F489937

General Info

Members Datasets Scaffolds Average Seq Length
1094 438 2188 231

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100227164|Ga0097621_1002271641
Length 263
Sequence MAKHGKKFTAAAAQVEDRPYRLEEAIPLIQKVKFAKFDETVEVAMRLGVDPKHADQMVRGTVVLPHGLGTSKSVLVIAGADKQKEAQDAGADFVGGDEVVEKILGGWMEFDAVVATPDMMRAVGRLGKVLGPRGLMPNPKTGTVTMDVAKAVSEAKAGKLEYRTDRGANVHVAIGKKSFEQRALVENYVAVLDEIIRAKPSAAKGRYIRQITLTSTMGPGIHVDPARIRGILEELDESSSNQNRELGEQAGEAATVPAEQLPA

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
231 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
253 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
275 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
282 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
288 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
295 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
313 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
388 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
408 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
409 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
424 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
425 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
429 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
435 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
436 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
437 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
438 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 3.29
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.18
Rhizoplane 2.47
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100227164 3300006237 Bacteria 1629
2 JGI24741J21665_1019232 3300001915 Bacteria 1084
3 JGI24738J21930_10013322 3300002075 Bacteria 1781
4 Ga0006762J43184_106338 3300002872 Bacteria 2251
5 rootL2_10370863 3300003322 Bacteria 1532
6 rootH1_10061610 3300003323 Bacteria 2013
7 JGI25407J50210_10003427 3300003373 Bacteria 3792
8 Ga0058863_10052666 3300004799 Bacteria 4400
9 Ga0058863_10170080 3300004799 Bacteria 2647
10 Ga0058861_10168291 3300004800 Bacteria 5401
11 Ga0058860_12210992 3300004801 Bacteria 980
12 Ga0058862_10289804 3300004803 Bacteria 2236
13 Ga0065704_10092589 3300005289 Bacteria 2645
14 Ga0065704_10096689 3300005289 Bacteria 2422
15 Ga0065712_10075001 3300005290 Bacteria 3957
16 Ga0065712_10075551 3300005290 Bacteria 3839
17 Ga0065712_10093133 3300005290 Bacteria 2305
18 Ga0065715_10114950 3300005293 Bacteria 2432
19 Ga0065715_10130388 3300005293 Bacteria 2027
20 Ga0065715_10154036 3300005293 Bacteria 1693
21 Ga0070658_10109288 3300005327 Bacteria 2289
22 Ga0070676_10062231 3300005328 Bacteria 2220
23 Ga0070676_10136059 3300005328 Bacteria 1559
24 Ga0070683_100054844 3300005329 Bacteria 3696
25 Ga0070683_100112701 3300005329 Bacteria 2567
26 Ga0070690_100048689 3300005330 Bacteria 2700
27 Ga0070690_100238709 3300005330 Bacteria 1281
28 Ga0070670_100002037 3300005331 Bacteria 16542
29 Ga0070670_100020542 3300005331 Bacteria 5678
30 Ga0070670_100028660 3300005331 Bacteria 4792
31 Ga0070670_100051264 3300005331 Bacteria 3545
32 Ga0070670_100115234 3300005331 Bacteria 2317
33 Ga0070670_100447223 3300005331 Bacteria 1145
34 Ga0070677_10189635 3300005333 Bacteria 985
35 Ga0068869_100050303 3300005334 Bacteria 3020
36 Ga0068869_100310311 3300005334 Bacteria 1276
37 Ga0070666_10010932 3300005335 Bacteria 5687
38 Ga0070680_100001103 3300005336 Bacteria 19365
39 Ga0070682_100038642 3300005337 Bacteria 2928
40 Ga0070682_100099053 3300005337 Bacteria 1921
41 Ga0070682_100313001 3300005337 Bacteria 1156
42 Ga0068868_100003244 3300005338 Bacteria 11319
43 Ga0068868_100065914 3300005338 Bacteria 2878
44 Ga0068868_100268547 3300005338 Bacteria 1440
45 Ga0068868_100279510 3300005338 Bacteria 1412
46 Ga0070660_100002528 3300005339 Bacteria 12533
47 Ga0070660_100047206 3300005339 Bacteria 3303
48 Ga0070660_100236668 3300005339 Bacteria 1486
49 Ga0070689_100055251 3300005340 Bacteria 3076
50 Ga0070689_100056159 3300005340 Bacteria 3052
51 Ga0070689_100116781 3300005340 Bacteria 2128
52 Ga0070689_100279803 3300005340 Bacteria 1384
53 Ga0070689_100413701 3300005340 Bacteria 1142
54 Ga0070689_100493516 3300005340 Bacteria 1048
55 Ga0070687_100139516 3300005343 Bacteria 1410
56 Ga0070661_100005158 3300005344 Bacteria 8991
57 Ga0070661_100060578 3300005344 Bacteria 2777
58 Ga0070661_100074038 3300005344 Bacteria 2508
59 Ga0070661_100084440 3300005344 Bacteria 2346
60 Ga0070692_10141598 3300005345 Bacteria 1362
61 Ga0070668_100144156 3300005347 Bacteria 1921
62 Ga0070669_100004448 3300005353 Bacteria 10105
63 Ga0070675_100006570 3300005354 Bacteria 8937
64 Ga0070675_100029347 3300005354 Bacteria 4435
65 Ga0070675_100053172 3300005354 Bacteria 3330
66 Ga0070675_100133271 3300005354 Bacteria 2119
67 Ga0070675_100188398 3300005354 Bacteria 1787
68 Ga0070675_100555303 3300005354 Bacteria 1039
69 Ga0070675_100909768 3300005354 Bacteria 806
70 Ga0070671_100001395 3300005355 Bacteria 18046
71 Ga0070671_100003462 3300005355 Bacteria 12327
72 Ga0070671_100038179 3300005355 Bacteria 3986
73 Ga0070671_100234024 3300005355 Bacteria 1559
74 Ga0070674_100082765 3300005356 Bacteria 2296
75 Ga0070673_100042705 3300005364 Bacteria 3497
76 Ga0070673_100049506 3300005364 Bacteria 3281
77 Ga0070673_100068302 3300005364 Bacteria 2845
78 Ga0070673_100070911 3300005364 Bacteria 2798
79 Ga0070673_100354362 3300005364 Bacteria 1303
80 Ga0070688_100019652 3300005365 Bacteria 3916
81 Ga0070688_100051080 3300005365 Bacteria 2578
82 Ga0070667_100005841 3300005367 Bacteria 10266
83 Ga0070667_100024096 3300005367 Bacteria 5054
84 Ga0070667_100103151 3300005367 Bacteria 2465
85 Ga0070709_10010452 3300005434 Bacteria 5143
86 Ga0070709_10169441 3300005434 Bacteria 1525
87 Ga0070714_100267983 3300005435 Unclassified 1583
88 Ga0070713_100199272 3300005436 Bacteria 1807
89 Ga0070710_10041040 3300005437 Bacteria 2552
90 Ga0070710_10164859 3300005437 Bacteria 1377
91 Ga0070701_10135483 3300005438 Bacteria 1403
92 Ga0070711_100029381 3300005439 Bacteria 3627
93 Ga0070711_100270155 3300005439 Bacteria 1341
94 Ga0070711_100521809 3300005439 Bacteria 982
95 Ga0070705_100205873 3300005440 Bacteria 1352
96 Ga0070694_100103391 3300005444 Bacteria 2018
97 Ga0070694_100264176 3300005444 Bacteria 1306
98 Ga0070694_100507763 3300005444 Bacteria 960
99 Ga0070708_100000449 3300005445 Bacteria 30862
100 Ga0070708_100016101 3300005445 Bacteria 6196
101 Ga0070708_100081988 3300005445 Bacteria 2921
102 Ga0070708_100514838 3300005445 Bacteria 1129
103 Ga0070708_100659104 3300005445 Bacteria 986
104 Ga0070663_100339387 3300005455 Bacteria 1213
105 Ga0070678_100203913 3300005456 Bacteria 1634
106 Ga0070678_100220038 3300005456 Bacteria 1578
107 Ga0070678_100303975 3300005456 Bacteria 1356
108 Ga0070662_100029624 3300005457 Bacteria 3821
109 Ga0070662_100032181 3300005457 Bacteria 3684
110 Ga0070681_10087087 3300005458 Bacteria 3076
111 Ga0068867_100057238 3300005459 Bacteria 2887
112 Ga0068867_100251482 3300005459 Bacteria 1437
113 Ga0070685_10001304 3300005466 Bacteria 13140
114 Ga0070685_10021547 3300005466 Bacteria 3503
115 Ga0070685_10052834 3300005466 Bacteria 2352
116 Ga0070685_10054316 3300005466 Bacteria 2323
117 Ga0070706_100004637 3300005467 Bacteria 13195
118 Ga0070706_100616300 3300005467 Bacteria 1008
119 Ga0070707_100006642 3300005468 Bacteria 10725
120 Ga0070707_100012678 3300005468 Bacteria 7873
121 Ga0070707_100048300 3300005468 Bacteria 4077
122 Ga0070707_100108612 3300005468 Bacteria 2691
123 Ga0070707_100202029 3300005468 Bacteria 1937
124 Ga0070707_100437566 3300005468 Bacteria 1268
125 Ga0070707_100567766 3300005468 Bacteria 1097
126 Ga0070698_100005408 3300005471 Bacteria 13953
127 Ga0070698_100437425 3300005471 Bacteria 1243
128 Ga0070699_100393235 3300005518 Bacteria 1253
129 Ga0070679_100034483 3300005530 Bacteria 5016
130 Ga0070679_100198221 3300005530 Bacteria 1974
131 Ga0070679_100321529 3300005530 Bacteria 1496
132 Ga0070684_100034883 3300005535 Bacteria 4304
133 Ga0070684_100411507 3300005535 Bacteria 1248
134 Ga0070684_100537817 3300005535 Bacteria 1084
135 Ga0070697_100000421 3300005536 Bacteria 32639
136 Ga0070697_100128234 3300005536 Bacteria 2126
137 Ga0070697_100337107 3300005536 Bacteria 1301
138 Ga0068853_100008003 3300005539 Bacteria 8479
139 Ga0070672_100019065 3300005543 Bacteria 4971
140 Ga0070672_100030640 3300005543 Bacteria 4043
141 Ga0070672_100204378 3300005543 Bacteria 1652
142 Ga0070672_100292590 3300005543 Bacteria 1379
143 Ga0070672_100809693 3300005543 Bacteria 824
144 Ga0070686_100090815 3300005544 Bacteria 2042
145 Ga0070695_100165636 3300005545 Bacteria 1556
146 Ga0070696_100033545 3300005546 Bacteria 3527
147 Ga0070696_100043851 3300005546 Unclassified 3096
148 Ga0070696_100425358 3300005546 Bacteria 1043
149 Ga0070665_100000269 3300005548 Bacteria 85401
150 Ga0070665_100003003 3300005548 Bacteria 18207
151 Ga0070665_100035708 3300005548 Bacteria 4999
152 Ga0070665_100084036 3300005548 Bacteria 3188
153 Ga0070665_100202373 3300005548 Bacteria 1986
154 Ga0070665_100456954 3300005548 Bacteria 1287
155 Ga0070704_100121260 3300005549 Bacteria 2009
156 Ga0070704_100235952 3300005549 Bacteria 1495
157 Ga0068855_100006099 3300005563 Bacteria 14696
158 Ga0068855_100012247 3300005563 Bacteria 10366
159 Ga0070664_100003979 3300005564 Bacteria 11884
160 Ga0070664_100020586 3300005564 Bacteria 5432
161 Ga0070664_100071441 3300005564 Bacteria 2974
162 Ga0070664_100214501 3300005564 Bacteria 1720
163 Ga0068857_100027185 3300005577 Bacteria 5046
164 Ga0068857_100068453 3300005577 Bacteria 3160
165 Ga0068857_100431895 3300005577 Bacteria 1229
166 Ga0068854_100001336 3300005578 Bacteria 14869
167 Ga0068856_100277726 3300005614 Bacteria 1692
168 Ga0070702_100155882 3300005615 Bacteria 1471
169 Ga0068852_100231142 3300005616 Bacteria 1763
170 Ga0068852_100510264 3300005616 Bacteria 1198
171 Ga0068852_100512776 3300005616 Bacteria 1196
172 Ga0068859_100079340 3300005617 Bacteria 3322
173 Ga0068859_100107960 3300005617 Bacteria 2844
174 Ga0068859_100144299 3300005617 Bacteria 2455
175 Ga0068859_100416509 3300005617 Bacteria 1440
176 Ga0068859_100885240 3300005617 Bacteria 978
177 Ga0068864_100008861 3300005618 Bacteria 8293
178 Ga0068864_100062599 3300005618 Bacteria 3224
179 Ga0068864_100279752 3300005618 Bacteria 1557
180 Ga0068864_100333325 3300005618 Bacteria 1428
181 Ga0068864_100799685 3300005618 Bacteria 927
182 Ga0068861_100250954 3300005719 Bacteria 1510
183 Ga0068861_100562106 3300005719 Bacteria 1041
184 Ga0068870_10165125 3300005840 Bacteria 1317
185 Ga0068870_10518570 3300005840 Bacteria 797
186 Ga0068863_100000969 3300005841 Bacteria 28867
187 Ga0068863_100012620 3300005841 Bacteria 8151
188 Ga0068863_100036154 3300005841 Bacteria 4704
189 Ga0068863_100138603 3300005841 Bacteria 2325
190 Ga0068863_100261002 3300005841 Bacteria 1675
191 Ga0068863_100268294 3300005841 Bacteria 1652
192 Ga0068858_100007152 3300005842 Bacteria 10830
193 Ga0068858_100078881 3300005842 Bacteria 3060
194 Ga0068858_100271131 3300005842 Bacteria 1615
195 Ga0068858_100386397 3300005842 Bacteria 1343
196 Ga0068860_100028140 3300005843 Bacteria 5410
197 Ga0068860_100131686 3300005843 Bacteria 2400
198 Ga0068860_100229215 3300005843 Bacteria 1805
199 Ga0068860_100567637 3300005843 Bacteria 1138
200 Ga0068860_100789425 3300005843 Bacteria 963
201 Ga0068862_100185583 3300005844 Bacteria 1869
202 Ga0068862_100246105 3300005844 Bacteria 1628
203 Ga0081455_10004528 3300005937 Bacteria 15525
204 Ga0081455_10153630 3300005937 Bacteria 1772
205 Ga0081538_10000250 3300005981 Bacteria 60946
206 Ga0081538_10002047 3300005981 Bacteria 20127
207 Ga0081538_10044880 3300005981 Bacteria 2749
208 Ga0070717_10627985 3300006028 Bacteria 975
209 Ga0075368_10005180 3300006042 Bacteria 4472
210 Ga0075364_10115498 3300006051 Bacteria 1794
211 Ga0070712_100058727 3300006175 Bacteria 2707
212 Ga0070712_100280953 3300006175 Bacteria 1341
213 Ga0075362_10000613 3300006177 Bacteria 10441
214 Ga0075367_10011391 3300006178 Bacteria 4703
215 Ga0075369_10002444 3300006186 Bacteria 6625
216 Ga0075366_10163935 3300006195 Bacteria 1347
217 Ga0097621_100020011 3300006237 Bacteria 5152
218 Ga0097621_100043872 3300006237 Bacteria 3606
219 Ga0097621_100046954 3300006237 Bacteria 3496
220 Ga0097621_100067794 3300006237 Bacteria 2941
221 Ga0097621_100100789 3300006237 Bacteria 2429
222 Ga0097621_100147274 3300006237 Bacteria 2017
223 Ga0097621_100156444 3300006237 Unclassified 1957
224 Ga0097621_100397873 3300006237 Bacteria 1233
225 Ga0075370_10164808 3300006353 Bacteria 1301
226 Ga0068871_100013592 3300006358 Bacteria 6044
227 Ga0068871_100028407 3300006358 Bacteria 4384
228 Ga0068871_100041568 3300006358 Bacteria 3687
229 Ga0068871_100061214 3300006358 Bacteria 3073
230 Ga0068871_100104558 3300006358 Bacteria 2375
231 Ga0068871_100331665 3300006358 Unclassified 1342
232 Ga0068871_100413750 3300006358 Bacteria 1203
233 Ga0068871_100505636 3300006358 Bacteria 1090
234 Ga0075428_100555731 3300006844 Bacteria 1227
235 Ga0075428_100759421 3300006844 Bacteria 1031
236 Ga0075430_100189597 3300006846 Bacteria 1709
237 Ga0075431_100071481 3300006847 Bacteria 3580
238 Ga0075431_100081000 3300006847 Bacteria 3352
239 Ga0075431_100131547 3300006847 Bacteria 2580
240 Ga0075431_100316046 3300006847 Bacteria 1576
241 Ga0075431_101002333 3300006847 Bacteria 802
242 Ga0075433_10049769 3300006852 Bacteria 3646
243 Ga0075433_10170130 3300006852 Bacteria 1939
244 Ga0075433_10187506 3300006852 Bacteria 1840
245 Ga0075433_10209882 3300006852 Bacteria 1731
246 Ga0075433_10502774 3300006852 Bacteria 1067
247 Ga0075434_100058033 3300006871 Bacteria 3847
248 Ga0075434_100084832 3300006871 Bacteria 3166
249 Ga0075434_100086909 3300006871 Bacteria 3127
250 Ga0075434_100142561 3300006871 Bacteria 2416
251 Ga0075429_100066027 3300006880 Bacteria 3149
252 Ga0075429_100196316 3300006880 Bacteria 1768
253 Ga0075429_100497079 3300006880 Bacteria 1069
254 Ga0068865_100055272 3300006881 Bacteria 2761
255 Ga0068865_100058801 3300006881 Bacteria 2687
256 Ga0068865_100177213 3300006881 Bacteria 1639
257 Ga0068865_100486097 3300006881 Bacteria 1027
258 Ga0068865_100815937 3300006881 Bacteria 806
259 Ga0097620_100079345 3300006931 Bacteria 3322
260 Ga0097620_100107978 3300006931 Bacteria 2844
261 Ga0097620_100144286 3300006931 Bacteria 2455
262 Ga0097620_100416506 3300006931 Bacteria 1440
263 Ga0097620_100885205 3300006931 Bacteria 978
264 Ga0079104_1051324 3300006946 Bacteria 918
265 Ga0075435_100064802 3300007076 Bacteria 2970
266 Ga0075435_100660785 3300007076 Bacteria 907
267 Ga0099794_10073987 3300007265 Bacteria 1673
268 Ga0099794_10075534 3300007265 Bacteria 1656
269 Ga0099794_10155250 3300007265 Bacteria 1163
270 Ga0099795_10022459 3300007788 Bacteria 2082
271 Ga0105251_10005138 3300009011 Bacteria 8649
272 Ga0105250_10110446 3300009092 Bacteria 1126
273 Ga0105240_10341619 3300009093 Bacteria 1700
274 Ga0111539_10007710 3300009094 Bacteria 13748
275 Ga0111539_10021601 3300009094 Bacteria 7917
276 Ga0111539_10044169 3300009094 Bacteria 5339
277 Ga0111539_10048633 3300009094 Bacteria 5062
278 Ga0111539_10053750 3300009094 Bacteria 4794
279 Ga0111539_10060925 3300009094 Bacteria 4471
280 Ga0111539_10160076 3300009094 Bacteria 2633
281 Ga0111539_10207560 3300009094 Bacteria 2283
282 Ga0111539_10365710 3300009094 Bacteria 1679
283 Ga0111539_10442518 3300009094 Bacteria 1513
284 Ga0111539_10984265 3300009094 Bacteria 981
285 Ga0105245_10514704 3300009098 Bacteria 1214
286 Ga0114129_10024758 3300009147 Bacteria 8509
287 Ga0114129_10066829 3300009147 Bacteria 5014
288 Ga0114129_10128790 3300009147 Bacteria 3478
289 Ga0114129_10274343 3300009147 Bacteria 2255
290 Ga0114129_10388655 3300009147 Bacteria 1841
291 Ga0114129_10467275 3300009147 Bacteria 1652
292 Ga0114129_10521481 3300009147 Bacteria 1549
293 Ga0114129_11067456 3300009147 Bacteria 1013
294 Ga0105243_10010720 3300009148 Bacteria 6943
295 Ga0105243_10081632 3300009148 Bacteria 2640
296 Ga0105242_10003471 3300009176 Bacteria 12255
297 Ga0105242_10097645 3300009176 Bacteria 2484
298 Ga0105242_10099116 3300009176 Bacteria 2466
299 Ga0105242_10164471 3300009176 Bacteria 1945
300 Ga0105242_10830964 3300009176 Unclassified 917
301 Ga0105248_10001106 3300009177 Bacteria 29895
302 Ga0105248_10009115 3300009177 Bacteria 10916
303 Ga0105248_10026939 3300009177 Bacteria 6392
304 Ga0105248_10061024 3300009177 Bacteria 4233
305 Ga0105248_10093930 3300009177 Bacteria 3378
306 Ga0105249_10075568 3300009553 Bacteria 3121
307 Ga0105249_10111457 3300009553 Bacteria 2587
308 Ga0105249_10287756 3300009553 Bacteria 1644
309 Ga0105249_10942128 3300009553 Bacteria 931
310 Ga0105249_10969848 3300009553 Bacteria 918
311 Ga0099796_10114967 3300010159 Bacteria 1028
312 Ga0105239_10050469 3300010375 Bacteria 4563
313 Ga0105239_11348957 3300010375 Bacteria 823
314 Ga0105246_10002809 3300011119 Bacteria 10542
315 Ga0105246_10268373 3300011119 Bacteria 1363
316 Ga0105246_10271338 3300011119 Bacteria 1356
317 Ga0105246_10327917 3300011119 Bacteria 1247
318 Ga0157373_10005741 3300013100 Bacteria 9295
319 Ga0157373_10211073 3300013100 Bacteria 1369
320 Ga0157373_10622710 3300013100 Bacteria 787
321 Ga0157371_10000847 3300013102 Bacteria 34925
322 Ga0157371_10069396 3300013102 Bacteria 2496
323 Ga0157370_10000897 3300013104 Bacteria 37754
324 Ga0157370_10278373 3300013104 Bacteria 1546
325 Ga0157370_10537202 3300013104 Bacteria 1072
326 Ga0157369_10005204 3300013105 Bacteria 15201
327 Ga0157374_10011913 3300013296 Bacteria 7547
328 Ga0157374_10115202 3300013296 Bacteria 2589
329 Ga0157374_10361456 3300013296 Bacteria 1444
330 Ga0157374_11112997 3300013296 Bacteria 810
331 Ga0157378_10032994 3300013297 Bacteria 4576
332 Ga0157378_10037612 3300013297 Bacteria 4288
333 Ga0157378_10072564 3300013297 Bacteria 3093
334 Ga0157378_10096220 3300013297 Bacteria 2698
335 Ga0157378_10110233 3300013297 Bacteria 2522
336 Ga0157378_10135288 3300013297 Bacteria 2284
337 Ga0157378_10347197 3300013297 Bacteria 1449
338 Ga0157378_10895426 3300013297 Bacteria 918
339 Ga0163162_10022654 3300013306 Bacteria 6193
340 Ga0163162_10057886 3300013306 Bacteria 3903
341 Ga0163162_10090809 3300013306 Bacteria 3136
342 Ga0163162_10309798 3300013306 Bacteria 1711
343 Ga0163162_11237993 3300013306 Bacteria 847
344 Ga0157372_10004693 3300013307 Bacteria 14512
345 Ga0157375_10004866 3300013308 Bacteria 11670
346 Ga0157375_10008115 3300013308 Bacteria 9188
347 Ga0157375_10051985 3300013308 Bacteria 4026
348 Ga0157375_10061324 3300013308 Bacteria 3734
349 Ga0157375_10137739 3300013308 Bacteria 2566
350 Ga0157375_10148350 3300013308 Bacteria 2478
351 Ga0157375_10256642 3300013308 Bacteria 1910
352 Ga0163163_10000446 3300014325 Bacteria 37797
353 Ga0163163_10055176 3300014325 Bacteria 3927
354 Ga0163163_10096297 3300014325 Bacteria 2979
355 Ga0163163_10131576 3300014325 Bacteria 2542
356 Ga0163163_10204195 3300014325 Bacteria 2024
357 Ga0163163_10245365 3300014325 Bacteria 1841
358 Ga0163163_10425161 3300014325 Bacteria 1387
359 Ga0157380_10145568 3300014326 Bacteria 2042
360 Ga0157380_10217623 3300014326 Bacteria 1707
361 Ga0157380_10250345 3300014326 Bacteria 1603
362 Ga0157380_10473177 3300014326 Bacteria 1210
363 Ga0157380_10502709 3300014326 Bacteria 1178
364 Ga0157380_10564165 3300014326 Bacteria 1119
365 Ga0157380_10768303 3300014326 Bacteria 977
366 Ga0157379_10000562 3300014968 Bacteria 29935
367 Ga0157379_10100279 3300014968 Bacteria 2599
368 Ga0157376_10000014 3300014969 Bacteria 303001
369 Ga0157376_10036580 3300014969 Bacteria 3978
370 Ga0157376_10057875 3300014969 Bacteria 3244
371 Ga0157376_10060869 3300014969 Bacteria 3172
372 Ga0157376_10074456 3300014969 Bacteria 2894
373 Ga0157376_10085537 3300014969 Bacteria 2717
374 Ga0157376_10151767 3300014969 Bacteria 2090
375 Ga0157376_10159200 3300014969 Bacteria 2045
376 Ga0157376_10206815 3300014969 Unclassified 1809
377 Ga0157376_10229726 3300014969 Bacteria 1723
378 Ga0157376_10288977 3300014969 Bacteria 1547
379 Ga0157376_11188262 3300014969 Bacteria 791
380 Ga0163161_10030399 3300017792 Bacteria 3844
381 Ga0163161_10506165 3300017792 Unclassified 984
382 Ga0184599_122998 3300019188 Bacteria 1539
383 Ga0206349_1555407 3300020075 Bacteria 1637
384 Ga0206351_10760636 3300020077 Bacteria 2109
385 Ga0206352_10266958 3300020078 Bacteria 2156
386 Ga0206354_10096804 3300020081 Bacteria 2168
387 Ga0213876_10025237 3300021384 Bacteria 3137
388 Ga0213876_10027791 3300021384 Bacteria 2983
389 Ga0213876_10115472 3300021384 Bacteria 1425
390 Ga0213875_10007729 3300021388 Bacteria 5532
391 Ga0224712_10002961 3300022467 Bacteria 4308
392 Ga0224712_10026872 3300022467 Bacteria 2040
393 Ga0228598_1011982 3300024227 Bacteria 1724
394 Ga0207697_10017447 3300025315 Bacteria 2950
395 Ga0207697_10047774 3300025315 Bacteria 1765
396 Ga0207697_10124793 3300025315 Bacteria 1110
397 Ga0207656_10133099 3300025321 Bacteria 1166
398 Ga0207713_1001799 3300025735 Bacteria 16387
399 Ga0207653_10000517 3300025885 Bacteria 14726
400 Ga0207680_10000784 3300025903 Bacteria 15032
401 Ga0207699_10008729 3300025906 Bacteria 5014
402 Ga0207699_10023466 3300025906 Bacteria 3357
403 Ga0207645_10236826 3300025907 Bacteria 1206
404 Ga0207643_10161510 3300025908 Bacteria 1348
405 Ga0207643_10259611 3300025908 Bacteria 1072
406 Ga0207705_10052692 3300025909 Bacteria 2930
407 Ga0207705_10086103 3300025909 Bacteria 2296
408 Ga0207705_10207334 3300025909 Bacteria 1486
409 Ga0207684_10133583 3300025910 Bacteria 2130
410 Ga0207684_10571806 3300025910 Bacteria 966
411 Ga0207654_10047172 3300025911 Bacteria 2460
412 Ga0207707_10016149 3300025912 Bacteria 6513
413 Ga0207707_10028950 3300025912 Bacteria 4841
414 Ga0207707_10075784 3300025912 Bacteria 2936
415 Ga0207695_10140453 3300025913 Bacteria 2364
416 Ga0207693_10010686 3300025915 Bacteria 7450
417 Ga0207693_10030426 3300025915 Bacteria 4264
418 Ga0207693_10137685 3300025915 Bacteria 1920
419 Ga0207693_10146737 3300025915 Bacteria 1855
420 Ga0207663_10004574 3300025916 Bacteria 6896
421 Ga0207660_10009046 3300025917 Bacteria 6449
422 Ga0207660_10018722 3300025917 Bacteria 4621
423 Ga0207660_10027520 3300025917 Bacteria 3881
424 Ga0207660_10130856 3300025917 Bacteria 1910
425 Ga0207660_10211390 3300025917 Bacteria 1519
426 Ga0207660_10623446 3300025917 Bacteria 879
427 Ga0207662_10013063 3300025918 Bacteria 4639
428 Ga0207662_10133008 3300025918 Bacteria 1570
429 Ga0207662_10162624 3300025918 Bacteria 1427
430 Ga0207657_10000083 3300025919 Bacteria 89409
431 Ga0207657_10014470 3300025919 Bacteria 7702
432 Ga0207657_10447531 3300025919 Bacteria 1014
433 Ga0207649_10001847 3300025920 Bacteria 12102
434 Ga0207649_10028375 3300025920 Bacteria 3294
435 Ga0207649_10065156 3300025920 Bacteria 2305
436 Ga0207652_10012202 3300025921 Bacteria 6943
437 Ga0207652_10025964 3300025921 Bacteria 4874
438 Ga0207652_10033139 3300025921 Bacteria 4348
439 Ga0207652_10059080 3300025921 Bacteria 3305
440 Ga0207646_10001680 3300025922 Bacteria 26958
441 Ga0207646_10017051 3300025922 Bacteria 6807
442 Ga0207646_10092622 3300025922 Bacteria 2705
443 Ga0207646_10097917 3300025922 Bacteria 2628
444 Ga0207646_10100701 3300025922 Bacteria 2590
445 Ga0207646_10159720 3300025922 Bacteria 2033
446 Ga0207646_10370025 3300025922 Bacteria 1295
447 Ga0207681_10003272 3300025923 Bacteria 10141
448 Ga0207681_10036207 3300025923 Bacteria 3255
449 Ga0207681_10050520 3300025923 Bacteria 2814
450 Ga0207681_10326746 3300025923 Bacteria 1221
451 Ga0207650_10002276 3300025925 Bacteria 13394
452 Ga0207650_10038113 3300025925 Bacteria 3507
453 Ga0207650_10108714 3300025925 Bacteria 2144
454 Ga0207650_10163969 3300025925 Bacteria 1762
455 Ga0207650_10287093 3300025925 Bacteria 1341
456 Ga0207659_10000169 3300025926 Bacteria 39159
457 Ga0207659_10000843 3300025926 Bacteria 18152
458 Ga0207659_10002914 3300025926 Bacteria 10190
459 Ga0207659_10056582 3300025926 Bacteria 2810
460 Ga0207659_10253138 3300025926 Bacteria 1430
461 Ga0207659_10304650 3300025926 Bacteria 1310
462 Ga0207659_10593370 3300025926 Bacteria 944
463 Ga0207700_10040381 3300025928 Bacteria 3405
464 Ga0207700_10263954 3300025928 Bacteria 1475
465 Ga0207644_10001196 3300025931 Bacteria 16709
466 Ga0207644_10006842 3300025931 Bacteria 7430
467 Ga0207644_10026639 3300025931 Bacteria 3986
468 Ga0207644_10097083 3300025931 Bacteria 2207
469 Ga0207644_10167225 3300025931 Bacteria 1714
470 Ga0207690_10000356 3300025932 Bacteria 30378
471 Ga0207690_10025822 3300025932 Bacteria 3693
472 Ga0207706_10005054 3300025933 Bacteria 12317
473 Ga0207706_10010712 3300025933 Bacteria 8374
474 Ga0207706_10253038 3300025933 Bacteria 1538
475 Ga0207686_10000496 3300025934 Bacteria 25802
476 Ga0207709_10001154 3300025935 Bacteria 19226
477 Ga0207709_10147840 3300025935 Bacteria 1623
478 Ga0207709_10157949 3300025935 Bacteria 1578
479 Ga0207709_10239338 3300025935 Bacteria 1319
480 Ga0207709_10653526 3300025935 Bacteria 837
481 Ga0207670_10007709 3300025936 Bacteria 6033
482 Ga0207670_10071199 3300025936 Bacteria 2404
483 Ga0207670_10165066 3300025936 Bacteria 1656
484 Ga0207670_10202826 3300025936 Bacteria 1508
485 Ga0207670_10295411 3300025936 Bacteria 1267
486 Ga0207669_10337532 3300025937 Bacteria 1159
487 Ga0207704_10003207 3300025938 Bacteria 7407
488 Ga0207704_10023061 3300025938 Bacteria 3347
489 Ga0207704_10084243 3300025938 Bacteria 2066
490 Ga0207704_10097938 3300025938 Bacteria 1947
491 Ga0207704_10245352 3300025938 Bacteria 1341
492 Ga0207665_10016663 3300025939 Bacteria 4826
493 Ga0207665_10041443 3300025939 Bacteria 3075
494 Ga0207691_10023258 3300025940 Bacteria 5834
495 Ga0207691_10059354 3300025940 Bacteria 3479
496 Ga0207691_10121064 3300025940 Bacteria 2319
497 Ga0207711_10002561 3300025941 Bacteria 16200
498 Ga0207711_10002690 3300025941 Bacteria 15714
499 Ga0207711_10016136 3300025941 Bacteria 6200
500 Ga0207711_10070683 3300025941 Bacteria 3027
501 Ga0207711_10136373 3300025941 Bacteria 2205
502 Ga0207689_10052132 3300025942 Bacteria 3372
503 Ga0207689_10095467 3300025942 Bacteria 2442
504 Ga0207689_10097667 3300025942 Bacteria 2413
505 Ga0207661_10071811 3300025944 Bacteria 2830
506 Ga0207679_10002743 3300025945 Bacteria 10895
507 Ga0207679_10003915 3300025945 Bacteria 9241
508 Ga0207679_10191930 3300025945 Bacteria 1699
509 Ga0207679_10303118 3300025945 Bacteria 1378
510 Ga0207679_10439920 3300025945 Bacteria 1154
511 Ga0207679_10443729 3300025945 Bacteria 1150
512 Ga0207667_10004004 3300025949 Bacteria 18100
513 Ga0207667_10004990 3300025949 Bacteria 16214
514 Ga0207651_10039011 3300025960 Bacteria 3127
515 Ga0207651_10041980 3300025960 Bacteria 3040
516 Ga0207651_10145313 3300025960 Bacteria 1838
517 Ga0207651_10227752 3300025960 Bacteria 1511
518 Ga0207651_10469648 3300025960 Bacteria 1082
519 Ga0207712_10156408 3300025961 Bacteria 1766
520 Ga0207712_10626211 3300025961 Bacteria 933
521 Ga0207668_10049299 3300025972 Bacteria 2894
522 Ga0207668_10129579 3300025972 Bacteria 1924
523 Ga0207640_10003576 3300025981 Bacteria 8379
524 Ga0207640_10004793 3300025981 Bacteria 7348
525 Ga0207658_10005136 3300025986 Bacteria 9017
526 Ga0207658_10014653 3300025986 Bacteria 5370
527 Ga0207658_10030281 3300025986 Bacteria 3830
528 Ga0207677_10010265 3300026023 Bacteria 5295
529 Ga0207677_10043856 3300026023 Bacteria 2976
530 Ga0207677_10274519 3300026023 Bacteria 1381
531 Ga0207703_10005252 3300026035 Bacteria 10445
532 Ga0207703_10006761 3300026035 Bacteria 9146
533 Ga0207703_10255747 3300026035 Bacteria 1581
534 Ga0207703_10314334 3300026035 Bacteria 1432
535 Ga0207639_10000175 3300026041 Bacteria 50016
536 Ga0207678_10009536 3300026067 Bacteria 8540
537 Ga0207708_10052924 3300026075 Bacteria 3092
538 Ga0207708_10132098 3300026075 Bacteria 1953
539 Ga0207708_10184539 3300026075 Bacteria 1657
540 Ga0207708_10480439 3300026075 Bacteria 1039
541 Ga0207702_10560982 3300026078 Bacteria 1118
542 Ga0207641_10000293 3300026088 Bacteria 62674
543 Ga0207641_10006158 3300026088 Bacteria 10152
544 Ga0207641_10036534 3300026088 Bacteria 4101
545 Ga0207641_10115321 3300026088 Bacteria 2388
546 Ga0207641_10123947 3300026088 Bacteria 2310
547 Ga0207641_10198459 3300026088 Bacteria 1848
548 Ga0207641_10206307 3300026088 Bacteria 1815
549 Ga0207641_10361827 3300026088 Bacteria 1385
550 Ga0207648_10135911 3300026089 Bacteria 2166
551 Ga0207648_10301506 3300026089 Bacteria 1437
552 Ga0207676_10003247 3300026095 Bacteria 11575
553 Ga0207676_10008606 3300026095 Bacteria 7251
554 Ga0207676_10072948 3300026095 Bacteria 2761
555 Ga0207676_10292740 3300026095 Bacteria 1483
556 Ga0207674_10013628 3300026116 Bacteria 9005
557 Ga0207674_10041311 3300026116 Bacteria 4770
558 Ga0207674_10082680 3300026116 Bacteria 3212
559 Ga0207674_10083057 3300026116 Bacteria 3203
560 Ga0207674_10217764 3300026116 Bacteria 1858
561 Ga0207674_10381506 3300026116 Bacteria 1363
562 Ga0207675_100106120 3300026118 Bacteria 2648
563 Ga0207675_100125229 3300026118 Bacteria 2434
564 Ga0207675_100251201 3300026118 Bacteria 1712
565 Ga0207675_100418708 3300026118 Bacteria 1322
566 Ga0207683_10041648 3300026121 Bacteria 4011
567 Ga0207683_10060510 3300026121 Bacteria 3329
568 Ga0207683_10079749 3300026121 Bacteria 2903
569 Ga0207683_10112116 3300026121 Bacteria 2443
570 Ga0207698_10342520 3300026142 Bacteria 1409
571 Ga0207698_10899905 3300026142 Bacteria 892
572 Ga0209281_1018955 3300027111 Bacteria 1366
573 Ga0209983_1043383 3300027665 Bacteria 976
574 Ga0209588_1023526 3300027671 Bacteria 1942
575 Ga0209588_1023623 3300027671 Bacteria 1939
576 Ga0209588_1069668 3300027671 Bacteria 1136
577 Ga0209588_1077578 3300027671 Bacteria 1074
578 Ga0209971_1008691 3300027682 Bacteria 2409
579 Ga0209998_10009176 3300027717 Bacteria 2051
580 Ga0209998_10072430 3300027717 Bacteria 825
581 Ga0209813_10000030 3300027866 Bacteria 65385
582 Ga0209974_10123585 3300027876 Bacteria 919
583 Ga0207428_10029211 3300027907 Bacteria 4573
584 Ga0207428_10031565 3300027907 Bacteria 4367
585 Ga0207428_10047561 3300027907 Bacteria 3444
586 Ga0207428_10047950 3300027907 Bacteria 3429
587 Ga0207428_10059423 3300027907 Bacteria 3032
588 Ga0207428_10115063 3300027907 Bacteria 2066
589 Ga0207428_10141228 3300027907 Bacteria 1838
590 Ga0207428_10232879 3300027907 Bacteria 1378
591 Ga0268266_10000072 3300028379 Bacteria 232245
592 Ga0268266_10000334 3300028379 Bacteria 73724
593 Ga0268266_10048996 3300028379 Bacteria 3621
594 Ga0268266_10055880 3300028379 Bacteria 3394
595 Ga0268266_10452167 3300028379 Bacteria 1221
596 Ga0268265_10433870 3300028380 Bacteria 1223
597 Ga0268265_10915173 3300028380 Bacteria 862
598 Ga0268264_10019574 3300028381 Bacteria 5529
599 Ga0268264_10116808 3300028381 Bacteria 2346
600 Ga0268264_10294590 3300028381 Bacteria 1525
601 Ga0268264_10301783 3300028381 Bacteria 1508
602 Ga0265318_10000165 3300028577 Bacteria 58672
603 Ga0265318_10002420 3300028577 Bacteria 9984
604 Ga0265323_10022789 3300028653 Bacteria 2392
605 Ga0265323_10093870 3300028653 Bacteria 999
606 Ga0265336_10044859 3300028666 Bacteria 1345
607 Ga0265338_10021503 3300028800 Bacteria 6724
608 Ga0265338_10033841 3300028800 Bacteria 4952
609 Ga0265324_10039063 3300029957 Bacteria 1646
610 Ga0265760_10036476 3300031090 Bacteria 1458
611 Ga0265330_10001250 3300031235 Bacteria 14886
612 Ga0265330_10036666 3300031235 Bacteria 2185
613 Ga0265332_10001069 3300031238 Bacteria 16016
614 Ga0265332_10004047 3300031238 Bacteria 6968
615 Ga0265328_10020981 3300031239 Bacteria 2497
616 Ga0265320_10000099 3300031240 Bacteria 73908
617 Ga0265320_10002218 3300031240 Bacteria 13639
618 Ga0265320_10063433 3300031240 Bacteria 1757
619 Ga0265325_10006073 3300031241 Bacteria 7390
620 Ga0265325_10016063 3300031241 Bacteria 4189
621 Ga0265325_10045537 3300031241 Bacteria 2279
622 Ga0265329_10000665 3300031242 Bacteria 17640
623 Ga0265329_10009674 3300031242 Bacteria 3581
624 Ga0265329_10030961 3300031242 Bacteria 1741
625 Ga0265340_10007939 3300031247 Bacteria 5754
626 Ga0265340_10017706 3300031247 Bacteria 3686
627 Ga0265339_10000649 3300031249 Bacteria 26897
628 Ga0265339_10001807 3300031249 Bacteria 15694
629 Ga0265339_10036620 3300031249 Bacteria 2745
630 Ga0265339_10071013 3300031249 Bacteria 1855
631 Ga0265331_10000196 3300031250 Bacteria 73914
632 Ga0265331_10008193 3300031250 Bacteria 5959
633 Ga0265331_10015188 3300031250 Bacteria 4074
634 Ga0265316_10001327 3300031344 Bacteria 26637
635 Ga0265316_10001597 3300031344 Bacteria 24155
636 Ga0265316_10003381 3300031344 Bacteria 16167
637 Ga0265316_10003941 3300031344 Bacteria 14873
638 Ga0265316_10029196 3300031344 Bacteria 4538
639 Ga0265316_10034724 3300031344 Bacteria 4094
640 Ga0265316_10048066 3300031344 Bacteria 3371
641 Ga0265316_10140851 3300031344 Bacteria 1812
642 Ga0265316_10177972 3300031344 Bacteria 1584
643 Ga0307408_100020865 3300031548 Bacteria 4426
644 Ga0307408_100298797 3300031548 Bacteria 1348
645 Ga0265313_10000953 3300031595 Bacteria 28730
646 Ga0265313_10002411 3300031595 Bacteria 16176
647 Ga0265313_10040192 3300031595 Bacteria 2314
648 Ga0265313_10076134 3300031595 Bacteria 1534
649 Ga0316575_10000098 3300031665 Bacteria 21261
650 Ga0316575_10112139 3300031665 Bacteria 1113
651 Ga0316579_10019813 3300031691 Bacteria 2977
652 Ga0316579_10086583 3300031691 Bacteria 1495
653 Ga0316579_10093522 3300031691 Bacteria 1436
654 Ga0265314_10000003 3300031711 Bacteria 1653386
655 Ga0265314_10000071 3300031711 Bacteria 152845
656 Ga0265314_10004438 3300031711 Bacteria 13024
657 Ga0265314_10031172 3300031711 Bacteria 3940
658 Ga0265314_10063500 3300031711 Bacteria 2505
659 Ga0265342_10000679 3300031712 Bacteria 35568
660 Ga0265342_10002488 3300031712 Bacteria 15862
661 Ga0316576_10000548 3300031727 Bacteria 17648
662 Ga0316576_10002466 3300031727 Bacteria 10527
663 Ga0316576_10009928 3300031727 Bacteria 6162
664 Ga0316576_10030207 3300031727 Bacteria 3835
665 Ga0316576_10169945 3300031727 Bacteria 1645
666 Ga0316576_10364365 3300031727 Bacteria 1074
667 Ga0316576_10381837 3300031727 Bacteria 1046
668 Ga0307405_10050168 3300031731 Bacteria 2583
669 Ga0316577_10015566 3300031733 Bacteria 4185
670 Ga0316577_10136248 3300031733 Bacteria 1382
671 Ga0316577_10185104 3300031733 Bacteria 1177
672 Ga0316577_10232584 3300031733 Bacteria 1042
673 Ga0307413_10121092 3300031824 Bacteria 1773
674 Ga0307413_10188987 3300031824 Bacteria 1477
675 Ga0307413_10265855 3300031824 Bacteria 1281
676 Ga0307410_10167213 3300031852 Bacteria 1653
677 Ga0307406_10015119 3300031901 Bacteria 4459
678 Ga0307406_10047965 3300031901 Bacteria 2695
679 Ga0307406_10059420 3300031901 Bacteria 2461
680 Ga0307407_10013301 3300031903 Bacteria 3989
681 Ga0307412_10010507 3300031911 Bacteria 5334
682 Ga0307412_10130228 3300031911 Bacteria 1826
683 Ga0307412_10280242 3300031911 Bacteria 1308
684 Ga0307412_10635686 3300031911 Bacteria 908
685 Ga0307409_100218540 3300031995 Bacteria 1719
686 Ga0307409_100433549 3300031995 Bacteria 1264
687 Ga0307409_100751137 3300031995 Bacteria 979
688 Ga0307416_100061839 3300032002 Bacteria 3058
689 Ga0307416_100909823 3300032002 Bacteria 980
690 Ga0307414_10201046 3300032004 Bacteria 1621
691 Ga0307411_10168166 3300032005 Bacteria 1650
692 Ga0307415_100355852 3300032126 Bacteria 1234
693 Ga0316593_10007662 3300032168 Bacteria 2972
694 Ga0316593_10024652 3300032168 Bacteria 1909
695 Ga0316593_10043261 3300032168 Bacteria 1504
696 Ga0316593_10056979 3300032168 Bacteria 1330
697 Ga0316592_1002050 3300033524 Bacteria 3414
698 Ga0316592_1003442 3300033524 Bacteria 2850
699 Ga0316592_1008760 3300033524 Bacteria 2009
700 Ga0316592_1038779 3300033524 Bacteria 1051
701 Ga0316588_1000219 3300033528 Bacteria 6805
702 Ga0316588_1002297 3300033528 Bacteria 3319
703 Ga0316588_1002933 3300033528 Bacteria 3039
704 Ga0316588_1006171 3300033528 Bacteria 2381
705 Ga0316588_1018566 3300033528 Bacteria 1559
706 Ga0316587_1000001 3300033529 Bacteria 17933
707 Ga0316596_1000985 3300033541 Bacteria 5469
708 Ga0316596_1006947 3300033541 Bacteria 2655
709 Ga0373926_0000781 3300035083 Bacteria 8934
710 Ga0373926_0132103 3300035083 Bacteria 946
711 Ga0373928_0069145 3300035084 Bacteria 869
712 Ga0373944_0010372 3300035089 Bacteria 2539
713 Ga0373944_0154259 3300035089 Bacteria 811
714 Ga0373923_0002039 3300035111 Bacteria 6090
715 Ga0373936_0193741 3300035113 Bacteria 895
716 Ga0373945_0053899 3300035116 Bacteria 1486
717 Ga0373954_0034762 3300035118 Bacteria 2335
718 Ga0373954_0133995 3300035118 Bacteria 1207
719 Ga0373956_0057189 3300035119 Bacteria 1762
720 Ga0373957_0128152 3300035120 Bacteria 1031
721 Ga0373943_0228552 3300035170 Bacteria 1039
722 Ga0373946_0151205 3300035171 Bacteria 1083
723 Ga0373946_0231329 3300035171 Bacteria 896
724 Ga0373955_0063537 3300035172 Bacteria 2044
725 Ga0373955_0073240 3300035172 Bacteria 1920
726 Ga0373961_0000446 3300035241 Bacteria 16728
727 Ga0316574_0009330 3300035398 Bacteria 5493
728 Ga0316574_0106711 3300035398 Bacteria 1794
729 Ga0373924_0044014 3300035410 Bacteria 1834
730 Ga0373931_0027382 3300035691 Bacteria 2910
731 Ga0373931_0106752 3300035691 Bacteria 1583
732 Ga0373931_0147691 3300035691 Bacteria 1368
733 Ga0373935_0027204 3300035692 Bacteria 3535
734 Ga0373935_0126145 3300035692 Bacteria 1715
735 Ga0373927_0005384 3300035695 Bacteria 8840
736 Ga0373933_0014827 3300035724 Bacteria 4337
737 Ga0373933_0381401 3300035724 Bacteria 918
738 Ga0373947_0010227 3300035725 Bacteria 5386
739 Ga0373937_0000078 3300036401 Bacteria 88688
740 Ga0373937_0021252 3300036401 Bacteria 5824
741 Ga0373937_0025354 3300036401 Bacteria 5353
742 Ga0373937_0031983 3300036401 Bacteria 4770
743 Ga0373937_0107774 3300036401 Bacteria 2590
744 Ga0373937_0238723 3300036401 Bacteria 1712
745 Ga0373937_0387063 3300036401 Bacteria 1326
746 Ga0373937_0691184 3300036401 Bacteria 966
747 Ga0265778_007972 3300036457 Bacteria 1171
748 Ga0316582_0058537 3300036647 Bacteria 2464
749 Ga0316582_0121182 3300036647 Bacteria 1750
750 Ga0316582_0218990 3300036647 Bacteria 1301
751 Ga0316582_0399222 3300036647 Bacteria 947
752 Ga0316584_0009978 3300036712 Bacteria 6616
753 Ga0316584_0025357 3300036712 Bacteria 4347
754 Ga0316584_0182353 3300036712 Bacteria 1554
755 Ga0316584_0220563 3300036712 Bacteria 1393
756 Ga0316584_0245852 3300036712 Bacteria 1308
757 Ga0316584_0791205 3300036712 Bacteria 645
758 Ga0373925_0165163 3300037068 Bacteria 1745
759 Ga0395899_0232654 3300037312 Bacteria 1272
760 Ga0395900_0479417 3300037418 Bacteria 1197
761 Ga0316581_0054063 3300037588 Bacteria 1231
762 Ga0436364_1196741 3300037853 Bacteria 11745
763 Ga0436364_1430661 3300037853 Bacteria 3099
764 Ga0400489_80694 3300039093 Bacteria 3149
765 Ga0400487_59508 3300039110 Bacteria 2380
766 Ga0436365_0831894 3300039437 Bacteria 2398
767 Ga0436365_0896462 3300039437 Bacteria 3816
768 Ga0436365_1742949 3300039437 Bacteria 4244
769 Ga0436365_1846658 3300039437 Bacteria 1008
770 Ga0436360_0655945 3300039438 Bacteria 3833
771 Ga0436361_1007716 3300039447 Bacteria 1557
772 Ga0439465_0001490 3300041413 Bacteria 7594
773 Ga0451807_0548069 3300041486 Bacteria 840
774 Ga0451849_1494037 3300041505 Bacteria 3718
775 Ga0451853_2126451 3300041512 Bacteria 4530
776 Ga0439443_007826 3300042003 Bacteria 1495
777 Ga0439445_0030206 3300042004 Bacteria 1403
778 Ga0439445_0053427 3300042004 Bacteria 1094
779 Ga0439456_058212 3300042013 Bacteria 848
780 Ga0439462_0004174 3300042015 Bacteria 3514
781 Ga0450923_010186 3300042125 Bacteria 1661
782 Ga0450918_005831 3300042531 Bacteria 2205
783 Ga0450918_019040 3300042531 Bacteria 1198
784 Ga0451577_0000139 3300042876 Bacteria 161883
785 Ga0451577_0332671 3300042876 Bacteria 1378
786 Ga0453683_0000392 3300044673 Bacteria 52154
787 Ga0453683_0068937 3300044673 Bacteria 2211
788 Ga0453684_0003616 3300044712 Bacteria 34458
789 Ga0453684_0010619 3300044712 Bacteria 15695
790 Ga0453684_0011627 3300044712 Bacteria 14698
791 Ga0453684_0020399 3300044712 Bacteria 9997
792 Ga0453684_0178052 3300044712 Bacteria 2499
793 Ga0453684_0251157 3300044712 Bacteria 2031
794 Ga0466968_0104281 3300044735 Bacteria 1269
795 Ga0451576_0026183 3300045051 Bacteria 6275
796 Ga0451576_0029400 3300045051 Bacteria 5881
797 Ga0451576_0392249 3300045051 Bacteria 1455
798 Ga0466967_0003862 3300045976 Bacteria 9928
799 Ga0495592_0005038 3300046454 Bacteria 9719
800 Ga0495592_0052007 3300046454 Bacteria 3042
801 Ga0495592_0054997 3300046454 Bacteria 2946
802 Ga0495592_0203556 3300046454 Bacteria 1334
803 Ga0495603_0058776 3300046455 Bacteria 2273
804 Ga0495603_0072551 3300046455 Bacteria 2022
805 Ga0495629_0007511 3300046459 Bacteria 8036
806 Ga0495629_0513808 3300046459 Bacteria 807
807 Ga0495638_0024402 3300046460 Bacteria 3943
808 Ga0495638_0157345 3300046460 Bacteria 1313
809 Ga0495641_0095648 3300046461 Bacteria 1326
810 Ga0495651_0000335 3300046462 Bacteria 36339
811 Ga0495651_0003305 3300046462 Bacteria 12380
812 Ga0495651_0006885 3300046462 Bacteria 8686
813 Ga0495651_0085033 3300046462 Bacteria 2383
814 Ga0495651_0228857 3300046462 Bacteria 1282
815 Ga0495653_0008639 3300046463 Bacteria 8351
816 Ga0495653_0151654 3300046463 Bacteria 1619
817 Ga0495580_0002835 3300046472 Bacteria 14909
818 Ga0495580_0028841 3300046472 Bacteria 4032
819 Ga0495580_0046881 3300046472 Bacteria 3065
820 Ga0495580_0086482 3300046472 Bacteria 2183
821 Ga0495580_0136192 3300046472 Bacteria 1702
822 Ga0495580_0530334 3300046472 Bacteria 784
823 Ga0495582_0000227 3300046473 Bacteria 31128
824 Ga0495582_0001649 3300046473 Bacteria 12583
825 Ga0495582_0181963 3300046473 Bacteria 1198
826 Ga0495639_0003836 3300046475 Bacteria 6454
827 Ga0495639_0225422 3300046475 Bacteria 922
828 Ga0495662_0050628 3300046476 Bacteria 2005
829 Ga0495664_0246106 3300046477 Bacteria 1081
830 Ga0495664_0440270 3300046477 Bacteria 781
831 Ga0495664_0503502 3300046477 Bacteria 723
832 Ga0495594_0139940 3300046499 Bacteria 1372
833 Ga0495608_0006109 3300046511 Bacteria 8543
834 Ga0495608_0016359 3300046511 Bacteria 5132
835 Ga0495608_0054588 3300046511 Bacteria 2641
836 Ga0495608_0142185 3300046511 Bacteria 1531
837 Ga0495618_0046504 3300046514 Bacteria 2739
838 Ga0495618_0083189 3300046514 Bacteria 2045
839 Ga0495628_0030708 3300046516 Bacteria 4349
840 Ga0495628_0048496 3300046516 Bacteria 3366
841 Ga0495628_0078943 3300046516 Bacteria 2559
842 Ga0495628_0197503 3300046516 Bacteria 1517
843 Ga0495630_0008656 3300046517 Bacteria 7304
844 Ga0495630_0090329 3300046517 Bacteria 2314
845 Ga0495630_0117603 3300046517 Bacteria 2015
846 Ga0495630_0269913 3300046517 Bacteria 1300
847 Ga0495630_0300077 3300046517 Bacteria 1227
848 Ga0495643_0015955 3300046522 Bacteria 4423
849 Ga0495666_0005964 3300046526 Bacteria 6143
850 Ga0495652_0013927 3300046529 Bacteria 7230
851 Ga0495652_0020061 3300046529 Bacteria 5945
852 Ga0495665_0001996 3300046531 Bacteria 11035
853 Ga0495665_0054933 3300046531 Bacteria 2104
854 Ga0495640_0095321 3300046533 Bacteria 1959
855 Ga0495640_0145489 3300046533 Bacteria 1525
856 Ga0495640_0271873 3300046533 Bacteria 1057
857 Ga0495586_0002069 3300046535 Bacteria 10898
858 Ga0495586_0030459 3300046535 Bacteria 2887
859 Ga0495586_0116737 3300046535 Bacteria 1489
860 Ga0495586_0142015 3300046535 Bacteria 1348
861 Ga0495587_0002155 3300046536 Bacteria 13171
862 Ga0495587_0044560 3300046536 Bacteria 2638
863 Ga0495621_0007223 3300046539 Bacteria 3281
864 Ga0495645_0019971 3300046543 Bacteria 4830
865 Ga0495645_0056273 3300046543 Bacteria 2856
866 Ga0495645_0162961 3300046543 Bacteria 1540
867 Ga0495645_0291381 3300046543 Bacteria 1070
868 Ga0495645_0429474 3300046543 Bacteria 837
869 Ga0495667_0002241 3300046559 Bacteria 12927
870 Ga0495667_0030860 3300046559 Bacteria 3600
871 Ga0495634_0018345 3300046642 Bacteria 4983
872 Ga0495635_0004284 3300046663 Bacteria 9876
873 Ga0495635_0132528 3300046663 Bacteria 1699
874 Ga0495635_0339231 3300046663 Bacteria 1004
875 Ga0495657_0003416 3300046675 Bacteria 12960
876 Ga0495657_0057267 3300046675 Bacteria 2592
877 Ga0495599_0114149 3300046678 Bacteria 1681
878 Ga0495599_0229996 3300046678 Bacteria 1132
879 Ga0495623_0012203 3300046679 Bacteria 5566
880 Ga0495646_0000703 3300046680 Bacteria 18504
881 Ga0495647_0005580 3300046681 Bacteria 4130
882 Ga0495658_0043580 3300046683 Bacteria 2510
883 Ga0495658_0082856 3300046683 Bacteria 1885
884 Ga0495658_0196338 3300046683 Bacteria 1256
885 Ga0495658_0222527 3300046683 Bacteria 1182
886 Ga0495613_0010783 3300046689 Bacteria 6780
887 Ga0495613_0045662 3300046689 Bacteria 3239
888 Ga0495613_0250488 3300046689 Bacteria 1236
889 Ga0495613_0500232 3300046689 Bacteria 818
890 Ga0495600_0012011 3300046809 Bacteria 5408
891 Ga0495600_0086143 3300046809 Bacteria 2050
892 Ga0495600_0281774 3300046809 Bacteria 1052
893 Ga0495581_0001452 3300047315 Bacteria 13170
894 Ga0495604_0098928 3300047317 Bacteria 2147
895 Ga0495604_0219352 3300047317 Bacteria 1310
896 Ga0495636_0001365 3300047318 Bacteria 9237
897 Ga0495636_0107688 3300047318 Bacteria 1224
898 Ga0495674_0037039 3300047319 Bacteria 4385
899 Ga0495674_0088681 3300047319 Bacteria 2645
900 Ga0495674_0121225 3300047319 Bacteria 2209
901 Ga0495674_0322663 3300047319 Bacteria 1258
902 Ga0495676_0024812 3300047321 Bacteria 5182
903 Ga0495676_0098517 3300047321 Bacteria 2169
904 Ga0495676_0352916 3300047321 Bacteria 983
905 Ga0495680_0000106 3300047322 Bacteria 77255
906 Ga0495680_0006887 3300047322 Bacteria 10492
907 Ga0495680_0029632 3300047322 Bacteria 4480
908 Ga0495680_0120388 3300047322 Bacteria 1938
909 Ga0495680_0204960 3300047322 Bacteria 1414
910 Ga0495675_0000643 3300047444 Bacteria 22174
911 Ga0495675_0002269 3300047444 Bacteria 11479
912 Ga0495675_0079541 3300047444 Bacteria 2065
913 Ga0495675_0099183 3300047444 Bacteria 1824
914 Ga0495684_0000488 3300047471 Bacteria 32453
915 Ga0495684_0007566 3300047471 Bacteria 8405
916 Ga0495684_0064208 3300047471 Bacteria 2790
917 Ga0495684_0222806 3300047471 Bacteria 1382
918 Ga0495593_0004921 3300047673 Bacteria 7920
919 Ga0495602_0003151 3300048088 Bacteria 16985
920 Ga0495602_0024638 3300048088 Bacteria 5835
921 Ga0495602_0147734 3300048088 Bacteria 1852
922 Ga0495602_0356930 3300048088 Bacteria 1053
923 Ga0495614_0116376 3300048089 Bacteria 1176
924 Ga0495615_0010063 3300048090 Bacteria 1879
925 Ga0496100_0067361 3300048903 Bacteria 2378
926 Ga0496100_0307378 3300048903 Bacteria 1188
927 Ga0496101_0757208 3300048904 Bacteria 766
928 Ga0496103_0002010 3300048906 Bacteria 13104
929 Ga0496104_0051204 3300048907 Bacteria 3897
930 Ga0496104_0063828 3300048907 Bacteria 3494
931 Ga0496104_0199320 3300048907 Bacteria 1914
932 Ga0496105_0108637 3300048908 Bacteria 2290
933 Ga0496106_0008373 3300048909 Bacteria 7653
934 Ga0496107_0271620 3300048910 Bacteria 1262
935 Ga0496108_0007055 3300048911 Bacteria 9097
936 Ga0496109_0040920 3300048912 Bacteria 4198
937 Ga0496110_0044043 3300048913 Bacteria 3897
938 Ga0496110_0333127 3300048913 Bacteria 1383
939 Ga0496111_0020980 3300048914 Bacteria 4555
940 Ga0496111_0145684 3300048914 Bacteria 1756
941 Ga0496112_0053099 3300048915 Bacteria 3979
942 Ga0496112_0112902 3300048915 Bacteria 2688
943 Ga0496112_0236835 3300048915 Bacteria 1779
944 Ga0496114_0175117 3300048917 Bacteria 1872
945 Ga0496114_0203527 3300048917 Bacteria 1734
946 Ga0496114_0294937 3300048917 Bacteria 1431
947 Ga0496114_0372525 3300048917 Bacteria 1264
948 Ga0496115_0000977 3300048918 Bacteria 20712
949 Ga0496115_0028556 3300048918 Bacteria 4374
950 Ga0496115_0046403 3300048918 Bacteria 3472
951 Ga0496118_0011507 3300048921 Bacteria 8626
952 Ga0496119_0037631 3300048922 Bacteria 3140
953 Ga0496121_0018026 3300048924 Bacteria 7151
954 Ga0496123_0117712 3300048926 Bacteria 1502
955 Ga0496126_0032158 3300048929 Bacteria 4946
956 Ga0501305_000074 3300049161 Bacteria 5694
957 Ga0501315_020018 3300049531 Bacteria 895
958 Ga0501323_001695 3300049539 Bacteria 2019
959 Ga0501031_0031770 3300049568 Bacteria 3444
960 Ga0501031_0147207 3300049568 Bacteria 1539
961 Ga0501031_0254269 3300049568 Bacteria 1142
962 Ga0501034_0003614 3300049571 Bacteria 17553
963 Ga0501034_0008086 3300049571 Bacteria 11154
964 Ga0501034_0424783 3300049571 Bacteria 1250
965 Ga0501034_0526046 3300049571 Bacteria 1094
966 Ga0501036_0208565 3300049572 Bacteria 1642
967 Ga0501036_0251923 3300049572 Bacteria 1480
968 Ga0501038_0399863 3300049574 Bacteria 1063
969 Ga0501039_0134957 3300049575 Bacteria 1937
970 Ga0501039_0474616 3300049575 Bacteria 982
971 Ga0501040_0180022 3300049576 Bacteria 1498
972 Ga0501041_0056572 3300049577 Bacteria 2397
973 Ga0501042_0008502 3300049578 Bacteria 6780
974 Ga0501042_0174625 3300049578 Bacteria 1550
975 Ga0501046_0070217 3300049580 Bacteria 2724
976 Ga0501046_0375285 3300049580 Bacteria 1030
977 Ga0501047_0231494 3300049581 Bacteria 1701
978 Ga0501048_0003213 3300049582 Bacteria 12444
979 Ga0501067_0013192 3300049583 Bacteria 4575
980 Ga0501067_0135074 3300049583 Bacteria 1373
981 Ga0501067_0196631 3300049583 Bacteria 1123
982 Ga0501069_0015105 3300049585 Bacteria 4136
983 Ga0501069_0034622 3300049585 Bacteria 2781
984 Ga0501070_0360042 3300049586 Bacteria 1180
985 Ga0501071_0004803 3300049587 Bacteria 8603
986 Ga0501071_0313739 3300049587 Bacteria 1190
987 Ga0501072_0016348 3300049588 Bacteria 5693
988 Ga0501072_0058802 3300049588 Bacteria 3030
989 Ga0501073_0005689 3300049589 Bacteria 9324
990 Ga0501074_0240097 3300049590 Bacteria 1289
991 Ga0501075_0011893 3300049591 Bacteria 6174
992 Ga0501075_0016294 3300049591 Bacteria 5351
993 Ga0501075_0134359 3300049591 Bacteria 1884
994 Ga0501075_0264931 3300049591 Bacteria 1310
995 Ga0501076_0009211 3300049592 Bacteria 7281
996 Ga0501076_0056448 3300049592 Bacteria 3117
997 Ga0501076_0115789 3300049592 Bacteria 2169
998 Ga0501077_0087652 3300049593 Bacteria 1973
999 Ga0501077_0104087 3300049593 Bacteria 1799
1000 Ga0501077_0243081 3300049593 Bacteria 1144
1001 Ga0501079_0053043 3300049741 Bacteria 3129
1002 Ga0501079_0465431 3300049741 Bacteria 993
1003 Ga0501079_0667556 3300049741 Bacteria 818
1004 Ga0501080_0321316 3300049742 Bacteria 1401
1005 Ga0501080_0574583 3300049742 Bacteria 1002
1006 Ga0501081_0215001 3300049743 Bacteria 1397
1007 Ga0501081_0296578 3300049743 Bacteria 1186
1008 Ga0501083_0402086 3300049744 Bacteria 891
1009 Ga0501035_0051311 3300049822 Bacteria 3694
1010 Ga0501035_0404190 3300049822 Bacteria 1136
1011 Ga0501044_0000121 3300049823 Bacteria 93902
1012 Ga0501044_0143341 3300049823 Bacteria 2377
1013 Ga0501044_0217000 3300049823 Bacteria 1865
1014 Ga0501044_0387311 3300049823 Bacteria 1312
1015 Ga0501044_0529673 3300049823 Bacteria 1077
1016 Ga0501045_0004485 3300049824 Bacteria 9645
1017 nmdc:mga03683_129_c1 3300050489 Bacteria 25227
1018 nmdc:mga00v17_13212_c1 3300050491 Bacteria 4576
1019 nmdc:mga00v17_200814_c1 3300050491 Bacteria 1289
1020 nmdc:mga0yw44_508548_c1 3300050492 Bacteria 817
1021 nmdc:mga0k408_11688_c1 3300050493 Bacteria 4786
1022 nmdc:mga0k408_144694_c1 3300050493 Bacteria 1415
1023 nmdc:mga06z11_122_c1 3300050494 Bacteria 32025
1024 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
1025 nmdc:mga05p37_122920_c1 3300050507 Bacteria 3188
1026 nmdc:mga05p37_337590_c2 3300050507 Bacteria 1439
1027 nmdc:mga05p37_36050_c1 3300050507 Bacteria 6069
1028 nmdc:mga05p37_80215_c1 3300050507 Bacteria 4020
1029 nmdc:mga05p37_81276_c1 3300050507 Bacteria 3992
1030 nmdc:mga09592_232146_c1 3300050508 Bacteria 1599
1031 nmdc:mga09592_521896_c1 3300050508 Bacteria 1021
1032 nmdc:mga09592_96641_c1 3300050508 Bacteria 2527
1033 nmdc:mga0qj67_3985_c1 3300050509 Bacteria 6623
1034 nmdc:mga06r32_718632_c1 3300050510 Bacteria 964
1035 nmdc:mga06r32_73091_c1 3300050510 Bacteria 3321
1036 nmdc:mga08y16_1471_c1 3300050511 Bacteria 23637
1037 nmdc:mga08y16_205774_c1 3300050511 Bacteria 2039
1038 nmdc:mga08y16_216002_c1 3300050511 Bacteria 1986
1039 nmdc:mga08y16_22400_c1 3300050511 Bacteria 6668
1040 nmdc:mga08y16_330478_c1 3300050511 Bacteria 1568
1041 nmdc:mga08y16_42715_c1 3300050511 Bacteria 4747
1042 nmdc:mga08y16_546602_c1 3300050511 Bacteria 1172
1043 nmdc:mga08y16_641077_c1 3300050511 Bacteria 1067
1044 nmdc:mga08y16_64310_c1 3300050511 Bacteria 3831
1045 nmdc:mga08y16_6740_c1 3300050511 Bacteria 12043
1046 nmdc:mga08y16_699456_c1 3300050511 Bacteria 1014
1047 nmdc:mga0n895_152814_c1 3300050512 Bacteria 2339
1048 nmdc:mga0n895_211173_c1 3300050512 Bacteria 1971
1049 nmdc:mga0n895_303697_c1 3300050512 Bacteria 1618
1050 nmdc:mga0n895_560099_c1 3300050512 Bacteria 1148
1051 nmdc:mga0n895_918341_c1 3300050512 Bacteria 860
1052 nmdc:mga0rr50_176693_c1 3300050513 Bacteria 1743
1053 nmdc:mga0rr50_326234_c1 3300050513 Bacteria 1288
1054 nmdc:mga0rr50_52636_c1 3300050513 Bacteria 3026
1055 nmdc:mga08x19_10729_c1 3300050514 Bacteria 5505
1056 nmdc:mga08x19_77608_c1 3300050514 Bacteria 2175
1057 nmdc:mga0a205_125519_c1 3300050515 Bacteria 2466
1058 nmdc:mga0a205_184445_c1 3300050515 Bacteria 1980
1059 nmdc:mga0a205_210619_c1 3300050515 Bacteria 1832
1060 nmdc:mga0a205_390444_c1 3300050515 Bacteria 1256
1061 nmdc:mga0a205_69391_c1 3300050515 Bacteria 3403
1062 nmdc:mga0a205_75696_c1 3300050515 Bacteria 3252
1063 nmdc:mga0a205_79703_c1 3300050515 Bacteria 3164
1064 nmdc:mga0sz30_330_c1 3300050516 Bacteria 18114
1065 Ga0495601_0110986 3300053077 Bacteria 1776
1066 Ga0495601_0276349 3300053077 Bacteria 1095
1067 Ga0495612_0001883 3300053078 Bacteria 8632
1068 Ga0495612_0157631 3300053078 Bacteria 990
1069 Ga0495595_0051307 3300053084 Bacteria 1912
1070 Ga0495619_0230491 3300053085 Bacteria 1283
1071 Ga0495619_0240162 3300053085 Bacteria 1255
1072 Ga0495619_0311284 3300053085 Bacteria 1090
1073 Ga0500643_000039 3300053087 Bacteria 169629
1074 Ga0500651_0111488 3300053093 Bacteria 1669
1075 Ga0500555_000967 3300053103 Bacteria 9951
1076 Ga0500562_030033 3300053108 Bacteria 1431
1077 Ga0500607_000721 3300053121 Bacteria 31928
1078 Ga0500616_0000357 3300053153 Bacteria 64980
1079 Ga0500616_0001815 3300053153 Bacteria 19409
1080 Ga0500645_003002 3300053730 Bacteria 7140
1081 Ga0500599_001640 3300053736 Bacteria 2606
1082 Ga0590071_003207 3300059421 Bacteria 4039
1083 Ga0590077_002487 3300059426 Bacteria 3925
1084 Ga0587080_022122 3300059503 Bacteria 1051
1085 Ga0587083_0022932 3300059505 Bacteria 1174
1086 Ga0501082_0017104 3300060353 Bacteria 6247
1087 Ga0501082_0050658 3300060353 Bacteria 3580
1088 Ga0501082_0179474 3300060353 Bacteria 1841
1089 Ga0530510_0109553 3300061734 Bacteria 2022
1090 Ga0530510_0165157 3300061734 Bacteria 1638
1091 2643951638 2643221588 Bacteria 3692460
1092 2848298602 2848297114 Bacteria 3608511
1093 2895881455 2895880812 Bacteria 11255272
1094 2896256219 2896253425 Bacteria 3418029
1095 Ga0097621_100227164
1096 JGI24741J21665_1019232
1097 JGI24738J21930_10013322
1098 Ga0006762J43184_106338
1099 rootL2_10370863
1100 rootH1_10061610
1101 JGI25407J50210_10003427
1102 Ga0058863_10052666
1103 Ga0058863_10170080
1104 Ga0058861_10168291
1105 Ga0058860_12210992
1106 Ga0058862_10289804
1107 Ga0065704_10092589
1108 Ga0065704_10096689
1109 Ga0065712_10075001
1110 Ga0065712_10075551
1111 Ga0065712_10093133
1112 Ga0065715_10114950
1113 Ga0065715_10130388
1114 Ga0065715_10154036
1115 Ga0070658_10109288
1116 Ga0070676_10062231
1117 Ga0070676_10136059
1118 Ga0070683_100054844
1119 Ga0070683_100112701
1120 Ga0070690_100048689
1121 Ga0070690_100238709
1122 Ga0070670_100002037
1123 Ga0070670_100020542
1124 Ga0070670_100028660
1125 Ga0070670_100051264
1126 Ga0070670_100115234
1127 Ga0070670_100447223
1128 Ga0070677_10189635
1129 Ga0068869_100050303
1130 Ga0068869_100310311
1131 Ga0070666_10010932
1132 Ga0070680_100001103
1133 Ga0070682_100038642
1134 Ga0070682_100099053
1135 Ga0070682_100313001
1136 Ga0068868_100003244
1137 Ga0068868_100065914
1138 Ga0068868_100268547
1139 Ga0068868_100279510
1140 Ga0070660_100002528
1141 Ga0070660_100047206
1142 Ga0070660_100236668
1143 Ga0070689_100055251
1144 Ga0070689_100056159
1145 Ga0070689_100116781
1146 Ga0070689_100279803
1147 Ga0070689_100413701
1148 Ga0070689_100493516
1149 Ga0070687_100139516
1150 Ga0070661_100005158
1151 Ga0070661_100060578
1152 Ga0070661_100074038
1153 Ga0070661_100084440
1154 Ga0070692_10141598
1155 Ga0070668_100144156
1156 Ga0070669_100004448
1157 Ga0070675_100006570
1158 Ga0070675_100029347
1159 Ga0070675_100053172
1160 Ga0070675_100133271
1161 Ga0070675_100188398
1162 Ga0070675_100555303
1163 Ga0070675_100909768
1164 Ga0070671_100001395
1165 Ga0070671_100003462
1166 Ga0070671_100038179
1167 Ga0070671_100234024
1168 Ga0070674_100082765
1169 Ga0070673_100042705
1170 Ga0070673_100049506
1171 Ga0070673_100068302
1172 Ga0070673_100070911
1173 Ga0070673_100354362
1174 Ga0070688_100019652
1175 Ga0070688_100051080
1176 Ga0070667_100005841
1177 Ga0070667_100024096
1178 Ga0070667_100103151
1179 Ga0070709_10010452
1180 Ga0070709_10169441
1181 Ga0070714_100267983
1182 Ga0070713_100199272
1183 Ga0070710_10041040
1184 Ga0070710_10164859
1185 Ga0070701_10135483
1186 Ga0070711_100029381
1187 Ga0070711_100270155
1188 Ga0070711_100521809
1189 Ga0070705_100205873
1190 Ga0070694_100103391
1191 Ga0070694_100264176
1192 Ga0070694_100507763
1193 Ga0070708_100000449
1194 Ga0070708_100016101
1195 Ga0070708_100081988
1196 Ga0070708_100514838
1197 Ga0070708_100659104
1198 Ga0070663_100339387
1199 Ga0070678_100203913
1200 Ga0070678_100220038
1201 Ga0070678_100303975
1202 Ga0070662_100029624
1203 Ga0070662_100032181
1204 Ga0070681_10087087
1205 Ga0068867_100057238
1206 Ga0068867_100251482
1207 Ga0070685_10001304
1208 Ga0070685_10021547
1209 Ga0070685_10052834
1210 Ga0070685_10054316
1211 Ga0070706_100004637
1212 Ga0070706_100616300
1213 Ga0070707_100006642
1214 Ga0070707_100012678
1215 Ga0070707_100048300
1216 Ga0070707_100108612
1217 Ga0070707_100202029
1218 Ga0070707_100437566
1219 Ga0070707_100567766
1220 Ga0070698_100005408
1221 Ga0070698_100437425
1222 Ga0070699_100393235
1223 Ga0070679_100034483
1224 Ga0070679_100198221
1225 Ga0070679_100321529
1226 Ga0070684_100034883
1227 Ga0070684_100411507
1228 Ga0070684_100537817
1229 Ga0070697_100000421
1230 Ga0070697_100128234
1231 Ga0070697_100337107
1232 Ga0068853_100008003
1233 Ga0070672_100019065
1234 Ga0070672_100030640
1235 Ga0070672_100204378
1236 Ga0070672_100292590
1237 Ga0070672_100809693
1238 Ga0070686_100090815
1239 Ga0070695_100165636
1240 Ga0070696_100033545
1241 Ga0070696_100043851
1242 Ga0070696_100425358
1243 Ga0070665_100000269
1244 Ga0070665_100003003
1245 Ga0070665_100035708
1246 Ga0070665_100084036
1247 Ga0070665_100202373
1248 Ga0070665_100456954
1249 Ga0070704_100121260
1250 Ga0070704_100235952
1251 Ga0068855_100006099
1252 Ga0068855_100012247
1253 Ga0070664_100003979
1254 Ga0070664_100020586
1255 Ga0070664_100071441
1256 Ga0070664_100214501
1257 Ga0068857_100027185
1258 Ga0068857_100068453
1259 Ga0068857_100431895
1260 Ga0068854_100001336
1261 Ga0068856_100277726
1262 Ga0070702_100155882
1263 Ga0068852_100231142
1264 Ga0068852_100510264
1265 Ga0068852_100512776
1266 Ga0068859_100079340
1267 Ga0068859_100107960
1268 Ga0068859_100144299
1269 Ga0068859_100416509
1270 Ga0068859_100885240
1271 Ga0068864_100008861
1272 Ga0068864_100062599
1273 Ga0068864_100279752
1274 Ga0068864_100333325
1275 Ga0068864_100799685
1276 Ga0068861_100250954
1277 Ga0068861_100562106
1278 Ga0068870_10165125
1279 Ga0068870_10518570
1280 Ga0068863_100000969
1281 Ga0068863_100012620
1282 Ga0068863_100036154
1283 Ga0068863_100138603
1284 Ga0068863_100261002
1285 Ga0068863_100268294
1286 Ga0068858_100007152
1287 Ga0068858_100078881
1288 Ga0068858_100271131
1289 Ga0068858_100386397
1290 Ga0068860_100028140
1291 Ga0068860_100131686
1292 Ga0068860_100229215
1293 Ga0068860_100567637
1294 Ga0068860_100789425
1295 Ga0068862_100185583
1296 Ga0068862_100246105
1297 Ga0081455_10004528
1298 Ga0081455_10153630
1299 Ga0081538_10000250
1300 Ga0081538_10002047
1301 Ga0081538_10044880
1302 Ga0070717_10627985
1303 Ga0075368_10005180
1304 Ga0075364_10115498
1305 Ga0070712_100058727
1306 Ga0070712_100280953
1307 Ga0075362_10000613
1308 Ga0075367_10011391
1309 Ga0075369_10002444
1310 Ga0075366_10163935
1311 Ga0097621_100020011
1312 Ga0097621_100043872
1313 Ga0097621_100046954
1314 Ga0097621_100067794
1315 Ga0097621_100100789
1316 Ga0097621_100147274
1317 Ga0097621_100156444
1318 Ga0097621_100397873
1319 Ga0075370_10164808
1320 Ga0068871_100013592
1321 Ga0068871_100028407
1322 Ga0068871_100041568
1323 Ga0068871_100061214
1324 Ga0068871_100104558
1325 Ga0068871_100331665
1326 Ga0068871_100413750
1327 Ga0068871_100505636
1328 Ga0075428_100555731
1329 Ga0075428_100759421
1330 Ga0075430_100189597
1331 Ga0075431_100071481
1332 Ga0075431_100081000
1333 Ga0075431_100131547
1334 Ga0075431_100316046
1335 Ga0075431_101002333
1336 Ga0075433_10049769
1337 Ga0075433_10170130
1338 Ga0075433_10187506
1339 Ga0075433_10209882
1340 Ga0075433_10502774
1341 Ga0075434_100058033
1342 Ga0075434_100084832
1343 Ga0075434_100086909
1344 Ga0075434_100142561
1345 Ga0075429_100066027
1346 Ga0075429_100196316
1347 Ga0075429_100497079
1348 Ga0068865_100055272
1349 Ga0068865_100058801
1350 Ga0068865_100177213
1351 Ga0068865_100486097
1352 Ga0068865_100815937
1353 Ga0097620_100079345
1354 Ga0097620_100107978
1355 Ga0097620_100144286
1356 Ga0097620_100416506
1357 Ga0097620_100885205
1358 Ga0079104_1051324
1359 Ga0075435_100064802
1360 Ga0075435_100660785
1361 Ga0099794_10073987
1362 Ga0099794_10075534
1363 Ga0099794_10155250
1364 Ga0099795_10022459
1365 Ga0105251_10005138
1366 Ga0105250_10110446
1367 Ga0105240_10341619
1368 Ga0111539_10007710
1369 Ga0111539_10021601
1370 Ga0111539_10044169
1371 Ga0111539_10048633
1372 Ga0111539_10053750
1373 Ga0111539_10060925
1374 Ga0111539_10160076
1375 Ga0111539_10207560
1376 Ga0111539_10365710
1377 Ga0111539_10442518
1378 Ga0111539_10984265
1379 Ga0105245_10514704
1380 Ga0114129_10024758
1381 Ga0114129_10066829
1382 Ga0114129_10128790
1383 Ga0114129_10274343
1384 Ga0114129_10388655
1385 Ga0114129_10467275
1386 Ga0114129_10521481
1387 Ga0114129_11067456
1388 Ga0105243_10010720
1389 Ga0105243_10081632
1390 Ga0105242_10003471
1391 Ga0105242_10097645
1392 Ga0105242_10099116
1393 Ga0105242_10164471
1394 Ga0105242_10830964
1395 Ga0105248_10001106
1396 Ga0105248_10009115
1397 Ga0105248_10026939
1398 Ga0105248_10061024
1399 Ga0105248_10093930
1400 Ga0105249_10075568
1401 Ga0105249_10111457
1402 Ga0105249_10287756
1403 Ga0105249_10942128
1404 Ga0105249_10969848
1405 Ga0099796_10114967
1406 Ga0105239_10050469
1407 Ga0105239_11348957
1408 Ga0105246_10002809
1409 Ga0105246_10268373
1410 Ga0105246_10271338
1411 Ga0105246_10327917
1412 Ga0157373_10005741
1413 Ga0157373_10211073
1414 Ga0157373_10622710
1415 Ga0157371_10000847
1416 Ga0157371_10069396
1417 Ga0157370_10000897
1418 Ga0157370_10278373
1419 Ga0157370_10537202
1420 Ga0157369_10005204
1421 Ga0157374_10011913
1422 Ga0157374_10115202
1423 Ga0157374_10361456
1424 Ga0157374_11112997
1425 Ga0157378_10032994
1426 Ga0157378_10037612
1427 Ga0157378_10072564
1428 Ga0157378_10096220
1429 Ga0157378_10110233
1430 Ga0157378_10135288
1431 Ga0157378_10347197
1432 Ga0157378_10895426
1433 Ga0163162_10022654
1434 Ga0163162_10057886
1435 Ga0163162_10090809
1436 Ga0163162_10309798
1437 Ga0163162_11237993
1438 Ga0157372_10004693
1439 Ga0157375_10004866
1440 Ga0157375_10008115
1441 Ga0157375_10051985
1442 Ga0157375_10061324
1443 Ga0157375_10137739
1444 Ga0157375_10148350
1445 Ga0157375_10256642
1446 Ga0163163_10000446
1447 Ga0163163_10055176
1448 Ga0163163_10096297
1449 Ga0163163_10131576
1450 Ga0163163_10204195
1451 Ga0163163_10245365
1452 Ga0163163_10425161
1453 Ga0157380_10145568
1454 Ga0157380_10217623
1455 Ga0157380_10250345
1456 Ga0157380_10473177
1457 Ga0157380_10502709
1458 Ga0157380_10564165
1459 Ga0157380_10768303
1460 Ga0157379_10000562
1461 Ga0157379_10100279
1462 Ga0157376_10000014
1463 Ga0157376_10036580
1464 Ga0157376_10057875
1465 Ga0157376_10060869
1466 Ga0157376_10074456
1467 Ga0157376_10085537
1468 Ga0157376_10151767
1469 Ga0157376_10159200
1470 Ga0157376_10206815
1471 Ga0157376_10229726
1472 Ga0157376_10288977
1473 Ga0157376_11188262
1474 Ga0163161_10030399
1475 Ga0163161_10506165
1476 Ga0184599_122998
1477 Ga0206349_1555407
1478 Ga0206351_10760636
1479 Ga0206352_10266958
1480 Ga0206354_10096804
1481 Ga0213876_10025237
1482 Ga0213876_10027791
1483 Ga0213876_10115472
1484 Ga0213875_10007729
1485 Ga0224712_10002961
1486 Ga0224712_10026872
1487 Ga0228598_1011982
1488 Ga0207697_10017447
1489 Ga0207697_10047774
1490 Ga0207697_10124793
1491 Ga0207656_10133099
1492 Ga0207713_1001799
1493 Ga0207653_10000517
1494 Ga0207680_10000784
1495 Ga0207699_10008729
1496 Ga0207699_10023466
1497 Ga0207645_10236826
1498 Ga0207643_10161510
1499 Ga0207643_10259611
1500 Ga0207705_10052692
1501 Ga0207705_10086103
1502 Ga0207705_10207334
1503 Ga0207684_10133583
1504 Ga0207684_10571806
1505 Ga0207654_10047172
1506 Ga0207707_10016149
1507 Ga0207707_10028950
1508 Ga0207707_10075784
1509 Ga0207695_10140453
1510 Ga0207693_10010686
1511 Ga0207693_10030426
1512 Ga0207693_10137685
1513 Ga0207693_10146737
1514 Ga0207663_10004574
1515 Ga0207660_10009046
1516 Ga0207660_10018722
1517 Ga0207660_10027520
1518 Ga0207660_10130856
1519 Ga0207660_10211390
1520 Ga0207660_10623446
1521 Ga0207662_10013063
1522 Ga0207662_10133008
1523 Ga0207662_10162624
1524 Ga0207657_10000083
1525 Ga0207657_10014470
1526 Ga0207657_10447531
1527 Ga0207649_10001847
1528 Ga0207649_10028375
1529 Ga0207649_10065156
1530 Ga0207652_10012202
1531 Ga0207652_10025964
1532 Ga0207652_10033139
1533 Ga0207652_10059080
1534 Ga0207646_10001680
1535 Ga0207646_10017051
1536 Ga0207646_10092622
1537 Ga0207646_10097917
1538 Ga0207646_10100701
1539 Ga0207646_10159720
1540 Ga0207646_10370025
1541 Ga0207681_10003272
1542 Ga0207681_10036207
1543 Ga0207681_10050520
1544 Ga0207681_10326746
1545 Ga0207650_10002276
1546 Ga0207650_10038113
1547 Ga0207650_10108714
1548 Ga0207650_10163969
1549 Ga0207650_10287093
1550 Ga0207659_10000169
1551 Ga0207659_10000843
1552 Ga0207659_10002914
1553 Ga0207659_10056582
1554 Ga0207659_10253138
1555 Ga0207659_10304650
1556 Ga0207659_10593370
1557 Ga0207700_10040381
1558 Ga0207700_10263954
1559 Ga0207644_10001196
1560 Ga0207644_10006842
1561 Ga0207644_10026639
1562 Ga0207644_10097083
1563 Ga0207644_10167225
1564 Ga0207690_10000356
1565 Ga0207690_10025822
1566 Ga0207706_10005054
1567 Ga0207706_10010712
1568 Ga0207706_10253038
1569 Ga0207686_10000496
1570 Ga0207709_10001154
1571 Ga0207709_10147840
1572 Ga0207709_10157949
1573 Ga0207709_10239338
1574 Ga0207709_10653526
1575 Ga0207670_10007709
1576 Ga0207670_10071199
1577 Ga0207670_10165066
1578 Ga0207670_10202826
1579 Ga0207670_10295411
1580 Ga0207669_10337532
1581 Ga0207704_10003207
1582 Ga0207704_10023061
1583 Ga0207704_10084243
1584 Ga0207704_10097938
1585 Ga0207704_10245352
1586 Ga0207665_10016663
1587 Ga0207665_10041443
1588 Ga0207691_10023258
1589 Ga0207691_10059354
1590 Ga0207691_10121064
1591 Ga0207711_10002561
1592 Ga0207711_10002690
1593 Ga0207711_10016136
1594 Ga0207711_10070683
1595 Ga0207711_10136373
1596 Ga0207689_10052132
1597 Ga0207689_10095467
1598 Ga0207689_10097667
1599 Ga0207661_10071811
1600 Ga0207679_10002743
1601 Ga0207679_10003915
1602 Ga0207679_10191930
1603 Ga0207679_10303118
1604 Ga0207679_10439920
1605 Ga0207679_10443729
1606 Ga0207667_10004004
1607 Ga0207667_10004990
1608 Ga0207651_10039011
1609 Ga0207651_10041980
1610 Ga0207651_10145313
1611 Ga0207651_10227752
1612 Ga0207651_10469648
1613 Ga0207712_10156408
1614 Ga0207712_10626211
1615 Ga0207668_10049299
1616 Ga0207668_10129579
1617 Ga0207640_10003576
1618 Ga0207640_10004793
1619 Ga0207658_10005136
1620 Ga0207658_10014653
1621 Ga0207658_10030281
1622 Ga0207677_10010265
1623 Ga0207677_10043856
1624 Ga0207677_10274519
1625 Ga0207703_10005252
1626 Ga0207703_10006761
1627 Ga0207703_10255747
1628 Ga0207703_10314334
1629 Ga0207639_10000175
1630 Ga0207678_10009536
1631 Ga0207708_10052924
1632 Ga0207708_10132098
1633 Ga0207708_10184539
1634 Ga0207708_10480439
1635 Ga0207702_10560982
1636 Ga0207641_10000293
1637 Ga0207641_10006158
1638 Ga0207641_10036534
1639 Ga0207641_10115321
1640 Ga0207641_10123947
1641 Ga0207641_10198459
1642 Ga0207641_10206307
1643 Ga0207641_10361827
1644 Ga0207648_10135911
1645 Ga0207648_10301506
1646 Ga0207676_10003247
1647 Ga0207676_10008606
1648 Ga0207676_10072948
1649 Ga0207676_10292740
1650 Ga0207674_10013628
1651 Ga0207674_10041311
1652 Ga0207674_10082680
1653 Ga0207674_10083057
1654 Ga0207674_10217764
1655 Ga0207674_10381506
1656 Ga0207675_100106120
1657 Ga0207675_100125229
1658 Ga0207675_100251201
1659 Ga0207675_100418708
1660 Ga0207683_10041648
1661 Ga0207683_10060510
1662 Ga0207683_10079749
1663 Ga0207683_10112116
1664 Ga0207698_10342520
1665 Ga0207698_10899905
1666 Ga0209281_1018955
1667 Ga0209983_1043383
1668 Ga0209588_1023526
1669 Ga0209588_1023623
1670 Ga0209588_1069668
1671 Ga0209588_1077578
1672 Ga0209971_1008691
1673 Ga0209998_10009176
1674 Ga0209998_10072430
1675 Ga0209813_10000030
1676 Ga0209974_10123585
1677 Ga0207428_10029211
1678 Ga0207428_10031565
1679 Ga0207428_10047561
1680 Ga0207428_10047950
1681 Ga0207428_10059423
1682 Ga0207428_10115063
1683 Ga0207428_10141228
1684 Ga0207428_10232879
1685 Ga0268266_10000072
1686 Ga0268266_10000334
1687 Ga0268266_10048996
1688 Ga0268266_10055880
1689 Ga0268266_10452167
1690 Ga0268265_10433870
1691 Ga0268265_10915173
1692 Ga0268264_10019574
1693 Ga0268264_10116808
1694 Ga0268264_10294590
1695 Ga0268264_10301783
1696 Ga0265318_10000165
1697 Ga0265318_10002420
1698 Ga0265323_10022789
1699 Ga0265323_10093870
1700 Ga0265336_10044859
1701 Ga0265338_10021503
1702 Ga0265338_10033841
1703 Ga0265324_10039063
1704 Ga0265760_10036476
1705 Ga0265330_10001250
1706 Ga0265330_10036666
1707 Ga0265332_10001069
1708 Ga0265332_10004047
1709 Ga0265328_10020981
1710 Ga0265320_10000099
1711 Ga0265320_10002218
1712 Ga0265320_10063433
1713 Ga0265325_10006073
1714 Ga0265325_10016063
1715 Ga0265325_10045537
1716 Ga0265329_10000665
1717 Ga0265329_10009674
1718 Ga0265329_10030961
1719 Ga0265340_10007939
1720 Ga0265340_10017706
1721 Ga0265339_10000649
1722 Ga0265339_10001807
1723 Ga0265339_10036620
1724 Ga0265339_10071013
1725 Ga0265331_10000196
1726 Ga0265331_10008193
1727 Ga0265331_10015188
1728 Ga0265316_10001327
1729 Ga0265316_10001597
1730 Ga0265316_10003381
1731 Ga0265316_10003941
1732 Ga0265316_10029196
1733 Ga0265316_10034724
1734 Ga0265316_10048066
1735 Ga0265316_10140851
1736 Ga0265316_10177972
1737 Ga0307408_100020865
1738 Ga0307408_100298797
1739 Ga0265313_10000953
1740 Ga0265313_10002411
1741 Ga0265313_10040192
1742 Ga0265313_10076134
1743 Ga0316575_10000098
1744 Ga0316575_10112139
1745 Ga0316579_10019813
1746 Ga0316579_10086583
1747 Ga0316579_10093522
1748 Ga0265314_10000003
1749 Ga0265314_10000071
1750 Ga0265314_10004438
1751 Ga0265314_10031172
1752 Ga0265314_10063500
1753 Ga0265342_10000679
1754 Ga0265342_10002488
1755 Ga0316576_10000548
1756 Ga0316576_10002466
1757 Ga0316576_10009928
1758 Ga0316576_10030207
1759 Ga0316576_10169945
1760 Ga0316576_10364365
1761 Ga0316576_10381837
1762 Ga0307405_10050168
1763 Ga0316577_10015566
1764 Ga0316577_10136248
1765 Ga0316577_10185104
1766 Ga0316577_10232584
1767 Ga0307413_10121092
1768 Ga0307413_10188987
1769 Ga0307413_10265855
1770 Ga0307410_10167213
1771 Ga0307406_10015119
1772 Ga0307406_10047965
1773 Ga0307406_10059420
1774 Ga0307407_10013301
1775 Ga0307412_10010507
1776 Ga0307412_10130228
1777 Ga0307412_10280242
1778 Ga0307412_10635686
1779 Ga0307409_100218540
1780 Ga0307409_100433549
1781 Ga0307409_100751137
1782 Ga0307416_100061839
1783 Ga0307416_100909823
1784 Ga0307414_10201046
1785 Ga0307411_10168166
1786 Ga0307415_100355852
1787 Ga0316593_10007662
1788 Ga0316593_10024652
1789 Ga0316593_10043261
1790 Ga0316593_10056979
1791 Ga0316592_1002050
1792 Ga0316592_1003442
1793 Ga0316592_1008760
1794 Ga0316592_1038779
1795 Ga0316588_1000219
1796 Ga0316588_1002297
1797 Ga0316588_1002933
1798 Ga0316588_1006171
1799 Ga0316588_1018566
1800 Ga0316587_1000001
1801 Ga0316596_1000985
1802 Ga0316596_1006947
1803 Ga0373926_0000781
1804 Ga0373926_0132103
1805 Ga0373928_0069145
1806 Ga0373944_0010372
1807 Ga0373944_0154259
1808 Ga0373923_0002039
1809 Ga0373936_0193741
1810 Ga0373945_0053899
1811 Ga0373954_0034762
1812 Ga0373954_0133995
1813 Ga0373956_0057189
1814 Ga0373957_0128152
1815 Ga0373943_0228552
1816 Ga0373946_0151205
1817 Ga0373946_0231329
1818 Ga0373955_0063537
1819 Ga0373955_0073240
1820 Ga0373961_0000446
1821 Ga0316574_0009330
1822 Ga0316574_0106711
1823 Ga0373924_0044014
1824 Ga0373931_0027382
1825 Ga0373931_0106752
1826 Ga0373931_0147691
1827 Ga0373935_0027204
1828 Ga0373935_0126145
1829 Ga0373927_0005384
1830 Ga0373933_0014827
1831 Ga0373933_0381401
1832 Ga0373947_0010227
1833 Ga0373937_0000078
1834 Ga0373937_0021252
1835 Ga0373937_0025354
1836 Ga0373937_0031983
1837 Ga0373937_0107774
1838 Ga0373937_0238723
1839 Ga0373937_0387063
1840 Ga0373937_0691184
1841 Ga0265778_007972
1842 Ga0316582_0058537
1843 Ga0316582_0121182
1844 Ga0316582_0218990
1845 Ga0316582_0399222
1846 Ga0316584_0009978
1847 Ga0316584_0025357
1848 Ga0316584_0182353
1849 Ga0316584_0220563
1850 Ga0316584_0245852
1851 Ga0316584_0791205
1852 Ga0373925_0165163
1853 Ga0395899_0232654
1854 Ga0395900_0479417
1855 Ga0316581_0054063
1856 Ga0436364_1196741
1857 Ga0436364_1430661
1858 Ga0400489_80694
1859 Ga0400487_59508
1860 Ga0436365_0831894
1861 Ga0436365_0896462
1862 Ga0436365_1742949
1863 Ga0436365_1846658
1864 Ga0436360_0655945
1865 Ga0436361_1007716
1866 Ga0439465_0001490
1867 Ga0451807_0548069
1868 Ga0451849_1494037
1869 Ga0451853_2126451
1870 Ga0439443_007826
1871 Ga0439445_0030206
1872 Ga0439445_0053427
1873 Ga0439456_058212
1874 Ga0439462_0004174
1875 Ga0450923_010186
1876 Ga0450918_005831
1877 Ga0450918_019040
1878 Ga0451577_0000139
1879 Ga0451577_0332671
1880 Ga0453683_0000392
1881 Ga0453683_0068937
1882 Ga0453684_0003616
1883 Ga0453684_0010619
1884 Ga0453684_0011627
1885 Ga0453684_0020399
1886 Ga0453684_0178052
1887 Ga0453684_0251157
1888 Ga0466968_0104281
1889 Ga0451576_0026183
1890 Ga0451576_0029400
1891 Ga0451576_0392249
1892 Ga0466967_0003862
1893 Ga0495592_0005038
1894 Ga0495592_0052007
1895 Ga0495592_0054997
1896 Ga0495592_0203556
1897 Ga0495603_0058776
1898 Ga0495603_0072551
1899 Ga0495629_0007511
1900 Ga0495629_0513808
1901 Ga0495638_0024402
1902 Ga0495638_0157345
1903 Ga0495641_0095648
1904 Ga0495651_0000335
1905 Ga0495651_0003305
1906 Ga0495651_0006885
1907 Ga0495651_0085033
1908 Ga0495651_0228857
1909 Ga0495653_0008639
1910 Ga0495653_0151654
1911 Ga0495580_0002835
1912 Ga0495580_0028841
1913 Ga0495580_0046881
1914 Ga0495580_0086482
1915 Ga0495580_0136192
1916 Ga0495580_0530334
1917 Ga0495582_0000227
1918 Ga0495582_0001649
1919 Ga0495582_0181963
1920 Ga0495639_0003836
1921 Ga0495639_0225422
1922 Ga0495662_0050628
1923 Ga0495664_0246106
1924 Ga0495664_0440270
1925 Ga0495664_0503502
1926 Ga0495594_0139940
1927 Ga0495608_0006109
1928 Ga0495608_0016359
1929 Ga0495608_0054588
1930 Ga0495608_0142185
1931 Ga0495618_0046504
1932 Ga0495618_0083189
1933 Ga0495628_0030708
1934 Ga0495628_0048496
1935 Ga0495628_0078943
1936 Ga0495628_0197503
1937 Ga0495630_0008656
1938 Ga0495630_0090329
1939 Ga0495630_0117603
1940 Ga0495630_0269913
1941 Ga0495630_0300077
1942 Ga0495643_0015955
1943 Ga0495666_0005964
1944 Ga0495652_0013927
1945 Ga0495652_0020061
1946 Ga0495665_0001996
1947 Ga0495665_0054933
1948 Ga0495640_0095321
1949 Ga0495640_0145489
1950 Ga0495640_0271873
1951 Ga0495586_0002069
1952 Ga0495586_0030459
1953 Ga0495586_0116737
1954 Ga0495586_0142015
1955 Ga0495587_0002155
1956 Ga0495587_0044560
1957 Ga0495621_0007223
1958 Ga0495645_0019971
1959 Ga0495645_0056273
1960 Ga0495645_0162961
1961 Ga0495645_0291381
1962 Ga0495645_0429474
1963 Ga0495667_0002241
1964 Ga0495667_0030860
1965 Ga0495634_0018345
1966 Ga0495635_0004284
1967 Ga0495635_0132528
1968 Ga0495635_0339231
1969 Ga0495657_0003416
1970 Ga0495657_0057267
1971 Ga0495599_0114149
1972 Ga0495599_0229996
1973 Ga0495623_0012203
1974 Ga0495646_0000703
1975 Ga0495647_0005580
1976 Ga0495658_0043580
1977 Ga0495658_0082856
1978 Ga0495658_0196338
1979 Ga0495658_0222527
1980 Ga0495613_0010783
1981 Ga0495613_0045662
1982 Ga0495613_0250488
1983 Ga0495613_0500232
1984 Ga0495600_0012011
1985 Ga0495600_0086143
1986 Ga0495600_0281774
1987 Ga0495581_0001452
1988 Ga0495604_0098928
1989 Ga0495604_0219352
1990 Ga0495636_0001365
1991 Ga0495636_0107688
1992 Ga0495674_0037039
1993 Ga0495674_0088681
1994 Ga0495674_0121225
1995 Ga0495674_0322663
1996 Ga0495676_0024812
1997 Ga0495676_0098517
1998 Ga0495676_0352916
1999 Ga0495680_0000106
2000 Ga0495680_0006887
2001 Ga0495680_0029632
2002 Ga0495680_0120388
2003 Ga0495680_0204960
2004 Ga0495675_0000643
2005 Ga0495675_0002269
2006 Ga0495675_0079541
2007 Ga0495675_0099183
2008 Ga0495684_0000488
2009 Ga0495684_0007566
2010 Ga0495684_0064208
2011 Ga0495684_0222806
2012 Ga0495593_0004921
2013 Ga0495602_0003151
2014 Ga0495602_0024638
2015 Ga0495602_0147734
2016 Ga0495602_0356930
2017 Ga0495614_0116376
2018 Ga0495615_0010063
2019 Ga0496100_0067361
2020 Ga0496100_0307378
2021 Ga0496101_0757208
2022 Ga0496103_0002010
2023 Ga0496104_0051204
2024 Ga0496104_0063828
2025 Ga0496104_0199320
2026 Ga0496105_0108637
2027 Ga0496106_0008373
2028 Ga0496107_0271620
2029 Ga0496108_0007055
2030 Ga0496109_0040920
2031 Ga0496110_0044043
2032 Ga0496110_0333127
2033 Ga0496111_0020980
2034 Ga0496111_0145684
2035 Ga0496112_0053099
2036 Ga0496112_0112902
2037 Ga0496112_0236835
2038 Ga0496114_0175117
2039 Ga0496114_0203527
2040 Ga0496114_0294937
2041 Ga0496114_0372525
2042 Ga0496115_0000977
2043 Ga0496115_0028556
2044 Ga0496115_0046403
2045 Ga0496118_0011507
2046 Ga0496119_0037631
2047 Ga0496121_0018026
2048 Ga0496123_0117712
2049 Ga0496126_0032158
2050 Ga0501305_000074
2051 Ga0501315_020018
2052 Ga0501323_001695
2053 Ga0501031_0031770
2054 Ga0501031_0147207
2055 Ga0501031_0254269
2056 Ga0501034_0003614
2057 Ga0501034_0008086
2058 Ga0501034_0424783
2059 Ga0501034_0526046
2060 Ga0501036_0208565
2061 Ga0501036_0251923
2062 Ga0501038_0399863
2063 Ga0501039_0134957
2064 Ga0501039_0474616
2065 Ga0501040_0180022
2066 Ga0501041_0056572
2067 Ga0501042_0008502
2068 Ga0501042_0174625
2069 Ga0501046_0070217
2070 Ga0501046_0375285
2071 Ga0501047_0231494
2072 Ga0501048_0003213
2073 Ga0501067_0013192
2074 Ga0501067_0135074
2075 Ga0501067_0196631
2076 Ga0501069_0015105
2077 Ga0501069_0034622
2078 Ga0501070_0360042
2079 Ga0501071_0004803
2080 Ga0501071_0313739
2081 Ga0501072_0016348
2082 Ga0501072_0058802
2083 Ga0501073_0005689
2084 Ga0501074_0240097
2085 Ga0501075_0011893
2086 Ga0501075_0016294
2087 Ga0501075_0134359
2088 Ga0501075_0264931
2089 Ga0501076_0009211
2090 Ga0501076_0056448
2091 Ga0501076_0115789
2092 Ga0501077_0087652
2093 Ga0501077_0104087
2094 Ga0501077_0243081
2095 Ga0501079_0053043
2096 Ga0501079_0465431
2097 Ga0501079_0667556
2098 Ga0501080_0321316
2099 Ga0501080_0574583
2100 Ga0501081_0215001
2101 Ga0501081_0296578
2102 Ga0501083_0402086
2103 Ga0501035_0051311
2104 Ga0501035_0404190
2105 Ga0501044_0000121
2106 Ga0501044_0143341
2107 Ga0501044_0217000
2108 Ga0501044_0387311
2109 Ga0501044_0529673
2110 Ga0501045_0004485
2111 nmdc:mga03683_129_c1
2112 nmdc:mga00v17_13212_c1
2113 nmdc:mga00v17_200814_c1
2114 nmdc:mga0yw44_508548_c1
2115 nmdc:mga0k408_11688_c1
2116 nmdc:mga0k408_144694_c1
2117 nmdc:mga06z11_122_c1
2118 nmdc:mga07m45_32_c1
2119 nmdc:mga05p37_122920_c1
2120 nmdc:mga05p37_337590_c2
2121 nmdc:mga05p37_36050_c1
2122 nmdc:mga05p37_80215_c1
2123 nmdc:mga05p37_81276_c1
2124 nmdc:mga09592_232146_c1
2125 nmdc:mga09592_521896_c1
2126 nmdc:mga09592_96641_c1
2127 nmdc:mga0qj67_3985_c1
2128 nmdc:mga06r32_718632_c1
2129 nmdc:mga06r32_73091_c1
2130 nmdc:mga08y16_1471_c1
2131 nmdc:mga08y16_205774_c1
2132 nmdc:mga08y16_216002_c1
2133 nmdc:mga08y16_22400_c1
2134 nmdc:mga08y16_330478_c1
2135 nmdc:mga08y16_42715_c1
2136 nmdc:mga08y16_546602_c1
2137 nmdc:mga08y16_641077_c1
2138 nmdc:mga08y16_64310_c1
2139 nmdc:mga08y16_6740_c1
2140 nmdc:mga08y16_699456_c1
2141 nmdc:mga0n895_152814_c1
2142 nmdc:mga0n895_211173_c1
2143 nmdc:mga0n895_303697_c1
2144 nmdc:mga0n895_560099_c1
2145 nmdc:mga0n895_918341_c1
2146 nmdc:mga0rr50_176693_c1
2147 nmdc:mga0rr50_326234_c1
2148 nmdc:mga0rr50_52636_c1
2149 nmdc:mga08x19_10729_c1
2150 nmdc:mga08x19_77608_c1
2151 nmdc:mga0a205_125519_c1
2152 nmdc:mga0a205_184445_c1
2153 nmdc:mga0a205_210619_c1
2154 nmdc:mga0a205_390444_c1
2155 nmdc:mga0a205_69391_c1
2156 nmdc:mga0a205_75696_c1
2157 nmdc:mga0a205_79703_c1
2158 nmdc:mga0sz30_330_c1
2159 Ga0495601_0110986
2160 Ga0495601_0276349
2161 Ga0495612_0001883
2162 Ga0495612_0157631
2163 Ga0495595_0051307
2164 Ga0495619_0230491
2165 Ga0495619_0240162
2166 Ga0495619_0311284
2167 Ga0500643_000039
2168 Ga0500651_0111488
2169 Ga0500555_000967
2170 Ga0500562_030033
2171 Ga0500607_000721
2172 Ga0500616_0000357
2173 Ga0500616_0001815
2174 Ga0500645_003002
2175 Ga0500599_001640
2176 Ga0590071_003207
2177 Ga0590077_002487
2178 Ga0587080_022122
2179 Ga0587083_0022932
2180 Ga0501082_0017104
2181 Ga0501082_0050658
2182 Ga0501082_0179474
2183 Ga0530510_0109553
2184 Ga0530510_0165157
2185 2643951638
2186 2848298602
2187 2895881455
2188 2896256219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

29

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qg3-assembly1.cif.gz_A crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9664 5 225
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9567 19 225
7msz-assembly1.cif.gz_8 mtb 70sic in complex with mtbetta at trans_r1 state 0.9549 5 229
4qvi-assembly1.cif.gz_A crystal structure of mutant ribosomal protein m218l tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9543 1 225
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9532 3 225
ID Description Score Start End Superfamily
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9801 16 225 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9747 74 159 3.40.50.790
af_Q9P6M9_97_182_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9621 73 156 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9576 16 225 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9569 18 232 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A0T2Q8X2-F1-model_v4 Large ribosomal subunit protein uL1 0.9842 1 232 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A2A3MUJ0-F1-model_v4 Large ribosomal subunit protein uL1 0.9829 1 232 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A1D2TYW0-F1-model_v4 Large ribosomal subunit protein uL1 0.9825 1 232 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A437JBT7-F1-model_v4 Large ribosomal subunit protein uL1 0.9821 1 232 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A2D8B214-F1-model_v4 Ribosomal protein 0.9805 48 232 GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625

Map