0643736 Ga0373937_0643736_169_948 254
663 3300037418 Ga0395900_0113554 Ga0395900_0113554_1671_2441 254
664 3300037471 Ga0395905_0017279 Ga0395905_0017279_5464_6240 254
665 3300037471 Ga0395905_0075046 Ga0395905_0075046_511_1287 254
666 3300037471 Ga0395905_0296906 Ga0395905_0296906_628_1407 254
667 3300037471 Ga0395905_0565956 Ga0395905_0565956_208_987 254
668 3300037471 Ga0395905_0615314 Ga0395905_0615314_33_812 254
669 3300039093 Ga0400489_26798 Ga0400489_26798_275_1042 254
670 3300039093 Ga0400489_51907 Ga0400489_51907_3150_3947 254
671 3300041486 Ga0451807_0800094 Ga0451807_0800094_248_1015 254
672 3300041512 Ga0451853_2563909 Ga0451853_2563909_4220_4990 254
673 3300041512 Ga0451853_3484866 Ga0451853_3484866_220_987 254
674 3300042435 Ga0439434_0054191 Ga0439434_0054191_383_1150 254
675 3300044658 Ga0466972_0000676 Ga0466972_0000676_12413_13183 254
676 3300044673 Ga0453683_0023888 Ga0453683_0023888_75_854 254
677 3300044712 Ga0453684_0040298 Ga0453684_0040298_3905_4684 254
678 3300044712 Ga0453684_0346247 Ga0453684_0346247_683_1450 254
679 3300044712 Ga0453684_0573803 Ga0453684_0573803_442_1209 254
680 3300044719 Ga0466971_0024021 Ga0466971_0024021_1849_2628 254
681 3300044735 Ga0466968_0072352 Ga0466968_0072352_360_1139 254
682 3300044735 Ga0466968_0230653 Ga0466968_0230653_17_826 254
683 3300044842 Ga0466957_0001546 Ga0466957_0001546_886_1656 254
684 3300044842 Ga0466957_0256075 Ga0466957_0256075_340_1143 254
685 3300045049 Ga0466959_0000488 Ga0466959_0000488_8389_9168 254
686 3300045836 Ga0466958_0030207 Ga0466958_0030207_631_1410 254
687 3300046460 Ga0495638_0019512 Ga0495638_0019512_1272_2051 254
688 3300046472 Ga0495580_0112580 Ga0495580_0112580_920_1699 254
689 3300046499 Ga0495594_0172213 Ga0495594_0172213_201_968 254
690 3300046507 Ga0495606_0003961 Ga0495606_0003961_13239_14018 254
691 3300046524 Ga0495648_0003762 Ga0495648_0003762_1145_1924 254
692 3300046648 Ga0495611_0000061 Ga0495611_0000061_54195_54974 254
693 3300046660 Ga0495625_0034276 Ga0495625_0034276_171_938 254
694 3300046660 Ga0495625_0187500 Ga0495625_0187500_354_1133 254
695 3300046663 Ga0495635_0324186 Ga0495635_0324186_164_943 254
696 3300047320 Ga0495672_0035104 Ga0495672_0035104_1235_2002 254
697 3300047320 Ga0495672_0062090 Ga0495672_0062090_1067_1843 254
698 3300047321 Ga0495676_0083444 Ga0495676_0083444_1085_1864 254
699 3300047471 Ga0495684_0039358 Ga0495684_0039358_2002_2781 254
700 3300047472 Ga0495686_0000010 Ga0495686_0000010_473553_474329 254
701 3300047472 Ga0495686_0093581 Ga0495686_0093581_359_1126 254
702 3300047472 Ga0495686_0152669 Ga0495686_0152669_258_1025 254
703 3300047472 Ga0495686_0197383 Ga0495686_0197383_156_920 254
704 3300047472 Ga0495686_0335059 Ga0495686_0335059_49_816 254
705 3300048088 Ga0495602_0187154 Ga0495602_0187154_749_1528 254
706 3300048904 Ga0496101_0079607 Ga0496101_0079607_1170_1937 254
707 3300048905 Ga0496102_0632528 Ga0496102_0632528_95_862 254
708 3300048907 Ga0496104_0185735 Ga0496104_0185735_1097_1876 254
709 3300048912 Ga0496109_0035289 Ga0496109_0035289_1505_2281 254
710 3300048917 Ga0496114_0294857 Ga0496114_0294857_120_887 254
711 3300049568 Ga0501031_0002263 Ga0501031_0002263_6545_7405 254
712 3300049569 Ga0501032_0010324 Ga0501032_0010324_5283_6050 254
713 3300049569 Ga0501032_0114378 Ga0501032_0114378_199_1059 254
714 3300049570 Ga0501033_0010409 Ga0501033_0010409_2637_3449 254
715 3300049571 Ga0501034_0000004 Ga0501034_0000004_160314_161090 254
716 3300049571 Ga0501034_0026263 Ga0501034_0026263_2841_3608 254
717 3300049571 Ga0501034_0035864 Ga0501034_0035864_1081_1848 254
718 3300049572 Ga0501036_0001446 Ga0501036_0001446_12179_13039 254
719 3300049572 Ga0501036_0022006 Ga0501036_0022006_4161_4928 254
720 3300049573 Ga0501037_0007204 Ga0501037_0007204_5456_6316 254
721 3300049574 Ga0501038_0003270 Ga0501038_0003270_13395_14255 254
722 3300049574 Ga0501038_0015262 Ga0501038_0015262_5558_6325 254
723 3300049575 Ga0501039_0009680 Ga0501039_0009680_2791_3651 254
724 3300049575 Ga0501039_0042353 Ga0501039_0042353_245_1012 254
725 3300049579 Ga0501043_0010690 Ga0501043_0010690_5752_6519 254
726 3300049579 Ga0501043_0424297 Ga0501043_0424297_110_877 254
727 3300049580 Ga0501046_0016366 Ga0501046_0016366_4495_5262 254
728 3300049581 Ga0501047_0009030 Ga0501047_0009030_3970_4737 254
729 3300049581 Ga0501047_0054326 Ga0501047_0054326_696_1466 254
730 3300049581 Ga0501047_0568911 Ga0501047_0568911_13_780 254
731 3300049582 Ga0501048_0023532 Ga0501048_0023532_2792_3559 254
732 3300049583 Ga0501067_0037603 Ga0501067_0037603_871_1707 254
733 3300049586 Ga0501070_0006613 Ga0501070_0006613_7978_8745 254
734 3300049586 Ga0501070_0108613 Ga0501070_0108613_729_1496 254
735 3300049588 Ga0501072_0138330 Ga0501072_0138330_633_1469 254
736 3300049589 Ga0501073_0027520 Ga0501073_0027520_967_1734 254
737 3300049589 Ga0501073_0412582 Ga0501073_0412582_33_839 254
738 3300049590 Ga0501074_0012286 Ga0501074_0012286_1278_2045 254
739 3300049593 Ga0501077_0289592 Ga0501077_0289592_255_1022 254
740 3300049663 Ga0501223_008443 Ga0501223_008443_208_984 254
741 3300049682 Ga0501252_006347 Ga0501252_006347_419_1195 254
742 3300049742 Ga0501080_0164554 Ga0501080_0164554_118_885 254
743 3300049744 Ga0501083_0042934 Ga0501083_0042934_1259_2026 254
744 3300049822 Ga0501035_0005853 Ga0501035_0005853_8014_8826 254
745 3300049822 Ga0501035_0039105 Ga0501035_0039105_2136_2996 254
746 3300049823 Ga0501044_0068107 Ga0501044_0068107_1492_2259 254
747 3300049823 Ga0501044_0574614 Ga0501044_0574614_191_967 254
748 3300049824 Ga0501045_0057147 Ga0501045_0057147_1451_2218 254
749 3300050493 nmdc:mga0k408_52941_c1 nmdc:mga0k408_52941_c1_1508_2278 254
750 3300050507 nmdc:mga05p37_286222_c1 nmdc:mga05p37_286222_c1_799_1566 254
751 3300050508 nmdc:mga09592_5311_c1 nmdc:mga09592_5311_c1_8950_9717 254
752 3300050508 nmdc:mga09592_674267_c1 nmdc:mga09592_674267_c1_98_865 254
753 3300050508 nmdc:mga09592_85887_c1 nmdc:mga09592_85887_c1_1118_1885 254
754 3300050508 nmdc:mga09592_92423_c1 nmdc:mga09592_92423_c1_1236_2003 254
755 3300050509 nmdc:mga0qj67_134949_c1 nmdc:mga0qj67_134949_c1_344_1111 254
756 3300050510 nmdc:mga06r32_36625_c1 nmdc:mga06r32_36625_c1_2452_3219 254
757 3300050511 nmdc:mga08y16_62717_c1 nmdc:mga08y16_62717_c1_1076_1843 254
758 3300050511 nmdc:mga08y16_967371_c1 nmdc:mga08y16_967371_c1_30_809 254
759 3300053086 Ga0500578_0001568 Ga0500578_0001568_19330_20100 254
760 3300053088 Ga0500644_0079193 Ga0500644_0079193_216_995 254
761 3300053090 Ga0500646_0000772 Ga0500646_0000772_3380_4147 254
762 3300053090 Ga0500646_0011068 Ga0500646_0011068_599_1378 254
763 3300053090 Ga0500646_0013394 Ga0500646_0013394_80_847 254
764 3300053092 Ga0500583_0004003 Ga0500583_0004003_241_1020 254
765 3300053098 Ga0500650_0013159 Ga0500650_0013159_2561_3328 254
766 3300053104 Ga0500556_0065227 Ga0500556_0065227_479_1246 254
767 3300053130 Ga0500642_0015283 Ga0500642_0015283_1184_1963 254
768 3300053139 Ga0500568_0010529 Ga0500568_0010529_1001_1780 254
769 3300053146 Ga0500588_0059628 Ga0500588_0059628_326_1093 254
770 3300054114 Ga0501084_0014521 Ga0501084_0014521_2203_3039 254
771 3300060353 Ga0501082_0046092 Ga0501082_0046092_74_850 254
772 3300060353 Ga0501082_0212638 Ga0501082_0212638_349_1116 254
773 3300061719 Ga0466962_0007910 Ga0466962_0007910_733_1512 254
774 2162886007 SwRhRL2b_contig_650288 SwRhRL2b_0742.00006910 255
775 3300001979 JGI24740J21852_10035509 JGI24740J21852_100355091 255
776 3300001990 JGI24737J22298_10000851 JGI24737J22298_100008512 255
777 3300001990 JGI24737J22298_10005505 JGI24737J22298_100055052 255
778 3300002067 JGI24735J21928_10000093 JGI24735J21928_1000009318 255
779 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008354 255
780 3300002737 JGI25162J39368_1000097 JGI25162J39368_10000979 255
781 3300002737 JGI25162J39368_1003452 JGI25162J39368_10034522 255
782 3300002741 JGI25157J39369_1006945 JGI25157J39369_10069452 255
783 3300002772 JGI25164J39214_1002202 JGI25164J39214_10022025 255
784 3300002773 JGI25152J39213_1000044 JGI25152J39213_100004424 255
785 3300002774 JGI25150J39212_1000006 JGI25150J39212_100000658 255
786 3300003187 JGI25151J46595_10000024 JGI25151J46595_10000024131 255
787 3300003214 JGI25165J46597_1000891 JGI25165J46597_100089117 255
788 3300003215 JGI25153J46596_10000026 JGI25153J46596_1000002659 255
789 3300003320 rootH2_10007960 rootH2_100079605 255
790 3300003320 rootH2_10061124 rootH2_100611243 255
791 3300003320 rootH2_10184756 rootH2_101847565 255
792 3300003322 rootL2_10240312 rootL2_102403124 255
793 3300003323 rootH1_10035781 rootH1_100357812 255
794 3300003323 rootH1_10050923 rootH1_100509235 255
795 3300003323 rootH1_10088396 rootH1_100883967 255
796 3300003323 rootH1_10131059 rootH1_101310593 255
797 3300003323 rootH1_10240758 rootH1_102407582 255
798 3300003781 Ga0055536_1000002 Ga0055536_1000002139 255
799 3300005288 Ga0065714_10005450 Ga0065714_100054505 255
800 3300005288 Ga0065714_10064557 Ga0065714_1006455710 255
801 3300005288 Ga0065714_10067802 Ga0065714_100678025 255
802 3300005288 Ga0065714_10069902 Ga0065714_100699023 255
803 3300005289 Ga0065704_10219819 Ga0065704_102198191 255
804 3300005327 Ga0070658_10000113 Ga0070658_1000011357 255
805 3300005327 Ga0070658_10757163 Ga0070658_107571631 255
806 3300005328 Ga0070676_10000205 Ga0070676_1000020527 255
807 3300005329 Ga0070683_100036133 Ga0070683_1000361333 255
808 3300005338 Ga0068868_100007394 Ga0068868_1000073942 255
809 3300005339 Ga0070660_100064037 Ga0070660_1000640372 255
810 3300005339 Ga0070660_100226946 Ga0070660_1002269462 255
811 3300005355 Ga0070671_100095808 Ga0070671_1000958084 255
812 3300005366 Ga0070659_100000199 Ga0070659_10000019944 255
813 3300005366 Ga0070659_100005494 Ga0070659_1000054943 255
814 3300005366 Ga0070659_100036212 Ga0070659_1000362125 255
815 3300005455 Ga0070663_100005053 Ga0070663_1000050535 255
816 3300005456 Ga0070678_100011513 Ga0070678_1000115136 255
817 3300005457 Ga0070662_100000772 Ga0070662_1000007725 255
818 3300005458 Ga0070681_10108996 Ga0070681_101089963 255
819 3300005459 Ga0068867_100000809 Ga0068867_10000080922 255
820 3300005530 Ga0070679_100013537 Ga0070679_1000135372 255
821 3300005539 Ga0068853_100024008 Ga0068853_1000240084 255
822 3300005539 Ga0068853_100089658 Ga0068853_1000896584 255
823 3300005539 Ga0068853_100248421 Ga0068853_1002484213 255
824 3300005539 Ga0068853_100374623 Ga0068853_1003746232 255
825 3300005539 Ga0068853_100578860 Ga0068853_1005788601 255
826 3300005543 Ga0070672_100157644 Ga0070672_1001576442 255
827 3300005548 Ga0070665_100000017 Ga0070665_100000017261 255
828 3300005563 Ga0068855_100000074 Ga0068855_10000007480 255
829 3300005563 Ga0068855_100000958 Ga0068855_1000009588 255
830 3300005563 Ga0068855_100093980 Ga0068855_1000939802 255
831 3300005563 Ga0068855_100304027 Ga0068855_1003040272 255
832 3300005563 Ga0068855_100396803 Ga0068855_1003968032 255
833 3300005614 Ga0068856_100000040 Ga0068856_10000004058 255
834 3300005614 Ga0068856_100017756 Ga0068856_1000177562 255
835 3300005614 Ga0068856_100032371 Ga0068856_1000323712 255
836 3300005614 Ga0068856_100321567 Ga0068856_1003215671 255
837 3300005614 Ga0068856_100792708 Ga0068856_1007927081 255
838 3300005616 Ga0068852_100000720 Ga0068852_10000072019 255
839 3300005616 Ga0068852_100234714 Ga0068852_1002347141 255
840 3300006195 Ga0075366_10000435 Ga0075366_1000043510 255
841 3300006195 Ga0075366_10000779 Ga0075366_1000077910 255
842 3300006195 Ga0075366_10002507 Ga0075366_100025077 255
843 3300006195 Ga0075366_10348083 Ga0075366_103480831 255
844 3300006237 Ga0097621_100000285 Ga0097621_10000028523 255
845 3300006358 Ga0068871_100000080 Ga0068871_10000008034 255
846 3300006881 Ga0068865_100000218 Ga0068865_10000021811 255
847 3300009036 Ga0105244_10025480 Ga0105244_100254805 255
848 3300009093 Ga0105240_10000083 Ga0105240_10000083119 255
849 3300009093 Ga0105240_10003566 Ga0105240_100035667 255
850 3300009093 Ga0105240_10036054 Ga0105240_100360545 255
851 3300009093 Ga0105240_10102820 Ga0105240_101028203 255
852 3300009093 Ga0105240_10332692 Ga0105240_103326922 255
853 3300009093 Ga0105240_10652633 Ga0105240_106526332 255
854 3300009148 Ga0105243_10000003 Ga0105243_10000003264 255
855 3300009174 Ga0105241_10005957 Ga0105241_100059571 255
856 3300009174 Ga0105241_10008209 Ga0105241_100082095 255
857 3300009174 Ga0105241_10011880 Ga0105241_100118808 255
858 3300009174 Ga0105241_10031123 Ga0105241_100311234 255
859 3300009176 Ga0105242_10031334 Ga0105242_100313342 255
860 3300009545 Ga0105237_10000138 Ga0105237_100001385 255
861 3300009545 Ga0105237_10001681 Ga0105237_100016817 255
862 3300009545 Ga0105237_10003760 Ga0105237_1000376010 255
863 3300009545 Ga0105237_10020681 Ga0105237_100206818 255
864 3300009545 Ga0105237_10024357 Ga0105237_100243572 255
865 3300009545 Ga0105237_10076228 Ga0105237_100762284 255
866 3300009545 Ga0105237_10287549 Ga0105237_102875492 255
867 3300009545 Ga0105237_10451876 Ga0105237_104518761 255
868 3300009545 Ga0105237_10526682 Ga0105237_105266821 255
869 3300009551 Ga0105238_10020232 Ga0105238_100202322 255
870 3300009551 Ga0105238_10116189 Ga0105238_101161893 255
871 3300009551 Ga0105238_10486506 Ga0105238_104865062 255
872 3300010375 Ga0105239_10000026 Ga0105239_10000026153 255
873 3300010375 Ga0105239_10000392 Ga0105239_1000039218 255
874 3300010375 Ga0105239_10002143 Ga0105239_100021439 255
875 3300010375 Ga0105239_10006488 Ga0105239_1000648814 255
876 3300010375 Ga0105239_10008812 Ga0105239_100088125 255
877 3300010375 Ga0105239_10017011 Ga0105239_100170113 255
878 3300013100 Ga0157373_10001288 Ga0157373_1000128815 255
879 3300013100 Ga0157373_10018692 Ga0157373_100186926 255
880 3300013100 Ga0157373_10064052 Ga0157373_100640522 255
881 3300013100 Ga0157373_10144870 Ga0157373_101448702 255
882 3300013102 Ga0157371_10000286 Ga0157371_1000028617 255
883 3300013102 Ga0157371_10000748 Ga0157371_1000074820 255
884 3300013102 Ga0157371_10002211 Ga0157371_100022113 255
885 3300013102 Ga0157371_10011893 Ga0157371_100118935 255
886 3300013102 Ga0157371_10104223 Ga0157371_101042232 255
887 3300013104 Ga0157370_10002658 Ga0157370_1000265818 255
888 3300013104 Ga0157370_10007099 Ga0157370_1000709912 255
889 3300013104 Ga0157370_10022935 Ga0157370_100229352 255
890 3300013104 Ga0157370_10027084 Ga0157370_100270842 255
891 3300013104 Ga0157370_10044025 Ga0157370_100440252 255
892 3300013104 Ga0157370_10053904 Ga0157370_100539043 255
893 3300013104 Ga0157370_10081166 Ga0157370_100811663 255
894 3300013104 Ga0157370_10297224 Ga0157370_102972242 255
895 3300013104 Ga0157370_10540126 Ga0157370_105401261 255
896 3300013105 Ga0157369_10000301 Ga0157369_1000030115 255
897 3300013105 Ga0157369_10184926 Ga0157369_101849262 255
898 3300013105 Ga0157369_10191609 Ga0157369_101916094 255
899 3300013296 Ga0157374_10000180 Ga0157374_100001803 255
900 3300013296 Ga0157374_10001208 Ga0157374_1000120819 255
901 3300013296 Ga0157374_10001936 Ga0157374_1000193610 255
902 3300013296 Ga0157374_10919633 Ga0157374_109196331 255
903 3300013297 Ga0157378_10421939 Ga0157378_104219392 255
904 3300013306 Ga0163162_10000011 Ga0163162_10000011147 255
905 3300013306 Ga0163162_10000051 Ga0163162_1000005130 255
906 3300013306 Ga0163162_10008696 Ga0163162_100086968 255
907 3300013306 Ga0163162_10073125 Ga0163162_100731253 255
908 3300013306 Ga0163162_10240591 Ga0163162_102405912 255
909 3300013307 Ga0157372_10000037 Ga0157372_10000037133 255
910 3300013307 Ga0157372_10009703 Ga0157372_100097033 255
911 3300013307 Ga0157372_10013991 Ga0157372_100139912 255
912 3300013307 Ga0157372_10118957 Ga0157372_101189575 255
913 3300013307 Ga0157372_10239976 Ga0157372_102399762 255
914 3300013308 Ga0157375_10017528 Ga0157375_100175286 255
915 3300013308 Ga0157375_10076232 Ga0157375_100762325 255
916 3300013308 Ga0157375_10222544 Ga0157375_102225444 255
917 3300014497 Ga0182008_10000059 Ga0182008_1000005981 255
918 3300014745 Ga0157377_10015027 Ga0157377_100150273 255
919 3300015261 Ga0182006_1000156 Ga0182006_100015621 255
920 3300015261 Ga0182006_1000482 Ga0182006_100048230 255
921 3300015262 Ga0182007_10000008 Ga0182007_10000008144 255
922 3300015682 Ga0183373_1002 Ga0183373_1002413 255
923 3300017792 Ga0163161_10000305 Ga0163161_1000030520 255
924 3300017792 Ga0163161_10000502 Ga0163161_1000050213 255
925 3300017792 Ga0163161_10005925 Ga0163161_100059255 255
926 3300017792 Ga0163161_10043127 Ga0163161_100431272 255
927 3300025231 Ga0207427_100071 Ga0207427_10007185 255
928 3300025233 Ga0209437_100021 Ga0209437_100021175 255
929 3300025233 Ga0209437_100030 Ga0209437_10003091 255
930 3300025245 Ga0207425_1000003 Ga0207425_100000358 255
931 3300025250 Ga0209026_1000325 Ga0209026_100032512 255
932 3300025250 Ga0209026_1001703 Ga0209026_10017032 255
933 3300025250 Ga0209026_1003864 Ga0209026_10038642 255
934 3300025258 Ga0209129_1000022 Ga0209129_100002258 255
935 3300025261 Ga0209233_1000035 Ga0209233_1000035463 255
936 3300025261 Ga0209233_1002101 Ga0209233_10021016 255
937 3300025272 Ga0209455_1003029 Ga0209455_10030294 255
938 3300025292 Ga0209676_1000022 Ga0209676_1000022401 255
939 3300025294 Ga0209025_1000007 Ga0209025_100000757 255
940 3300025297 Ga0209758_1000012 Ga0209758_100001258 255
941 3300025298 Ga0209050_1000020 Ga0209050_1000020138 255
942 3300025899 Ga0207642_10043526 Ga0207642_100435262 255
943 3300025904 Ga0207647_10000453 Ga0207647_100004535 255
944 3300025904 Ga0207647_10000687 Ga0207647_1000068716 255
945 3300025904 Ga0207647_10060271 Ga0207647_100602711 255
946 3300025907 Ga0207645_10000398 Ga0207645_1000039820 255
947 3300025909 Ga0207705_10000160 Ga0207705_1000016019 255
948 3300025911 Ga0207654_10003611 Ga0207654_100036115 255
949 3300025911 Ga0207654_10004664 Ga0207654_100046645 255
950 3300025911 Ga0207654_10074444 Ga0207654_100744442 255
951 3300025911 Ga0207654_10128702 Ga0207654_101287023 255
952 3300025912 Ga0207707_10063196 Ga0207707_100631962 255
953 3300025913 Ga0207695_10000127 Ga0207695_10000127118 255
954 3300025913 Ga0207695_10012480 Ga0207695_1001248011 255
955 3300025913 Ga0207695_10030736 Ga0207695_100307365 255
956 3300025913 Ga0207695_10194858 Ga0207695_101948581 255
957 3300025913 Ga0207695_10258714 Ga0207695_102587142 255
958 3300025914 Ga0207671_10001040 Ga0207671_1000104025 255
959 3300025914 Ga0207671_10003253 Ga0207671_100032537 255
960 3300025914 Ga0207671_10003548 Ga0207671_100035488 255
961 3300025914 Ga0207671_10012109 Ga0207671_100121097 255
962 3300025914 Ga0207671_10142456 Ga0207671_101424562 255
963 3300025914 Ga0207671_10156194 Ga0207671_101561941 255
964 3300025914 Ga0207671_10335022 Ga0207671_103350221 255
965 3300025919 Ga0207657_10026795 Ga0207657_100267953 255
966 3300025919 Ga0207657_10214952 Ga0207657_102149522 255
967 3300025924 Ga0207694_10165901 Ga0207694_101659013 255
968 3300025931 Ga0207644_10159093 Ga0207644_101590931 255
969 3300025932 Ga0207690_10003707 Ga0207690_100037071 255
970 3300025932 Ga0207690_10057474 Ga0207690_100574742 255
971 3300025932 Ga0207690_10321768 Ga0207690_103217681 255
972 3300025933 Ga0207706_10001940 Ga0207706_100019405 255
973 3300025934 Ga0207686_10012335 Ga0207686_100123355 255
974 3300025935 Ga0207709_10000008 Ga0207709_10000008310 255
975 3300025938 Ga0207704_10000065 Ga0207704_1000006518 255
976 3300025940 Ga0207691_10163024 Ga0207691_101630243 255
977 3300025949 Ga0207667_10000014 Ga0207667_1000001428 255
978 3300025949 Ga0207667_10008556 Ga0207667_100085565 255
979 3300025949 Ga0207667_10367336 Ga0207667_103673362 255
980 3300025949 Ga0207667_10717871 Ga0207667_107178711 255
981 3300025981 Ga0207640_10031441 Ga0207640_100314411 255
982 3300026041 Ga0207639_10006123 Ga0207639_100061238 255
983 3300026041 Ga0207639_10030028 Ga0207639_100300285 255
984 3300026041 Ga0207639_10241198 Ga0207639_102411983 255
985 3300026041 Ga0207639_10369581 Ga0207639_103695812 255
986 3300026041 Ga0207639_10675531 Ga0207639_106755311 255
987 3300026067 Ga0207678_10012592 Ga0207678_100125925 255
988 3300026078 Ga0207702_10000042 Ga0207702_1000004231 255
989 3300026078 Ga0207702_10121103 Ga0207702_101211033 255
990 3300026078 Ga0207702_10180036 Ga0207702_101800362 255
991 3300026078 Ga0207702_10276991 Ga0207702_102769911 255
992 3300026078 Ga0207702_10577303 Ga0207702_105773031 255
993 3300026089 Ga0207648_10000886 Ga0207648_100008862 255
994 3300026121 Ga0207683_10079670 Ga0207683_100796703 255
995 3300026142 Ga0207698_10946465 Ga0207698_109464651 255
996 3300028379 Ga0268266_10000037 Ga0268266_1000003757 255
997 3300028786 Ga0307517_10000212 Ga0307517_1000021280 255
998 3300028794 Ga0307515_10000224 Ga0307515_1000022462 255
999 3300028794 Ga0307515_10000318 Ga0307515_1000031820 255
1000 3300028794 Ga0307515_10019542 Ga0307515_100195429 255
1001 3300028794 Ga0307515_10096065 Ga0307515_100960653 255
1002 3300028800 Ga0265338_10188569 Ga0265338_101885692 255
1003 3300028800 Ga0265338_10323807 Ga0265338_103238072 255
1004 3300030731 Ga0316177_1017133 Ga0316177_10171333 255
1005 3300030732 Ga0316176_1014596 Ga0316176_101459613 255
1006 3300030742 Ga0316183_1003890 Ga0316183_10038904 255
1007 3300030745 Ga0316182_1151228 Ga0316182_11512284 255
1008 3300031507 Ga0307509_10116179 Ga0307509_101161793 255
1009 3300031548 Ga0307408_100000209 Ga0307408_10000020944 255
1010 3300031548 Ga0307408_100000487 Ga0307408_1000004875 255
1011 3300031731 Ga0307405_10000341 Ga0307405_1000034111 255
1012 3300031903 Ga0307407_10000002 Ga0307407_10000002117 255
1013 3300031911 Ga0307412_10000724 Ga0307412_100007242 255
1014 3300031995 Ga0307409_100090130 Ga0307409_1000901302 255
1015 3300032002 Ga0307416_100000005 Ga0307416_100000005117 255
1016 3300032004 Ga0307414_10000655 Ga0307414_100006555 255
1017 3300032004 Ga0307414_10056253 Ga0307414_100562532 255
1018 3300032004 Ga0307414_10187346 Ga0307414_101873462 255
1019 3300032004 Ga0307414_10281211 Ga0307414_102812112 255
1020 3300033179 Ga0307507_10000111 Ga0307507_1000011160 255
1021 3300033180 Ga0307510_10000249 Ga0307510_1000024949 255
1022 3300037312 Ga0395899_0000017 Ga0395899_0000017_331404_332174 255
1023 3300037312 Ga0395899_0000280 Ga0395899_0000280_48807_49574 255
1024 3300037312 Ga0395899_0016189 Ga0395899_0016189_1969_2742 255
1025 3300037312 Ga0395899_0016320 Ga0395899_0016320_4568_5392 255
1026 3300037312 Ga0395899_0204332 Ga0395899_0204332_200_976 255
1027 3300037418 Ga0395900_0000204 Ga0395900_0000204_9806_10582 255
1028 3300037418 Ga0395900_0006199 Ga0395900_0006199_879_1652 255
1029 3300037418 Ga0395900_0066255 Ga0395900_0066255_894_1718 255
1030 3300037466 Ga0395898_0058793 Ga0395898_0058793_664_1437 255
1031 3300037471 Ga0395905_0000327 Ga0395905_0000327_58791_59564 255
1032 3300037471 Ga0395905_0606915 Ga0395905_0606915_40_807 255
1033 3300038443 Ga0395901_0000895 Ga0395901_0000895_17846_18619 255
1034 3300038443 Ga0395901_0075824 Ga0395901_0075824_2036_2803 255
1035 3300041486 Ga0451807_0937824 Ga0451807_0937824_223_990 255
1036 3300041498 Ga0451841_1340210 Ga0451841_1340210_125_892 255
1037 3300044656 Ga0466969_0059284 Ga0466969_0059284_439_1206 255
1038 3300044693 Ga0466961_0015564 Ga0466961_0015564_3431_4198 255
1039 3300045049 Ga0466959_0168455 Ga0466959_0168455_262_1029 255
1040 3300046462 Ga0495651_0155366 Ga0495651_0155366_631_1398 255
1041 3300046471 Ga0495650_0000268 Ga0495650_0000268_19416_20183 255
1042 3300046471 Ga0495650_0033044 Ga0495650_0033044_1148_1930 255
1043 3300046492 Ga0495585_0000034 Ga0495585_0000034_91023_91790 255
1044 3300046492 Ga0495585_0000785 Ga0495585_0000785_1911_2678 255
1045 3300046500 Ga0495596_0017038 Ga0495596_0017038_45_812 255
1046 3300046506 Ga0495583_0025110 Ga0495583_0025110_441_1208 255
1047 3300046507 Ga0495606_0000009 Ga0495606_0000009_8788_9555 255
1048 3300046507 Ga0495606_0003806 Ga0495606_0003806_3228_4001 255
1049 3300046507 Ga0495606_0026886 Ga0495606_0026886_1599_2366 255
1050 3300046507 Ga0495606_0028027 Ga0495606_0028027_2518_3285 255
1051 3300046507 Ga0495606_0031240 Ga0495606_0031240_1643_2410 255
1052 3300046507 Ga0495606_0144048 Ga0495606_0144048_259_1026 255
1053 3300046512 Ga0495610_0000084 Ga0495610_0000084_15968_16735 255
1054 3300046512 Ga0495610_0001784 Ga0495610_0001784_7655_8422 255
1055 3300046512 Ga0495610_0058527 Ga0495610_0058527_722_1489 255
1056 3300046512 Ga0495610_0165173 Ga0495610_0165173_141_908 255
1057 3300046513 Ga0495616_0000907 Ga0495616_0000907_16304_17071 255
1058 3300046513 Ga0495616_0128305 Ga0495616_0128305_121_888 255
1059 3300046514 Ga0495618_0239537 Ga0495618_0239537_133_900 255
1060 3300046518 Ga0495631_0036513 Ga0495631_0036513_172_939 255
1061 3300046518 Ga0495631_0155858 Ga0495631_0155858_102_869 255
1062 3300046519 Ga0495632_0150796 Ga0495632_0150796_55_822 255
1063 3300046520 Ga0495637_0008861 Ga0495637_0008861_141_908 255
1064 3300046523 Ga0495644_0004309 Ga0495644_0004309_3247_4014 255
1065 3300046524 Ga0495648_0016466 Ga0495648_0016466_4317_5099 255
1066 3300046524 Ga0495648_0022677 Ga0495648_0022677_287_1054 255
1067 3300046524 Ga0495648_0076075 Ga0495648_0076075_291_1058 255
1068 3300046524 Ga0495648_0212462 Ga0495648_0212462_69_851 255
1069 3300046529 Ga0495652_0269295 Ga0495652_0269295_135_923 255
1070 3300046530 Ga0495654_0042615 Ga0495654_0042615_1435_2202 255
1071 3300046538 Ga0495609_0034960 Ga0495609_0034960_1054_1821 255
1072 3300046557 Ga0495622_0192670 Ga0495622_0192670_77_844 255
1073 3300046558 Ga0495633_0000785 Ga0495633_0000785_19214_19981 255
1074 3300046558 Ga0495633_0163455 Ga0495633_0163455_220_987 255
1075 3300046616 Ga0495668_0000055 Ga0495668_0000055_7749_8516 255
1076 3300046660 Ga0495625_0000007 Ga0495625_0000007_349317_350084 255
1077 3300046660 Ga0495625_0000761 Ga0495625_0000761_13851_14618 255
1078 3300046660 Ga0495625_0001500 Ga0495625_0001500_9489_10256 255
1079 3300046660 Ga0495625_0003990 Ga0495625_0003990_3997_4764 255
1080 3300046660 Ga0495625_0047405 Ga0495625_0047405_1656_2426 255
1081 3300046660 Ga0495625_0061832 Ga0495625_0061832_818_1585 255
1082 3300046660 Ga0495625_0376184 Ga0495625_0376184_12_779 255
1083 3300046665 Ga0495661_0001101 Ga0495661_0001101_4248_5015 255
1084 3300046665 Ga0495661_0002357 Ga0495661_0002357_2515_3282 255
1085 3300046665 Ga0495661_0071867 Ga0495661_0071867_1078_1845 255
1086 3300046665 Ga0495661_0093349 Ga0495661_0093349_223_990 255
1087 3300046694 Ga0495649_0000007 Ga0495649_0000007_87429_88196 255
1088 3300046810 Ga0495660_0015258 Ga0495660_0015258_2740_3507 255
1089 3300046810 Ga0495660_0098012 Ga0495660_0098012_193_960 255
1090 3300047323 Ga0495683_0097950 Ga0495683_0097950_456_1223 255
1091 3300047443 Ga0495687_001497 Ga0495687_001497_10800_11567 255
1092 3300047443 Ga0495687_004528 Ga0495687_004528_2286_3053 255
1093 3300047443 Ga0495687_069141 Ga0495687_069141_185_952 255
1094 3300047469 Ga0495673_0123554 Ga0495673_0123554_80_847 255
1095 3300047472 Ga0495686_0000965 Ga0495686_0000965_6398_7165 255
1096 3300047472 Ga0495686_0001146 Ga0495686_0001146_11461_12228 255
1097 3300047472 Ga0495686_0027599 Ga0495686_0027599_2434_3201 255
1098 3300048917 Ga0496114_0349697 Ga0496114_0349697_99_866 255
1099 3300048918 Ga0496115_0054596 Ga0496115_0054596_737_1504 255
1100 3300048919 Ga0496116_0002140 Ga0496116_0002140_5404_6171 255
1101 3300048920 Ga0496117_0001774 Ga0496117_0001774_17482_18249 255
1102 3300048925 Ga0496122_0003563 Ga0496122_0003563_1905_2672 255
1103 3300048926 Ga0496123_0111706 Ga0496123_0111706_584_1351 255
1104 3300049459 Ga0495678_042611 Ga0495678_042611_864_1631 255
1105 3300050493 nmdc:mga0k408_11130_c1 nmdc:mga0k408_11130_c1_3551_4318 255
1106 3300050493 nmdc:mga0k408_120_c1 nmdc:mga0k408_120_c1_29008_29775 255
1107 3300050493 nmdc:mga0k408_245849_c1 nmdc:mga0k408_245849_c1_45_812 255
1108 3300050493 nmdc:mga0k408_364_c1 nmdc:mga0k408_364_c1_1705_2475 255
1109 3300053080 Ga0500635_0001085 Ga0500635_0001085_503_1270 255
1110 3300053122 Ga0500608_048215 Ga0500608_048215_249_1016 255
1111 3300053123 Ga0500614_015999 Ga0500614_015999_724_1491 255
1112 3300053125 Ga0500618_000006 Ga0500618_000006_176372_177139 255
1113 3300053130 Ga0500642_0050257 Ga0500642_0050257_350_1117 255
1114 3300053153 Ga0500616_0037550 Ga0500616_0037550_1302_2069 255
1115 3300053156 Ga0500622_0017330 Ga0500622_0017330_2979_3749 255
1116 3300053157 Ga0500624_000567 Ga0500624_000567_2883_3650 255
1117 2162886007 SwRhRL2b_contig_3456730 SwRhRL2b_0596.00005760 256
1118 3300005288 Ga0065714_10098959 Ga0065714_100989592 256
1119 3300005289 Ga0065704_10000218 Ga0065704_1000021834 256
1120 3300005289 Ga0065704_10077810 Ga0065704_100778101 256
1121 3300005289 Ga0065704_10190854 Ga0065704_101908542 256
1122 3300009545 Ga0105237_10000429 Ga0105237_100004298 256
1123 3300013100 Ga0157373_10000167 Ga0157373_1000016726 256
1124 3300013102 Ga0157371_10001037 Ga0157371_1000103728 256
1125 3300013102 Ga0157371_10001713 Ga0157371_1000171315 256
1126 3300013104 Ga0157370_10000681 Ga0157370_1000068112 256
1127 3300013104 Ga0157370_10008287 Ga0157370_100082875 256
1128 3300013104 Ga0157370_10081249 Ga0157370_100812493 256
1129 3300013308 Ga0157375_10055544 Ga0157375_100555442 256
1130 3300014497 Ga0182008_10000025 Ga0182008_1000002560 256
1131 3300014497 Ga0182008_10000058 Ga0182008_1000005813 256
1132 3300014497 Ga0182008_10059196 Ga0182008_100591961 256
1133 3300015261 Ga0182006_1000470 Ga0182006_100047012 256
1134 3300015261 Ga0182006_1001296 Ga0182006_10012965 256
1135 3300015262 Ga0182007_10034751 Ga0182007_100347512 256
1136 3300017792 Ga0163161_10000778 Ga0163161_100007787 256
1137 3300025914 Ga0207671_10003463 Ga0207671_100034638 256
1138 3300031731 Ga0307405_10109604 Ga0307405_101096042 256
1139 3300031911 Ga0307412_10000001 Ga0307412_10000001513 256
1140 3300031911 Ga0307412_10115103 Ga0307412_101151032 256
1141 3300031911 Ga0307412_10240019 Ga0307412_102400192 256
1142 3300031911 Ga0307412_10259443 Ga0307412_102594432 256
1143 3300032004 Ga0307414_10002342 Ga0307414_100023429 256
1144 3300032004 Ga0307414_10017828 Ga0307414_100178285 256
1145 3300046501 Ga0495607_0221045 Ga0495607_0221045_62_832 256
1146 3300046538 Ga0495609_0034564 Ga0495609_0034564_1022_1792 256
1147 3300048925 Ga0496122_0000783 Ga0496122_0000783_55800_56570 256
1148 3300048926 Ga0496123_0000586 Ga0496123_0000586_33793_34563 256
1149 3300048928 Ga0496125_0034972 Ga0496125_0034972_691_1461 256
1150 3300049649 Ga0501198_009024 Ga0501198_009024_283_1053 256
1151 3300049758 Ga0501241_012071 Ga0501241_012071_181_951 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

18

260

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g91-assembly1.cif.gz_A 1.2 angstrom structure of the exonuclease iii homologue mth0212 0.9713 1 256
3w2y-assembly2.cif.gz_D crystal structure of dna uridine endonuclease mth212 mutant w205s 0.9704 1 256
3g4t-assembly1.cif.gz_A mth0212 (wt) in complex with a 7bp dsdna 0.9691 1 255
3g0r-assembly1.cif.gz_A complex of mth0212 and an 8bp dsdna with distorted ends 0.9683 1 256
3g4t-assembly1.cif.gz_A mth0212 (wt) in complex with a 7bp dsdna 0.9617 1 255
ID Description Score Start End Superfamily
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9696 1 256 3.60.10.10
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9614 1 255 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9585 1 256 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9542 1 256 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.947 1 256 3.60.10.10

Feature Viewer

pLDDT pTM Quality
94.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map