F490359

General Info

Members Datasets Scaffolds Average Seq Length
1119 482 1101 297

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100256214|Ga0068863_1002562142
Length 346
Sequence MTVSATSAQGLDMPHLLKKRLKLNPFVDLGTVQGGDKRAFLFNVPADSQSMAHETLVSLDLPGVDKLRSGKVREVFDLGETLLFVATDRLSAFDVILPDPIPFKGAVLNQISAFWFQKIQLATNHFVTTDFAKFPAELQPYRAQLAGRSMIVRRTKPLPIECVVRGYLAGSGWKDYQATGEVCGHRLPAGLRLASELPEPIFTPSTKNEAGHDLNINWTQCCDAIGKSLARKVRDLSLRIYLAGKEHAAKRGIIVADTKFEFGLAGEELLLIDECLTPDSSRFWPADSYAPGKSPPSFDKQFVRDYLETLDWNKTPPGPRLPADVIEKTSAKYRDAFQRLTKSELS

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221586 Lysobacter sp. Root667 Isolate Unclassified
5 2643221593 Lysobacter sp. Root690 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221695 Lysobacter sp. Root494 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
12 2734482264 Dyella sp. AD052 Isolate Unclassified
13 2738543009 Luteibacter sp. OK325 Isolate Unclassified
14 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
15 2919085039 Luteibacter sp. 1214 Isolate Unclassified
16 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
17 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
245 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
304 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
305 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
306 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
310 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
311 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
312 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
313 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
314 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
315 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
316 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
317 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
318 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
319 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
320 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
321 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
391 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
392 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
393 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
419 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
420 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
437 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
440 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
441 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
442 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
443 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
444 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
445 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
446 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
447 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
448 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
465 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
466 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
467 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
468 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
471 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
472 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
473 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
474 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
475 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
476 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
477 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
482 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0.09
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 4.2
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 4.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000053 3300000545 Bacteria 22078
2 JGI25162J39368_1000837 3300002737 Bacteria 20279
3 JGI25157J39369_1000177 3300002741 Bacteria 53890
4 JGI25163J39215_1002314 3300002771 Bacteria 2049
5 JGI25164J39214_1000159 3300002772 Bacteria 63983
6 JGI25151J46595_10001571 3300003187 Bacteria 15244
7 JGI25165J46597_1000287 3300003214 Bacteria 64000
8 rootH1_10130599 3300003323 Bacteria 4508
9 Ga0055535_1000329 3300003761 Bacteria 47890
10 Ga0055542_1000547 3300003762 Bacteria 33443
11 Ga0055529_1000108 3300003763 Bacteria 122223
12 Ga0055536_1002534 3300003781 Bacteria 10230
13 Ga0055536_1020770 3300003781 Bacteria 2015
14 Ga0055536_1037451 3300003781 Bacteria 1187
15 Ga0055530_10001342 3300003791 Bacteria 18385
16 Ga0055531_10001941 3300003794 Bacteria 14444
17 Ga0055531_10025470 3300003794 Bacteria 2146
18 Ga0065712_10077015 3300005290 Bacteria 3563
19 Ga0065715_10091766 3300005293 Bacteria 5565
20 Ga0065707_10021569 3300005295 Unclassified 1746
21 Ga0065707_10082772 3300005295 Bacteria 12215
22 Ga0065707_10084930 3300005295 Bacteria 6627
23 Ga0065707_10120764 3300005295 Bacteria 2126
24 Ga0065707_10166743 3300005295 Bacteria 1516
25 Ga0070676_10005061 3300005328 Bacteria 6989
26 Ga0070676_10009567 3300005328 Bacteria 5235
27 Ga0070676_10015813 3300005328 Bacteria 4163
28 Ga0070676_10019381 3300005328 Bacteria 3784
29 Ga0070676_10072619 3300005328 Bacteria 2069
30 Ga0070683_100066760 3300005329 Bacteria 3351
31 Ga0070690_100013171 3300005330 Bacteria 4882
32 Ga0070690_100014709 3300005330 Bacteria 4647
33 Ga0070690_100041653 3300005330 Bacteria 2908
34 Ga0070670_100016518 3300005331 Bacteria 6336
35 Ga0070670_100018329 3300005331 Bacteria 6006
36 Ga0070670_100026951 3300005331 Bacteria 4943
37 Ga0070670_100127393 3300005331 Bacteria 2198
38 Ga0070677_10016848 3300005333 Bacteria 2608
39 Ga0068869_100081038 3300005334 Bacteria 2423
40 Ga0070666_10015646 3300005335 Bacteria 4841
41 Ga0070666_10068861 3300005335 Bacteria 2405
42 Ga0070666_10136193 3300005335 Bacteria 1709
43 Ga0070680_100009323 3300005336 Bacteria 7539
44 Ga0070680_100060056 3300005336 Bacteria 3111
45 Ga0070680_100276719 3300005336 Bacteria 1421
46 Ga0070682_100118532 3300005337 Bacteria 1773
47 Ga0068868_100014018 3300005338 Bacteria 5898
48 Ga0068868_100016352 3300005338 Bacteria 5509
49 Ga0068868_100039621 3300005338 Bacteria 3662
50 Ga0068868_100041492 3300005338 Bacteria 3585
51 Ga0068868_100132026 3300005338 Bacteria 2044
52 Ga0070689_100000945 3300005340 Bacteria 18075
53 Ga0070689_100001450 3300005340 Bacteria 15138
54 Ga0070689_100012449 3300005340 Bacteria 6129
55 Ga0070689_100081283 3300005340 Bacteria 2544
56 Ga0070689_100154175 3300005340 Bacteria 1854
57 Ga0070687_100000577 3300005343 Bacteria 12201
58 Ga0070687_100086250 3300005343 Bacteria 1725
59 Ga0070661_100028400 3300005344 Bacteria 4035
60 Ga0070661_100065072 3300005344 Bacteria 2679
61 Ga0070668_100008104 3300005347 Bacteria 7803
62 Ga0070668_100072757 3300005347 Bacteria 2679
63 Ga0070668_100102853 3300005347 Bacteria 2266
64 Ga0070668_100234977 3300005347 Bacteria 1517
65 Ga0070668_100458069 3300005347 Bacteria 1098
66 Ga0070668_100466121 3300005347 Bacteria 1089
67 Ga0070669_100002483 3300005353 Bacteria 13359
68 Ga0070669_100060779 3300005353 Bacteria 2776
69 Ga0070669_100087759 3300005353 Bacteria 2326
70 Ga0070675_100001717 3300005354 Bacteria 16184
71 Ga0070675_100002965 3300005354 Bacteria 12811
72 Ga0070675_100010769 3300005354 Bacteria 7154
73 Ga0070675_100048024 3300005354 Bacteria 3499
74 Ga0070675_100077596 3300005354 Bacteria 2765
75 Ga0070675_100140321 3300005354 Unclassified 2065
76 Ga0070675_100174081 3300005354 Bacteria 1857
77 Ga0070675_100314314 3300005354 Bacteria 1383
78 Ga0070671_100010170 3300005355 Bacteria 7551
79 Ga0070671_100021794 3300005355 Bacteria 5233
80 Ga0070671_100023724 3300005355 Bacteria 5021
81 Ga0070671_100041962 3300005355 Bacteria 3803
82 Ga0070671_100162934 3300005355 Bacteria 1885
83 Ga0070674_100000943 3300005356 Bacteria 15159
84 Ga0070674_100013991 3300005356 Bacteria 4977
85 Ga0070674_100023293 3300005356 Bacteria 4006
86 Ga0070674_100025646 3300005356 Bacteria 3840
87 Ga0070674_100050426 3300005356 Bacteria 2866
88 Ga0070673_100001757 3300005364 Bacteria 12923
89 Ga0070673_100004145 3300005364 Bacteria 9129
90 Ga0070673_100026784 3300005364 Bacteria 4263
91 Ga0070673_100050461 3300005364 Bacteria 3253
92 Ga0070673_100050659 3300005364 Bacteria 3247
93 Ga0070673_100086795 3300005364 Bacteria 2550
94 Ga0070688_100025361 3300005365 Bacteria 3510
95 Ga0070688_100033591 3300005365 Bacteria 3102
96 Ga0070688_100096141 3300005365 Unclassified 1945
97 Ga0070659_100003104 3300005366 Bacteria 11813
98 Ga0070667_100001144 3300005367 Bacteria 24083
99 Ga0070667_100001152 3300005367 Bacteria 23990
100 Ga0070667_100063863 3300005367 Bacteria 3122
101 Ga0070667_100136318 3300005367 Bacteria 2146
102 Ga0070667_100160666 3300005367 Bacteria 1979
103 Ga0070709_10074566 3300005434 Bacteria 2199
104 Ga0070709_10157158 3300005434 Bacteria 1577
105 Ga0070709_10162600 3300005434 Bacteria 1553
106 Ga0070713_100000635 3300005436 Bacteria 22421
107 Ga0070713_100451815 3300005436 Bacteria 1207
108 Ga0070710_10041243 3300005437 Bacteria 2547
109 Ga0070701_10015659 3300005438 Bacteria 3508
110 Ga0070711_100001699 3300005439 Bacteria 12200
111 Ga0070711_100010266 3300005439 Bacteria 5793
112 Ga0070711_100020880 3300005439 Bacteria 4227
113 Ga0070705_100096360 3300005440 Bacteria 1857
114 Ga0070705_100159346 3300005440 Bacteria 1507
115 Ga0070705_100289564 3300005440 Bacteria 1168
116 Ga0070700_100028284 3300005441 Bacteria 3332
117 Ga0070694_100054385 3300005444 Bacteria 2712
118 Ga0070708_100061928 3300005445 Bacteria 3344
119 Ga0070708_100108787 3300005445 Bacteria 2546
120 Ga0070663_100055413 3300005455 Bacteria 2838
121 Ga0070678_100003884 3300005456 Bacteria 8396
122 Ga0070678_100136932 3300005456 Bacteria 1954
123 Ga0070678_100230905 3300005456 Bacteria 1542
124 Ga0070662_100002487 3300005457 Bacteria 11357
125 Ga0070662_100102116 3300005457 Bacteria 2172
126 Ga0070662_100130834 3300005457 Bacteria 1934
127 Ga0070662_100158043 3300005457 Unclassified 1771
128 Ga0070662_100179390 3300005457 Bacteria 1668
129 Ga0070681_10006880 3300005458 Bacteria 11070
130 Ga0070681_10015633 3300005458 Bacteria 7558
131 Ga0070681_10155029 3300005458 Bacteria 2216
132 Ga0068867_100057000 3300005459 Bacteria 2892
133 Ga0070685_10035477 3300005466 Bacteria 2813
134 Ga0070685_10038178 3300005466 Bacteria 2723
135 Ga0070706_100028777 3300005467 Bacteria 5117
136 Ga0070706_100075924 3300005467 Bacteria 3110
137 Ga0070707_100000049 3300005468 Bacteria 102972
138 Ga0070707_100007424 3300005468 Bacteria 10179
139 Ga0070707_100036291 3300005468 Bacteria 4702
140 Ga0070707_100075070 3300005468 Bacteria 3260
141 Ga0070707_100128199 3300005468 Bacteria 2466
142 Ga0070707_100167331 3300005468 Unclassified 2142
143 Ga0070707_100277610 3300005468 Bacteria 1629
144 Ga0070698_100123519 3300005471 Bacteria 2547
145 Ga0070699_100265886 3300005518 Bacteria 1534
146 Ga0070679_100004933 3300005530 Bacteria 12310
147 Ga0070679_100085288 3300005530 Bacteria 3145
148 Ga0070679_100226203 3300005530 Bacteria 1831
149 Ga0070679_100330174 3300005530 Bacteria 1474
150 Ga0070697_100006541 3300005536 Bacteria 9025
151 Ga0070697_100132275 3300005536 Bacteria 2093
152 Ga0070697_100255962 3300005536 Bacteria 1498
153 Ga0070697_100318771 3300005536 Bacteria 1338
154 Ga0070672_100001943 3300005543 Bacteria 12956
155 Ga0070672_100002408 3300005543 Bacteria 11848
156 Ga0070672_100011227 3300005543 Bacteria 6245
157 Ga0070672_100038187 3300005543 Bacteria 3667
158 Ga0070672_100131034 3300005543 Bacteria 2061
159 Ga0070672_100275064 3300005543 Bacteria 1423
160 Ga0070672_100368504 3300005543 Bacteria 1227
161 Ga0070686_100014455 3300005544 Bacteria 4552
162 Ga0070686_100015716 3300005544 Bacteria 4391
163 Ga0070686_100047307 3300005544 Bacteria 2720
164 Ga0070686_100142040 3300005544 Bacteria 1672
165 Ga0070695_100008782 3300005545 Bacteria 6005
166 Ga0070696_100253881 3300005546 Bacteria 1331
167 Ga0070696_100261723 3300005546 Bacteria 1312
168 Ga0070693_100016370 3300005547 Bacteria 3838
169 Ga0070665_100009546 3300005548 Bacteria 9813
170 Ga0070665_100016694 3300005548 Bacteria 7357
171 Ga0070665_100167823 3300005548 Bacteria 2197
172 Ga0070665_100378535 3300005548 Bacteria 1423
173 Ga0070704_100007181 3300005549 Bacteria 6621
174 Ga0070704_100010173 3300005549 Bacteria 5721
175 Ga0068855_100002029 3300005563 Bacteria 25111
176 Ga0068855_100004382 3300005563 Bacteria 17249
177 Ga0068855_100020496 3300005563 Bacteria 7927
178 Ga0068855_100021246 3300005563 Bacteria 7781
179 Ga0068855_100188006 3300005563 Bacteria 2331
180 Ga0070664_100000478 3300005564 Bacteria 30240
181 Ga0068856_100049179 3300005614 Bacteria 4156
182 Ga0068856_100210301 3300005614 Bacteria 1960
183 Ga0070702_100029377 3300005615 Bacteria 2989
184 Ga0070702_100095611 3300005615 Bacteria 1811
185 Ga0068859_100000831 3300005617 Bacteria 31419
186 Ga0068859_100033950 3300005617 Bacteria 5122
187 Ga0068864_100007046 3300005618 Bacteria 9229
188 Ga0068864_100045068 3300005618 Bacteria 3783
189 Ga0068864_100146428 3300005618 Bacteria 2136
190 Ga0068866_10011945 3300005718 Bacteria 3774
191 Ga0068866_10018274 3300005718 Bacteria 3168
192 Ga0068866_10112429 3300005718 Bacteria 1522
193 Ga0068861_100004533 3300005719 Bacteria 9328
194 Ga0068861_100015762 3300005719 Bacteria 5335
195 Ga0068870_10055258 3300005840 Bacteria 2115
196 Ga0068870_10056769 3300005840 Bacteria 2091
197 Ga0068863_100001040 3300005841 Bacteria 27786
198 Ga0068863_100014440 3300005841 Bacteria 7606
199 Ga0068863_100018533 3300005841 Bacteria 6662
200 Ga0068863_100161412 3300005841 Bacteria 2147
201 Ga0068863_100215302 3300005841 Bacteria 1850
202 Ga0068863_100256214 3300005841 Bacteria 1691
203 Ga0068858_100070305 3300005842 Bacteria 3244
204 Ga0068858_100135763 3300005842 Bacteria 2308
205 Ga0068858_100268276 3300005842 Bacteria 1623
206 Ga0068860_100001229 3300005843 Bacteria 27945
207 Ga0068860_100005012 3300005843 Bacteria 13483
208 Ga0068860_100010393 3300005843 Bacteria 9206
209 Ga0068860_100032175 3300005843 Bacteria 5041
210 Ga0068860_100044910 3300005843 Bacteria 4211
211 Ga0068860_100108360 3300005843 Bacteria 2655
212 Ga0068862_100001139 3300005844 Bacteria 25183
213 Ga0068862_100004453 3300005844 Bacteria 11818
214 Ga0068862_100008015 3300005844 Bacteria 8742
215 Ga0068862_100050351 3300005844 Bacteria 3560
216 Ga0068862_100058472 3300005844 Bacteria 3307
217 Ga0068862_100082852 3300005844 Bacteria 2785
218 Ga0068862_100354687 3300005844 Bacteria 1362
219 Ga0081455_10000192 3300005937 Bacteria 77713
220 Ga0081455_10003245 3300005937 Bacteria 18830
221 Ga0081455_10003695 3300005937 Bacteria 17523
222 Ga0081455_10006042 3300005937 Bacteria 13104
223 Ga0081455_10325496 3300005937 Bacteria 1093
224 Ga0081540_1035648 3300005983 Bacteria 2664
225 Ga0081539_10000383 3300005985 Bacteria 95995
226 Ga0081539_10002232 3300005985 Bacteria 28218
227 Ga0081539_10030194 3300005985 Bacteria 3370
228 Ga0081539_10041447 3300005985 Bacteria 2691
229 Ga0070717_10536548 3300006028 Bacteria 1059
230 Ga0070716_100007793 3300006173 Bacteria 5289
231 Ga0070716_100018410 3300006173 Bacteria 3639
232 Ga0070716_100047887 3300006173 Bacteria 2413
233 Ga0070712_100002312 3300006175 Bacteria 11742
234 Ga0070712_100071788 3300006175 Bacteria 2478
235 Ga0075369_10111558 3300006186 Bacteria 1233
236 Ga0097621_100008000 3300006237 Bacteria 7588
237 Ga0097621_100016502 3300006237 Bacteria 5585
238 Ga0097621_100020951 3300006237 Bacteria 5045
239 Ga0097621_100023330 3300006237 Bacteria 4816
240 Ga0097621_100063875 3300006237 Bacteria 3026
241 Ga0068871_100012976 3300006358 Bacteria 6170
242 Ga0068871_100041971 3300006358 Bacteria 3670
243 Ga0068871_100071935 3300006358 Bacteria 2846
244 Ga0068871_100193900 3300006358 Bacteria 1751
245 Ga0068871_100459876 3300006358 Bacteria 1142
246 Ga0075428_100001274 3300006844 Bacteria 26894
247 Ga0075428_100003879 3300006844 Bacteria 16435
248 Ga0075428_100005990 3300006844 Bacteria 13502
249 Ga0075428_100010791 3300006844 Bacteria 10153
250 Ga0075428_100059535 3300006844 Bacteria 4182
251 Ga0075430_100000913 3300006846 Bacteria 23184
252 Ga0075430_100057950 3300006846 Bacteria 3257
253 Ga0075430_100114313 3300006846 Bacteria 2249
254 Ga0075431_100001253 3300006847 Bacteria 23092
255 Ga0075431_100005040 3300006847 Bacteria 12994
256 Ga0075431_100052449 3300006847 Bacteria 4206
257 Ga0075433_10067805 3300006852 Bacteria 3131
258 Ga0075434_100004319 3300006871 Bacteria 12780
259 Ga0075429_100000022 3300006880 Bacteria 68533
260 Ga0075429_100181450 3300006880 Bacteria 1845
261 Ga0075429_100362807 3300006880 Bacteria 1268
262 Ga0068865_100013725 3300006881 Bacteria 5131
263 Ga0068865_100020816 3300006881 Bacteria 4259
264 Ga0068865_100057160 3300006881 Bacteria 2721
265 Ga0075436_100056445 3300006914 Bacteria 2712
266 Ga0097620_100000831 3300006931 Bacteria 31419
267 Ga0097620_100033950 3300006931 Bacteria 5122
268 Ga0099794_10024955 3300007265 Bacteria 2748
269 Ga0099795_10000048 3300007788 Bacteria 26858
270 Ga0099795_10000148 3300007788 Bacteria 11732
271 Ga0105250_10000024 3300009092 Bacteria 218115
272 Ga0105240_10000901 3300009093 Bacteria 53028
273 Ga0105240_10014105 3300009093 Bacteria 10922
274 Ga0105240_10026721 3300009093 Bacteria 7571
275 Ga0105240_10083685 3300009093 Bacteria 3914
276 Ga0105240_10203690 3300009093 Bacteria 2317
277 Ga0105240_10643913 3300009093 Bacteria 1162
278 Ga0111539_10002430 3300009094 Bacteria 24767
279 Ga0111539_10003440 3300009094 Bacteria 20847
280 Ga0111539_10006408 3300009094 Bacteria 15177
281 Ga0111539_10037630 3300009094 Bacteria 5842
282 Ga0111539_10076014 3300009094 Bacteria 3955
283 Ga0111539_10084162 3300009094 Bacteria 3740
284 Ga0111539_10112002 3300009094 Bacteria 3201
285 Ga0105245_10001689 3300009098 Bacteria 20076
286 Ga0105245_10030551 3300009098 Bacteria 4764
287 Ga0105245_10045099 3300009098 Bacteria 3936
288 Ga0105247_10008112 3300009101 Bacteria 6415
289 Ga0105247_10051584 3300009101 Bacteria 2534
290 Ga0114129_10000119 3300009147 Bacteria 79679
291 Ga0114129_10056261 3300009147 Bacteria 5510
292 Ga0114129_10289232 3300009147 Bacteria 2187
293 Ga0114129_10458134 3300009147 Bacteria 1671
294 Ga0114129_10562462 3300009147 Bacteria 1482
295 Ga0105243_10031692 3300009148 Bacteria 4077
296 Ga0105241_10107967 3300009174 Bacteria 2224
297 Ga0105241_10112391 3300009174 Bacteria 2182
298 Ga0105242_10044172 3300009176 Bacteria 3607
299 Ga0105242_10142480 3300009176 Bacteria 2081
300 Ga0105248_10003905 3300009177 Bacteria 16485
301 Ga0105248_10042203 3300009177 Bacteria 5115
302 Ga0105248_10052989 3300009177 Bacteria 4552
303 Ga0105237_10051480 3300009545 Bacteria 4136
304 Ga0105237_10073452 3300009545 Bacteria 3412
305 Ga0105237_10157361 3300009545 Bacteria 2269
306 Ga0105238_10024802 3300009551 Bacteria 6112
307 Ga0105238_10035681 3300009551 Bacteria 5054
308 Ga0105238_10128745 3300009551 Bacteria 2510
309 Ga0105238_10159039 3300009551 Bacteria 2235
310 Ga0105238_10316408 3300009551 Bacteria 1546
311 Ga0105238_10423924 3300009551 Bacteria 1325
312 Ga0105249_10013319 3300009553 Bacteria 7261
313 Ga0105249_10099754 3300009553 Bacteria 2730
314 Ga0105249_10134454 3300009553 Bacteria 2365
315 Ga0105249_10304139 3300009553 Bacteria 1600
316 Ga0105030_100699 3300009987 Bacteria 2954
317 Ga0099796_10000013 3300010159 Bacteria 54630
318 Ga0105239_10003699 3300010375 Bacteria 18629
319 Ga0105239_10308610 3300010375 Bacteria 1783
320 Ga0105239_10655159 3300010375 Bacteria 1199
321 Ga0105246_10266363 3300011119 Bacteria 1367
322 Ga0157370_10007337 3300013104 Bacteria 12029
323 Ga0157370_10078111 3300013104 Bacteria 3117
324 Ga0157369_10004204 3300013105 Bacteria 17052
325 Ga0157369_10089167 3300013105 Bacteria 3293
326 Ga0157369_10507723 3300013105 Bacteria 1247
327 Ga0157374_10003141 3300013296 Bacteria 13882
328 Ga0157374_10004874 3300013296 Bacteria 11257
329 Ga0157374_10004940 3300013296 Bacteria 11191
330 Ga0157374_10018270 3300013296 Bacteria 6187
331 Ga0157374_10102434 3300013296 Bacteria 2746
332 Ga0157374_10120606 3300013296 Bacteria 2530
333 Ga0157374_10123081 3300013296 Bacteria 2505
334 Ga0157374_10177158 3300013296 Bacteria 2081
335 Ga0157378_10015300 3300013297 Bacteria 6720
336 Ga0157378_10025804 3300013297 Bacteria 5177
337 Ga0157378_10099785 3300013297 Bacteria 2649
338 Ga0157378_10124859 3300013297 Bacteria 2377
339 Ga0163162_10026276 3300013306 Bacteria 5754
340 Ga0163162_10030229 3300013306 Bacteria 5368
341 Ga0163162_10037397 3300013306 Bacteria 4844
342 Ga0163162_10056546 3300013306 Bacteria 3951
343 Ga0163162_10157536 3300013306 Bacteria 2391
344 Ga0163162_10557177 3300013306 Bacteria 1274
345 Ga0157372_10011446 3300013307 Bacteria 9431
346 Ga0157372_10018240 3300013307 Bacteria 7544
347 Ga0157372_10032248 3300013307 Bacteria 5743
348 Ga0157372_10147056 3300013307 Bacteria 2717
349 Ga0157375_10000847 3300013308 Bacteria 26687
350 Ga0157375_10001173 3300013308 Bacteria 22614
351 Ga0157375_10017319 3300013308 Bacteria 6500
352 Ga0157375_10018258 3300013308 Bacteria 6357
353 Ga0157375_10021318 3300013308 Bacteria 5939
354 Ga0157375_10127837 3300013308 Bacteria 2658
355 Ga0157375_10172603 3300013308 Bacteria 2310
356 Ga0157375_10175425 3300013308 Bacteria 2292
357 Ga0157375_10663138 3300013308 Bacteria 1199
358 Ga0157514_105626 3300013874 Bacteria 1647
359 Ga0163163_10000651 3300014325 Bacteria 29734
360 Ga0163163_10013480 3300014325 Bacteria 7488
361 Ga0163163_10696742 3300014325 Bacteria 1079
362 Ga0157380_10006559 3300014326 Bacteria 8209
363 Ga0157380_10021197 3300014326 Bacteria 4871
364 Ga0157380_10115984 3300014326 Bacteria 2259
365 Ga0182008_10141322 3300014497 Bacteria 1204
366 Ga0157377_10015235 3300014745 Bacteria 3928
367 Ga0157379_10000140 3300014968 Bacteria 51940
368 Ga0157379_10001153 3300014968 Bacteria 21560
369 Ga0157379_10034646 3300014968 Bacteria 4502
370 Ga0157379_10039315 3300014968 Bacteria 4220
371 Ga0157379_10605188 3300014968 Bacteria 1023
372 Ga0157376_10010708 3300014969 Bacteria 6723
373 Ga0157376_10021870 3300014969 Bacteria 4973
374 Ga0157376_10059428 3300014969 Bacteria 3205
375 Ga0157376_10079436 3300014969 Bacteria 2812
376 Ga0157376_10180015 3300014969 Bacteria 1931
377 Ga0157376_10334301 3300014969 Bacteria 1444
378 Ga0182006_1000426 3300015261 Bacteria 33653
379 Ga0182007_10019720 3300015262 Bacteria 2420
380 Ga0182005_1000177 3300015265 Bacteria 43741
381 Ga0183360_10001 3300015689 Bacteria 3943671
382 Ga0163161_10165243 3300017792 Bacteria 1689
383 Ga0209760_100925 3300025207 Bacteria 3634
384 Ga0209784_100076 3300025224 Bacteria 139766
385 Ga0207427_100097 3300025231 Bacteria 122973
386 Ga0209437_100116 3300025233 Bacteria 209449
387 Ga0209258_100214 3300025242 Bacteria 115049
388 Ga0207425_1012309 3300025245 Bacteria 2012
389 Ga0209026_1000152 3300025250 Bacteria 110285
390 Ga0209148_1000047 3300025254 Bacteria 434369
391 Ga0209759_1000477 3300025256 Bacteria 44647
392 Ga0209233_1000100 3300025261 Bacteria 293905
393 Ga0209455_1000056 3300025272 Bacteria 349821
394 Ga0209455_1008009 3300025272 Bacteria 2920
395 Ga0209675_1008947 3300025291 Bacteria 3600
396 Ga0209676_1000902 3300025292 Bacteria 37485
397 Ga0209676_1001161 3300025292 Bacteria 28651
398 Ga0209676_1003988 3300025292 Bacteria 8526
399 Ga0209025_1000006 3300025294 Bacteria 1153444
400 Ga0209564_1008169 3300025295 Bacteria 5229
401 Ga0209758_1010914 3300025297 Bacteria 5352
402 Ga0209758_1022287 3300025297 Bacteria 2913
403 Ga0209758_1035471 3300025297 Bacteria 1966
404 Ga0209050_1001357 3300025298 Bacteria 26808
405 Ga0209050_1020156 3300025298 Bacteria 2493
406 Ga0209256_1003764 3300025299 Bacteria 10230
407 Ga0209256_1005859 3300025299 Bacteria 6819
408 Ga0209051_1004483 3300025303 Bacteria 8585
409 Ga0209257_1000210 3300025304 Bacteria 140822
410 Ga0209257_1003174 3300025304 Bacteria 14617
411 Ga0207697_10000127 3300025315 Bacteria 36502
412 Ga0207697_10000230 3300025315 Bacteria 30289
413 Ga0207697_10002319 3300025315 Bacteria 9913
414 Ga0207697_10034143 3300025315 Bacteria 2082
415 Ga0207696_1000096 3300025711 Bacteria 177263
416 Ga0207692_10045343 3300025898 Bacteria 2199
417 Ga0207642_10012409 3300025899 Bacteria 3075
418 Ga0207710_10005865 3300025900 Bacteria 5267
419 Ga0207688_10000591 3300025901 Bacteria 17806
420 Ga0207688_10036345 3300025901 Unclassified 2730
421 Ga0207680_10023677 3300025903 Bacteria 3358
422 Ga0207680_10064604 3300025903 Bacteria 2244
423 Ga0207680_10204137 3300025903 Bacteria 1348
424 Ga0207685_10006566 3300025905 Bacteria 3178
425 Ga0207699_10130360 3300025906 Bacteria 1639
426 Ga0207645_10000171 3300025907 Bacteria 51812
427 Ga0207645_10006341 3300025907 Bacteria 8505
428 Ga0207645_10013669 3300025907 Bacteria 5461
429 Ga0207645_10032058 3300025907 Bacteria 3379
430 Ga0207645_10038449 3300025907 Bacteria 3069
431 Ga0207643_10049139 3300025908 Bacteria 2390
432 Ga0207643_10076788 3300025908 Bacteria 1930
433 Ga0207643_10093215 3300025908 Bacteria 1758
434 Ga0207643_10247148 3300025908 Bacteria 1098
435 Ga0207684_10037866 3300025910 Unclassified 4092
436 Ga0207684_10098239 3300025910 Bacteria 2500
437 Ga0207707_10001141 3300025912 Bacteria 25186
438 Ga0207707_10088618 3300025912 Bacteria 2703
439 Ga0207695_10005812 3300025913 Bacteria 16234
440 Ga0207695_10012567 3300025913 Bacteria 10146
441 Ga0207695_10036780 3300025913 Bacteria 5288
442 Ga0207695_10130051 3300025913 Bacteria 2476
443 Ga0207695_10171000 3300025913 Bacteria 2098
444 Ga0207693_10000503 3300025915 Bacteria 35359
445 Ga0207693_10005444 3300025915 Bacteria 10616
446 Ga0207693_10256185 3300025915 Bacteria 1372
447 Ga0207663_10011802 3300025916 Bacteria 4704
448 Ga0207663_10023100 3300025916 Bacteria 3564
449 Ga0207660_10019218 3300025917 Bacteria 4564
450 Ga0207660_10074190 3300025917 Bacteria 2482
451 Ga0207660_10211583 3300025917 Bacteria 1519
452 Ga0207662_10016842 3300025918 Bacteria 4129
453 Ga0207662_10091820 3300025918 Bacteria 1868
454 Ga0207662_10126810 3300025918 Bacteria 1605
455 Ga0207649_10041309 3300025920 Bacteria 2807
456 Ga0207652_10002545 3300025921 Bacteria 15309
457 Ga0207652_10093156 3300025921 Bacteria 2651
458 Ga0207652_10223712 3300025921 Bacteria 1696
459 Ga0207646_10000115 3300025922 Bacteria 110424
460 Ga0207646_10176222 3300025922 Bacteria 1931
461 Ga0207681_10001338 3300025923 Bacteria 15901
462 Ga0207681_10068054 3300025923 Bacteria 2471
463 Ga0207681_10116045 3300025923 Bacteria 1955
464 Ga0207681_10207184 3300025923 Bacteria 1509
465 Ga0207681_10290062 3300025923 Bacteria 1291
466 Ga0207694_10059801 3300025924 Bacteria 2964
467 Ga0207694_10221015 3300025924 Bacteria 1545
468 Ga0207650_10032005 3300025925 Bacteria 3803
469 Ga0207650_10093412 3300025925 Bacteria 2303
470 Ga0207650_10107177 3300025925 Unclassified 2158
471 Ga0207650_10158378 3300025925 Bacteria 1792
472 Ga0207659_10003201 3300025926 Bacteria 9791
473 Ga0207659_10011180 3300025926 Bacteria 5663
474 Ga0207659_10035522 3300025926 Bacteria 3445
475 Ga0207659_10044224 3300025926 Bacteria 3132
476 Ga0207659_10058465 3300025926 Bacteria 2768
477 Ga0207659_10151725 3300025926 Bacteria 1810
478 Ga0207687_10090224 3300025927 Bacteria 2233
479 Ga0207687_10171123 3300025927 Bacteria 1675
480 Ga0207664_10020285 3300025929 Bacteria 4923
481 Ga0207644_10009392 3300025931 Bacteria 6423
482 Ga0207644_10019599 3300025931 Bacteria 4591
483 Ga0207644_10022203 3300025931 Bacteria 4334
484 Ga0207644_10059011 3300025931 Unclassified 2774
485 Ga0207644_10143243 3300025931 Bacteria 1842
486 Ga0207706_10000921 3300025933 Bacteria 30112
487 Ga0207706_10104054 3300025933 Bacteria 2497
488 Ga0207706_10116337 3300025933 Bacteria 2352
489 Ga0207706_10212264 3300025933 Bacteria 1696
490 Ga0207686_10011202 3300025934 Bacteria 4904
491 Ga0207686_10067655 3300025934 Bacteria 2286
492 Ga0207686_10119445 3300025934 Bacteria 1792
493 Ga0207670_10009590 3300025936 Bacteria 5531
494 Ga0207670_10045538 3300025936 Bacteria 2909
495 Ga0207670_10054826 3300025936 Bacteria 2692
496 Ga0207670_10060043 3300025936 Bacteria 2589
497 Ga0207670_10065040 3300025936 Bacteria 2502
498 Ga0207669_10003041 3300025937 Bacteria 7222
499 Ga0207669_10020808 3300025937 Bacteria 3448
500 Ga0207669_10063271 3300025937 Bacteria 2283
501 Ga0207704_10006008 3300025938 Bacteria 5627
502 Ga0207704_10062251 3300025938 Bacteria 2319
503 Ga0207665_10001022 3300025939 Bacteria 18882
504 Ga0207665_10022922 3300025939 Bacteria 4110
505 Ga0207665_10038899 3300025939 Bacteria 3169
506 Ga0207665_10079680 3300025939 Bacteria 2251
507 Ga0207665_10290627 3300025939 Bacteria 1219
508 Ga0207691_10000559 3300025940 Bacteria 37169
509 Ga0207691_10001130 3300025940 Bacteria 26498
510 Ga0207691_10012145 3300025940 Bacteria 8257
511 Ga0207691_10014279 3300025940 Bacteria 7575
512 Ga0207691_10072437 3300025940 Bacteria 3108
513 Ga0207691_10114204 3300025940 Bacteria 2399
514 Ga0207691_10138756 3300025940 Bacteria 2143
515 Ga0207691_10218961 3300025940 Bacteria 1651
516 Ga0207711_10049042 3300025941 Bacteria 3614
517 Ga0207711_10301688 3300025941 Bacteria 1477
518 Ga0207689_10002452 3300025942 Bacteria 17282
519 Ga0207689_10055262 3300025942 Bacteria 3268
520 Ga0207689_10089737 3300025942 Bacteria 2525
521 Ga0207689_10131883 3300025942 Bacteria 2056
522 Ga0207661_10011542 3300025944 Bacteria 6407
523 Ga0207679_10044562 3300025945 Bacteria 3201
524 Ga0207679_10276241 3300025945 Bacteria 1439
525 Ga0207667_10003042 3300025949 Bacteria 20811
526 Ga0207667_10007832 3300025949 Bacteria 12766
527 Ga0207667_10015125 3300025949 Bacteria 8774
528 Ga0207667_10016187 3300025949 Bacteria 8430
529 Ga0207667_10050891 3300025949 Bacteria 4370
530 Ga0207651_10018685 3300025960 Bacteria 4133
531 Ga0207651_10096373 3300025960 Bacteria 2181
532 Ga0207651_10131406 3300025960 Unclassified 1917
533 Ga0207651_10132280 3300025960 Bacteria 1912
534 Ga0207712_10011043 3300025961 Bacteria 5749
535 Ga0207668_10000957 3300025972 Bacteria 17416
536 Ga0207668_10018195 3300025972 Bacteria 4416
537 Ga0207668_10041479 3300025972 Bacteria 3111
538 Ga0207668_10078135 3300025972 Bacteria 2389
539 Ga0207668_10366227 3300025972 Bacteria 1209
540 Ga0207658_10000131 3300025986 Bacteria 80909
541 Ga0207658_10004264 3300025986 Bacteria 9962
542 Ga0207658_10013569 3300025986 Bacteria 5571
543 Ga0207658_10038107 3300025986 Bacteria 3460
544 Ga0207658_10088850 3300025986 Bacteria 2390
545 Ga0207658_10120211 3300025986 Bacteria 2093
546 Ga0207658_10206184 3300025986 Bacteria 1644
547 Ga0207677_10054699 3300026023 Bacteria 2725
548 Ga0207677_10207243 3300026023 Unclassified 1563
549 Ga0207677_10230151 3300026023 Unclassified 1492
550 Ga0207703_10016287 3300026035 Bacteria 5795
551 Ga0207703_10099428 3300026035 Bacteria 2462
552 Ga0207703_10446782 3300026035 Unclassified 1207
553 Ga0207639_10065784 3300026041 Bacteria 2815
554 Ga0207639_10240985 3300026041 Bacteria 1572
555 Ga0207708_10039861 3300026075 Bacteria 3580
556 Ga0207702_10023010 3300026078 Bacteria 5169
557 Ga0207702_10152734 3300026078 Bacteria 2102
558 Ga0207641_10001631 3300026088 Bacteria 21877
559 Ga0207641_10007657 3300026088 Bacteria 8979
560 Ga0207641_10010738 3300026088 Bacteria 7508
561 Ga0207641_10177441 3300026088 Bacteria 1949
562 Ga0207641_10335107 3300026088 Bacteria 1438
563 Ga0207648_10000450 3300026089 Bacteria 45586
564 Ga0207648_10009740 3300026089 Bacteria 9187
565 Ga0207676_10011037 3300026095 Bacteria 6446
566 Ga0207674_10096108 3300026116 Bacteria 2948
567 Ga0207674_10200954 3300026116 Bacteria 1942
568 Ga0207675_100000186 3300026118 Bacteria 56221
569 Ga0207675_100009520 3300026118 Bacteria 9089
570 Ga0207675_100012136 3300026118 Bacteria 8049
571 Ga0207675_100013158 3300026118 Bacteria 7723
572 Ga0207675_100123924 3300026118 Bacteria 2447
573 Ga0207683_10003057 3300026121 Bacteria 14629
574 Ga0207683_10048708 3300026121 Bacteria 3709
575 Ga0207683_10127022 3300026121 Bacteria 2292
576 Ga0207683_10285550 3300026121 Bacteria 1508
577 Ga0207698_10260058 3300026142 Bacteria 1594
578 Ga0209984_1007099 3300027424 Bacteria 1387
579 Ga0209179_1000025 3300027512 Bacteria 37683
580 Ga0209970_1000774 3300027614 Bacteria 5588
581 Ga0210002_1000587 3300027617 Bacteria 4931
582 Ga0209983_1001502 3300027665 Bacteria 5192
583 Ga0209588_1014692 3300027671 Bacteria 2400
584 Ga0209971_1004126 3300027682 Bacteria 3441
585 Ga0209998_10002195 3300027717 Bacteria 4532
586 Ga0209974_10000104 3300027876 Bacteria 23941
587 Ga0207428_10005148 3300027907 Bacteria 12247
588 Ga0207428_10051710 3300027907 Bacteria 3283
589 Ga0207428_10059740 3300027907 Bacteria 3022
590 Ga0207428_10073196 3300027907 Bacteria 2688
591 Ga0207428_10182389 3300027907 Bacteria 1585
592 Ga0268266_10079426 3300028379 Bacteria 2856
593 Ga0268266_10092394 3300028379 Bacteria 2655
594 Ga0268266_10096839 3300028379 Bacteria 2595
595 Ga0268266_10232811 3300028379 Bacteria 1697
596 Ga0268265_10000879 3300028380 Bacteria 28089
597 Ga0268265_10043119 3300028380 Bacteria 3351
598 Ga0268265_10063385 3300028380 Bacteria 2843
599 Ga0268265_10080292 3300028380 Bacteria 2572
600 Ga0268265_10150675 3300028380 Bacteria 1961
601 Ga0268264_10000102 3300028381 Bacteria 222526
602 Ga0268264_10013464 3300028381 Bacteria 6734
603 Ga0268264_10013892 3300028381 Bacteria 6620
604 Ga0268264_10071509 3300028381 Bacteria 2939
605 Ga0265334_10012805 3300028573 Bacteria 3518
606 Ga0265338_10003632 3300028800 Bacteria 21487
607 Ga0307511_10004214 3300030521 Bacteria 14673
608 Ga0307511_10036113 3300030521 Bacteria 4298
609 Ga0265760_10002154 3300031090 Bacteria 5762
610 Ga0265339_10054301 3300031249 Bacteria 2176
611 Ga0265331_10009421 3300031250 Bacteria 5481
612 Ga0265327_10000556 3300031251 Bacteria 63939
613 Ga0265327_10003741 3300031251 Bacteria 14146
614 Ga0265327_10017089 3300031251 Bacteria 4569
615 Ga0265327_10017852 3300031251 Bacteria 4426
616 Ga0265327_10093483 3300031251 Bacteria 1463
617 Ga0265316_10000167 3300031344 Bacteria 74551
618 Ga0307513_10008759 3300031456 Bacteria 12885
619 Ga0307513_10183040 3300031456 Bacteria 1956
620 Ga0307513_10259883 3300031456 Bacteria 1527
621 Ga0307509_10209922 3300031507 Bacteria 1773
622 Ga0307408_100036559 3300031548 Bacteria 3453
623 Ga0307408_100076964 3300031548 Bacteria 2483
624 Ga0307408_100262339 3300031548 Bacteria 1430
625 Ga0307408_100323812 3300031548 Bacteria 1299
626 Ga0307408_100521352 3300031548 Bacteria 1044
627 Ga0265313_10044529 3300031595 Bacteria 2166
628 Ga0307508_10261319 3300031616 Bacteria 1326
629 Ga0316575_10006188 3300031665 Bacteria 4294
630 Ga0316575_10008075 3300031665 Bacteria 3826
631 Ga0316575_10009617 3300031665 Bacteria 3541
632 Ga0316575_10024359 3300031665 Bacteria 2343
633 Ga0316579_10009386 3300031691 Bacteria 4112
634 Ga0316576_10005106 3300031727 Bacteria 7966
635 Ga0316576_10018540 3300031727 Bacteria 4753
636 Ga0316576_10056216 3300031727 Bacteria 2873
637 Ga0316576_10066117 3300031727 Bacteria 2658
638 Ga0316576_10101925 3300031727 Bacteria 2146
639 Ga0316578_10051924 3300031728 Bacteria 2401
640 Ga0316578_10058275 3300031728 Bacteria 2271
641 Ga0307516_10000081 3300031730 Bacteria 105223
642 Ga0307405_10028693 3300031731 Bacteria 3244
643 Ga0316577_10000946 3300031733 Bacteria 12913
644 Ga0316577_10007228 3300031733 Bacteria 5918
645 Ga0316577_10074569 3300031733 Bacteria 1894
646 Ga0307413_10165982 3300031824 Unclassified 1557
647 Ga0307413_10293709 3300031824 Bacteria 1229
648 Ga0307410_10108025 3300031852 Bacteria 2008
649 Ga0307410_10248047 3300031852 Bacteria 1383
650 Ga0307406_10115597 3300031901 Bacteria 1855
651 Ga0307406_10150755 3300031901 Bacteria 1658
652 Ga0307407_10015223 3300031903 Bacteria 3793
653 Ga0307407_10050152 3300031903 Bacteria 2387
654 Ga0307407_10066608 3300031903 Bacteria 2125
655 Ga0307409_100002001 3300031995 Bacteria 10456
656 Ga0307409_100047196 3300031995 Bacteria 3267
657 Ga0307409_100459714 3300031995 Bacteria 1230
658 Ga0307416_100018243 3300032002 Bacteria 4937
659 Ga0307416_100023642 3300032002 Bacteria 4465
660 Ga0307416_100028901 3300032002 Bacteria 4132
661 Ga0307416_100114613 3300032002 Bacteria 2385
662 Ga0307414_10046280 3300032004 Bacteria 2985
663 Ga0307411_10017297 3300032005 Bacteria 4104
664 Ga0307411_10214136 3300032005 Bacteria 1490
665 Ga0307415_100545326 3300032126 Bacteria 1022
666 Ga0316580_10012862 3300032139 Bacteria 2550
667 Ga0316580_10042730 3300032139 Bacteria 1399
668 Ga0307510_10000006 3300033180 Bacteria 566474
669 Ga0373934_0000368 3300035086 Bacteria 15752
670 Ga0373934_0000410 3300035086 Bacteria 15055
671 Ga0373944_0017915 3300035089 Bacteria 2017
672 Ga0373944_0056672 3300035089 Bacteria 1248
673 Ga0373923_0018514 3300035111 Bacteria 2682
674 Ga0373923_0050074 3300035111 Bacteria 1748
675 Ga0373936_0006311 3300035113 Bacteria 4468
676 Ga0373945_0097279 3300035116 Bacteria 1148
677 Ga0373945_0140497 3300035116 Bacteria 973
678 Ga0373953_0020584 3300035117 Bacteria 2466
679 Ga0373954_0001420 3300035118 Bacteria 9700
680 Ga0373954_0004483 3300035118 Bacteria 6010
681 Ga0373954_0032778 3300035118 Bacteria 2403
682 Ga0373954_0035135 3300035118 Bacteria 2323
683 Ga0373956_0010617 3300035119 Bacteria 3779
684 Ga0373957_0003247 3300035120 Bacteria 4781
685 Ga0373957_0014510 3300035120 Bacteria 2694
686 Ga0373943_0053245 3300035170 Bacteria 1998
687 Ga0373943_0115360 3300035170 Bacteria 1422
688 Ga0373955_0001973 3300035172 Bacteria 8838
689 Ga0373955_0031395 3300035172 Bacteria 2782
690 Ga0373955_0078054 3300035172 Bacteria 1865
691 Ga0316574_0000907 3300035398 Bacteria 13124
692 Ga0316574_0004321 3300035398 Bacteria 7422
693 Ga0316574_0006853 3300035398 Bacteria 6195
694 Ga0316574_0021411 3300035398 Bacteria 3838
695 Ga0316574_0030227 3300035398 Bacteria 3279
696 Ga0316574_0032277 3300035398 Bacteria 3182
697 Ga0316574_0044614 3300035398 Bacteria 2743
698 Ga0316574_0112790 3300035398 Bacteria 1743
699 Ga0316574_0114889 3300035398 Bacteria 1726
700 Ga0373924_0003250 3300035410 Bacteria 5560
701 Ga0373935_0001511 3300035692 Bacteria 12932
702 Ga0373935_0032184 3300035692 Bacteria 3258
703 Ga0373935_0317485 3300035692 Bacteria 1105
704 Ga0373927_0000002 3300035695 Bacteria 966219
705 Ga0373927_0045147 3300035695 Bacteria 2851
706 Ga0373927_0101301 3300035695 Bacteria 1873
707 Ga0373933_0000335 3300035724 Bacteria 30249
708 Ga0373933_0101203 3300035724 Bacteria 1788
709 Ga0373947_0014892 3300035725 Bacteria 4463
710 Ga0373947_0022163 3300035725 Bacteria 3681
711 Ga0373947_0108948 3300035725 Bacteria 1748
712 Ga0373947_0279906 3300035725 Bacteria 1109
713 Ga0373937_0001114 3300036401 Bacteria 22657
714 Ga0373937_0018294 3300036401 Bacteria 6255
715 Ga0373937_0019437 3300036401 Bacteria 6081
716 Ga0373937_0040334 3300036401 Bacteria 4255
717 Ga0373937_0140081 3300036401 Bacteria 2262
718 Ga0373937_0182014 3300036401 Bacteria 1974
719 Ga0373937_0202480 3300036401 Bacteria 1866
720 Ga0373937_0267009 3300036401 Bacteria 1614
721 Ga0316582_0019082 3300036647 Bacteria 4006
722 Ga0316582_0019741 3300036647 Bacteria 3951
723 Ga0316584_0029803 3300036712 Bacteria 4029
724 Ga0316584_0067900 3300036712 Bacteria 2672
725 Ga0373925_0035071 3300037068 Bacteria 3700
726 Ga0373925_0051829 3300037068 Bacteria 3064
727 Ga0373925_0149829 3300037068 Bacteria 1831
728 Ga0373925_0181274 3300037068 Bacteria 1667
729 Ga0395899_0003927 3300037312 Bacteria 11720
730 Ga0395900_0016871 3300037418 Bacteria 7453
731 Ga0395900_0208144 3300037418 Bacteria 1976
732 Ga0395898_0019512 3300037466 Bacteria 6899
733 Ga0395898_0388359 3300037466 Bacteria 1331
734 Ga0395905_0000491 3300037471 Bacteria 54464
735 Ga0395905_0001364 3300037471 Bacteria 29717
736 Ga0316581_0008820 3300037588 Bacteria 2755
737 Ga0316581_0031972 3300037588 Bacteria 1587
738 Ga0436364_1265600 3300037853 Bacteria 1134
739 Ga0395901_0016944 3300038443 Bacteria 7427
740 Ga0436365_0183573 3300039437 Bacteria 1259
741 Ga0436365_0185309 3300039437 Bacteria 2223
742 Ga0436365_0831110 3300039437 Bacteria 13047
743 Ga0436363_0158878 3300039450 Bacteria 7240
744 Ga0436363_1045643 3300039450 Unclassified 1761
745 Ga0436363_1321922 3300039450 Bacteria 2662
746 Ga0439447_000636 3300041407 Bacteria 13075
747 Ga0451841_1321531 3300041498 Bacteria 2285
748 Ga0439441_009725 3300042001 Bacteria 1599
749 Ga0439442_006739 3300042002 Bacteria 2308
750 Ga0439449_0027011 3300042007 Bacteria 2142
751 Ga0439449_0034393 3300042007 Bacteria 1887
752 Ga0439452_025133 3300042010 Bacteria 1515
753 Ga0439454_012946 3300042011 Bacteria 1138
754 Ga0450914_007621 3300042118 Bacteria 982
755 Ga0450920_000265 3300042122 Bacteria 7823
756 Ga0450923_000721 3300042125 Bacteria 3912
757 Ga0450923_036647 3300042125 Bacteria 1018
758 Ga0450891_007844 3300042129 Bacteria 979
759 Ga0450894_004353 3300042131 Bacteria 1840
760 Ga0450896_004094 3300042133 Bacteria 1966
761 Ga0450898_017616 3300042134 Bacteria 1230
762 Ga0450910_008149 3300042147 Bacteria 1470
763 Ga0450908_000566 3300042184 Bacteria 7101
764 Ga0439435_0007663 3300042436 Bacteria 2479
765 Ga0439444_0008815 3300042437 Bacteria 1577
766 Ga0451577_0064238 3300042876 Bacteria 3273
767 Ga0451577_0303388 3300042876 Bacteria 1447
768 Ga0466966_0071783 3300044684 Bacteria 2169
769 Ga0453684_0014076 3300044712 Bacteria 12865
770 Ga0453684_0037359 3300044712 Bacteria 6667
771 Ga0453684_0567487 3300044712 Bacteria 1248
772 Ga0466957_0103105 3300044842 Bacteria 1801
773 Ga0466959_0062293 3300045049 Bacteria 2711
774 Ga0451576_0002379 3300045051 Bacteria 28340
775 Ga0451576_0040111 3300045051 Bacteria 4957
776 Ga0451576_0068419 3300045051 Bacteria 3695
777 Ga0451576_0101804 3300045051 Bacteria 2987
778 Ga0466967_0011944 3300045976 Bacteria 6617
779 Ga0466967_0342586 3300045976 Bacteria 1446
780 Ga0495617_000131 3300046452 Bacteria 49764
781 Ga0495617_001386 3300046452 Bacteria 10676
782 Ga0495592_0029149 3300046454 Bacteria 4178
783 Ga0495592_0048971 3300046454 Bacteria 3142
784 Ga0495603_0075883 3300046455 Bacteria 1973
785 Ga0495603_0098263 3300046455 Bacteria 1710
786 Ga0495629_0034030 3300046459 Bacteria 3603
787 Ga0495629_0159541 3300046459 Bacteria 1567
788 Ga0495638_0000180 3300046460 Bacteria 96716
789 Ga0495638_0005940 3300046460 Bacteria 8961
790 Ga0495638_0103716 3300046460 Bacteria 1697
791 Ga0495641_0023815 3300046461 Bacteria 3033
792 Ga0495651_0000408 3300046462 Bacteria 33285
793 Ga0495651_0001927 3300046462 Bacteria 16055
794 Ga0495651_0080049 3300046462 Bacteria 2468
795 Ga0495653_0007912 3300046463 Bacteria 8701
796 Ga0495650_0006073 3300046471 Bacteria 7624
797 Ga0495650_0013234 3300046471 Bacteria 4378
798 Ga0495580_0008617 3300046472 Bacteria 8087
799 Ga0495580_0039451 3300046472 Bacteria 3378
800 Ga0495580_0058235 3300046472 Bacteria 2718
801 Ga0495580_0121921 3300046472 Bacteria 1810
802 Ga0495664_0014727 3300046477 Bacteria 4437
803 Ga0495584_0001164 3300046491 Bacteria 16193
804 Ga0495585_0000437 3300046492 Bacteria 39894
805 Ga0495594_0056106 3300046499 Bacteria 2173
806 Ga0495607_0000654 3300046501 Bacteria 33669
807 Ga0495606_0000918 3300046507 Bacteria 43503
808 Ga0495606_0009672 3300046507 Bacteria 8115
809 Ga0495608_0067704 3300046511 Bacteria 2335
810 Ga0495616_0000190 3300046513 Bacteria 51392
811 Ga0495616_0000360 3300046513 Bacteria 35740
812 Ga0495618_0076527 3300046514 Bacteria 2133
813 Ga0495618_0137694 3300046514 Bacteria 1561
814 Ga0495620_0000719 3300046515 Bacteria 20409
815 Ga0495628_0004271 3300046516 Bacteria 12709
816 Ga0495628_0066181 3300046516 Bacteria 2825
817 Ga0495628_0085758 3300046516 Bacteria 2442
818 Ga0495628_0144119 3300046516 Bacteria 1817
819 Ga0495630_0075496 3300046517 Bacteria 2540
820 Ga0495630_0252477 3300046517 Bacteria 1347
821 Ga0495631_0000389 3300046518 Bacteria 30279
822 Ga0495631_0000631 3300046518 Bacteria 23012
823 Ga0495632_0000135 3300046519 Bacteria 75082
824 Ga0495632_0007588 3300046519 Bacteria 6788
825 Ga0495637_0034945 3300046520 Bacteria 2198
826 Ga0495644_0005069 3300046523 Bacteria 5153
827 Ga0495648_0003653 3300046524 Bacteria 13457
828 Ga0495648_0005315 3300046524 Bacteria 10739
829 Ga0495663_0028503 3300046525 Bacteria 1644
830 Ga0495666_0005322 3300046526 Bacteria 6489
831 Ga0495652_0041652 3300046529 Bacteria 3963
832 Ga0495652_0290449 3300046529 Bacteria 1193
833 Ga0495665_0026288 3300046531 Bacteria 3126
834 Ga0495640_0006168 3300046533 Bacteria 9502
835 Ga0495586_0106170 3300046535 Bacteria 1561
836 Ga0495586_0130027 3300046535 Bacteria 1409
837 Ga0495587_0005354 3300046536 Bacteria 8392
838 Ga0495609_0015535 3300046538 Bacteria 3562
839 Ga0495621_0002704 3300046539 Bacteria 4808
840 Ga0495622_0027562 3300046557 Bacteria 2652
841 Ga0495622_0042981 3300046557 Bacteria 2101
842 Ga0495667_0007860 3300046559 Bacteria 7226
843 Ga0495656_0027319 3300046615 Bacteria 2278
844 Ga0495656_0072717 3300046615 Bacteria 1531
845 Ga0495668_0001101 3300046616 Bacteria 27963
846 Ga0495668_0004981 3300046616 Bacteria 9190
847 Ga0495634_0050977 3300046642 Bacteria 2777
848 Ga0495611_0000004 3300046648 Bacteria 308149
849 Ga0495611_0000285 3300046648 Bacteria 34425
850 Ga0495625_0000617 3300046660 Bacteria 51659
851 Ga0495625_0009073 3300046660 Bacteria 8390
852 Ga0495625_0065486 3300046660 Bacteria 2561
853 Ga0495635_0134045 3300046663 Bacteria 1688
854 Ga0495659_0005803 3300046664 Bacteria 3895
855 Ga0495661_0001370 3300046665 Bacteria 20570
856 Ga0495657_0007507 3300046675 Bacteria 8425
857 Ga0495599_0004788 3300046678 Bacteria 8046
858 Ga0495647_0002069 3300046681 Bacteria 6279
859 Ga0495647_0028686 3300046681 Bacteria 2054
860 Ga0495658_0009573 3300046683 Bacteria 4832
861 Ga0495658_0036728 3300046683 Bacteria 2705
862 Ga0495658_0060184 3300046683 Bacteria 2177
863 Ga0495669_0043136 3300046684 Bacteria 2007
864 Ga0495613_0008505 3300046689 Bacteria 7616
865 Ga0495613_0262702 3300046689 Bacteria 1202
866 Ga0495670_0000884 3300046691 Bacteria 14524
867 Ga0495671_0010269 3300046692 Bacteria 5198
868 Ga0495671_0026160 3300046692 Bacteria 3027
869 Ga0495671_0076964 3300046692 Bacteria 1636
870 Ga0495649_0003176 3300046694 Bacteria 11231
871 Ga0495649_0003223 3300046694 Bacteria 11133
872 Ga0495589_0002511 3300046794 Bacteria 10232
873 Ga0495600_0031607 3300046809 Bacteria 3430
874 Ga0495660_0000356 3300046810 Bacteria 40494
875 Ga0495660_0000685 3300046810 Bacteria 25950
876 Ga0495604_0071290 3300047317 Bacteria 2628
877 Ga0495604_0201517 3300047317 Bacteria 1380
878 Ga0495636_0013408 3300047318 Bacteria 3253
879 Ga0495674_0012393 3300047319 Bacteria 8034
880 Ga0495680_0426497 3300047322 Bacteria 911
881 Ga0495679_000011 3300047446 Bacteria 324498
882 Ga0495673_0000036 3300047469 Bacteria 311035
883 Ga0495673_0000151 3300047469 Bacteria 122181
884 Ga0495673_0003447 3300047469 Bacteria 10415
885 Ga0495681_0014156 3300047470 Bacteria 4589
886 Ga0495684_0008689 3300047471 Bacteria 7855
887 Ga0495686_0002323 3300047472 Bacteria 18182
888 Ga0495614_0007216 3300048089 Bacteria 4953
889 Ga0496100_0014939 3300048903 Bacteria 4524
890 Ga0496100_0049219 3300048903 Bacteria 2724
891 Ga0496100_0074816 3300048903 Bacteria 2270
892 Ga0496100_0079114 3300048903 Bacteria 2214
893 Ga0496101_0002453 3300048904 Bacteria 11402
894 Ga0496101_0005357 3300048904 Bacteria 8175
895 Ga0496101_0146004 3300048904 Bacteria 1806
896 Ga0496102_0170892 3300048905 Bacteria 2046
897 Ga0496104_0026561 3300048907 Bacteria 5349
898 Ga0496104_0078178 3300048907 Bacteria 3152
899 Ga0496104_0194561 3300048907 Bacteria 1940
900 Ga0496104_0461198 3300048907 Bacteria 1182
901 Ga0496105_0000580 3300048908 Bacteria 24291
902 Ga0496105_0113849 3300048908 Bacteria 2231
903 Ga0496106_0000566 3300048909 Bacteria 26337
904 Ga0496106_0069150 3300048909 Bacteria 2694
905 Ga0496106_0145522 3300048909 Bacteria 1866
906 Ga0496106_0175758 3300048909 Bacteria 1699
907 Ga0496107_0005975 3300048910 Bacteria 8341
908 Ga0496107_0186452 3300048910 Bacteria 1541
909 Ga0496107_0192992 3300048910 Bacteria 1513
910 Ga0496108_0001827 3300048911 Bacteria 17004
911 Ga0496108_0017773 3300048911 Bacteria 5816
912 Ga0496108_0040285 3300048911 Bacteria 3893
913 Ga0496109_0002877 3300048912 Bacteria 14402
914 Ga0496109_0038885 3300048912 Bacteria 4304
915 Ga0496109_0053143 3300048912 Bacteria 3693
916 Ga0496109_0214444 3300048912 Bacteria 1810
917 Ga0496110_0006554 3300048913 Bacteria 9241
918 Ga0496110_0022928 3300048913 Bacteria 5305
919 Ga0496111_0001612 3300048914 Bacteria 13057
920 Ga0496111_0094679 3300048914 Bacteria 2191
921 Ga0496112_0037819 3300048915 Bacteria 4712
922 Ga0496112_0058925 3300048915 Bacteria 3783
923 Ga0496112_0146886 3300048915 Bacteria 2326
924 Ga0496112_0384375 3300048915 Bacteria 1344
925 Ga0496113_0107043 3300048916 Bacteria 2172
926 Ga0496113_0148860 3300048916 Bacteria 1846
927 Ga0496114_0012763 3300048917 Bacteria 6727
928 Ga0496114_0224762 3300048917 Bacteria 1648
929 Ga0496114_0265174 3300048917 Bacteria 1513
930 Ga0496114_0295362 3300048917 Bacteria 1430
931 Ga0496115_0000135 3300048918 Bacteria 67733
932 Ga0496115_0007937 3300048918 Bacteria 7831
933 Ga0496115_0008471 3300048918 Bacteria 7607
934 Ga0496115_0011136 3300048918 Bacteria 6739
935 Ga0496115_0446265 3300048918 Bacteria 1045
936 Ga0496119_0014503 3300048922 Bacteria 6159
937 Ga0496120_0002881 3300048923 Bacteria 16484
938 Ga0496121_0001803 3300048924 Bacteria 34595
939 Ga0496121_0003261 3300048924 Bacteria 23328
940 Ga0496121_0033724 3300048924 Bacteria 4626
941 Ga0496121_0034585 3300048924 Bacteria 4547
942 Ga0496122_0059687 3300048925 Bacteria 2814
943 Ga0496122_0060937 3300048925 Bacteria 2774
944 Ga0496122_0120871 3300048925 Bacteria 1689
945 Ga0496123_0071204 3300048926 Bacteria 2170
946 Ga0496123_0167255 3300048926 Bacteria 1164
947 Ga0496125_0029540 3300048928 Bacteria 4924
948 Ga0496126_0038468 3300048929 Bacteria 4451
949 Ga0496126_0046614 3300048929 Bacteria 3973
950 Ga0496126_0052844 3300048929 Bacteria 3690
951 Ga0496126_0065365 3300048929 Bacteria 3255
952 Ga0495678_000067 3300049459 Bacteria 132540
953 Ga0495682_0044085 3300049460 Bacteria 1632
954 Ga0495682_0094802 3300049460 Bacteria 1071
955 Ga0501031_0017509 3300049568 Bacteria 4658
956 Ga0501031_0060896 3300049568 Bacteria 2460
957 Ga0501032_0039245 3300049569 Bacteria 3221
958 Ga0501033_0006636 3300049570 Bacteria 9050
959 Ga0501034_0021355 3300049571 Bacteria 6601
960 Ga0501036_0001084 3300049572 Bacteria 20626
961 Ga0501036_0184721 3300049572 Bacteria 1754
962 Ga0501037_0010840 3300049573 Bacteria 6697
963 Ga0501038_0006113 3300049574 Bacteria 11142
964 Ga0501038_0081494 3300049574 Bacteria 2726
965 Ga0501038_0096827 3300049574 Bacteria 2462
966 Ga0501039_0001878 3300049575 Bacteria 15530
967 Ga0501039_0035236 3300049575 Bacteria 3862
968 Ga0501039_0335905 3300049575 Bacteria 1187
969 Ga0501040_0008280 3300049576 Bacteria 6764
970 Ga0501041_0001352 3300049577 Bacteria 13505
971 Ga0501041_0004090 3300049577 Bacteria 8424
972 Ga0501041_0004174 3300049577 Bacteria 8363
973 Ga0501042_0021423 3300049578 Bacteria 4505
974 Ga0501042_0054772 3300049578 Bacteria 2845
975 Ga0501042_0117642 3300049578 Bacteria 1913
976 Ga0501042_0120685 3300049578 Bacteria 1887
977 Ga0501043_0003354 3300049579 Bacteria 13194
978 Ga0501043_0033076 3300049579 Bacteria 4067
979 Ga0501046_0004568 3300049580 Bacteria 12530
980 Ga0501046_0059561 3300049580 Bacteria 2991
981 Ga0501046_0061552 3300049580 Bacteria 2934
982 Ga0501046_0381646 3300049580 Bacteria 1020
983 Ga0501047_0017266 3300049581 Bacteria 6910
984 Ga0501048_0125258 3300049582 Bacteria 1816
985 Ga0501048_0209418 3300049582 Bacteria 1383
986 Ga0501048_0238749 3300049582 Bacteria 1290
987 Ga0501067_0007592 3300049583 Bacteria 6029
988 Ga0501068_0004281 3300049584 Bacteria 7751
989 Ga0501068_0067378 3300049584 Bacteria 2181
990 Ga0501068_0128373 3300049584 Bacteria 1584
991 Ga0501069_0024446 3300049585 Bacteria 3295
992 Ga0501070_0008384 3300049586 Bacteria 8731
993 Ga0501070_0066896 3300049586 Bacteria 2976
994 Ga0501071_0001102 3300049587 Bacteria 15055
995 Ga0501071_0007186 3300049587 Bacteria 7284
996 Ga0501071_0088804 3300049587 Bacteria 2268
997 Ga0501071_0164848 3300049587 Bacteria 1658
998 Ga0501071_0313432 3300049587 Bacteria 1190
999 Ga0501072_0004768 3300049588 Bacteria 10324
1000 Ga0501072_0021469 3300049588 Bacteria 5006
1001 Ga0501072_0030487 3300049588 Bacteria 4219
1002 Ga0501072_0083607 3300049588 Bacteria 2530
1003 Ga0501072_0112566 3300049588 Bacteria 2167
1004 Ga0501073_0000353 3300049589 Bacteria 31030
1005 Ga0501073_0001886 3300049589 Bacteria 15613
1006 Ga0501073_0026530 3300049589 Bacteria 4150
1007 Ga0501073_0315840 3300049589 Bacteria 1078
1008 Ga0501074_0003294 3300049590 Bacteria 11426
1009 Ga0501074_0019490 3300049590 Bacteria 4926
1010 Ga0501075_0000520 3300049591 Bacteria 23251
1011 Ga0501075_0013581 3300049591 Bacteria 5815
1012 Ga0501075_0145419 3300049591 Bacteria 1807
1013 Ga0501076_0002351 3300049592 Bacteria 12937
1014 Ga0501076_0002386 3300049592 Bacteria 12862
1015 Ga0501076_0016740 3300049592 Bacteria 5562
1016 Ga0501076_0030284 3300049592 Bacteria 4215
1017 Ga0501076_0103409 3300049592 Bacteria 2298
1018 Ga0501076_0165545 3300049592 Bacteria 1802
1019 Ga0501076_0274709 3300049592 Bacteria 1380
1020 Ga0501077_0004241 3300049593 Bacteria 8667
1021 Ga0501077_0107752 3300049593 Bacteria 1765
1022 Ga0501077_0131792 3300049593 Bacteria 1585
1023 Ga0501077_0143422 3300049593 Bacteria 1515
1024 Ga0501209_012427 3300049656 Bacteria 1815
1025 Ga0501249_034133 3300049679 Bacteria 1140
1026 Ga0501250_014979 3300049680 Bacteria 948
1027 Ga0501079_0000016 3300049741 Bacteria 65975
1028 Ga0501079_0001155 3300049741 Bacteria 18458
1029 Ga0501079_0010787 3300049741 Bacteria 6957
1030 Ga0501080_0000344 3300049742 Bacteria 35777
1031 Ga0501080_0003150 3300049742 Bacteria 14528
1032 Ga0501080_0005196 3300049742 Bacteria 11600
1033 Ga0501080_0013763 3300049742 Bacteria 7449
1034 Ga0501081_0005614 3300049743 Bacteria 8104
1035 Ga0501081_0016366 3300049743 Bacteria 4901
1036 Ga0501081_0038157 3300049743 Bacteria 3280
1037 Ga0501081_0277979 3300049743 Bacteria 1225
1038 Ga0501083_0063859 3300049744 Bacteria 2455
1039 Ga0501083_0130495 3300049744 Bacteria 1647
1040 Ga0501083_0267820 3300049744 Bacteria 1111
1041 Ga0501035_0017079 3300049822 Bacteria 6686
1042 Ga0501035_0035198 3300049822 Bacteria 4545
1043 Ga0501035_0038779 3300049822 Bacteria 4313
1044 Ga0501035_0163012 3300049822 Bacteria 1929
1045 Ga0501044_0076307 3300049823 Bacteria 3402
1046 Ga0501045_0002571 3300049824 Bacteria 12379
1047 Ga0501045_0038353 3300049824 Bacteria 3484
1048 nmdc:mga05p37_122_c1 3300050507 Bacteria 70077
1049 nmdc:mga05p37_46323_c1 3300050507 Bacteria 5347
1050 nmdc:mga09592_120_c1 3300050508 Bacteria 50062
1051 nmdc:mga09592_380_c1 3300050508 Bacteria 32519
1052 nmdc:mga09592_415926_c1 3300050508 Bacteria 1162
1053 nmdc:mga09592_66814_c1 3300050508 Bacteria 3048
1054 nmdc:mga0qj67_186476_c1 3300050509 Bacteria 1685
1055 nmdc:mga0qj67_386_c1 3300050509 Bacteria 30425
1056 nmdc:mga0qj67_51284_c1 3300050509 Bacteria 3262
1057 nmdc:mga0qj67_64402_c1 3300050509 Bacteria 2915
1058 nmdc:mga06r32_137_c1 3300050510 Bacteria 54136
1059 nmdc:mga06r32_36556_c1 3300050510 Bacteria 4642
1060 nmdc:mga06r32_42737_c1 3300050510 Bacteria 4311
1061 nmdc:mga06r32_4682_c1 3300050510 Bacteria 12287
1062 nmdc:mga06r32_8162_c1 3300050510 Bacteria 9421
1063 nmdc:mga08y16_1797_c1 3300050511 Bacteria 21750
1064 nmdc:mga08y16_3233_c1 3300050511 Bacteria 16874
1065 nmdc:mga08y16_54603_c1 3300050511 Bacteria 4174
1066 nmdc:mga08y16_59886_c1 3300050511 Bacteria 3977
1067 nmdc:mga08y16_62003_c1 3300050511 Bacteria 3905
1068 nmdc:mga08y16_98316_c1 3300050511 Bacteria 3048
1069 nmdc:mga0n895_563584_c1 3300050512 Bacteria 1144
1070 nmdc:mga0n895_736_c1 3300050512 Bacteria 23112
1071 nmdc:mga0rr50_27752_c1 3300050513 Bacteria 3969
1072 nmdc:mga0rr50_54044_c1 3300050513 Bacteria 2990
1073 nmdc:mga08x19_47292_c1 3300050514 Bacteria 2754
1074 nmdc:mga0a205_9711_c1 3300050515 Bacteria 8813
1075 Ga0495601_0008506 3300053077 Bacteria 6060
1076 Ga0495601_0053019 3300053077 Bacteria 2563
1077 Ga0495612_0144958 3300053078 Bacteria 1031
1078 Ga0495655_0059876 3300053083 Bacteria 1035
1079 Ga0495595_0001644 3300053084 Bacteria 8749
1080 Ga0500643_000012 3300053087 Bacteria 369839
1081 Ga0500583_0004089 3300053092 Bacteria 4701
1082 Ga0500583_0073946 3300053092 Bacteria 1635
1083 Ga0500556_0000313 3300053104 Bacteria 36728
1084 Ga0500588_0041615 3300053146 Bacteria 1387
1085 Ga0500622_0001607 3300053156 Bacteria 17745
1086 Ga0500622_0004452 3300053156 Bacteria 8795
1087 Ga0500622_0027685 3300053156 Bacteria 2988
1088 Ga0500633_0021636 3300053160 Bacteria 1958
1089 Ga0500636_0001930 3300053177 Bacteria 11386
1090 Ga0500637_0014858 3300053178 Bacteria 4112
1091 Ga0500637_0065022 3300053178 Bacteria 2092
1092 Ga0500625_003485 3300053729 Bacteria 6229
1093 Ga0501084_0038603 3300054114 Bacteria 3992
1094 Ga0501084_0164994 3300054114 Bacteria 1869
1095 Ga0501084_0204297 3300054114 Bacteria 1667
1096 Ga0501082_0000552 3300060353 Bacteria 33331
1097 Ga0501082_0019061 3300060353 Bacteria 5911
1098 Ga0501082_0034152 3300060353 Bacteria 4387
1099 Ga0530510_0000463 3300061734 Bacteria 26209
1100 Ga0530510_0012087 3300061734 Bacteria 6058
1101 Ga0530510_0167072 3300061734 Bacteria 1629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0238749 Ga0501048_0238749_10_690 223
2 3300046472 Ga0495580_0121921 Ga0495580_0121921_581_1468 250
3 3300005434 Ga0070709_10162600 Ga0070709_101626001 254
4 3300025939 Ga0207665_10290627 Ga0207665_102906271 254
5 3300005456 Ga0070678_100230905 Ga0070678_1002309052 255
6 3300006881 Ga0068865_100057160 Ga0068865_1000571604 255
7 3300010375 Ga0105239_10655159 Ga0105239_106551592 255
8 3300013296 Ga0157374_10177158 Ga0157374_101771582 255
9 3300013297 Ga0157378_10099785 Ga0157378_100997853 255
10 3300013306 Ga0163162_10157536 Ga0163162_101575362 255
11 3300013308 Ga0157375_10175425 Ga0157375_101754252 255
12 3300014969 Ga0157376_10334301 Ga0157376_103343012 255
13 3300025925 Ga0207650_10107177 Ga0207650_101071772 255
14 3300028379 Ga0268266_10096839 Ga0268266_100968392 255
15 3300035116 Ga0373945_0097279 Ga0373945_0097279_164_1120 255
16 3300048903 Ga0496100_0079114 Ga0496100_0079114_783_1667 255
17 3300048904 Ga0496101_0146004 Ga0496101_0146004_815_1699 255
18 3300048905 Ga0496102_0170892 Ga0496102_0170892_750_1634 255
19 3300048909 Ga0496106_0145522 Ga0496106_0145522_794_1678 255
20 3300048910 Ga0496107_0192992 Ga0496107_0192992_270_1154 255
21 3300048915 Ga0496112_0146886 Ga0496112_0146886_704_1588 255
22 3300048917 Ga0496114_0265174 Ga0496114_0265174_336_1220 255
23 3300035089 Ga0373944_0017915 Ga0373944_0017915_83_1105 256
24 3300005328 Ga0070676_10019381 Ga0070676_100193811 257
25 3300005338 Ga0068868_100041492 Ga0068868_1000414921 257
26 3300005347 Ga0070668_100234977 Ga0070668_1002349771 257
27 3300005356 Ga0070674_100050426 Ga0070674_1000504263 257
28 3300005457 Ga0070662_100179390 Ga0070662_1001793901 257
29 3300005546 Ga0070696_100253881 Ga0070696_1002538811 257
30 3300006175 Ga0070712_100071788 Ga0070712_1000717882 257
31 3300025315 Ga0207697_10002319 Ga0207697_1000231913 257
32 3300025901 Ga0207688_10036345 Ga0207688_100363452 257
33 3300025903 Ga0207680_10204137 Ga0207680_102041372 257
34 3300025915 Ga0207693_10256185 Ga0207693_102561851 257
35 3300025916 Ga0207663_10023100 Ga0207663_100231004 257
36 3300025931 Ga0207644_10143243 Ga0207644_101432432 257
37 3300025939 Ga0207665_10038899 Ga0207665_100388993 257
38 3300025940 Ga0207691_10014279 Ga0207691_100142793 257
39 3300025986 Ga0207658_10120211 Ga0207658_101202113 257
40 3300026023 Ga0207677_10207243 Ga0207677_102072431 257
41 3300026121 Ga0207683_10048708 Ga0207683_100487081 257
42 3300049575 Ga0501039_0335905 Ga0501039_0335905_302_1138 274
43 3300049580 Ga0501046_0381646 Ga0501046_0381646_124_963 275
44 3300049581 Ga0501047_0017266 Ga0501047_0017266_4463_5302 275
45 3300049587 Ga0501071_0164848 Ga0501071_0164848_766_1605 275
46 3300049588 Ga0501072_0112566 Ga0501072_0112566_931_1770 275
47 3300049592 Ga0501076_0274709 Ga0501076_0274709_508_1347 275
48 3300005290 Ga0065712_10077015 Ga0065712_100770153 280
49 3300005293 Ga0065715_10091766 Ga0065715_100917667 280
50 3300005328 Ga0070676_10072619 Ga0070676_100726192 280
51 3300005331 Ga0070670_100026951 Ga0070670_1000269513 280
52 3300005331 Ga0070670_100127393 Ga0070670_1001273931 280
53 3300005338 Ga0068868_100016352 Ga0068868_1000163521 280
54 3300005340 Ga0070689_100000945 Ga0070689_1000009458 280
55 3300005354 Ga0070675_100010769 Ga0070675_1000107694 280
56 3300005364 Ga0070673_100004145 Ga0070673_1000041458 280
57 3300005365 Ga0070688_100025361 Ga0070688_1000253612 280
58 3300005367 Ga0070667_100160666 Ga0070667_1001606662 280
59 3300005440 Ga0070705_100159346 Ga0070705_1001593462 280
60 3300005441 Ga0070700_100028284 Ga0070700_1000282844 280
61 3300005457 Ga0070662_100002487 Ga0070662_1000024871 280
62 3300005466 Ga0070685_10035477 Ga0070685_100354772 280
63 3300005530 Ga0070679_100330174 Ga0070679_1003301742 280
64 3300005543 Ga0070672_100001943 Ga0070672_1000019439 280
65 3300005544 Ga0070686_100014455 Ga0070686_1000144553 280
66 3300005548 Ga0070665_100167823 Ga0070665_1001678231 280
67 3300005564 Ga0070664_100000478 Ga0070664_1000004789 280
68 3300005615 Ga0070702_100095611 Ga0070702_1000956112 280
69 3300005617 Ga0068859_100000831 Ga0068859_1000008318 280
70 3300005618 Ga0068864_100007046 Ga0068864_1000070468 280
71 3300005718 Ga0068866_10018274 Ga0068866_100182743 280
72 3300005719 Ga0068861_100004533 Ga0068861_1000045338 280
73 3300005840 Ga0068870_10055258 Ga0068870_100552583 280
74 3300005841 Ga0068863_100001040 Ga0068863_10000104027 280
75 3300005844 Ga0068862_100001139 Ga0068862_10000113921 280
76 3300005844 Ga0068862_100008015 Ga0068862_1000080152 280
77 3300006358 Ga0068871_100193900 Ga0068871_1001939002 280
78 3300006844 Ga0075428_100001274 Ga0075428_10000127420 280
79 3300006844 Ga0075428_100003879 Ga0075428_10000387913 280
80 3300006844 Ga0075428_100059535 Ga0075428_1000595352 280
81 3300006846 Ga0075430_100000913 Ga0075430_10000091321 280
82 3300006846 Ga0075430_100114313 Ga0075430_1001143131 280
83 3300006847 Ga0075431_100001253 Ga0075431_10000125320 280
84 3300006847 Ga0075431_100005040 Ga0075431_10000504011 280
85 3300006880 Ga0075429_100000022 Ga0075429_10000002221 280
86 3300006880 Ga0075429_100181450 Ga0075429_1001814502 280
87 3300006881 Ga0068865_100020816 Ga0068865_1000208162 280
88 3300006931 Ga0097620_100000831 Ga0097620_1000008318 280
89 3300009094 Ga0111539_10003440 Ga0111539_1000344014 280
90 3300009094 Ga0111539_10006408 Ga0111539_100064084 280
91 3300009094 Ga0111539_10084162 Ga0111539_100841623 280
92 3300009147 Ga0114129_10056261 Ga0114129_100562613 280
93 3300009147 Ga0114129_10458134 Ga0114129_104581342 280
94 3300009148 Ga0105243_10031692 Ga0105243_100316921 280
95 3300009176 Ga0105242_10142480 Ga0105242_101424802 280
96 3300009177 Ga0105248_10003905 Ga0105248_1000390510 280
97 3300009553 Ga0105249_10099754 Ga0105249_100997543 280
98 3300011119 Ga0105246_10266363 Ga0105246_102663631 280
99 3300013308 Ga0157375_10021318 Ga0157375_100213185 280
100 3300014325 Ga0163163_10000651 Ga0163163_100006515 280
101 3300014745 Ga0157377_10015235 Ga0157377_100152353 280
102 3300014969 Ga0157376_10079436 Ga0157376_100794363 280
103 3300025903 Ga0207680_10064604 Ga0207680_100646042 280
104 3300025907 Ga0207645_10038449 Ga0207645_100384493 280
105 3300025908 Ga0207643_10049139 Ga0207643_100491392 280
106 3300025908 Ga0207643_10076788 Ga0207643_100767883 280
107 3300025918 Ga0207662_10016842 Ga0207662_100168422 280
108 3300025923 Ga0207681_10001338 Ga0207681_1000133813 280
109 3300025925 Ga0207650_10158378 Ga0207650_101583782 280
110 3300025926 Ga0207659_10003201 Ga0207659_100032018 280
111 3300025927 Ga0207687_10171123 Ga0207687_101711232 280
112 3300025933 Ga0207706_10116337 Ga0207706_101163372 280
113 3300025934 Ga0207686_10067655 Ga0207686_100676552 280
114 3300025936 Ga0207670_10054826 Ga0207670_100548263 280
115 3300025938 Ga0207704_10062251 Ga0207704_100622512 280
116 3300025940 Ga0207691_10012145 Ga0207691_100121458 280
117 3300025942 Ga0207689_10002452 Ga0207689_100024523 280
118 3300025945 Ga0207679_10276241 Ga0207679_102762412 280
119 3300025960 Ga0207651_10096373 Ga0207651_100963732 280
120 3300025961 Ga0207712_10011043 Ga0207712_100110436 280
121 3300026075 Ga0207708_10039861 Ga0207708_100398613 280
122 3300026088 Ga0207641_10007657 Ga0207641_100076574 280
123 3300026089 Ga0207648_10009740 Ga0207648_100097406 280
124 3300026116 Ga0207674_10096108 Ga0207674_100961082 280
125 3300026118 Ga0207675_100009520 Ga0207675_1000095203 280
126 3300026118 Ga0207675_100123924 Ga0207675_1001239242 280
127 3300027907 Ga0207428_10051710 Ga0207428_100517104 280
128 3300027907 Ga0207428_10059740 Ga0207428_100597404 280
129 3300027907 Ga0207428_10073196 Ga0207428_100731962 280
130 3300027907 Ga0207428_10182389 Ga0207428_101823892 280
131 3300028379 Ga0268266_10232811 Ga0268266_102328111 280
132 3300028380 Ga0268265_10000879 Ga0268265_100008796 280
133 3300031548 Ga0307408_100076964 Ga0307408_1000769643 280
134 3300031548 Ga0307408_100262339 Ga0307408_1002623392 280
135 3300031852 Ga0307410_10108025 Ga0307410_101080252 280
136 3300031901 Ga0307406_10115597 Ga0307406_101155972 280
137 3300031903 Ga0307407_10050152 Ga0307407_100501522 280
138 3300031995 Ga0307409_100459714 Ga0307409_1004597142 280
139 3300032002 Ga0307416_100114613 Ga0307416_1001146133 280
140 3300033180 Ga0307510_10000006 Ga0307510_10000006398 280
141 3300035398 Ga0316574_0000907 Ga0316574_0000907_9319_10191 280
142 3300042002 Ga0439442_006739 Ga0439442_006739_482_1354 280
143 3300042007 Ga0439449_0034393 Ga0439449_0034393_869_1741 280
144 3300042131 Ga0450894_004353 Ga0450894_004353_224_1096 280
145 3300046471 Ga0495650_0013234 Ga0495650_0013234_2351_3223 280
146 3300048907 Ga0496104_0461198 Ga0496104_0461198_275_1147 280
147 3300048914 Ga0496111_0094679 Ga0496111_0094679_857_1729 280
148 3300049679 Ga0501249_034133 Ga0501249_034133_194_1066 280
149 3300050507 nmdc:mga05p37_122_c1 nmdc:mga05p37_122_c1_27333_28205 280
150 3300050507 nmdc:mga05p37_46323_c1 nmdc:mga05p37_46323_c1_796_1668 280
151 3300050508 nmdc:mga09592_120_c1 nmdc:mga09592_120_c1_20556_21428 280
152 3300050508 nmdc:mga09592_380_c1 nmdc:mga09592_380_c1_234_1106 280
153 3300050508 nmdc:mga09592_66814_c1 nmdc:mga09592_66814_c1_323_1195 280
154 3300050509 nmdc:mga0qj67_386_c1 nmdc:mga0qj67_386_c1_2349_3221 280
155 3300050509 nmdc:mga0qj67_64402_c1 nmdc:mga0qj67_64402_c1_1016_1888 280
156 3300050510 nmdc:mga06r32_137_c1 nmdc:mga06r32_137_c1_28103_28975 280
157 3300050510 nmdc:mga06r32_36556_c1 nmdc:mga06r32_36556_c1_1312_2184 280
158 3300050510 nmdc:mga06r32_8162_c1 nmdc:mga06r32_8162_c1_8270_9142 280
159 3300050511 nmdc:mga08y16_1797_c1 nmdc:mga08y16_1797_c1_2182_3054 280
160 3300050511 nmdc:mga08y16_59886_c1 nmdc:mga08y16_59886_c1_1363_2235 280
161 3300050511 nmdc:mga08y16_98316_c1 nmdc:mga08y16_98316_c1_1861_2733 280
162 3300053092 Ga0500583_0073946 Ga0500583_0073946_257_1129 280
163 3300053156 Ga0500622_0001607 Ga0500622_0001607_15150_16022 280
164 3300053156 Ga0500622_0027685 Ga0500622_0027685_1954_2826 280
165 3300005295 Ga0065707_10084930 Ga0065707_100849304 281
166 3300005563 Ga0068855_100002029 Ga0068855_10000202911 281
167 3300005614 Ga0068856_100049179 Ga0068856_1000491792 281
168 3300009093 Ga0105240_10083685 Ga0105240_100836852 281
169 3300009551 Ga0105238_10024802 Ga0105238_100248021 281
170 3300025711 Ga0207696_1000096 Ga0207696_100009641 281
171 3300025913 Ga0207695_10171000 Ga0207695_101710002 281
172 3300025949 Ga0207667_10016187 Ga0207667_100161878 281
173 3300026078 Ga0207702_10152734 Ga0207702_101527342 281
174 3300031548 Ga0307408_100036559 Ga0307408_1000365594 281
175 3300031824 Ga0307413_10293709 Ga0307413_102937092 281
176 3300031995 Ga0307409_100002001 Ga0307409_1000020016 281
177 3300032002 Ga0307416_100023642 Ga0307416_1000236424 281
178 3300041498 Ga0451841_1321531 Ga0451841_1321531_937_1812 281
179 3300042437 Ga0439444_0008815 Ga0439444_0008815_152_1027 281
180 3300044842 Ga0466957_0103105 Ga0466957_0103105_604_1479 281
181 3300047322 Ga0495680_0426497 Ga0495680_0426497_16_891 281
182 3300005328 Ga0070676_10015813 Ga0070676_100158132 282
183 3300005333 Ga0070677_10016848 Ga0070677_100168482 282
184 3300005336 Ga0070680_100009323 Ga0070680_1000093234 282
185 3300005347 Ga0070668_100072757 Ga0070668_1000727571 282
186 3300005353 Ga0070669_100087759 Ga0070669_1000877592 282
187 3300005356 Ga0070674_100025646 Ga0070674_1000256462 282
188 3300005459 Ga0068867_100057000 Ga0068867_1000570002 282
189 3300005543 Ga0070672_100011227 Ga0070672_1000112272 282
190 3300005718 Ga0068866_10112429 Ga0068866_101124292 282
191 3300005844 Ga0068862_100050351 Ga0068862_1000503511 282
192 3300006847 Ga0075431_100052449 Ga0075431_1000524494 282
193 3300006880 Ga0075429_100362807 Ga0075429_1003628072 282
194 3300009094 Ga0111539_10037630 Ga0111539_100376304 282
195 3300009553 Ga0105249_10304139 Ga0105249_103041392 282
196 3300025899 Ga0207642_10012409 Ga0207642_100124092 282
197 3300025907 Ga0207645_10000171 Ga0207645_1000017155 282
198 3300025937 Ga0207669_10020808 Ga0207669_100208083 282
199 3300025940 Ga0207691_10000559 Ga0207691_100005596 282
200 3300026089 Ga0207648_10000450 Ga0207648_100004506 282
201 3300026118 Ga0207675_100000186 Ga0207675_10000018657 282
202 3300027424 Ga0209984_1007099 Ga0209984_10070992 282
203 3300027617 Ga0210002_1000587 Ga0210002_10005874 282
204 3300027665 Ga0209983_1001502 Ga0209983_10015022 282
205 3300027682 Ga0209971_1004126 Ga0209971_10041264 282
206 3300027717 Ga0209998_10002195 Ga0209998_100021953 282
207 3300027876 Ga0209974_10000104 Ga0209974_1000010417 282
208 3300028380 Ga0268265_10043119 Ga0268265_100431193 282
209 3300031727 Ga0316576_10056216 Ga0316576_100562162 282
210 3300035398 Ga0316574_0044614 Ga0316574_0044614_1766_2653 282
211 3300035398 Ga0316574_0114889 Ga0316574_0114889_25_909 282
212 3300042125 Ga0450923_036647 Ga0450923_036647_92_970 282
213 3300042134 Ga0450898_017616 Ga0450898_017616_142_1020 282
214 3300050508 nmdc:mga09592_415926_c1 nmdc:mga09592_415926_c1_50_928 282
215 3300050509 nmdc:mga0qj67_51284_c1 nmdc:mga0qj67_51284_c1_2101_2979 282
216 3300050510 nmdc:mga06r32_42737_c1 nmdc:mga06r32_42737_c1_56_934 282
217 3300050510 nmdc:mga06r32_4682_c1 nmdc:mga06r32_4682_c1_6268_7146 282
218 3300050511 nmdc:mga08y16_62003_c1 nmdc:mga08y16_62003_c1_2955_3833 282
219 iso_pu_bacteria 8001522603 8001522921 282
220 3300005841 Ga0068863_100215302 Ga0068863_1002153022 283
221 3300009094 Ga0111539_10076014 Ga0111539_100760142 283
222 3300009147 Ga0114129_10000119 Ga0114129_1000011931 283
223 3300026088 Ga0207641_10177441 Ga0207641_101774412 283
224 3300026121 Ga0207683_10285550 Ga0207683_102855502 283
225 3300031665 Ga0316575_10006188 Ga0316575_100061884 283
226 3300031665 Ga0316575_10024359 Ga0316575_100243592 283
227 3300031691 Ga0316579_10009386 Ga0316579_100093864 283
228 3300031727 Ga0316576_10066117 Ga0316576_100661173 283
229 3300032139 Ga0316580_10012862 Ga0316580_100128622 283
230 3300035398 Ga0316574_0006853 Ga0316574_0006853_3016_3909 283
231 3300035398 Ga0316574_0021411 Ga0316574_0021411_892_1776 283
232 3300035398 Ga0316574_0032277 Ga0316574_0032277_32_916 283
233 3300036647 Ga0316582_0019082 Ga0316582_0019082_387_1271 283
234 3300036712 Ga0316584_0029803 Ga0316584_0029803_2747_3631 283
235 3300037588 Ga0316581_0031972 Ga0316581_0031972_108_992 283
236 3300042876 Ga0451577_0303388 Ga0451577_0303388_179_1063 283
237 3300045051 Ga0451576_0101804 Ga0451576_0101804_1382_2266 283
238 3300046517 Ga0495630_0075496 Ga0495630_0075496_1004_1888 283
239 3300050511 nmdc:mga08y16_54603_c1 nmdc:mga08y16_54603_c1_1225_2109 283
240 3300003323 rootH1_10130599 rootH1_101305994 284
241 3300005336 Ga0070680_100060056 Ga0070680_1000600562 284
242 3300005336 Ga0070680_100276719 Ga0070680_1002767192 284
243 3300005337 Ga0070682_100118532 Ga0070682_1001185322 284
244 3300005458 Ga0070681_10006880 Ga0070681_100068809 284
245 3300005458 Ga0070681_10015633 Ga0070681_100156333 284
246 3300005530 Ga0070679_100004933 Ga0070679_10000493315 284
247 3300005530 Ga0070679_100085288 Ga0070679_1000852883 284
248 3300005563 Ga0068855_100020496 Ga0068855_1000204968 284
249 3300005563 Ga0068855_100021246 Ga0068855_1000212465 284
250 3300009093 Ga0105240_10014105 Ga0105240_100141053 284
251 3300009551 Ga0105238_10128745 Ga0105238_101287452 284
252 3300013104 Ga0157370_10078111 Ga0157370_100781114 284
253 3300013105 Ga0157369_10089167 Ga0157369_100891672 284
254 3300025912 Ga0207707_10001141 Ga0207707_1000114110 284
255 3300025912 Ga0207707_10088618 Ga0207707_100886183 284
256 3300025913 Ga0207695_10130051 Ga0207695_101300512 284
257 3300025917 Ga0207660_10019218 Ga0207660_100192182 284
258 3300025917 Ga0207660_10074190 Ga0207660_100741902 284
259 3300025917 Ga0207660_10211583 Ga0207660_102115831 284
260 3300025921 Ga0207652_10002545 Ga0207652_1000254517 284
261 3300025921 Ga0207652_10223712 Ga0207652_102237121 284
262 3300025949 Ga0207667_10003042 Ga0207667_1000304214 284
263 3300025949 Ga0207667_10050891 Ga0207667_100508913 284
264 3300027614 Ga0209970_1000774 Ga0209970_10007742 284
265 3300031595 Ga0265313_10044529 Ga0265313_100445292 284
266 3300031665 Ga0316575_10008075 Ga0316575_100080753 284
267 3300035398 Ga0316574_0004321 Ga0316574_0004321_2418_3305 284
268 3300037068 Ga0373925_0149829 Ga0373925_0149829_161_1048 284
269 3300046615 Ga0495656_0072717 Ga0495656_0072717_544_1452 284
270 3300047318 Ga0495636_0013408 Ga0495636_0013408_1216_2124 284
271 3300048922 Ga0496119_0014503 Ga0496119_0014503_3556_4527 284
272 3300048923 Ga0496120_0002881 Ga0496120_0002881_5080_6051 284
273 3300048928 Ga0496125_0029540 Ga0496125_0029540_1316_2215 284
274 3300049570 Ga0501033_0006636 Ga0501033_0006636_5694_6590 284
275 3300049592 Ga0501076_0103409 Ga0501076_0103409_32_922 284
276 3300049822 Ga0501035_0163012 Ga0501035_0163012_625_1515 284
277 3300053146 Ga0500588_0041615 Ga0500588_0041615_203_1087 284
278 iso_pu_bacteria 2524614729 2525558229 284
279 iso_pu_bacteria 2627854209 2630650217 284
280 iso_pu_bacteria 2643221593 2643973179 284
281 iso_pu_bacteria 2718218334 2721028995 284
282 iso_pu_bacteria 2734482264 2735835425 284
283 iso_pu_bacteria 2738543009 2739227377 284
284 iso_pu_bacteria 2842914999 2842918714 284
285 iso_pu_bacteria 2919085039 2919087207 284
286 iso_pu_bacteria 2995948881 2995949806 284
287 iso_pu_bacteria 8003014200 8003015325 284
288 3300005295 Ga0065707_10082772 Ga0065707_100827727 285
289 3300005295 Ga0065707_10120764 Ga0065707_101207641 285
290 3300005295 Ga0065707_10166743 Ga0065707_101667431 285
291 3300005330 Ga0070690_100013171 Ga0070690_1000131712 285
292 3300005330 Ga0070690_100041653 Ga0070690_1000416533 285
293 3300005334 Ga0068869_100081038 Ga0068869_1000810381 285
294 3300005335 Ga0070666_10015646 Ga0070666_100156463 285
295 3300005335 Ga0070666_10068861 Ga0070666_100688612 285
296 3300005338 Ga0068868_100014018 Ga0068868_1000140184 285
297 3300005340 Ga0070689_100012449 Ga0070689_1000124493 285
298 3300005344 Ga0070661_100065072 Ga0070661_1000650723 285
299 3300005354 Ga0070675_100174081 Ga0070675_1001740811 285
300 3300005355 Ga0070671_100010170 Ga0070671_1000101708 285
301 3300005355 Ga0070671_100162934 Ga0070671_1001629342 285
302 3300005364 Ga0070673_100050461 Ga0070673_1000504613 285
303 3300005364 Ga0070673_100086795 Ga0070673_1000867952 285
304 3300005367 Ga0070667_100001144 Ga0070667_10000114415 285
305 3300005367 Ga0070667_100063863 Ga0070667_1000638632 285
306 3300005434 Ga0070709_10074566 Ga0070709_100745662 285
307 3300005436 Ga0070713_100000635 Ga0070713_10000063520 285
308 3300005436 Ga0070713_100451815 Ga0070713_1004518151 285
309 3300005437 Ga0070710_10041243 Ga0070710_100412433 285
310 3300005438 Ga0070701_10015659 Ga0070701_100156593 285
311 3300005439 Ga0070711_100001699 Ga0070711_10000169913 285
312 3300005439 Ga0070711_100020880 Ga0070711_1000208804 285
313 3300005440 Ga0070705_100096360 Ga0070705_1000963602 285
314 3300005456 Ga0070678_100003884 Ga0070678_1000038842 285
315 3300005458 Ga0070681_10155029 Ga0070681_101550293 285
316 3300005530 Ga0070679_100226203 Ga0070679_1002262032 285
317 3300005543 Ga0070672_100131034 Ga0070672_1001310341 285
318 3300005543 Ga0070672_100368504 Ga0070672_1003685041 285
319 3300005544 Ga0070686_100047307 Ga0070686_1000473072 285
320 3300005544 Ga0070686_100142040 Ga0070686_1001420401 285
321 3300005545 Ga0070695_100008782 Ga0070695_1000087825 285
322 3300005546 Ga0070696_100261723 Ga0070696_1002617231 285
323 3300005548 Ga0070665_100009546 Ga0070665_1000095464 285
324 3300005563 Ga0068855_100004382 Ga0068855_10000438210 285
325 3300005563 Ga0068855_100188006 Ga0068855_1001880061 285
326 3300005614 Ga0068856_100210301 Ga0068856_1002103012 285
327 3300005615 Ga0070702_100029377 Ga0070702_1000293773 285
328 3300005617 Ga0068859_100033950 Ga0068859_1000339503 285
329 3300005618 Ga0068864_100045068 Ga0068864_1000450683 285
330 3300005718 Ga0068866_10011945 Ga0068866_100119454 285
331 3300005719 Ga0068861_100015762 Ga0068861_1000157624 285
332 3300005841 Ga0068863_100014440 Ga0068863_1000144403 285
333 3300005841 Ga0068863_100018533 Ga0068863_1000185336 285
334 3300005841 Ga0068863_100161412 Ga0068863_1001614123 285
335 3300005842 Ga0068858_100070305 Ga0068858_1000703052 285
336 3300005842 Ga0068858_100135763 Ga0068858_1001357632 285
337 3300005843 Ga0068860_100001229 Ga0068860_10000122926 285
338 3300005843 Ga0068860_100010393 Ga0068860_1000103935 285
339 3300005843 Ga0068860_100032175 Ga0068860_1000321755 285
340 3300005843 Ga0068860_100044910 Ga0068860_1000449103 285
341 3300005844 Ga0068862_100058472 Ga0068862_1000584724 285
342 3300005844 Ga0068862_100082852 Ga0068862_1000828523 285
343 3300005844 Ga0068862_100354687 Ga0068862_1003546872 285
344 3300005937 Ga0081455_10000192 Ga0081455_100001926 285
345 3300005937 Ga0081455_10003695 Ga0081455_1000369511 285
346 3300006173 Ga0070716_100007793 Ga0070716_1000077932 285
347 3300006173 Ga0070716_100047887 Ga0070716_1000478873 285
348 3300006175 Ga0070712_100002312 Ga0070712_10000231211 285
349 3300006237 Ga0097621_100023330 Ga0097621_1000233303 285
350 3300006237 Ga0097621_100063875 Ga0097621_1000638752 285
351 3300006358 Ga0068871_100041971 Ga0068871_1000419712 285
352 3300006358 Ga0068871_100071935 Ga0068871_1000719352 285
353 3300006844 Ga0075428_100005990 Ga0075428_1000059904 285
354 3300006852 Ga0075433_10067805 Ga0075433_100678052 285
355 3300006871 Ga0075434_100004319 Ga0075434_10000431919 285
356 3300006881 Ga0068865_100013725 Ga0068865_1000137252 285
357 3300006931 Ga0097620_100033950 Ga0097620_1000339503 285
358 3300007265 Ga0099794_10024955 Ga0099794_100249552 285
359 3300007788 Ga0099795_10000048 Ga0099795_1000004822 285
360 3300007788 Ga0099795_10000148 Ga0099795_100001483 285
361 3300009093 Ga0105240_10000901 Ga0105240_1000090122 285
362 3300009093 Ga0105240_10026721 Ga0105240_100267218 285
363 3300009093 Ga0105240_10203690 Ga0105240_102036903 285
364 3300009093 Ga0105240_10643913 Ga0105240_106439131 285
365 3300009094 Ga0111539_10002430 Ga0111539_1000243021 285
366 3300009098 Ga0105245_10001689 Ga0105245_100016897 285
367 3300009098 Ga0105245_10030551 Ga0105245_100305512 285
368 3300009101 Ga0105247_10008112 Ga0105247_100081123 285
369 3300009101 Ga0105247_10051584 Ga0105247_100515843 285
370 3300009147 Ga0114129_10289232 Ga0114129_102892322 285
371 3300009147 Ga0114129_10562462 Ga0114129_105624622 285
372 3300009174 Ga0105241_10107967 Ga0105241_101079672 285
373 3300009174 Ga0105241_10112391 Ga0105241_101123912 285
374 3300009176 Ga0105242_10044172 Ga0105242_100441724 285
375 3300009177 Ga0105248_10042203 Ga0105248_100422035 285
376 3300009177 Ga0105248_10052989 Ga0105248_100529895 285
377 3300009545 Ga0105237_10051480 Ga0105237_100514805 285
378 3300009545 Ga0105237_10073452 Ga0105237_100734523 285
379 3300009551 Ga0105238_10159039 Ga0105238_101590392 285
380 3300009551 Ga0105238_10423924 Ga0105238_104239242 285
381 3300010159 Ga0099796_10000013 Ga0099796_1000001351 285
382 3300010375 Ga0105239_10308610 Ga0105239_103086102 285
383 3300013105 Ga0157369_10004204 Ga0157369_1000420415 285
384 3300013105 Ga0157369_10507723 Ga0157369_105077231 285
385 3300013296 Ga0157374_10004874 Ga0157374_100048745 285
386 3300013296 Ga0157374_10004940 Ga0157374_100049405 285
387 3300013297 Ga0157378_10124859 Ga0157378_101248592 285
388 3300013306 Ga0163162_10056546 Ga0163162_100565462 285
389 3300013307 Ga0157372_10147056 Ga0157372_101470562 285
390 3300013308 Ga0157375_10017319 Ga0157375_1001731910 285
391 3300014325 Ga0163163_10013480 Ga0163163_100134802 285
392 3300014325 Ga0163163_10696742 Ga0163163_106967421 285
393 3300014326 Ga0157380_10006559 Ga0157380_1000655912 285
394 3300014326 Ga0157380_10021197 Ga0157380_100211974 285
395 3300014968 Ga0157379_10001153 Ga0157379_1000115321 285
396 3300014968 Ga0157379_10034646 Ga0157379_100346465 285
397 3300014968 Ga0157379_10039315 Ga0157379_100393153 285
398 3300014969 Ga0157376_10021870 Ga0157376_100218705 285
399 3300014969 Ga0157376_10180015 Ga0157376_101800152 285
400 3300017792 Ga0163161_10165243 Ga0163161_101652432 285
401 3300025898 Ga0207692_10045343 Ga0207692_100453432 285
402 3300025900 Ga0207710_10005865 Ga0207710_100058652 285
403 3300025903 Ga0207680_10023677 Ga0207680_100236774 285
404 3300025905 Ga0207685_10006566 Ga0207685_100065661 285
405 3300025906 Ga0207699_10130360 Ga0207699_101303602 285
406 3300025913 Ga0207695_10005812 Ga0207695_1000581214 285
407 3300025913 Ga0207695_10012567 Ga0207695_100125674 285
408 3300025913 Ga0207695_10036780 Ga0207695_100367804 285
409 3300025915 Ga0207693_10000503 Ga0207693_1000050322 285
410 3300025918 Ga0207662_10091820 Ga0207662_100918202 285
411 3300025918 Ga0207662_10126810 Ga0207662_101268102 285
412 3300025921 Ga0207652_10093156 Ga0207652_100931562 285
413 3300025923 Ga0207681_10207184 Ga0207681_102071841 285
414 3300025926 Ga0207659_10035522 Ga0207659_100355224 285
415 3300025927 Ga0207687_10090224 Ga0207687_100902242 285
416 3300025929 Ga0207664_10020285 Ga0207664_100202856 285
417 3300025931 Ga0207644_10009392 Ga0207644_1000939210 285
418 3300025934 Ga0207686_10011202 Ga0207686_100112027 285
419 3300025936 Ga0207670_10009590 Ga0207670_100095904 285
420 3300025936 Ga0207670_10065040 Ga0207670_100650402 285
421 3300025938 Ga0207704_10006008 Ga0207704_100060089 285
422 3300025939 Ga0207665_10022922 Ga0207665_100229223 285
423 3300025940 Ga0207691_10218961 Ga0207691_102189611 285
424 3300025941 Ga0207711_10049042 Ga0207711_100490423 285
425 3300025941 Ga0207711_10301688 Ga0207711_103016882 285
426 3300025942 Ga0207689_10089737 Ga0207689_100897372 285
427 3300025945 Ga0207679_10044562 Ga0207679_100445622 285
428 3300025949 Ga0207667_10007832 Ga0207667_100078329 285
429 3300025960 Ga0207651_10132280 Ga0207651_101322803 285
430 3300025986 Ga0207658_10000131 Ga0207658_1000013180 285
431 3300025986 Ga0207658_10038107 Ga0207658_100381072 285
432 3300025986 Ga0207658_10206184 Ga0207658_102061842 285
433 3300026035 Ga0207703_10016287 Ga0207703_100162873 285
434 3300026035 Ga0207703_10099428 Ga0207703_100994282 285
435 3300026041 Ga0207639_10240985 Ga0207639_102409852 285
436 3300026078 Ga0207702_10023010 Ga0207702_100230105 285
437 3300026088 Ga0207641_10001631 Ga0207641_1000163111 285
438 3300026088 Ga0207641_10010738 Ga0207641_100107383 285
439 3300026088 Ga0207641_10335107 Ga0207641_103351071 285
440 3300026095 Ga0207676_10011037 Ga0207676_100110373 285
441 3300026116 Ga0207674_10200954 Ga0207674_102009542 285
442 3300026118 Ga0207675_100012136 Ga0207675_1000121364 285
443 3300026118 Ga0207675_100013158 Ga0207675_1000131584 285
444 3300026121 Ga0207683_10003057 Ga0207683_100030575 285
445 3300026142 Ga0207698_10260058 Ga0207698_102600582 285
446 3300027512 Ga0209179_1000025 Ga0209179_100002514 285
447 3300027671 Ga0209588_1014692 Ga0209588_10146923 285
448 3300027907 Ga0207428_10005148 Ga0207428_1000514816 285
449 3300028379 Ga0268266_10092394 Ga0268266_100923942 285
450 3300028380 Ga0268265_10063385 Ga0268265_100633854 285
451 3300028380 Ga0268265_10080292 Ga0268265_100802923 285
452 3300028381 Ga0268264_10000102 Ga0268264_1000010267 285
453 3300028381 Ga0268264_10013464 Ga0268264_100134642 285
454 3300028381 Ga0268264_10013892 Ga0268264_100138923 285
455 3300028381 Ga0268264_10071509 Ga0268264_100715092 285
456 3300030521 Ga0307511_10004214 Ga0307511_1000421417 285
457 3300030521 Ga0307511_10036113 Ga0307511_100361132 285
458 3300031090 Ga0265760_10002154 Ga0265760_100021542 285
459 3300031249 Ga0265339_10054301 Ga0265339_100543012 285
460 3300031456 Ga0307513_10008759 Ga0307513_100087594 285
461 3300031456 Ga0307513_10259883 Ga0307513_102598832 285
462 3300031507 Ga0307509_10209922 Ga0307509_102099221 285
463 3300031548 Ga0307408_100521352 Ga0307408_1005213521 285
464 3300031616 Ga0307508_10261319 Ga0307508_102613191 285
465 3300031727 Ga0316576_10005106 Ga0316576_100051062 285
466 3300031730 Ga0307516_10000081 Ga0307516_1000008162 285
467 3300031733 Ga0316577_10000946 Ga0316577_1000094610 285
468 3300031824 Ga0307413_10165982 Ga0307413_101659822 285
469 3300031852 Ga0307410_10248047 Ga0307410_102480472 285
470 3300031903 Ga0307407_10015223 Ga0307407_100152232 285
471 3300031995 Ga0307409_100047196 Ga0307409_1000471962 285
472 3300032005 Ga0307411_10214136 Ga0307411_102141362 285
473 3300032126 Ga0307415_100545326 Ga0307415_1005453261 285
474 3300035111 Ga0373923_0018514 Ga0373923_0018514_1604_2509 285
475 3300035692 Ga0373935_0317485 Ga0373935_0317485_49_954 285
476 3300035725 Ga0373947_0108948 Ga0373947_0108948_632_1537 285
477 3300036401 Ga0373937_0019437 Ga0373937_0019437_3348_4253 285
478 3300036401 Ga0373937_0202480 Ga0373937_0202480_218_1141 285
479 3300037418 Ga0395900_0208144 Ga0395900_0208144_272_1159 285
480 3300037466 Ga0395898_0019512 Ga0395898_0019512_908_1795 285
481 3300037466 Ga0395898_0388359 Ga0395898_0388359_190_1077 285
482 3300039437 Ga0436365_0831110 Ga0436365_0831110_1151_2044 285
483 3300039450 Ga0436363_1321922 Ga0436363_1321922_1377_2270 285
484 3300042001 Ga0439441_009725 Ga0439441_009725_694_1581 285
485 3300042118 Ga0450914_007621 Ga0450914_007621_28_915 285
486 3300042122 Ga0450920_000265 Ga0450920_000265_664_1551 285
487 3300042125 Ga0450923_000721 Ga0450923_000721_2359_3246 285
488 3300042129 Ga0450891_007844 Ga0450891_007844_50_937 285
489 3300042133 Ga0450896_004094 Ga0450896_004094_979_1866 285
490 3300042147 Ga0450910_008149 Ga0450910_008149_302_1189 285
491 3300044684 Ga0466966_0071783 Ga0466966_0071783_613_1500 285
492 3300044712 Ga0453684_0037359 Ga0453684_0037359_1451_2368 285
493 3300045049 Ga0466959_0062293 Ga0466959_0062293_1020_1907 285
494 3300046455 Ga0495603_0075883 Ga0495603_0075883_863_1774 285
495 3300046455 Ga0495603_0098263 Ga0495603_0098263_663_1574 285
496 3300046459 Ga0495629_0034030 Ga0495629_0034030_1909_2820 285
497 3300046460 Ga0495638_0005940 Ga0495638_0005940_5919_6815 285
498 3300046460 Ga0495638_0103716 Ga0495638_0103716_109_1011 285
499 3300046472 Ga0495580_0039451 Ga0495580_0039451_1061_1966 285
500 3300046472 Ga0495580_0058235 Ga0495580_0058235_513_1430 285
501 3300046499 Ga0495594_0056106 Ga0495594_0056106_826_1737 285
502 3300046513 Ga0495616_0000360 Ga0495616_0000360_10700_11608 285
503 3300046523 Ga0495644_0005069 Ga0495644_0005069_2358_3269 285
504 3300046539 Ga0495621_0002704 Ga0495621_0002704_2327_3238 285
505 3300046615 Ga0495656_0027319 Ga0495656_0027319_842_1753 285
506 3300046660 Ga0495625_0009073 Ga0495625_0009073_2011_2907 285
507 3300046681 Ga0495647_0028686 Ga0495647_0028686_598_1503 285
508 3300046683 Ga0495658_0009573 Ga0495658_0009573_2726_3637 285
509 3300046683 Ga0495658_0036728 Ga0495658_0036728_1780_2685 285
510 3300046692 Ga0495671_0026160 Ga0495671_0026160_1607_2518 285
511 3300046692 Ga0495671_0076964 Ga0495671_0076964_661_1548 285
512 3300047470 Ga0495681_0014156 Ga0495681_0014156_635_1546 285
513 3300048903 Ga0496100_0049219 Ga0496100_0049219_1154_2059 285
514 3300048903 Ga0496100_0074816 Ga0496100_0074816_1114_2013 285
515 3300048904 Ga0496101_0005357 Ga0496101_0005357_2250_3155 285
516 3300048907 Ga0496104_0026561 Ga0496104_0026561_1098_2021 285
517 3300048907 Ga0496104_0078178 Ga0496104_0078178_1828_2733 285
518 3300048908 Ga0496105_0000580 Ga0496105_0000580_5343_6242 285
519 3300048908 Ga0496105_0113849 Ga0496105_0113849_758_1663 285
520 3300048909 Ga0496106_0069150 Ga0496106_0069150_1123_2028 285
521 3300048909 Ga0496106_0175758 Ga0496106_0175758_411_1334 285
522 3300048910 Ga0496107_0005975 Ga0496107_0005975_6878_7783 285
523 3300048911 Ga0496108_0001827 Ga0496108_0001827_8551_9456 285
524 3300048911 Ga0496108_0040285 Ga0496108_0040285_2809_3732 285
525 3300048912 Ga0496109_0002877 Ga0496109_0002877_11493_12398 285
526 3300048912 Ga0496109_0053143 Ga0496109_0053143_1058_1981 285
527 3300048913 Ga0496110_0006554 Ga0496110_0006554_4689_5612 285
528 3300048913 Ga0496110_0022928 Ga0496110_0022928_3556_4461 285
529 3300048914 Ga0496111_0001612 Ga0496111_0001612_11733_12638 285
530 3300048915 Ga0496112_0037819 Ga0496112_0037819_2952_3857 285
531 3300048916 Ga0496113_0107043 Ga0496113_0107043_1104_2009 285
532 3300048916 Ga0496113_0148860 Ga0496113_0148860_341_1264 285
533 3300048917 Ga0496114_0012763 Ga0496114_0012763_4585_5490 285
534 3300048917 Ga0496114_0224762 Ga0496114_0224762_165_1064 285
535 3300048917 Ga0496114_0295362 Ga0496114_0295362_171_1094 285
536 3300048918 Ga0496115_0011136 Ga0496115_0011136_813_1718 285
537 3300048924 Ga0496121_0033724 Ga0496121_0033724_2464_3360 285
538 3300048929 Ga0496126_0052844 Ga0496126_0052844_1232_2125 285
539 3300049568 Ga0501031_0017509 Ga0501031_0017509_1380_2267 285
540 3300049568 Ga0501031_0060896 Ga0501031_0060896_148_1044 285
541 3300049569 Ga0501032_0039245 Ga0501032_0039245_1176_2063 285
542 3300049572 Ga0501036_0001084 Ga0501036_0001084_19532_20428 285
543 3300049572 Ga0501036_0184721 Ga0501036_0184721_143_1030 285
544 3300049574 Ga0501038_0006113 Ga0501038_0006113_7475_8371 285
545 3300049574 Ga0501038_0081494 Ga0501038_0081494_1808_2695 285
546 3300049574 Ga0501038_0096827 Ga0501038_0096827_853_1740 285
547 3300049575 Ga0501039_0001878 Ga0501039_0001878_613_1500 285
548 3300049575 Ga0501039_0035236 Ga0501039_0035236_2920_3816 285
549 3300049576 Ga0501040_0008280 Ga0501040_0008280_5352_6248 285
550 3300049577 Ga0501041_0001352 Ga0501041_0001352_10154_11050 285
551 3300049577 Ga0501041_0004090 Ga0501041_0004090_7440_8327 285
552 3300049577 Ga0501041_0004174 Ga0501041_0004174_4408_5295 285
553 3300049578 Ga0501042_0021423 Ga0501042_0021423_1853_2752 285
554 3300049578 Ga0501042_0054772 Ga0501042_0054772_407_1294 285
555 3300049578 Ga0501042_0117642 Ga0501042_0117642_805_1701 285
556 3300049578 Ga0501042_0120685 Ga0501042_0120685_278_1165 285
557 3300049580 Ga0501046_0059561 Ga0501046_0059561_1594_2481 285
558 3300049580 Ga0501046_0061552 Ga0501046_0061552_795_1682 285
559 3300049582 Ga0501048_0125258 Ga0501048_0125258_140_1036 285
560 3300049582 Ga0501048_0209418 Ga0501048_0209418_222_1109 285
561 3300049584 Ga0501068_0067378 Ga0501068_0067378_1125_2021 285
562 3300049584 Ga0501068_0128373 Ga0501068_0128373_455_1342 285
563 3300049587 Ga0501071_0007186 Ga0501071_0007186_4193_5089 285
564 3300049587 Ga0501071_0088804 Ga0501071_0088804_798_1685 285
565 3300049587 Ga0501071_0313432 Ga0501071_0313432_171_1058 285
566 3300049588 Ga0501072_0004768 Ga0501072_0004768_3948_4844 285
567 3300049588 Ga0501072_0021469 Ga0501072_0021469_1539_2426 285
568 3300049588 Ga0501072_0083607 Ga0501072_0083607_252_1139 285
569 3300049589 Ga0501073_0026530 Ga0501073_0026530_293_1180 285
570 3300049590 Ga0501074_0019490 Ga0501074_0019490_510_1397 285
571 3300049591 Ga0501075_0000520 Ga0501075_0000520_19772_20668 285
572 3300049591 Ga0501075_0013581 Ga0501075_0013581_3229_4116 285
573 3300049592 Ga0501076_0002351 Ga0501076_0002351_11512_12399 285
574 3300049592 Ga0501076_0002386 Ga0501076_0002386_4170_5066 285
575 3300049592 Ga0501076_0016740 Ga0501076_0016740_2422_3309 285
576 3300049592 Ga0501076_0165545 Ga0501076_0165545_543_1430 285
577 3300049593 Ga0501077_0107752 Ga0501077_0107752_141_1037 285
578 3300049593 Ga0501077_0143422 Ga0501077_0143422_25_912 285
579 3300049656 Ga0501209_012427 Ga0501209_012427_57_950 285
580 3300049741 Ga0501079_0001155 Ga0501079_0001155_142_1038 285
581 3300049741 Ga0501079_0010787 Ga0501079_0010787_4498_5385 285
582 3300049742 Ga0501080_0000344 Ga0501080_0000344_34757_35653 285
583 3300049742 Ga0501080_0003150 Ga0501080_0003150_12048_12935 285
584 3300049743 Ga0501081_0005614 Ga0501081_0005614_232_1128 285
585 3300049743 Ga0501081_0016366 Ga0501081_0016366_3308_4195 285
586 3300049743 Ga0501081_0038157 Ga0501081_0038157_2357_3244 285
587 3300049744 Ga0501083_0063859 Ga0501083_0063859_136_1032 285
588 3300049744 Ga0501083_0130495 Ga0501083_0130495_549_1436 285
589 3300049822 Ga0501035_0035198 Ga0501035_0035198_3592_4488 285
590 3300049822 Ga0501035_0038779 Ga0501035_0038779_767_1654 285
591 3300049824 Ga0501045_0002571 Ga0501045_0002571_11290_12186 285
592 3300049824 Ga0501045_0038353 Ga0501045_0038353_1373_2260 285
593 3300050509 nmdc:mga0qj67_186476_c1 nmdc:mga0qj67_186476_c1_101_994 285
594 3300050511 nmdc:mga08y16_3233_c1 nmdc:mga08y16_3233_c1_10241_11128 285
595 3300050512 nmdc:mga0n895_736_c1 nmdc:mga0n895_736_c1_6889_7776 285
596 3300050513 nmdc:mga0rr50_27752_c1 nmdc:mga0rr50_27752_c1_867_1754 285
597 3300050513 nmdc:mga0rr50_54044_c1 nmdc:mga0rr50_54044_c1_1899_2786 285
598 3300050515 nmdc:mga0a205_9711_c1 nmdc:mga0a205_9711_c1_1734_2621 285
599 3300053092 Ga0500583_0004089 Ga0500583_0004089_3522_4424 285
600 3300053104 Ga0500556_0000313 Ga0500556_0000313_31687_32586 285
601 3300054114 Ga0501084_0164994 Ga0501084_0164994_798_1694 285
602 3300060353 Ga0501082_0019061 Ga0501082_0019061_1580_2467 285
603 3300060353 Ga0501082_0034152 Ga0501082_0034152_3343_4239 285
604 3300061734 Ga0530510_0000463 Ga0530510_0000463_17802_18698 285
605 3300061734 Ga0530510_0012087 Ga0530510_0012087_824_1711 285
606 3300005549 Ga0070704_100010173 Ga0070704_1000101732 286
607 3300005840 Ga0068870_10056769 Ga0068870_100567692 286
608 3300006844 Ga0075428_100010791 Ga0075428_1000107917 286
609 3300009092 Ga0105250_10000024 Ga0105250_10000024120 286
610 3300009987 Ga0105030_100699 Ga0105030_1006992 286
611 3300013874 Ga0157514_105626 Ga0157514_1056262 286
612 3300014326 Ga0157380_10115984 Ga0157380_101159843 286
613 3300014968 Ga0157379_10000140 Ga0157379_1000014014 286
614 3300025908 Ga0207643_10093215 Ga0207643_100932152 286
615 3300025942 Ga0207689_10055262 Ga0207689_100552623 286
616 3300028573 Ga0265334_10012805 Ga0265334_100128054 286
617 3300031250 Ga0265331_10009421 Ga0265331_100094215 286
618 3300031251 Ga0265327_10000556 Ga0265327_1000055624 286
619 3300031251 Ga0265327_10003741 Ga0265327_100037414 286
620 3300031251 Ga0265327_10017852 Ga0265327_100178522 286
621 3300031344 Ga0265316_10000167 Ga0265316_1000016757 286
622 3300031456 Ga0307513_10183040 Ga0307513_101830403 286
623 3300031731 Ga0307405_10028693 Ga0307405_100286934 286
624 3300032002 Ga0307416_100018243 Ga0307416_1000182436 286
625 3300032005 Ga0307411_10017297 Ga0307411_100172972 286
626 3300035695 Ga0373927_0000002 Ga0373927_0000002_400188_401084 286
627 3300036712 Ga0316584_0067900 Ga0316584_0067900_602_1501 286
628 3300042436 Ga0439435_0007663 Ga0439435_0007663_169_1059 286
629 3300046694 Ga0495649_0003223 Ga0495649_0003223_9519_10412 286
630 3300049583 Ga0501067_0007592 Ga0501067_0007592_3598_4488 286
631 3300049584 Ga0501068_0004281 Ga0501068_0004281_1166_2068 286
632 3300049586 Ga0501070_0066896 Ga0501070_0066896_1104_2006 286
633 3300049587 Ga0501071_0001102 Ga0501071_0001102_2549_3451 286
634 3300049588 Ga0501072_0030487 Ga0501072_0030487_668_1570 286
635 3300049589 Ga0501073_0000353 Ga0501073_0000353_20246_21136 286
636 3300049589 Ga0501073_0001886 Ga0501073_0001886_14565_15467 286
637 3300049589 Ga0501073_0315840 Ga0501073_0315840_35_925 286
638 3300049590 Ga0501074_0003294 Ga0501074_0003294_7807_8709 286
639 3300049592 Ga0501076_0030284 Ga0501076_0030284_2927_3829 286
640 3300049593 Ga0501077_0004241 Ga0501077_0004241_4819_5721 286
641 3300049741 Ga0501079_0000016 Ga0501079_0000016_41200_42102 286
642 3300049742 Ga0501080_0005196 Ga0501080_0005196_9803_10693 286
643 3300049742 Ga0501080_0013763 Ga0501080_0013763_2632_3534 286
644 3300049744 Ga0501083_0267820 Ga0501083_0267820_192_1082 286
645 3300053156 Ga0500622_0004452 Ga0500622_0004452_933_1838 286
646 3300053177 Ga0500636_0001930 Ga0500636_0001930_6193_7086 286
647 3300053178 Ga0500637_0014858 Ga0500637_0014858_1628_2527 286
648 3300053178 Ga0500637_0065022 Ga0500637_0065022_630_1523 286
649 3300053729 Ga0500625_003485 Ga0500625_003485_1367_2260 286
650 3300054114 Ga0501084_0038603 Ga0501084_0038603_3032_3934 286
651 3300054114 Ga0501084_0204297 Ga0501084_0204297_572_1462 286
652 3300060353 Ga0501082_0000552 Ga0501082_0000552_28719_29609 286
653 3300002737 JGI25162J39368_1000837 JGI25162J39368_10008374 287
654 3300002741 JGI25157J39369_1000177 JGI25157J39369_100017737 287
655 3300002771 JGI25163J39215_1002314 JGI25163J39215_10023141 287
656 3300002772 JGI25164J39214_1000159 JGI25164J39214_100015928 287
657 3300003187 JGI25151J46595_10001571 JGI25151J46595_1000157116 287
658 3300003214 JGI25165J46597_1000287 JGI25165J46597_100028728 287
659 3300003761 Ga0055535_1000329 Ga0055535_100032920 287
660 3300003762 Ga0055542_1000547 Ga0055542_10005474 287
661 3300003763 Ga0055529_1000108 Ga0055529_100010828 287
662 3300003781 Ga0055536_1002534 Ga0055536_100253411 287
663 3300003781 Ga0055536_1020770 Ga0055536_10207702 287
664 3300003781 Ga0055536_1037451 Ga0055536_10374511 287
665 3300003791 Ga0055530_10001342 Ga0055530_1000134210 287
666 3300003794 Ga0055531_10001941 Ga0055531_100019416 287
667 3300003794 Ga0055531_10025470 Ga0055531_100254702 287
668 3300005340 Ga0070689_100081283 Ga0070689_1000812834 287
669 3300005344 Ga0070661_100028400 Ga0070661_1000284004 287
670 3300005455 Ga0070663_100055413 Ga0070663_1000554132 287
671 3300005536 Ga0070697_100132275 Ga0070697_1001322751 287
672 3300005547 Ga0070693_100016370 Ga0070693_1000163702 287
673 3300005843 Ga0068860_100108360 Ga0068860_1001083603 287
674 3300006173 Ga0070716_100018410 Ga0070716_1000184103 287
675 3300006186 Ga0075369_10111558 Ga0075369_101115582 287
676 3300006846 Ga0075430_100057950 Ga0075430_1000579502 287
677 3300006914 Ga0075436_100056445 Ga0075436_1000564452 287
678 3300009551 Ga0105238_10035681 Ga0105238_100356814 287
679 3300009551 Ga0105238_10316408 Ga0105238_103164082 287
680 3300013104 Ga0157370_10007337 Ga0157370_100073378 287
681 3300013306 Ga0163162_10037397 Ga0163162_100373972 287
682 3300013307 Ga0157372_10011446 Ga0157372_100114463 287
683 3300014497 Ga0182008_10141322 Ga0182008_101413221 287
684 3300015261 Ga0182006_1000426 Ga0182006_10004263 287
685 3300015262 Ga0182007_10019720 Ga0182007_100197202 287
686 3300015265 Ga0182005_1000177 Ga0182005_100017720 287
687 3300015689 Ga0183360_10001 Ga0183360_100013229 287
688 3300025207 Ga0209760_100925 Ga0209760_1009254 287
689 3300025224 Ga0209784_100076 Ga0209784_10007642 287
690 3300025231 Ga0207427_100097 Ga0207427_10009728 287
691 3300025233 Ga0209437_100116 Ga0209437_10011693 287
692 3300025242 Ga0209258_100214 Ga0209258_10021428 287
693 3300025245 Ga0207425_1012309 Ga0207425_10123093 287
694 3300025250 Ga0209026_1000152 Ga0209026_100015292 287
695 3300025254 Ga0209148_1000047 Ga0209148_1000047169 287
696 3300025256 Ga0209759_1000477 Ga0209759_100047737 287
697 3300025261 Ga0209233_1000100 Ga0209233_1000100101 287
698 3300025272 Ga0209455_1000056 Ga0209455_100005693 287
699 3300025272 Ga0209455_1008009 Ga0209455_10080093 287
700 3300025291 Ga0209675_1008947 Ga0209675_10089472 287
701 3300025292 Ga0209676_1000902 Ga0209676_100090233 287
702 3300025292 Ga0209676_1001161 Ga0209676_100116123 287
703 3300025292 Ga0209676_1003988 Ga0209676_10039886 287
704 3300025294 Ga0209025_1000006 Ga0209025_1000006468 287
705 3300025295 Ga0209564_1008169 Ga0209564_10081696 287
706 3300025297 Ga0209758_1010914 Ga0209758_10109142 287
707 3300025297 Ga0209758_1022287 Ga0209758_10222871 287
708 3300025297 Ga0209758_1035471 Ga0209758_10354713 287
709 3300025298 Ga0209050_1001357 Ga0209050_100135718 287
710 3300025298 Ga0209050_1020156 Ga0209050_10201564 287
711 3300025299 Ga0209256_1003764 Ga0209256_10037642 287
712 3300025299 Ga0209256_1005859 Ga0209256_10058597 287
713 3300025303 Ga0209051_1004483 Ga0209051_10044835 287
714 3300025304 Ga0209257_1000210 Ga0209257_100021096 287
715 3300025304 Ga0209257_1003174 Ga0209257_10031741 287
716 3300025920 Ga0207649_10041309 Ga0207649_100413093 287
717 3300025924 Ga0207694_10059801 Ga0207694_100598014 287
718 3300025924 Ga0207694_10221015 Ga0207694_102210152 287
719 3300025936 Ga0207670_10060043 Ga0207670_100600434 287
720 3300025939 Ga0207665_10001022 Ga0207665_100010223 287
721 3300025949 Ga0207667_10015125 Ga0207667_1001512513 287
722 3300026041 Ga0207639_10065784 Ga0207639_100657843 287
723 3300031548 Ga0307408_100323812 Ga0307408_1003238122 287
724 3300031665 Ga0316575_10009617 Ga0316575_100096174 287
725 3300031727 Ga0316576_10018540 Ga0316576_100185403 287
726 3300031727 Ga0316576_10101925 Ga0316576_101019254 287
727 3300031728 Ga0316578_10051924 Ga0316578_100519242 287
728 3300031728 Ga0316578_10058275 Ga0316578_100582753 287
729 3300031733 Ga0316577_10007228 Ga0316577_100072282 287
730 3300031733 Ga0316577_10074569 Ga0316577_100745692 287
731 3300032002 Ga0307416_100028901 Ga0307416_1000289014 287
732 3300032004 Ga0307414_10046280 Ga0307414_100462803 287
733 3300032139 Ga0316580_10042730 Ga0316580_100427302 287
734 3300035086 Ga0373934_0000368 Ga0373934_0000368_12963_13862 287
735 3300035086 Ga0373934_0000410 Ga0373934_0000410_10038_10934 287
736 3300035111 Ga0373923_0050074 Ga0373923_0050074_245_1141 287
737 3300035113 Ga0373936_0006311 Ga0373936_0006311_1169_2065 287
738 3300035117 Ga0373953_0020584 Ga0373953_0020584_757_1653 287
739 3300035118 Ga0373954_0001420 Ga0373954_0001420_7877_8776 287
740 3300035118 Ga0373954_0004483 Ga0373954_0004483_1052_1951 287
741 3300035118 Ga0373954_0032778 Ga0373954_0032778_1109_2005 287
742 3300035118 Ga0373954_0035135 Ga0373954_0035135_1100_1996 287
743 3300035119 Ga0373956_0010617 Ga0373956_0010617_1707_2606 287
744 3300035120 Ga0373957_0003247 Ga0373957_0003247_1750_2646 287
745 3300035120 Ga0373957_0014510 Ga0373957_0014510_489_1388 287
746 3300035172 Ga0373955_0001973 Ga0373955_0001973_4464_5360 287
747 3300035172 Ga0373955_0078054 Ga0373955_0078054_394_1290 287
748 3300035398 Ga0316574_0030227 Ga0316574_0030227_1403_2299 287
749 3300035398 Ga0316574_0112790 Ga0316574_0112790_801_1706 287
750 3300035410 Ga0373924_0003250 Ga0373924_0003250_756_1652 287
751 3300035692 Ga0373935_0001511 Ga0373935_0001511_5226_6122 287
752 3300035695 Ga0373927_0101301 Ga0373927_0101301_803_1699 287
753 3300035724 Ga0373933_0000335 Ga0373933_0000335_12621_13520 287
754 3300035725 Ga0373947_0279906 Ga0373947_0279906_131_1027 287
755 3300036401 Ga0373937_0001114 Ga0373937_0001114_8998_9897 287
756 3300036401 Ga0373937_0040334 Ga0373937_0040334_328_1224 287
757 3300036401 Ga0373937_0140081 Ga0373937_0140081_12_908 287
758 3300036647 Ga0316582_0019741 Ga0316582_0019741_428_1327 287
759 3300037068 Ga0373925_0051829 Ga0373925_0051829_383_1279 287
760 3300037312 Ga0395899_0003927 Ga0395899_0003927_2867_3796 287
761 3300037418 Ga0395900_0016871 Ga0395900_0016871_1625_2554 287
762 3300037471 Ga0395905_0000491 Ga0395905_0000491_10312_11241 287
763 3300037588 Ga0316581_0008820 Ga0316581_0008820_621_1517 287
764 3300038443 Ga0395901_0016944 Ga0395901_0016944_2505_3434 287
765 3300039437 Ga0436365_0185309 Ga0436365_0185309_900_1796 287
766 3300041407 Ga0439447_000636 Ga0439447_000636_11489_12418 287
767 3300042010 Ga0439452_025133 Ga0439452_025133_482_1402 287
768 3300042184 Ga0450908_000566 Ga0450908_000566_2594_3490 287
769 3300045051 Ga0451576_0068419 Ga0451576_0068419_479_1375 287
770 3300045976 Ga0466967_0342586 Ga0466967_0342586_281_1177 287
771 3300046452 Ga0495617_000131 Ga0495617_000131_23682_24578 287
772 3300046452 Ga0495617_001386 Ga0495617_001386_1364_2260 287
773 3300046454 Ga0495592_0029149 Ga0495592_0029149_1369_2265 287
774 3300046459 Ga0495629_0159541 Ga0495629_0159541_299_1195 287
775 3300046460 Ga0495638_0000180 Ga0495638_0000180_70796_71692 287
776 3300046461 Ga0495641_0023815 Ga0495641_0023815_756_1652 287
777 3300046462 Ga0495651_0000408 Ga0495651_0000408_13280_14179 287
778 3300046462 Ga0495651_0001927 Ga0495651_0001927_6084_6980 287
779 3300046463 Ga0495653_0007912 Ga0495653_0007912_1751_2647 287
780 3300046471 Ga0495650_0006073 Ga0495650_0006073_4876_5772 287
781 3300046472 Ga0495580_0008617 Ga0495580_0008617_5406_6302 287
782 3300046477 Ga0495664_0014727 Ga0495664_0014727_2570_3466 287
783 3300046491 Ga0495584_0001164 Ga0495584_0001164_10932_11828 287
784 3300046492 Ga0495585_0000437 Ga0495585_0000437_31151_32047 287
785 3300046501 Ga0495607_0000654 Ga0495607_0000654_1588_2484 287
786 3300046507 Ga0495606_0000918 Ga0495606_0000918_24628_25524 287
787 3300046507 Ga0495606_0009672 Ga0495606_0009672_3282_4178 287
788 3300046511 Ga0495608_0067704 Ga0495608_0067704_1112_2008 287
789 3300046513 Ga0495616_0000190 Ga0495616_0000190_19539_20435 287
790 3300046514 Ga0495618_0137694 Ga0495618_0137694_154_1050 287
791 3300046515 Ga0495620_0000719 Ga0495620_0000719_19294_20190 287
792 3300046516 Ga0495628_0004271 Ga0495628_0004271_5073_5969 287
793 3300046516 Ga0495628_0066181 Ga0495628_0066181_179_1078 287
794 3300046516 Ga0495628_0085758 Ga0495628_0085758_1090_1986 287
795 3300046517 Ga0495630_0252477 Ga0495630_0252477_387_1283 287
796 3300046518 Ga0495631_0000389 Ga0495631_0000389_15461_16357 287
797 3300046518 Ga0495631_0000631 Ga0495631_0000631_19717_20613 287
798 3300046519 Ga0495632_0000135 Ga0495632_0000135_25632_26528 287
799 3300046519 Ga0495632_0007588 Ga0495632_0007588_241_1137 287
800 3300046520 Ga0495637_0034945 Ga0495637_0034945_56_952 287
801 3300046524 Ga0495648_0003653 Ga0495648_0003653_618_1514 287
802 3300046524 Ga0495648_0005315 Ga0495648_0005315_1856_2752 287
803 3300046526 Ga0495666_0005322 Ga0495666_0005322_512_1408 287
804 3300046529 Ga0495652_0041652 Ga0495652_0041652_313_1209 287
805 3300046531 Ga0495665_0026288 Ga0495665_0026288_1960_2856 287
806 3300046533 Ga0495640_0006168 Ga0495640_0006168_4890_5786 287
807 3300046535 Ga0495586_0106170 Ga0495586_0106170_512_1408 287
808 3300046535 Ga0495586_0130027 Ga0495586_0130027_127_1023 287
809 3300046536 Ga0495587_0005354 Ga0495587_0005354_2324_3220 287
810 3300046538 Ga0495609_0015535 Ga0495609_0015535_1397_2293 287
811 3300046557 Ga0495622_0027562 Ga0495622_0027562_1103_1999 287
812 3300046557 Ga0495622_0042981 Ga0495622_0042981_501_1397 287
813 3300046559 Ga0495667_0007860 Ga0495667_0007860_757_1653 287
814 3300046616 Ga0495668_0001101 Ga0495668_0001101_2232_3161 287
815 3300046616 Ga0495668_0004981 Ga0495668_0004981_5040_5936 287
816 3300046642 Ga0495634_0050977 Ga0495634_0050977_1370_2266 287
817 3300046648 Ga0495611_0000004 Ga0495611_0000004_30987_31883 287
818 3300046648 Ga0495611_0000285 Ga0495611_0000285_23111_24007 287
819 3300046660 Ga0495625_0000617 Ga0495625_0000617_32580_33476 287
820 3300046663 Ga0495635_0134045 Ga0495635_0134045_281_1177 287
821 3300046665 Ga0495661_0001370 Ga0495661_0001370_295_1191 287
822 3300046675 Ga0495657_0007507 Ga0495657_0007507_5017_5913 287
823 3300046678 Ga0495599_0004788 Ga0495599_0004788_637_1533 287
824 3300046681 Ga0495647_0002069 Ga0495647_0002069_338_1234 287
825 3300046683 Ga0495658_0060184 Ga0495658_0060184_757_1653 287
826 3300046689 Ga0495613_0008505 Ga0495613_0008505_5964_6860 287
827 3300046689 Ga0495613_0262702 Ga0495613_0262702_74_970 287
828 3300046691 Ga0495670_0000884 Ga0495670_0000884_1465_2361 287
829 3300046692 Ga0495671_0010269 Ga0495671_0010269_2317_3213 287
830 3300046794 Ga0495589_0002511 Ga0495589_0002511_4052_4948 287
831 3300046809 Ga0495600_0031607 Ga0495600_0031607_932_1828 287
832 3300046810 Ga0495660_0000356 Ga0495660_0000356_18137_19033 287
833 3300046810 Ga0495660_0000685 Ga0495660_0000685_9004_9900 287
834 3300047317 Ga0495604_0071290 Ga0495604_0071290_756_1652 287
835 3300047317 Ga0495604_0201517 Ga0495604_0201517_126_1022 287
836 3300047319 Ga0495674_0012393 Ga0495674_0012393_1914_2810 287
837 3300047446 Ga0495679_000011 Ga0495679_000011_290864_291760 287
838 3300047469 Ga0495673_0000036 Ga0495673_0000036_31088_31984 287
839 3300047469 Ga0495673_0000151 Ga0495673_0000151_20848_21744 287
840 3300047469 Ga0495673_0003447 Ga0495673_0003447_597_1493 287
841 3300047471 Ga0495684_0008689 Ga0495684_0008689_1786_2682 287
842 3300047472 Ga0495686_0002323 Ga0495686_0002323_4435_5331 287
843 3300048089 Ga0495614_0007216 Ga0495614_0007216_1051_1947 287
844 3300048903 Ga0496100_0014939 Ga0496100_0014939_1725_2621 287
845 3300048904 Ga0496101_0002453 Ga0496101_0002453_613_1509 287
846 3300048909 Ga0496106_0000566 Ga0496106_0000566_24428_25324 287
847 3300048912 Ga0496109_0214444 Ga0496109_0214444_269_1198 287
848 3300048915 Ga0496112_0384375 Ga0496112_0384375_16_945 287
849 3300048918 Ga0496115_0007937 Ga0496115_0007937_2515_3411 287
850 3300048924 Ga0496121_0001803 Ga0496121_0001803_10734_11630 287
851 3300048924 Ga0496121_0003261 Ga0496121_0003261_16589_17485 287
852 3300048924 Ga0496121_0034585 Ga0496121_0034585_3220_4116 287
853 3300048925 Ga0496122_0059687 Ga0496122_0059687_303_1208 287
854 3300048925 Ga0496122_0060937 Ga0496122_0060937_94_990 287
855 3300048926 Ga0496123_0071204 Ga0496123_0071204_1003_1899 287
856 3300048926 Ga0496123_0167255 Ga0496123_0167255_232_1137 287
857 3300048929 Ga0496126_0038468 Ga0496126_0038468_812_1708 287
858 3300048929 Ga0496126_0065365 Ga0496126_0065365_779_1729 287
859 3300049459 Ga0495678_000067 Ga0495678_000067_114369_115265 287
860 3300049460 Ga0495682_0044085 Ga0495682_0044085_536_1432 287
861 3300049460 Ga0495682_0094802 Ga0495682_0094802_43_939 287
862 3300049571 Ga0501034_0021355 Ga0501034_0021355_4151_5047 287
863 3300049573 Ga0501037_0010840 Ga0501037_0010840_816_1724 287
864 3300049579 Ga0501043_0003354 Ga0501043_0003354_4670_5590 287
865 3300049579 Ga0501043_0033076 Ga0501043_0033076_1160_2068 287
866 3300049580 Ga0501046_0004568 Ga0501046_0004568_10689_11585 287
867 3300049585 Ga0501069_0024446 Ga0501069_0024446_646_1542 287
868 3300049586 Ga0501070_0008384 Ga0501070_0008384_1935_2843 287
869 3300049593 Ga0501077_0131792 Ga0501077_0131792_653_1561 287
870 3300049680 Ga0501250_014979 Ga0501250_014979_11_910 287
871 3300049822 Ga0501035_0017079 Ga0501035_0017079_2736_3644 287
872 3300049823 Ga0501044_0076307 Ga0501044_0076307_1368_2276 287
873 3300050514 nmdc:mga08x19_47292_c1 nmdc:mga08x19_47292_c1_1212_2111 287
874 3300053077 Ga0495601_0008506 Ga0495601_0008506_5069_5965 287
875 3300053078 Ga0495612_0144958 Ga0495612_0144958_15_911 287
876 3300053084 Ga0495595_0001644 Ga0495595_0001644_2837_3733 287
877 3300053087 Ga0500643_000012 Ga0500643_000012_31029_31925 287
878 3300053160 Ga0500633_0021636 Ga0500633_0021636_911_1807 287
879 iso_pu_bacteria 2643221559 2643818476 287
880 iso_pu_bacteria 2643221586 2643938383 287
881 iso_pu_bacteria 2643221612 2644079034 287
882 iso_pu_bacteria 2643221695 2644530649 287
883 iso_pu_bacteria 2643221720 2644661227 287
884 iso_pu_bacteria 2643221727 2644693811 287
885 iso_pu_bacteria 2643221728 2644699304 287
886 3300006358 Ga0068871_100459876 Ga0068871_1004598761 288
887 3300025908 Ga0207643_10247148 Ga0207643_102471481 288
888 3300028800 Ga0265338_10003632 Ga0265338_1000363222 288
889 3300042876 Ga0451577_0064238 Ga0451577_0064238_580_1539 288
890 3300044712 Ga0453684_0014076 Ga0453684_0014076_8972_9931 288
891 3300045051 Ga0451576_0040111 Ga0451576_0040111_2673_3632 288
892 3300049591 Ga0501075_0145419 Ga0501075_0145419_467_1369 288
893 3300049743 Ga0501081_0277979 Ga0501081_0277979_271_1173 288
894 3300009545 Ga0105237_10157361 Ga0105237_101573612 289
895 3300031251 Ga0265327_10017089 Ga0265327_100170894 289
896 3300031251 Ga0265327_10093483 Ga0265327_100934832 289
897 3300031901 Ga0307406_10150755 Ga0307406_101507552 289
898 3300031903 Ga0307407_10066608 Ga0307407_100666082 289
899 3300035172 Ga0373955_0031395 Ga0373955_0031395_1528_2430 289
900 3300035724 Ga0373933_0101203 Ga0373933_0101203_364_1266 289
901 3300036401 Ga0373937_0018294 Ga0373937_0018294_2470_3372 289
902 3300036401 Ga0373937_0267009 Ga0373937_0267009_183_1085 289
903 3300039437 Ga0436365_0183573 Ga0436365_0183573_158_1030 289
904 3300039450 Ga0436363_0158878 Ga0436363_0158878_1164_2036 289
905 3300039450 Ga0436363_1045643 Ga0436363_1045643_350_1222 289
906 3300042007 Ga0439449_0027011 Ga0439449_0027011_701_1651 289
907 3300044712 Ga0453684_0567487 Ga0453684_0567487_13_921 289
908 3300045051 Ga0451576_0002379 Ga0451576_0002379_1900_2805 289
909 3300046660 Ga0495625_0065486 Ga0495625_0065486_271_1254 289
910 3300046694 Ga0495649_0003176 Ga0495649_0003176_6188_7171 289
911 3300048918 Ga0496115_0000135 Ga0496115_0000135_31848_32831 289
912 3300048918 Ga0496115_0446265 Ga0496115_0446265_45_1004 289
913 3300048925 Ga0496122_0120871 Ga0496122_0120871_64_993 289
914 3300048929 Ga0496126_0046614 Ga0496126_0046614_2454_3437 289
915 3300061734 Ga0530510_0167072 Ga0530510_0167072_11_958 289
916 3300025934 Ga0207686_10119445 Ga0207686_101194452 291
917 3300035116 Ga0373945_0140497 Ga0373945_0140497_71_958 292
918 3300005354 Ga0070675_100140321 Ga0070675_1001403212 293
919 3300005365 Ga0070688_100096141 Ga0070688_1000961412 293
920 3300005457 Ga0070662_100158043 Ga0070662_1001580432 293
921 3300009094 Ga0111539_10112002 Ga0111539_101120022 293
922 3300025933 Ga0207706_10104054 Ga0207706_101040541 293
923 3300026035 Ga0207703_10446782 Ga0207703_104467822 293
924 3300025922 Ga0207646_10000115 Ga0207646_1000011534 294
925 3300037853 Ga0436364_1265600 Ga0436364_1265600_202_1089 294
926 3300013296 Ga0157374_10123081 Ga0157374_101230811 295
927 3300036401 Ga0373937_0182014 Ga0373937_0182014_884_1774 295
928 3300046454 Ga0495592_0048971 Ga0495592_0048971_1571_2467 295
929 3300046462 Ga0495651_0080049 Ga0495651_0080049_32_928 295
930 3300046514 Ga0495618_0076527 Ga0495618_0076527_184_1110 295
931 3300046516 Ga0495628_0144119 Ga0495628_0144119_362_1288 295
932 3300046529 Ga0495652_0290449 Ga0495652_0290449_270_1166 295
933 3300053077 Ga0495601_0053019 Ga0495601_0053019_720_1616 295
934 3300000545 CNXas_1000053 CNXas_100005319 296
935 3300005295 Ga0065707_10021569 Ga0065707_100215691 296
936 3300005328 Ga0070676_10005061 Ga0070676_100050616 296
937 3300005328 Ga0070676_10009567 Ga0070676_100095674 296
938 3300005329 Ga0070683_100066760 Ga0070683_1000667602 296
939 3300005330 Ga0070690_100014709 Ga0070690_1000147095 296
940 3300005331 Ga0070670_100016518 Ga0070670_1000165185 296
941 3300005331 Ga0070670_100018329 Ga0070670_1000183296 296
942 3300005335 Ga0070666_10136193 Ga0070666_101361932 296
943 3300005338 Ga0068868_100039621 Ga0068868_1000396212 296
944 3300005338 Ga0068868_100132026 Ga0068868_1001320262 296
945 3300005340 Ga0070689_100001450 Ga0070689_10000145011 296
946 3300005340 Ga0070689_100154175 Ga0070689_1001541752 296
947 3300005343 Ga0070687_100000577 Ga0070687_1000005773 296
948 3300005343 Ga0070687_100086250 Ga0070687_1000862502 296
949 3300005347 Ga0070668_100008104 Ga0070668_1000081043 296
950 3300005347 Ga0070668_100102853 Ga0070668_1001028532 296
951 3300005347 Ga0070668_100458069 Ga0070668_1004580691 296
952 3300005347 Ga0070668_100466121 Ga0070668_1004661211 296
953 3300005353 Ga0070669_100002483 Ga0070669_10000248312 296
954 3300005353 Ga0070669_100060779 Ga0070669_1000607792 296
955 3300005354 Ga0070675_100001717 Ga0070675_10000171715 296
956 3300005354 Ga0070675_100002965 Ga0070675_1000029658 296
957 3300005354 Ga0070675_100048024 Ga0070675_1000480242 296
958 3300005354 Ga0070675_100077596 Ga0070675_1000775962 296
959 3300005354 Ga0070675_100314314 Ga0070675_1003143142 296
960 3300005355 Ga0070671_100021794 Ga0070671_1000217946 296
961 3300005355 Ga0070671_100023724 Ga0070671_1000237242 296
962 3300005355 Ga0070671_100041962 Ga0070671_1000419622 296
963 3300005356 Ga0070674_100000943 Ga0070674_10000094313 296
964 3300005356 Ga0070674_100013991 Ga0070674_1000139913 296
965 3300005356 Ga0070674_100023293 Ga0070674_1000232933 296
966 3300005364 Ga0070673_100001757 Ga0070673_1000017579 296
967 3300005364 Ga0070673_100026784 Ga0070673_1000267843 296
968 3300005364 Ga0070673_100050659 Ga0070673_1000506592 296
969 3300005365 Ga0070688_100033591 Ga0070688_1000335912 296
970 3300005366 Ga0070659_100003104 Ga0070659_10000310410 296
971 3300005367 Ga0070667_100001152 Ga0070667_10000115210 296
972 3300005367 Ga0070667_100136318 Ga0070667_1001363182 296
973 3300005434 Ga0070709_10157158 Ga0070709_101571582 296
974 3300005439 Ga0070711_100010266 Ga0070711_1000102665 296
975 3300005440 Ga0070705_100289564 Ga0070705_1002895641 296
976 3300005444 Ga0070694_100054385 Ga0070694_1000543853 296
977 3300005445 Ga0070708_100061928 Ga0070708_1000619282 296
978 3300005445 Ga0070708_100108787 Ga0070708_1001087871 296
979 3300005456 Ga0070678_100136932 Ga0070678_1001369322 296
980 3300005457 Ga0070662_100102116 Ga0070662_1001021162 296
981 3300005457 Ga0070662_100130834 Ga0070662_1001308342 296
982 3300005466 Ga0070685_10038178 Ga0070685_100381782 296
983 3300005467 Ga0070706_100028777 Ga0070706_1000287772 296
984 3300005467 Ga0070706_100075924 Ga0070706_1000759243 296
985 3300005468 Ga0070707_100000049 Ga0070707_10000004969 296
986 3300005468 Ga0070707_100007424 Ga0070707_10000742410 296
987 3300005468 Ga0070707_100036291 Ga0070707_1000362915 296
988 3300005468 Ga0070707_100075070 Ga0070707_1000750702 296
989 3300005468 Ga0070707_100128199 Ga0070707_1001281992 296
990 3300005468 Ga0070707_100167331 Ga0070707_1001673312 296
991 3300005468 Ga0070707_100277610 Ga0070707_1002776102 296
992 3300005471 Ga0070698_100123519 Ga0070698_1001235192 296
993 3300005518 Ga0070699_100265886 Ga0070699_1002658862 296
994 3300005536 Ga0070697_100006541 Ga0070697_1000065412 296
995 3300005536 Ga0070697_100255962 Ga0070697_1002559622 296
996 3300005536 Ga0070697_100318771 Ga0070697_1003187711 296
997 3300005543 Ga0070672_100002408 Ga0070672_1000024086 296
998 3300005543 Ga0070672_100038187 Ga0070672_1000381872 296
999 3300005543 Ga0070672_100275064 Ga0070672_1002750642 296
1000 3300005544 Ga0070686_100015716 Ga0070686_1000157162 296
1001 3300005548 Ga0070665_100016694 Ga0070665_1000166942 296
1002 3300005548 Ga0070665_100378535 Ga0070665_1003785352 296
1003 3300005549 Ga0070704_100007181 Ga0070704_1000071815 296
1004 3300005618 Ga0068864_100146428 Ga0068864_1001464282 296
1005 3300005841 Ga0068863_100256214 Ga0068863_1002562142 296
1006 3300005842 Ga0068858_100268276 Ga0068858_1002682761 296
1007 3300005843 Ga0068860_100005012 Ga0068860_1000050126 296
1008 3300005844 Ga0068862_100004453 Ga0068862_1000044533 296
1009 3300005937 Ga0081455_10003245 Ga0081455_100032452 296
1010 3300005937 Ga0081455_10006042 Ga0081455_100060427 296
1011 3300005937 Ga0081455_10325496 Ga0081455_103254961 296
1012 3300005983 Ga0081540_1035648 Ga0081540_10356482 296
1013 3300005985 Ga0081539_10000383 Ga0081539_1000038363 296
1014 3300005985 Ga0081539_10002232 Ga0081539_1000223216 296
1015 3300005985 Ga0081539_10030194 Ga0081539_100301942 296
1016 3300005985 Ga0081539_10041447 Ga0081539_100414472 296
1017 3300006028 Ga0070717_10536548 Ga0070717_105365482 296
1018 3300006237 Ga0097621_100008000 Ga0097621_1000080006 296
1019 3300006237 Ga0097621_100016502 Ga0097621_1000165022 296
1020 3300006237 Ga0097621_100020951 Ga0097621_1000209512 296
1021 3300006358 Ga0068871_100012976 Ga0068871_1000129766 296
1022 3300009098 Ga0105245_10045099 Ga0105245_100450993 296
1023 3300009553 Ga0105249_10013319 Ga0105249_100133195 296
1024 3300009553 Ga0105249_10134454 Ga0105249_101344542 296
1025 3300010375 Ga0105239_10003699 Ga0105239_1000369917 296
1026 3300013296 Ga0157374_10003141 Ga0157374_1000314113 296
1027 3300013296 Ga0157374_10018270 Ga0157374_100182703 296
1028 3300013296 Ga0157374_10102434 Ga0157374_101024342 296
1029 3300013296 Ga0157374_10120606 Ga0157374_101206062 296
1030 3300013297 Ga0157378_10015300 Ga0157378_100153006 296
1031 3300013297 Ga0157378_10025804 Ga0157378_100258043 296
1032 3300013306 Ga0163162_10026276 Ga0163162_100262766 296
1033 3300013306 Ga0163162_10030229 Ga0163162_100302292 296
1034 3300013306 Ga0163162_10557177 Ga0163162_105571771 296
1035 3300013307 Ga0157372_10018240 Ga0157372_100182404 296
1036 3300013307 Ga0157372_10032248 Ga0157372_100322486 296
1037 3300013308 Ga0157375_10000847 Ga0157375_1000084718 296
1038 3300013308 Ga0157375_10001173 Ga0157375_1000117320 296
1039 3300013308 Ga0157375_10018258 Ga0157375_100182584 296
1040 3300013308 Ga0157375_10127837 Ga0157375_101278371 296
1041 3300013308 Ga0157375_10172603 Ga0157375_101726033 296
1042 3300013308 Ga0157375_10663138 Ga0157375_106631381 296
1043 3300014968 Ga0157379_10605188 Ga0157379_106051881 296
1044 3300014969 Ga0157376_10010708 Ga0157376_100107085 296
1045 3300014969 Ga0157376_10059428 Ga0157376_100594282 296
1046 3300025315 Ga0207697_10000127 Ga0207697_100001276 296
1047 3300025315 Ga0207697_10000230 Ga0207697_1000023021 296
1048 3300025315 Ga0207697_10034143 Ga0207697_100341432 296
1049 3300025901 Ga0207688_10000591 Ga0207688_100005917 296
1050 3300025907 Ga0207645_10006341 Ga0207645_100063415 296
1051 3300025907 Ga0207645_10013669 Ga0207645_100136692 296
1052 3300025907 Ga0207645_10032058 Ga0207645_100320582 296
1053 3300025910 Ga0207684_10037866 Ga0207684_100378662 296
1054 3300025910 Ga0207684_10098239 Ga0207684_100982392 296
1055 3300025915 Ga0207693_10005444 Ga0207693_100054443 296
1056 3300025916 Ga0207663_10011802 Ga0207663_100118026 296
1057 3300025922 Ga0207646_10176222 Ga0207646_101762222 296
1058 3300025923 Ga0207681_10068054 Ga0207681_100680543 296
1059 3300025923 Ga0207681_10116045 Ga0207681_101160452 296
1060 3300025923 Ga0207681_10290062 Ga0207681_102900621 296
1061 3300025925 Ga0207650_10032005 Ga0207650_100320053 296
1062 3300025925 Ga0207650_10093412 Ga0207650_100934122 296
1063 3300025926 Ga0207659_10011180 Ga0207659_100111804 296
1064 3300025926 Ga0207659_10044224 Ga0207659_100442242 296
1065 3300025926 Ga0207659_10058465 Ga0207659_100584652 296
1066 3300025926 Ga0207659_10151725 Ga0207659_101517252 296
1067 3300025931 Ga0207644_10019599 Ga0207644_100195992 296
1068 3300025931 Ga0207644_10022203 Ga0207644_100222032 296
1069 3300025931 Ga0207644_10059011 Ga0207644_100590112 296
1070 3300025933 Ga0207706_10000921 Ga0207706_1000092130 296
1071 3300025933 Ga0207706_10212264 Ga0207706_102122642 296
1072 3300025936 Ga0207670_10045538 Ga0207670_100455383 296
1073 3300025937 Ga0207669_10003041 Ga0207669_100030417 296
1074 3300025937 Ga0207669_10063271 Ga0207669_100632712 296
1075 3300025939 Ga0207665_10079680 Ga0207665_100796802 296
1076 3300025940 Ga0207691_10001130 Ga0207691_1000113010 296
1077 3300025940 Ga0207691_10072437 Ga0207691_100724372 296
1078 3300025940 Ga0207691_10114204 Ga0207691_101142041 296
1079 3300025940 Ga0207691_10138756 Ga0207691_101387562 296
1080 3300025942 Ga0207689_10131883 Ga0207689_101318832 296
1081 3300025944 Ga0207661_10011542 Ga0207661_100115422 296
1082 3300025960 Ga0207651_10018685 Ga0207651_100186852 296
1083 3300025960 Ga0207651_10131406 Ga0207651_101314062 296
1084 3300025972 Ga0207668_10000957 Ga0207668_100009573 296
1085 3300025972 Ga0207668_10018195 Ga0207668_100181952 296
1086 3300025972 Ga0207668_10041479 Ga0207668_100414792 296
1087 3300025972 Ga0207668_10078135 Ga0207668_100781352 296
1088 3300025972 Ga0207668_10366227 Ga0207668_103662271 296
1089 3300025986 Ga0207658_10004264 Ga0207658_100042643 296
1090 3300025986 Ga0207658_10013569 Ga0207658_100135692 296
1091 3300025986 Ga0207658_10088850 Ga0207658_100888502 296
1092 3300026023 Ga0207677_10054699 Ga0207677_100546992 296
1093 3300026023 Ga0207677_10230151 Ga0207677_102301512 296
1094 3300026121 Ga0207683_10127022 Ga0207683_101270222 296
1095 3300028379 Ga0268266_10079426 Ga0268266_100794262 296
1096 3300028380 Ga0268265_10150675 Ga0268265_101506752 296
1097 3300035089 Ga0373944_0056672 Ga0373944_0056672_292_1185 296
1098 3300035170 Ga0373943_0053245 Ga0373943_0053245_996_1958 296
1099 3300035170 Ga0373943_0115360 Ga0373943_0115360_194_1087 296
1100 3300035692 Ga0373935_0032184 Ga0373935_0032184_2005_2898 296
1101 3300035695 Ga0373927_0045147 Ga0373927_0045147_1434_2330 296
1102 3300035725 Ga0373947_0014892 Ga0373947_0014892_1790_2683 296
1103 3300035725 Ga0373947_0022163 Ga0373947_0022163_1399_2361 296
1104 3300037068 Ga0373925_0035071 Ga0373925_0035071_554_1450 296
1105 3300037068 Ga0373925_0181274 Ga0373925_0181274_491_1384 296
1106 3300037471 Ga0395905_0001364 Ga0395905_0001364_1822_2733 296
1107 3300042011 Ga0439454_012946 Ga0439454_012946_72_962 296
1108 3300045976 Ga0466967_0011944 Ga0466967_0011944_4254_5147 296
1109 3300046525 Ga0495663_0028503 Ga0495663_0028503_437_1330 296
1110 3300046664 Ga0495659_0005803 Ga0495659_0005803_1966_2859 296
1111 3300046684 Ga0495669_0043136 Ga0495669_0043136_507_1400 296
1112 3300048907 Ga0496104_0194561 Ga0496104_0194561_330_1223 296
1113 3300048910 Ga0496107_0186452 Ga0496107_0186452_286_1257 296
1114 3300048911 Ga0496108_0017773 Ga0496108_0017773_1967_2932 296
1115 3300048912 Ga0496109_0038885 Ga0496109_0038885_2988_3953 296
1116 3300048915 Ga0496112_0058925 Ga0496112_0058925_908_1873 296
1117 3300048918 Ga0496115_0008471 Ga0496115_0008471_4195_5166 296
1118 3300050512 nmdc:mga0n895_563584_c1 nmdc:mga0n895_563584_c1_43_936 296
1119 3300053083 Ga0495655_0059876 Ga0495655_0059876_53_946 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

66

319

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9398 6 296
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9324 6 296
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9309 6 294
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9229 6 294
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9214 6 296
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9723 107 247 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9576 106 247 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9396 107 247 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9307 108 239 3.30.470.20
af_A0A1D8PRQ1_1_101_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9276 6 104 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A535BLM7-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9981 56 296 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2V5X396-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9968 1 296 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7W0YC12-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9955 1 296 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7X7XHC9-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9954 4 295 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2V6HF81-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9942 1 242 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
93.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map