F489937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 438 | 2188 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_100227164|Ga0097621_1002271641 |
| Length | 263 |
| Sequence | MAKHGKKFTAAAAQVEDRPYRLEEAIPLIQKVKFAKFDETVEVAMRLGVDPKHADQMVRGTVVLPHGLGTSKSVLVIAGADKQKEAQDAGADFVGGDEVVEKILGGWMEFDAVVATPDMMRAVGRLGKVLGPRGLMPNPKTGTVTMDVAKAVSEAKAGKLEYRTDRGANVHVAIGKKSFEQRALVENYVAVLDEIIRAKPSAAKGRYIRQITLTSTMGPGIHVDPARIRGILEELDESSSNQNRELGEQAGEAATVPAEQLPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 231 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 253 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 275 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 282 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 291 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 292 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 295 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 298 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 299 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 425 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 429 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 430 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 431 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 435 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 436 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 437 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 438 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.34 |
| Metatranscriptomes | 3.29 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.38 |
| Nodule | 0.18 |
| Rhizoplane | 2.47 |
| Rhizosphere | 92.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0097621_100227164 | 3300006237 | Bacteria | 1629 |
| 2 | JGI24741J21665_1019232 | 3300001915 | Bacteria | 1084 |
| 3 | JGI24738J21930_10013322 | 3300002075 | Bacteria | 1781 |
| 4 | Ga0006762J43184_106338 | 3300002872 | Bacteria | 2251 |
| 5 | rootL2_10370863 | 3300003322 | Bacteria | 1532 |
| 6 | rootH1_10061610 | 3300003323 | Bacteria | 2013 |
| 7 | JGI25407J50210_10003427 | 3300003373 | Bacteria | 3792 |
| 8 | Ga0058863_10052666 | 3300004799 | Bacteria | 4400 |
| 9 | Ga0058863_10170080 | 3300004799 | Bacteria | 2647 |
| 10 | Ga0058861_10168291 | 3300004800 | Bacteria | 5401 |
| 11 | Ga0058860_12210992 | 3300004801 | Bacteria | 980 |
| 12 | Ga0058862_10289804 | 3300004803 | Bacteria | 2236 |
| 13 | Ga0065704_10092589 | 3300005289 | Bacteria | 2645 |
| 14 | Ga0065704_10096689 | 3300005289 | Bacteria | 2422 |
| 15 | Ga0065712_10075001 | 3300005290 | Bacteria | 3957 |
| 16 | Ga0065712_10075551 | 3300005290 | Bacteria | 3839 |
| 17 | Ga0065712_10093133 | 3300005290 | Bacteria | 2305 |
| 18 | Ga0065715_10114950 | 3300005293 | Bacteria | 2432 |
| 19 | Ga0065715_10130388 | 3300005293 | Bacteria | 2027 |
| 20 | Ga0065715_10154036 | 3300005293 | Bacteria | 1693 |
| 21 | Ga0070658_10109288 | 3300005327 | Bacteria | 2289 |
| 22 | Ga0070676_10062231 | 3300005328 | Bacteria | 2220 |
| 23 | Ga0070676_10136059 | 3300005328 | Bacteria | 1559 |
| 24 | Ga0070683_100054844 | 3300005329 | Bacteria | 3696 |
| 25 | Ga0070683_100112701 | 3300005329 | Bacteria | 2567 |
| 26 | Ga0070690_100048689 | 3300005330 | Bacteria | 2700 |
| 27 | Ga0070690_100238709 | 3300005330 | Bacteria | 1281 |
| 28 | Ga0070670_100002037 | 3300005331 | Bacteria | 16542 |
| 29 | Ga0070670_100020542 | 3300005331 | Bacteria | 5678 |
| 30 | Ga0070670_100028660 | 3300005331 | Bacteria | 4792 |
| 31 | Ga0070670_100051264 | 3300005331 | Bacteria | 3545 |
| 32 | Ga0070670_100115234 | 3300005331 | Bacteria | 2317 |
| 33 | Ga0070670_100447223 | 3300005331 | Bacteria | 1145 |
| 34 | Ga0070677_10189635 | 3300005333 | Bacteria | 985 |
| 35 | Ga0068869_100050303 | 3300005334 | Bacteria | 3020 |
| 36 | Ga0068869_100310311 | 3300005334 | Bacteria | 1276 |
| 37 | Ga0070666_10010932 | 3300005335 | Bacteria | 5687 |
| 38 | Ga0070680_100001103 | 3300005336 | Bacteria | 19365 |
| 39 | Ga0070682_100038642 | 3300005337 | Bacteria | 2928 |
| 40 | Ga0070682_100099053 | 3300005337 | Bacteria | 1921 |
| 41 | Ga0070682_100313001 | 3300005337 | Bacteria | 1156 |
| 42 | Ga0068868_100003244 | 3300005338 | Bacteria | 11319 |
| 43 | Ga0068868_100065914 | 3300005338 | Bacteria | 2878 |
| 44 | Ga0068868_100268547 | 3300005338 | Bacteria | 1440 |
| 45 | Ga0068868_100279510 | 3300005338 | Bacteria | 1412 |
| 46 | Ga0070660_100002528 | 3300005339 | Bacteria | 12533 |
| 47 | Ga0070660_100047206 | 3300005339 | Bacteria | 3303 |
| 48 | Ga0070660_100236668 | 3300005339 | Bacteria | 1486 |
| 49 | Ga0070689_100055251 | 3300005340 | Bacteria | 3076 |
| 50 | Ga0070689_100056159 | 3300005340 | Bacteria | 3052 |
| 51 | Ga0070689_100116781 | 3300005340 | Bacteria | 2128 |
| 52 | Ga0070689_100279803 | 3300005340 | Bacteria | 1384 |
| 53 | Ga0070689_100413701 | 3300005340 | Bacteria | 1142 |
| 54 | Ga0070689_100493516 | 3300005340 | Bacteria | 1048 |
| 55 | Ga0070687_100139516 | 3300005343 | Bacteria | 1410 |
| 56 | Ga0070661_100005158 | 3300005344 | Bacteria | 8991 |
| 57 | Ga0070661_100060578 | 3300005344 | Bacteria | 2777 |
| 58 | Ga0070661_100074038 | 3300005344 | Bacteria | 2508 |
| 59 | Ga0070661_100084440 | 3300005344 | Bacteria | 2346 |
| 60 | Ga0070692_10141598 | 3300005345 | Bacteria | 1362 |
| 61 | Ga0070668_100144156 | 3300005347 | Bacteria | 1921 |
| 62 | Ga0070669_100004448 | 3300005353 | Bacteria | 10105 |
| 63 | Ga0070675_100006570 | 3300005354 | Bacteria | 8937 |
| 64 | Ga0070675_100029347 | 3300005354 | Bacteria | 4435 |
| 65 | Ga0070675_100053172 | 3300005354 | Bacteria | 3330 |
| 66 | Ga0070675_100133271 | 3300005354 | Bacteria | 2119 |
| 67 | Ga0070675_100188398 | 3300005354 | Bacteria | 1787 |
| 68 | Ga0070675_100555303 | 3300005354 | Bacteria | 1039 |
| 69 | Ga0070675_100909768 | 3300005354 | Bacteria | 806 |
| 70 | Ga0070671_100001395 | 3300005355 | Bacteria | 18046 |
| 71 | Ga0070671_100003462 | 3300005355 | Bacteria | 12327 |
| 72 | Ga0070671_100038179 | 3300005355 | Bacteria | 3986 |
| 73 | Ga0070671_100234024 | 3300005355 | Bacteria | 1559 |
| 74 | Ga0070674_100082765 | 3300005356 | Bacteria | 2296 |
| 75 | Ga0070673_100042705 | 3300005364 | Bacteria | 3497 |
| 76 | Ga0070673_100049506 | 3300005364 | Bacteria | 3281 |
| 77 | Ga0070673_100068302 | 3300005364 | Bacteria | 2845 |
| 78 | Ga0070673_100070911 | 3300005364 | Bacteria | 2798 |
| 79 | Ga0070673_100354362 | 3300005364 | Bacteria | 1303 |
| 80 | Ga0070688_100019652 | 3300005365 | Bacteria | 3916 |
| 81 | Ga0070688_100051080 | 3300005365 | Bacteria | 2578 |
| 82 | Ga0070667_100005841 | 3300005367 | Bacteria | 10266 |
| 83 | Ga0070667_100024096 | 3300005367 | Bacteria | 5054 |
| 84 | Ga0070667_100103151 | 3300005367 | Bacteria | 2465 |
| 85 | Ga0070709_10010452 | 3300005434 | Bacteria | 5143 |
| 86 | Ga0070709_10169441 | 3300005434 | Bacteria | 1525 |
| 87 | Ga0070714_100267983 | 3300005435 | Unclassified | 1583 |
| 88 | Ga0070713_100199272 | 3300005436 | Bacteria | 1807 |
| 89 | Ga0070710_10041040 | 3300005437 | Bacteria | 2552 |
| 90 | Ga0070710_10164859 | 3300005437 | Bacteria | 1377 |
| 91 | Ga0070701_10135483 | 3300005438 | Bacteria | 1403 |
| 92 | Ga0070711_100029381 | 3300005439 | Bacteria | 3627 |
| 93 | Ga0070711_100270155 | 3300005439 | Bacteria | 1341 |
| 94 | Ga0070711_100521809 | 3300005439 | Bacteria | 982 |
| 95 | Ga0070705_100205873 | 3300005440 | Bacteria | 1352 |
| 96 | Ga0070694_100103391 | 3300005444 | Bacteria | 2018 |
| 97 | Ga0070694_100264176 | 3300005444 | Bacteria | 1306 |
| 98 | Ga0070694_100507763 | 3300005444 | Bacteria | 960 |
| 99 | Ga0070708_100000449 | 3300005445 | Bacteria | 30862 |
| 100 | Ga0070708_100016101 | 3300005445 | Bacteria | 6196 |
| 101 | Ga0070708_100081988 | 3300005445 | Bacteria | 2921 |
| 102 | Ga0070708_100514838 | 3300005445 | Bacteria | 1129 |
| 103 | Ga0070708_100659104 | 3300005445 | Bacteria | 986 |
| 104 | Ga0070663_100339387 | 3300005455 | Bacteria | 1213 |
| 105 | Ga0070678_100203913 | 3300005456 | Bacteria | 1634 |
| 106 | Ga0070678_100220038 | 3300005456 | Bacteria | 1578 |
| 107 | Ga0070678_100303975 | 3300005456 | Bacteria | 1356 |
| 108 | Ga0070662_100029624 | 3300005457 | Bacteria | 3821 |
| 109 | Ga0070662_100032181 | 3300005457 | Bacteria | 3684 |
| 110 | Ga0070681_10087087 | 3300005458 | Bacteria | 3076 |
| 111 | Ga0068867_100057238 | 3300005459 | Bacteria | 2887 |
| 112 | Ga0068867_100251482 | 3300005459 | Bacteria | 1437 |
| 113 | Ga0070685_10001304 | 3300005466 | Bacteria | 13140 |
| 114 | Ga0070685_10021547 | 3300005466 | Bacteria | 3503 |
| 115 | Ga0070685_10052834 | 3300005466 | Bacteria | 2352 |
| 116 | Ga0070685_10054316 | 3300005466 | Bacteria | 2323 |
| 117 | Ga0070706_100004637 | 3300005467 | Bacteria | 13195 |
| 118 | Ga0070706_100616300 | 3300005467 | Bacteria | 1008 |
| 119 | Ga0070707_100006642 | 3300005468 | Bacteria | 10725 |
| 120 | Ga0070707_100012678 | 3300005468 | Bacteria | 7873 |
| 121 | Ga0070707_100048300 | 3300005468 | Bacteria | 4077 |
| 122 | Ga0070707_100108612 | 3300005468 | Bacteria | 2691 |
| 123 | Ga0070707_100202029 | 3300005468 | Bacteria | 1937 |
| 124 | Ga0070707_100437566 | 3300005468 | Bacteria | 1268 |
| 125 | Ga0070707_100567766 | 3300005468 | Bacteria | 1097 |
| 126 | Ga0070698_100005408 | 3300005471 | Bacteria | 13953 |
| 127 | Ga0070698_100437425 | 3300005471 | Bacteria | 1243 |
| 128 | Ga0070699_100393235 | 3300005518 | Bacteria | 1253 |
| 129 | Ga0070679_100034483 | 3300005530 | Bacteria | 5016 |
| 130 | Ga0070679_100198221 | 3300005530 | Bacteria | 1974 |
| 131 | Ga0070679_100321529 | 3300005530 | Bacteria | 1496 |
| 132 | Ga0070684_100034883 | 3300005535 | Bacteria | 4304 |
| 133 | Ga0070684_100411507 | 3300005535 | Bacteria | 1248 |
| 134 | Ga0070684_100537817 | 3300005535 | Bacteria | 1084 |
| 135 | Ga0070697_100000421 | 3300005536 | Bacteria | 32639 |
| 136 | Ga0070697_100128234 | 3300005536 | Bacteria | 2126 |
| 137 | Ga0070697_100337107 | 3300005536 | Bacteria | 1301 |
| 138 | Ga0068853_100008003 | 3300005539 | Bacteria | 8479 |
| 139 | Ga0070672_100019065 | 3300005543 | Bacteria | 4971 |
| 140 | Ga0070672_100030640 | 3300005543 | Bacteria | 4043 |
| 141 | Ga0070672_100204378 | 3300005543 | Bacteria | 1652 |
| 142 | Ga0070672_100292590 | 3300005543 | Bacteria | 1379 |
| 143 | Ga0070672_100809693 | 3300005543 | Bacteria | 824 |
| 144 | Ga0070686_100090815 | 3300005544 | Bacteria | 2042 |
| 145 | Ga0070695_100165636 | 3300005545 | Bacteria | 1556 |
| 146 | Ga0070696_100033545 | 3300005546 | Bacteria | 3527 |
| 147 | Ga0070696_100043851 | 3300005546 | Unclassified | 3096 |
| 148 | Ga0070696_100425358 | 3300005546 | Bacteria | 1043 |
| 149 | Ga0070665_100000269 | 3300005548 | Bacteria | 85401 |
| 150 | Ga0070665_100003003 | 3300005548 | Bacteria | 18207 |
| 151 | Ga0070665_100035708 | 3300005548 | Bacteria | 4999 |
| 152 | Ga0070665_100084036 | 3300005548 | Bacteria | 3188 |
| 153 | Ga0070665_100202373 | 3300005548 | Bacteria | 1986 |
| 154 | Ga0070665_100456954 | 3300005548 | Bacteria | 1287 |
| 155 | Ga0070704_100121260 | 3300005549 | Bacteria | 2009 |
| 156 | Ga0070704_100235952 | 3300005549 | Bacteria | 1495 |
| 157 | Ga0068855_100006099 | 3300005563 | Bacteria | 14696 |
| 158 | Ga0068855_100012247 | 3300005563 | Bacteria | 10366 |
| 159 | Ga0070664_100003979 | 3300005564 | Bacteria | 11884 |
| 160 | Ga0070664_100020586 | 3300005564 | Bacteria | 5432 |
| 161 | Ga0070664_100071441 | 3300005564 | Bacteria | 2974 |
| 162 | Ga0070664_100214501 | 3300005564 | Bacteria | 1720 |
| 163 | Ga0068857_100027185 | 3300005577 | Bacteria | 5046 |
| 164 | Ga0068857_100068453 | 3300005577 | Bacteria | 3160 |
| 165 | Ga0068857_100431895 | 3300005577 | Bacteria | 1229 |
| 166 | Ga0068854_100001336 | 3300005578 | Bacteria | 14869 |
| 167 | Ga0068856_100277726 | 3300005614 | Bacteria | 1692 |
| 168 | Ga0070702_100155882 | 3300005615 | Bacteria | 1471 |
| 169 | Ga0068852_100231142 | 3300005616 | Bacteria | 1763 |
| 170 | Ga0068852_100510264 | 3300005616 | Bacteria | 1198 |
| 171 | Ga0068852_100512776 | 3300005616 | Bacteria | 1196 |
| 172 | Ga0068859_100079340 | 3300005617 | Bacteria | 3322 |
| 173 | Ga0068859_100107960 | 3300005617 | Bacteria | 2844 |
| 174 | Ga0068859_100144299 | 3300005617 | Bacteria | 2455 |
| 175 | Ga0068859_100416509 | 3300005617 | Bacteria | 1440 |
| 176 | Ga0068859_100885240 | 3300005617 | Bacteria | 978 |
| 177 | Ga0068864_100008861 | 3300005618 | Bacteria | 8293 |
| 178 | Ga0068864_100062599 | 3300005618 | Bacteria | 3224 |
| 179 | Ga0068864_100279752 | 3300005618 | Bacteria | 1557 |
| 180 | Ga0068864_100333325 | 3300005618 | Bacteria | 1428 |
| 181 | Ga0068864_100799685 | 3300005618 | Bacteria | 927 |
| 182 | Ga0068861_100250954 | 3300005719 | Bacteria | 1510 |
| 183 | Ga0068861_100562106 | 3300005719 | Bacteria | 1041 |
| 184 | Ga0068870_10165125 | 3300005840 | Bacteria | 1317 |
| 185 | Ga0068870_10518570 | 3300005840 | Bacteria | 797 |
| 186 | Ga0068863_100000969 | 3300005841 | Bacteria | 28867 |
| 187 | Ga0068863_100012620 | 3300005841 | Bacteria | 8151 |
| 188 | Ga0068863_100036154 | 3300005841 | Bacteria | 4704 |
| 189 | Ga0068863_100138603 | 3300005841 | Bacteria | 2325 |
| 190 | Ga0068863_100261002 | 3300005841 | Bacteria | 1675 |
| 191 | Ga0068863_100268294 | 3300005841 | Bacteria | 1652 |
| 192 | Ga0068858_100007152 | 3300005842 | Bacteria | 10830 |
| 193 | Ga0068858_100078881 | 3300005842 | Bacteria | 3060 |
| 194 | Ga0068858_100271131 | 3300005842 | Bacteria | 1615 |
| 195 | Ga0068858_100386397 | 3300005842 | Bacteria | 1343 |
| 196 | Ga0068860_100028140 | 3300005843 | Bacteria | 5410 |
| 197 | Ga0068860_100131686 | 3300005843 | Bacteria | 2400 |
| 198 | Ga0068860_100229215 | 3300005843 | Bacteria | 1805 |
| 199 | Ga0068860_100567637 | 3300005843 | Bacteria | 1138 |
| 200 | Ga0068860_100789425 | 3300005843 | Bacteria | 963 |
| 201 | Ga0068862_100185583 | 3300005844 | Bacteria | 1869 |
| 202 | Ga0068862_100246105 | 3300005844 | Bacteria | 1628 |
| 203 | Ga0081455_10004528 | 3300005937 | Bacteria | 15525 |
| 204 | Ga0081455_10153630 | 3300005937 | Bacteria | 1772 |
| 205 | Ga0081538_10000250 | 3300005981 | Bacteria | 60946 |
| 206 | Ga0081538_10002047 | 3300005981 | Bacteria | 20127 |
| 207 | Ga0081538_10044880 | 3300005981 | Bacteria | 2749 |
| 208 | Ga0070717_10627985 | 3300006028 | Bacteria | 975 |
| 209 | Ga0075368_10005180 | 3300006042 | Bacteria | 4472 |
| 210 | Ga0075364_10115498 | 3300006051 | Bacteria | 1794 |
| 211 | Ga0070712_100058727 | 3300006175 | Bacteria | 2707 |
| 212 | Ga0070712_100280953 | 3300006175 | Bacteria | 1341 |
| 213 | Ga0075362_10000613 | 3300006177 | Bacteria | 10441 |
| 214 | Ga0075367_10011391 | 3300006178 | Bacteria | 4703 |
| 215 | Ga0075369_10002444 | 3300006186 | Bacteria | 6625 |
| 216 | Ga0075366_10163935 | 3300006195 | Bacteria | 1347 |
| 217 | Ga0097621_100020011 | 3300006237 | Bacteria | 5152 |
| 218 | Ga0097621_100043872 | 3300006237 | Bacteria | 3606 |
| 219 | Ga0097621_100046954 | 3300006237 | Bacteria | 3496 |
| 220 | Ga0097621_100067794 | 3300006237 | Bacteria | 2941 |
| 221 | Ga0097621_100100789 | 3300006237 | Bacteria | 2429 |
| 222 | Ga0097621_100147274 | 3300006237 | Bacteria | 2017 |
| 223 | Ga0097621_100156444 | 3300006237 | Unclassified | 1957 |
| 224 | Ga0097621_100397873 | 3300006237 | Bacteria | 1233 |
| 225 | Ga0075370_10164808 | 3300006353 | Bacteria | 1301 |
| 226 | Ga0068871_100013592 | 3300006358 | Bacteria | 6044 |
| 227 | Ga0068871_100028407 | 3300006358 | Bacteria | 4384 |
| 228 | Ga0068871_100041568 | 3300006358 | Bacteria | 3687 |
| 229 | Ga0068871_100061214 | 3300006358 | Bacteria | 3073 |
| 230 | Ga0068871_100104558 | 3300006358 | Bacteria | 2375 |
| 231 | Ga0068871_100331665 | 3300006358 | Unclassified | 1342 |
| 232 | Ga0068871_100413750 | 3300006358 | Bacteria | 1203 |
| 233 | Ga0068871_100505636 | 3300006358 | Bacteria | 1090 |
| 234 | Ga0075428_100555731 | 3300006844 | Bacteria | 1227 |
| 235 | Ga0075428_100759421 | 3300006844 | Bacteria | 1031 |
| 236 | Ga0075430_100189597 | 3300006846 | Bacteria | 1709 |
| 237 | Ga0075431_100071481 | 3300006847 | Bacteria | 3580 |
| 238 | Ga0075431_100081000 | 3300006847 | Bacteria | 3352 |
| 239 | Ga0075431_100131547 | 3300006847 | Bacteria | 2580 |
| 240 | Ga0075431_100316046 | 3300006847 | Bacteria | 1576 |
| 241 | Ga0075431_101002333 | 3300006847 | Bacteria | 802 |
| 242 | Ga0075433_10049769 | 3300006852 | Bacteria | 3646 |
| 243 | Ga0075433_10170130 | 3300006852 | Bacteria | 1939 |
| 244 | Ga0075433_10187506 | 3300006852 | Bacteria | 1840 |
| 245 | Ga0075433_10209882 | 3300006852 | Bacteria | 1731 |
| 246 | Ga0075433_10502774 | 3300006852 | Bacteria | 1067 |
| 247 | Ga0075434_100058033 | 3300006871 | Bacteria | 3847 |
| 248 | Ga0075434_100084832 | 3300006871 | Bacteria | 3166 |
| 249 | Ga0075434_100086909 | 3300006871 | Bacteria | 3127 |
| 250 | Ga0075434_100142561 | 3300006871 | Bacteria | 2416 |
| 251 | Ga0075429_100066027 | 3300006880 | Bacteria | 3149 |
| 252 | Ga0075429_100196316 | 3300006880 | Bacteria | 1768 |
| 253 | Ga0075429_100497079 | 3300006880 | Bacteria | 1069 |
| 254 | Ga0068865_100055272 | 3300006881 | Bacteria | 2761 |
| 255 | Ga0068865_100058801 | 3300006881 | Bacteria | 2687 |
| 256 | Ga0068865_100177213 | 3300006881 | Bacteria | 1639 |
| 257 | Ga0068865_100486097 | 3300006881 | Bacteria | 1027 |
| 258 | Ga0068865_100815937 | 3300006881 | Bacteria | 806 |
| 259 | Ga0097620_100079345 | 3300006931 | Bacteria | 3322 |
| 260 | Ga0097620_100107978 | 3300006931 | Bacteria | 2844 |
| 261 | Ga0097620_100144286 | 3300006931 | Bacteria | 2455 |
| 262 | Ga0097620_100416506 | 3300006931 | Bacteria | 1440 |
| 263 | Ga0097620_100885205 | 3300006931 | Bacteria | 978 |
| 264 | Ga0079104_1051324 | 3300006946 | Bacteria | 918 |
| 265 | Ga0075435_100064802 | 3300007076 | Bacteria | 2970 |
| 266 | Ga0075435_100660785 | 3300007076 | Bacteria | 907 |
| 267 | Ga0099794_10073987 | 3300007265 | Bacteria | 1673 |
| 268 | Ga0099794_10075534 | 3300007265 | Bacteria | 1656 |
| 269 | Ga0099794_10155250 | 3300007265 | Bacteria | 1163 |
| 270 | Ga0099795_10022459 | 3300007788 | Bacteria | 2082 |
| 271 | Ga0105251_10005138 | 3300009011 | Bacteria | 8649 |
| 272 | Ga0105250_10110446 | 3300009092 | Bacteria | 1126 |
| 273 | Ga0105240_10341619 | 3300009093 | Bacteria | 1700 |
| 274 | Ga0111539_10007710 | 3300009094 | Bacteria | 13748 |
| 275 | Ga0111539_10021601 | 3300009094 | Bacteria | 7917 |
| 276 | Ga0111539_10044169 | 3300009094 | Bacteria | 5339 |
| 277 | Ga0111539_10048633 | 3300009094 | Bacteria | 5062 |
| 278 | Ga0111539_10053750 | 3300009094 | Bacteria | 4794 |
| 279 | Ga0111539_10060925 | 3300009094 | Bacteria | 4471 |
| 280 | Ga0111539_10160076 | 3300009094 | Bacteria | 2633 |
| 281 | Ga0111539_10207560 | 3300009094 | Bacteria | 2283 |
| 282 | Ga0111539_10365710 | 3300009094 | Bacteria | 1679 |
| 283 | Ga0111539_10442518 | 3300009094 | Bacteria | 1513 |
| 284 | Ga0111539_10984265 | 3300009094 | Bacteria | 981 |
| 285 | Ga0105245_10514704 | 3300009098 | Bacteria | 1214 |
| 286 | Ga0114129_10024758 | 3300009147 | Bacteria | 8509 |
| 287 | Ga0114129_10066829 | 3300009147 | Bacteria | 5014 |
| 288 | Ga0114129_10128790 | 3300009147 | Bacteria | 3478 |
| 289 | Ga0114129_10274343 | 3300009147 | Bacteria | 2255 |
| 290 | Ga0114129_10388655 | 3300009147 | Bacteria | 1841 |
| 291 | Ga0114129_10467275 | 3300009147 | Bacteria | 1652 |
| 292 | Ga0114129_10521481 | 3300009147 | Bacteria | 1549 |
| 293 | Ga0114129_11067456 | 3300009147 | Bacteria | 1013 |
| 294 | Ga0105243_10010720 | 3300009148 | Bacteria | 6943 |
| 295 | Ga0105243_10081632 | 3300009148 | Bacteria | 2640 |
| 296 | Ga0105242_10003471 | 3300009176 | Bacteria | 12255 |
| 297 | Ga0105242_10097645 | 3300009176 | Bacteria | 2484 |
| 298 | Ga0105242_10099116 | 3300009176 | Bacteria | 2466 |
| 299 | Ga0105242_10164471 | 3300009176 | Bacteria | 1945 |
| 300 | Ga0105242_10830964 | 3300009176 | Unclassified | 917 |
| 301 | Ga0105248_10001106 | 3300009177 | Bacteria | 29895 |
| 302 | Ga0105248_10009115 | 3300009177 | Bacteria | 10916 |
| 303 | Ga0105248_10026939 | 3300009177 | Bacteria | 6392 |
| 304 | Ga0105248_10061024 | 3300009177 | Bacteria | 4233 |
| 305 | Ga0105248_10093930 | 3300009177 | Bacteria | 3378 |
| 306 | Ga0105249_10075568 | 3300009553 | Bacteria | 3121 |
| 307 | Ga0105249_10111457 | 3300009553 | Bacteria | 2587 |
| 308 | Ga0105249_10287756 | 3300009553 | Bacteria | 1644 |
| 309 | Ga0105249_10942128 | 3300009553 | Bacteria | 931 |
| 310 | Ga0105249_10969848 | 3300009553 | Bacteria | 918 |
| 311 | Ga0099796_10114967 | 3300010159 | Bacteria | 1028 |
| 312 | Ga0105239_10050469 | 3300010375 | Bacteria | 4563 |
| 313 | Ga0105239_11348957 | 3300010375 | Bacteria | 823 |
| 314 | Ga0105246_10002809 | 3300011119 | Bacteria | 10542 |
| 315 | Ga0105246_10268373 | 3300011119 | Bacteria | 1363 |
| 316 | Ga0105246_10271338 | 3300011119 | Bacteria | 1356 |
| 317 | Ga0105246_10327917 | 3300011119 | Bacteria | 1247 |
| 318 | Ga0157373_10005741 | 3300013100 | Bacteria | 9295 |
| 319 | Ga0157373_10211073 | 3300013100 | Bacteria | 1369 |
| 320 | Ga0157373_10622710 | 3300013100 | Bacteria | 787 |
| 321 | Ga0157371_10000847 | 3300013102 | Bacteria | 34925 |
| 322 | Ga0157371_10069396 | 3300013102 | Bacteria | 2496 |
| 323 | Ga0157370_10000897 | 3300013104 | Bacteria | 37754 |
| 324 | Ga0157370_10278373 | 3300013104 | Bacteria | 1546 |
| 325 | Ga0157370_10537202 | 3300013104 | Bacteria | 1072 |
| 326 | Ga0157369_10005204 | 3300013105 | Bacteria | 15201 |
| 327 | Ga0157374_10011913 | 3300013296 | Bacteria | 7547 |
| 328 | Ga0157374_10115202 | 3300013296 | Bacteria | 2589 |
| 329 | Ga0157374_10361456 | 3300013296 | Bacteria | 1444 |
| 330 | Ga0157374_11112997 | 3300013296 | Bacteria | 810 |
| 331 | Ga0157378_10032994 | 3300013297 | Bacteria | 4576 |
| 332 | Ga0157378_10037612 | 3300013297 | Bacteria | 4288 |
| 333 | Ga0157378_10072564 | 3300013297 | Bacteria | 3093 |
| 334 | Ga0157378_10096220 | 3300013297 | Bacteria | 2698 |
| 335 | Ga0157378_10110233 | 3300013297 | Bacteria | 2522 |
| 336 | Ga0157378_10135288 | 3300013297 | Bacteria | 2284 |
| 337 | Ga0157378_10347197 | 3300013297 | Bacteria | 1449 |
| 338 | Ga0157378_10895426 | 3300013297 | Bacteria | 918 |
| 339 | Ga0163162_10022654 | 3300013306 | Bacteria | 6193 |
| 340 | Ga0163162_10057886 | 3300013306 | Bacteria | 3903 |
| 341 | Ga0163162_10090809 | 3300013306 | Bacteria | 3136 |
| 342 | Ga0163162_10309798 | 3300013306 | Bacteria | 1711 |
| 343 | Ga0163162_11237993 | 3300013306 | Bacteria | 847 |
| 344 | Ga0157372_10004693 | 3300013307 | Bacteria | 14512 |
| 345 | Ga0157375_10004866 | 3300013308 | Bacteria | 11670 |
| 346 | Ga0157375_10008115 | 3300013308 | Bacteria | 9188 |
| 347 | Ga0157375_10051985 | 3300013308 | Bacteria | 4026 |
| 348 | Ga0157375_10061324 | 3300013308 | Bacteria | 3734 |
| 349 | Ga0157375_10137739 | 3300013308 | Bacteria | 2566 |
| 350 | Ga0157375_10148350 | 3300013308 | Bacteria | 2478 |
| 351 | Ga0157375_10256642 | 3300013308 | Bacteria | 1910 |
| 352 | Ga0163163_10000446 | 3300014325 | Bacteria | 37797 |
| 353 | Ga0163163_10055176 | 3300014325 | Bacteria | 3927 |
| 354 | Ga0163163_10096297 | 3300014325 | Bacteria | 2979 |
| 355 | Ga0163163_10131576 | 3300014325 | Bacteria | 2542 |
| 356 | Ga0163163_10204195 | 3300014325 | Bacteria | 2024 |
| 357 | Ga0163163_10245365 | 3300014325 | Bacteria | 1841 |
| 358 | Ga0163163_10425161 | 3300014325 | Bacteria | 1387 |
| 359 | Ga0157380_10145568 | 3300014326 | Bacteria | 2042 |
| 360 | Ga0157380_10217623 | 3300014326 | Bacteria | 1707 |
| 361 | Ga0157380_10250345 | 3300014326 | Bacteria | 1603 |
| 362 | Ga0157380_10473177 | 3300014326 | Bacteria | 1210 |
| 363 | Ga0157380_10502709 | 3300014326 | Bacteria | 1178 |
| 364 | Ga0157380_10564165 | 3300014326 | Bacteria | 1119 |
| 365 | Ga0157380_10768303 | 3300014326 | Bacteria | 977 |
| 366 | Ga0157379_10000562 | 3300014968 | Bacteria | 29935 |
| 367 | Ga0157379_10100279 | 3300014968 | Bacteria | 2599 |
| 368 | Ga0157376_10000014 | 3300014969 | Bacteria | 303001 |
| 369 | Ga0157376_10036580 | 3300014969 | Bacteria | 3978 |
| 370 | Ga0157376_10057875 | 3300014969 | Bacteria | 3244 |
| 371 | Ga0157376_10060869 | 3300014969 | Bacteria | 3172 |
| 372 | Ga0157376_10074456 | 3300014969 | Bacteria | 2894 |
| 373 | Ga0157376_10085537 | 3300014969 | Bacteria | 2717 |
| 374 | Ga0157376_10151767 | 3300014969 | Bacteria | 2090 |
| 375 | Ga0157376_10159200 | 3300014969 | Bacteria | 2045 |
| 376 | Ga0157376_10206815 | 3300014969 | Unclassified | 1809 |
| 377 | Ga0157376_10229726 | 3300014969 | Bacteria | 1723 |
| 378 | Ga0157376_10288977 | 3300014969 | Bacteria | 1547 |
| 379 | Ga0157376_11188262 | 3300014969 | Bacteria | 791 |
| 380 | Ga0163161_10030399 | 3300017792 | Bacteria | 3844 |
| 381 | Ga0163161_10506165 | 3300017792 | Unclassified | 984 |
| 382 | Ga0184599_122998 | 3300019188 | Bacteria | 1539 |
| 383 | Ga0206349_1555407 | 3300020075 | Bacteria | 1637 |
| 384 | Ga0206351_10760636 | 3300020077 | Bacteria | 2109 |
| 385 | Ga0206352_10266958 | 3300020078 | Bacteria | 2156 |
| 386 | Ga0206354_10096804 | 3300020081 | Bacteria | 2168 |
| 387 | Ga0213876_10025237 | 3300021384 | Bacteria | 3137 |
| 388 | Ga0213876_10027791 | 3300021384 | Bacteria | 2983 |
| 389 | Ga0213876_10115472 | 3300021384 | Bacteria | 1425 |
| 390 | Ga0213875_10007729 | 3300021388 | Bacteria | 5532 |
| 391 | Ga0224712_10002961 | 3300022467 | Bacteria | 4308 |
| 392 | Ga0224712_10026872 | 3300022467 | Bacteria | 2040 |
| 393 | Ga0228598_1011982 | 3300024227 | Bacteria | 1724 |
| 394 | Ga0207697_10017447 | 3300025315 | Bacteria | 2950 |
| 395 | Ga0207697_10047774 | 3300025315 | Bacteria | 1765 |
| 396 | Ga0207697_10124793 | 3300025315 | Bacteria | 1110 |
| 397 | Ga0207656_10133099 | 3300025321 | Bacteria | 1166 |
| 398 | Ga0207713_1001799 | 3300025735 | Bacteria | 16387 |
| 399 | Ga0207653_10000517 | 3300025885 | Bacteria | 14726 |
| 400 | Ga0207680_10000784 | 3300025903 | Bacteria | 15032 |
| 401 | Ga0207699_10008729 | 3300025906 | Bacteria | 5014 |
| 402 | Ga0207699_10023466 | 3300025906 | Bacteria | 3357 |
| 403 | Ga0207645_10236826 | 3300025907 | Bacteria | 1206 |
| 404 | Ga0207643_10161510 | 3300025908 | Bacteria | 1348 |
| 405 | Ga0207643_10259611 | 3300025908 | Bacteria | 1072 |
| 406 | Ga0207705_10052692 | 3300025909 | Bacteria | 2930 |
| 407 | Ga0207705_10086103 | 3300025909 | Bacteria | 2296 |
| 408 | Ga0207705_10207334 | 3300025909 | Bacteria | 1486 |
| 409 | Ga0207684_10133583 | 3300025910 | Bacteria | 2130 |
| 410 | Ga0207684_10571806 | 3300025910 | Bacteria | 966 |
| 411 | Ga0207654_10047172 | 3300025911 | Bacteria | 2460 |
| 412 | Ga0207707_10016149 | 3300025912 | Bacteria | 6513 |
| 413 | Ga0207707_10028950 | 3300025912 | Bacteria | 4841 |
| 414 | Ga0207707_10075784 | 3300025912 | Bacteria | 2936 |
| 415 | Ga0207695_10140453 | 3300025913 | Bacteria | 2364 |
| 416 | Ga0207693_10010686 | 3300025915 | Bacteria | 7450 |
| 417 | Ga0207693_10030426 | 3300025915 | Bacteria | 4264 |
| 418 | Ga0207693_10137685 | 3300025915 | Bacteria | 1920 |
| 419 | Ga0207693_10146737 | 3300025915 | Bacteria | 1855 |
| 420 | Ga0207663_10004574 | 3300025916 | Bacteria | 6896 |
| 421 | Ga0207660_10009046 | 3300025917 | Bacteria | 6449 |
| 422 | Ga0207660_10018722 | 3300025917 | Bacteria | 4621 |
| 423 | Ga0207660_10027520 | 3300025917 | Bacteria | 3881 |
| 424 | Ga0207660_10130856 | 3300025917 | Bacteria | 1910 |
| 425 | Ga0207660_10211390 | 3300025917 | Bacteria | 1519 |
| 426 | Ga0207660_10623446 | 3300025917 | Bacteria | 879 |
| 427 | Ga0207662_10013063 | 3300025918 | Bacteria | 4639 |
| 428 | Ga0207662_10133008 | 3300025918 | Bacteria | 1570 |
| 429 | Ga0207662_10162624 | 3300025918 | Bacteria | 1427 |
| 430 | Ga0207657_10000083 | 3300025919 | Bacteria | 89409 |
| 431 | Ga0207657_10014470 | 3300025919 | Bacteria | 7702 |
| 432 | Ga0207657_10447531 | 3300025919 | Bacteria | 1014 |
| 433 | Ga0207649_10001847 | 3300025920 | Bacteria | 12102 |
| 434 | Ga0207649_10028375 | 3300025920 | Bacteria | 3294 |
| 435 | Ga0207649_10065156 | 3300025920 | Bacteria | 2305 |
| 436 | Ga0207652_10012202 | 3300025921 | Bacteria | 6943 |
| 437 | Ga0207652_10025964 | 3300025921 | Bacteria | 4874 |
| 438 | Ga0207652_10033139 | 3300025921 | Bacteria | 4348 |
| 439 | Ga0207652_10059080 | 3300025921 | Bacteria | 3305 |
| 440 | Ga0207646_10001680 | 3300025922 | Bacteria | 26958 |
| 441 | Ga0207646_10017051 | 3300025922 | Bacteria | 6807 |
| 442 | Ga0207646_10092622 | 3300025922 | Bacteria | 2705 |
| 443 | Ga0207646_10097917 | 3300025922 | Bacteria | 2628 |
| 444 | Ga0207646_10100701 | 3300025922 | Bacteria | 2590 |
| 445 | Ga0207646_10159720 | 3300025922 | Bacteria | 2033 |
| 446 | Ga0207646_10370025 | 3300025922 | Bacteria | 1295 |
| 447 | Ga0207681_10003272 | 3300025923 | Bacteria | 10141 |
| 448 | Ga0207681_10036207 | 3300025923 | Bacteria | 3255 |
| 449 | Ga0207681_10050520 | 3300025923 | Bacteria | 2814 |
| 450 | Ga0207681_10326746 | 3300025923 | Bacteria | 1221 |
| 451 | Ga0207650_10002276 | 3300025925 | Bacteria | 13394 |
| 452 | Ga0207650_10038113 | 3300025925 | Bacteria | 3507 |
| 453 | Ga0207650_10108714 | 3300025925 | Bacteria | 2144 |
| 454 | Ga0207650_10163969 | 3300025925 | Bacteria | 1762 |
| 455 | Ga0207650_10287093 | 3300025925 | Bacteria | 1341 |
| 456 | Ga0207659_10000169 | 3300025926 | Bacteria | 39159 |
| 457 | Ga0207659_10000843 | 3300025926 | Bacteria | 18152 |
| 458 | Ga0207659_10002914 | 3300025926 | Bacteria | 10190 |
| 459 | Ga0207659_10056582 | 3300025926 | Bacteria | 2810 |
| 460 | Ga0207659_10253138 | 3300025926 | Bacteria | 1430 |
| 461 | Ga0207659_10304650 | 3300025926 | Bacteria | 1310 |
| 462 | Ga0207659_10593370 | 3300025926 | Bacteria | 944 |
| 463 | Ga0207700_10040381 | 3300025928 | Bacteria | 3405 |
| 464 | Ga0207700_10263954 | 3300025928 | Bacteria | 1475 |
| 465 | Ga0207644_10001196 | 3300025931 | Bacteria | 16709 |
| 466 | Ga0207644_10006842 | 3300025931 | Bacteria | 7430 |
| 467 | Ga0207644_10026639 | 3300025931 | Bacteria | 3986 |
| 468 | Ga0207644_10097083 | 3300025931 | Bacteria | 2207 |
| 469 | Ga0207644_10167225 | 3300025931 | Bacteria | 1714 |
| 470 | Ga0207690_10000356 | 3300025932 | Bacteria | 30378 |
| 471 | Ga0207690_10025822 | 3300025932 | Bacteria | 3693 |
| 472 | Ga0207706_10005054 | 3300025933 | Bacteria | 12317 |
| 473 | Ga0207706_10010712 | 3300025933 | Bacteria | 8374 |
| 474 | Ga0207706_10253038 | 3300025933 | Bacteria | 1538 |
| 475 | Ga0207686_10000496 | 3300025934 | Bacteria | 25802 |
| 476 | Ga0207709_10001154 | 3300025935 | Bacteria | 19226 |
| 477 | Ga0207709_10147840 | 3300025935 | Bacteria | 1623 |
| 478 | Ga0207709_10157949 | 3300025935 | Bacteria | 1578 |
| 479 | Ga0207709_10239338 | 3300025935 | Bacteria | 1319 |
| 480 | Ga0207709_10653526 | 3300025935 | Bacteria | 837 |
| 481 | Ga0207670_10007709 | 3300025936 | Bacteria | 6033 |
| 482 | Ga0207670_10071199 | 3300025936 | Bacteria | 2404 |
| 483 | Ga0207670_10165066 | 3300025936 | Bacteria | 1656 |
| 484 | Ga0207670_10202826 | 3300025936 | Bacteria | 1508 |
| 485 | Ga0207670_10295411 | 3300025936 | Bacteria | 1267 |
| 486 | Ga0207669_10337532 | 3300025937 | Bacteria | 1159 |
| 487 | Ga0207704_10003207 | 3300025938 | Bacteria | 7407 |
| 488 | Ga0207704_10023061 | 3300025938 | Bacteria | 3347 |
| 489 | Ga0207704_10084243 | 3300025938 | Bacteria | 2066 |
| 490 | Ga0207704_10097938 | 3300025938 | Bacteria | 1947 |
| 491 | Ga0207704_10245352 | 3300025938 | Bacteria | 1341 |
| 492 | Ga0207665_10016663 | 3300025939 | Bacteria | 4826 |
| 493 | Ga0207665_10041443 | 3300025939 | Bacteria | 3075 |
| 494 | Ga0207691_10023258 | 3300025940 | Bacteria | 5834 |
| 495 | Ga0207691_10059354 | 3300025940 | Bacteria | 3479 |
| 496 | Ga0207691_10121064 | 3300025940 | Bacteria | 2319 |
| 497 | Ga0207711_10002561 | 3300025941 | Bacteria | 16200 |
| 498 | Ga0207711_10002690 | 3300025941 | Bacteria | 15714 |
| 499 | Ga0207711_10016136 | 3300025941 | Bacteria | 6200 |
| 500 | Ga0207711_10070683 | 3300025941 | Bacteria | 3027 |
| 501 | Ga0207711_10136373 | 3300025941 | Bacteria | 2205 |
| 502 | Ga0207689_10052132 | 3300025942 | Bacteria | 3372 |
| 503 | Ga0207689_10095467 | 3300025942 | Bacteria | 2442 |
| 504 | Ga0207689_10097667 | 3300025942 | Bacteria | 2413 |
| 505 | Ga0207661_10071811 | 3300025944 | Bacteria | 2830 |
| 506 | Ga0207679_10002743 | 3300025945 | Bacteria | 10895 |
| 507 | Ga0207679_10003915 | 3300025945 | Bacteria | 9241 |
| 508 | Ga0207679_10191930 | 3300025945 | Bacteria | 1699 |
| 509 | Ga0207679_10303118 | 3300025945 | Bacteria | 1378 |
| 510 | Ga0207679_10439920 | 3300025945 | Bacteria | 1154 |
| 511 | Ga0207679_10443729 | 3300025945 | Bacteria | 1150 |
| 512 | Ga0207667_10004004 | 3300025949 | Bacteria | 18100 |
| 513 | Ga0207667_10004990 | 3300025949 | Bacteria | 16214 |
| 514 | Ga0207651_10039011 | 3300025960 | Bacteria | 3127 |
| 515 | Ga0207651_10041980 | 3300025960 | Bacteria | 3040 |
| 516 | Ga0207651_10145313 | 3300025960 | Bacteria | 1838 |
| 517 | Ga0207651_10227752 | 3300025960 | Bacteria | 1511 |
| 518 | Ga0207651_10469648 | 3300025960 | Bacteria | 1082 |
| 519 | Ga0207712_10156408 | 3300025961 | Bacteria | 1766 |
| 520 | Ga0207712_10626211 | 3300025961 | Bacteria | 933 |
| 521 | Ga0207668_10049299 | 3300025972 | Bacteria | 2894 |
| 522 | Ga0207668_10129579 | 3300025972 | Bacteria | 1924 |
| 523 | Ga0207640_10003576 | 3300025981 | Bacteria | 8379 |
| 524 | Ga0207640_10004793 | 3300025981 | Bacteria | 7348 |
| 525 | Ga0207658_10005136 | 3300025986 | Bacteria | 9017 |
| 526 | Ga0207658_10014653 | 3300025986 | Bacteria | 5370 |
| 527 | Ga0207658_10030281 | 3300025986 | Bacteria | 3830 |
| 528 | Ga0207677_10010265 | 3300026023 | Bacteria | 5295 |
| 529 | Ga0207677_10043856 | 3300026023 | Bacteria | 2976 |
| 530 | Ga0207677_10274519 | 3300026023 | Bacteria | 1381 |
| 531 | Ga0207703_10005252 | 3300026035 | Bacteria | 10445 |
| 532 | Ga0207703_10006761 | 3300026035 | Bacteria | 9146 |
| 533 | Ga0207703_10255747 | 3300026035 | Bacteria | 1581 |
| 534 | Ga0207703_10314334 | 3300026035 | Bacteria | 1432 |
| 535 | Ga0207639_10000175 | 3300026041 | Bacteria | 50016 |
| 536 | Ga0207678_10009536 | 3300026067 | Bacteria | 8540 |
| 537 | Ga0207708_10052924 | 3300026075 | Bacteria | 3092 |
| 538 | Ga0207708_10132098 | 3300026075 | Bacteria | 1953 |
| 539 | Ga0207708_10184539 | 3300026075 | Bacteria | 1657 |
| 540 | Ga0207708_10480439 | 3300026075 | Bacteria | 1039 |
| 541 | Ga0207702_10560982 | 3300026078 | Bacteria | 1118 |
| 542 | Ga0207641_10000293 | 3300026088 | Bacteria | 62674 |
| 543 | Ga0207641_10006158 | 3300026088 | Bacteria | 10152 |
| 544 | Ga0207641_10036534 | 3300026088 | Bacteria | 4101 |
| 545 | Ga0207641_10115321 | 3300026088 | Bacteria | 2388 |
| 546 | Ga0207641_10123947 | 3300026088 | Bacteria | 2310 |
| 547 | Ga0207641_10198459 | 3300026088 | Bacteria | 1848 |
| 548 | Ga0207641_10206307 | 3300026088 | Bacteria | 1815 |
| 549 | Ga0207641_10361827 | 3300026088 | Bacteria | 1385 |
| 550 | Ga0207648_10135911 | 3300026089 | Bacteria | 2166 |
| 551 | Ga0207648_10301506 | 3300026089 | Bacteria | 1437 |
| 552 | Ga0207676_10003247 | 3300026095 | Bacteria | 11575 |
| 553 | Ga0207676_10008606 | 3300026095 | Bacteria | 7251 |
| 554 | Ga0207676_10072948 | 3300026095 | Bacteria | 2761 |
| 555 | Ga0207676_10292740 | 3300026095 | Bacteria | 1483 |
| 556 | Ga0207674_10013628 | 3300026116 | Bacteria | 9005 |
| 557 | Ga0207674_10041311 | 3300026116 | Bacteria | 4770 |
| 558 | Ga0207674_10082680 | 3300026116 | Bacteria | 3212 |
| 559 | Ga0207674_10083057 | 3300026116 | Bacteria | 3203 |
| 560 | Ga0207674_10217764 | 3300026116 | Bacteria | 1858 |
| 561 | Ga0207674_10381506 | 3300026116 | Bacteria | 1363 |
| 562 | Ga0207675_100106120 | 3300026118 | Bacteria | 2648 |
| 563 | Ga0207675_100125229 | 3300026118 | Bacteria | 2434 |
| 564 | Ga0207675_100251201 | 3300026118 | Bacteria | 1712 |
| 565 | Ga0207675_100418708 | 3300026118 | Bacteria | 1322 |
| 566 | Ga0207683_10041648 | 3300026121 | Bacteria | 4011 |
| 567 | Ga0207683_10060510 | 3300026121 | Bacteria | 3329 |
| 568 | Ga0207683_10079749 | 3300026121 | Bacteria | 2903 |
| 569 | Ga0207683_10112116 | 3300026121 | Bacteria | 2443 |
| 570 | Ga0207698_10342520 | 3300026142 | Bacteria | 1409 |
| 571 | Ga0207698_10899905 | 3300026142 | Bacteria | 892 |
| 572 | Ga0209281_1018955 | 3300027111 | Bacteria | 1366 |
| 573 | Ga0209983_1043383 | 3300027665 | Bacteria | 976 |
| 574 | Ga0209588_1023526 | 3300027671 | Bacteria | 1942 |
| 575 | Ga0209588_1023623 | 3300027671 | Bacteria | 1939 |
| 576 | Ga0209588_1069668 | 3300027671 | Bacteria | 1136 |
| 577 | Ga0209588_1077578 | 3300027671 | Bacteria | 1074 |
| 578 | Ga0209971_1008691 | 3300027682 | Bacteria | 2409 |
| 579 | Ga0209998_10009176 | 3300027717 | Bacteria | 2051 |
| 580 | Ga0209998_10072430 | 3300027717 | Bacteria | 825 |
| 581 | Ga0209813_10000030 | 3300027866 | Bacteria | 65385 |
| 582 | Ga0209974_10123585 | 3300027876 | Bacteria | 919 |
| 583 | Ga0207428_10029211 | 3300027907 | Bacteria | 4573 |
| 584 | Ga0207428_10031565 | 3300027907 | Bacteria | 4367 |
| 585 | Ga0207428_10047561 | 3300027907 | Bacteria | 3444 |
| 586 | Ga0207428_10047950 | 3300027907 | Bacteria | 3429 |
| 587 | Ga0207428_10059423 | 3300027907 | Bacteria | 3032 |
| 588 | Ga0207428_10115063 | 3300027907 | Bacteria | 2066 |
| 589 | Ga0207428_10141228 | 3300027907 | Bacteria | 1838 |
| 590 | Ga0207428_10232879 | 3300027907 | Bacteria | 1378 |
| 591 | Ga0268266_10000072 | 3300028379 | Bacteria | 232245 |
| 592 | Ga0268266_10000334 | 3300028379 | Bacteria | 73724 |
| 593 | Ga0268266_10048996 | 3300028379 | Bacteria | 3621 |
| 594 | Ga0268266_10055880 | 3300028379 | Bacteria | 3394 |
| 595 | Ga0268266_10452167 | 3300028379 | Bacteria | 1221 |
| 596 | Ga0268265_10433870 | 3300028380 | Bacteria | 1223 |
| 597 | Ga0268265_10915173 | 3300028380 | Bacteria | 862 |
| 598 | Ga0268264_10019574 | 3300028381 | Bacteria | 5529 |
| 599 | Ga0268264_10116808 | 3300028381 | Bacteria | 2346 |
| 600 | Ga0268264_10294590 | 3300028381 | Bacteria | 1525 |
| 601 | Ga0268264_10301783 | 3300028381 | Bacteria | 1508 |
| 602 | Ga0265318_10000165 | 3300028577 | Bacteria | 58672 |
| 603 | Ga0265318_10002420 | 3300028577 | Bacteria | 9984 |
| 604 | Ga0265323_10022789 | 3300028653 | Bacteria | 2392 |
| 605 | Ga0265323_10093870 | 3300028653 | Bacteria | 999 |
| 606 | Ga0265336_10044859 | 3300028666 | Bacteria | 1345 |
| 607 | Ga0265338_10021503 | 3300028800 | Bacteria | 6724 |
| 608 | Ga0265338_10033841 | 3300028800 | Bacteria | 4952 |
| 609 | Ga0265324_10039063 | 3300029957 | Bacteria | 1646 |
| 610 | Ga0265760_10036476 | 3300031090 | Bacteria | 1458 |
| 611 | Ga0265330_10001250 | 3300031235 | Bacteria | 14886 |
| 612 | Ga0265330_10036666 | 3300031235 | Bacteria | 2185 |
| 613 | Ga0265332_10001069 | 3300031238 | Bacteria | 16016 |
| 614 | Ga0265332_10004047 | 3300031238 | Bacteria | 6968 |
| 615 | Ga0265328_10020981 | 3300031239 | Bacteria | 2497 |
| 616 | Ga0265320_10000099 | 3300031240 | Bacteria | 73908 |
| 617 | Ga0265320_10002218 | 3300031240 | Bacteria | 13639 |
| 618 | Ga0265320_10063433 | 3300031240 | Bacteria | 1757 |
| 619 | Ga0265325_10006073 | 3300031241 | Bacteria | 7390 |
| 620 | Ga0265325_10016063 | 3300031241 | Bacteria | 4189 |
| 621 | Ga0265325_10045537 | 3300031241 | Bacteria | 2279 |
| 622 | Ga0265329_10000665 | 3300031242 | Bacteria | 17640 |
| 623 | Ga0265329_10009674 | 3300031242 | Bacteria | 3581 |
| 624 | Ga0265329_10030961 | 3300031242 | Bacteria | 1741 |
| 625 | Ga0265340_10007939 | 3300031247 | Bacteria | 5754 |
| 626 | Ga0265340_10017706 | 3300031247 | Bacteria | 3686 |
| 627 | Ga0265339_10000649 | 3300031249 | Bacteria | 26897 |
| 628 | Ga0265339_10001807 | 3300031249 | Bacteria | 15694 |
| 629 | Ga0265339_10036620 | 3300031249 | Bacteria | 2745 |
| 630 | Ga0265339_10071013 | 3300031249 | Bacteria | 1855 |
| 631 | Ga0265331_10000196 | 3300031250 | Bacteria | 73914 |
| 632 | Ga0265331_10008193 | 3300031250 | Bacteria | 5959 |
| 633 | Ga0265331_10015188 | 3300031250 | Bacteria | 4074 |
| 634 | Ga0265316_10001327 | 3300031344 | Bacteria | 26637 |
| 635 | Ga0265316_10001597 | 3300031344 | Bacteria | 24155 |
| 636 | Ga0265316_10003381 | 3300031344 | Bacteria | 16167 |
| 637 | Ga0265316_10003941 | 3300031344 | Bacteria | 14873 |
| 638 | Ga0265316_10029196 | 3300031344 | Bacteria | 4538 |
| 639 | Ga0265316_10034724 | 3300031344 | Bacteria | 4094 |
| 640 | Ga0265316_10048066 | 3300031344 | Bacteria | 3371 |
| 641 | Ga0265316_10140851 | 3300031344 | Bacteria | 1812 |
| 642 | Ga0265316_10177972 | 3300031344 | Bacteria | 1584 |
| 643 | Ga0307408_100020865 | 3300031548 | Bacteria | 4426 |
| 644 | Ga0307408_100298797 | 3300031548 | Bacteria | 1348 |
| 645 | Ga0265313_10000953 | 3300031595 | Bacteria | 28730 |
| 646 | Ga0265313_10002411 | 3300031595 | Bacteria | 16176 |
| 647 | Ga0265313_10040192 | 3300031595 | Bacteria | 2314 |
| 648 | Ga0265313_10076134 | 3300031595 | Bacteria | 1534 |
| 649 | Ga0316575_10000098 | 3300031665 | Bacteria | 21261 |
| 650 | Ga0316575_10112139 | 3300031665 | Bacteria | 1113 |
| 651 | Ga0316579_10019813 | 3300031691 | Bacteria | 2977 |
| 652 | Ga0316579_10086583 | 3300031691 | Bacteria | 1495 |
| 653 | Ga0316579_10093522 | 3300031691 | Bacteria | 1436 |
| 654 | Ga0265314_10000003 | 3300031711 | Bacteria | 1653386 |
| 655 | Ga0265314_10000071 | 3300031711 | Bacteria | 152845 |
| 656 | Ga0265314_10004438 | 3300031711 | Bacteria | 13024 |
| 657 | Ga0265314_10031172 | 3300031711 | Bacteria | 3940 |
| 658 | Ga0265314_10063500 | 3300031711 | Bacteria | 2505 |
| 659 | Ga0265342_10000679 | 3300031712 | Bacteria | 35568 |
| 660 | Ga0265342_10002488 | 3300031712 | Bacteria | 15862 |
| 661 | Ga0316576_10000548 | 3300031727 | Bacteria | 17648 |
| 662 | Ga0316576_10002466 | 3300031727 | Bacteria | 10527 |
| 663 | Ga0316576_10009928 | 3300031727 | Bacteria | 6162 |
| 664 | Ga0316576_10030207 | 3300031727 | Bacteria | 3835 |
| 665 | Ga0316576_10169945 | 3300031727 | Bacteria | 1645 |
| 666 | Ga0316576_10364365 | 3300031727 | Bacteria | 1074 |
| 667 | Ga0316576_10381837 | 3300031727 | Bacteria | 1046 |
| 668 | Ga0307405_10050168 | 3300031731 | Bacteria | 2583 |
| 669 | Ga0316577_10015566 | 3300031733 | Bacteria | 4185 |
| 670 | Ga0316577_10136248 | 3300031733 | Bacteria | 1382 |
| 671 | Ga0316577_10185104 | 3300031733 | Bacteria | 1177 |
| 672 | Ga0316577_10232584 | 3300031733 | Bacteria | 1042 |
| 673 | Ga0307413_10121092 | 3300031824 | Bacteria | 1773 |
| 674 | Ga0307413_10188987 | 3300031824 | Bacteria | 1477 |
| 675 | Ga0307413_10265855 | 3300031824 | Bacteria | 1281 |
| 676 | Ga0307410_10167213 | 3300031852 | Bacteria | 1653 |
| 677 | Ga0307406_10015119 | 3300031901 | Bacteria | 4459 |
| 678 | Ga0307406_10047965 | 3300031901 | Bacteria | 2695 |
| 679 | Ga0307406_10059420 | 3300031901 | Bacteria | 2461 |
| 680 | Ga0307407_10013301 | 3300031903 | Bacteria | 3989 |
| 681 | Ga0307412_10010507 | 3300031911 | Bacteria | 5334 |
| 682 | Ga0307412_10130228 | 3300031911 | Bacteria | 1826 |
| 683 | Ga0307412_10280242 | 3300031911 | Bacteria | 1308 |
| 684 | Ga0307412_10635686 | 3300031911 | Bacteria | 908 |
| 685 | Ga0307409_100218540 | 3300031995 | Bacteria | 1719 |
| 686 | Ga0307409_100433549 | 3300031995 | Bacteria | 1264 |
| 687 | Ga0307409_100751137 | 3300031995 | Bacteria | 979 |
| 688 | Ga0307416_100061839 | 3300032002 | Bacteria | 3058 |
| 689 | Ga0307416_100909823 | 3300032002 | Bacteria | 980 |
| 690 | Ga0307414_10201046 | 3300032004 | Bacteria | 1621 |
| 691 | Ga0307411_10168166 | 3300032005 | Bacteria | 1650 |
| 692 | Ga0307415_100355852 | 3300032126 | Bacteria | 1234 |
| 693 | Ga0316593_10007662 | 3300032168 | Bacteria | 2972 |
| 694 | Ga0316593_10024652 | 3300032168 | Bacteria | 1909 |
| 695 | Ga0316593_10043261 | 3300032168 | Bacteria | 1504 |
| 696 | Ga0316593_10056979 | 3300032168 | Bacteria | 1330 |
| 697 | Ga0316592_1002050 | 3300033524 | Bacteria | 3414 |
| 698 | Ga0316592_1003442 | 3300033524 | Bacteria | 2850 |
| 699 | Ga0316592_1008760 | 3300033524 | Bacteria | 2009 |
| 700 | Ga0316592_1038779 | 3300033524 | Bacteria | 1051 |
| 701 | Ga0316588_1000219 | 3300033528 | Bacteria | 6805 |
| 702 | Ga0316588_1002297 | 3300033528 | Bacteria | 3319 |
| 703 | Ga0316588_1002933 | 3300033528 | Bacteria | 3039 |
| 704 | Ga0316588_1006171 | 3300033528 | Bacteria | 2381 |
| 705 | Ga0316588_1018566 | 3300033528 | Bacteria | 1559 |
| 706 | Ga0316587_1000001 | 3300033529 | Bacteria | 17933 |
| 707 | Ga0316596_1000985 | 3300033541 | Bacteria | 5469 |
| 708 | Ga0316596_1006947 | 3300033541 | Bacteria | 2655 |
| 709 | Ga0373926_0000781 | 3300035083 | Bacteria | 8934 |
| 710 | Ga0373926_0132103 | 3300035083 | Bacteria | 946 |
| 711 | Ga0373928_0069145 | 3300035084 | Bacteria | 869 |
| 712 | Ga0373944_0010372 | 3300035089 | Bacteria | 2539 |
| 713 | Ga0373944_0154259 | 3300035089 | Bacteria | 811 |
| 714 | Ga0373923_0002039 | 3300035111 | Bacteria | 6090 |
| 715 | Ga0373936_0193741 | 3300035113 | Bacteria | 895 |
| 716 | Ga0373945_0053899 | 3300035116 | Bacteria | 1486 |
| 717 | Ga0373954_0034762 | 3300035118 | Bacteria | 2335 |
| 718 | Ga0373954_0133995 | 3300035118 | Bacteria | 1207 |
| 719 | Ga0373956_0057189 | 3300035119 | Bacteria | 1762 |
| 720 | Ga0373957_0128152 | 3300035120 | Bacteria | 1031 |
| 721 | Ga0373943_0228552 | 3300035170 | Bacteria | 1039 |
| 722 | Ga0373946_0151205 | 3300035171 | Bacteria | 1083 |
| 723 | Ga0373946_0231329 | 3300035171 | Bacteria | 896 |
| 724 | Ga0373955_0063537 | 3300035172 | Bacteria | 2044 |
| 725 | Ga0373955_0073240 | 3300035172 | Bacteria | 1920 |
| 726 | Ga0373961_0000446 | 3300035241 | Bacteria | 16728 |
| 727 | Ga0316574_0009330 | 3300035398 | Bacteria | 5493 |
| 728 | Ga0316574_0106711 | 3300035398 | Bacteria | 1794 |
| 729 | Ga0373924_0044014 | 3300035410 | Bacteria | 1834 |
| 730 | Ga0373931_0027382 | 3300035691 | Bacteria | 2910 |
| 731 | Ga0373931_0106752 | 3300035691 | Bacteria | 1583 |
| 732 | Ga0373931_0147691 | 3300035691 | Bacteria | 1368 |
| 733 | Ga0373935_0027204 | 3300035692 | Bacteria | 3535 |
| 734 | Ga0373935_0126145 | 3300035692 | Bacteria | 1715 |
| 735 | Ga0373927_0005384 | 3300035695 | Bacteria | 8840 |
| 736 | Ga0373933_0014827 | 3300035724 | Bacteria | 4337 |
| 737 | Ga0373933_0381401 | 3300035724 | Bacteria | 918 |
| 738 | Ga0373947_0010227 | 3300035725 | Bacteria | 5386 |
| 739 | Ga0373937_0000078 | 3300036401 | Bacteria | 88688 |
| 740 | Ga0373937_0021252 | 3300036401 | Bacteria | 5824 |
| 741 | Ga0373937_0025354 | 3300036401 | Bacteria | 5353 |
| 742 | Ga0373937_0031983 | 3300036401 | Bacteria | 4770 |
| 743 | Ga0373937_0107774 | 3300036401 | Bacteria | 2590 |
| 744 | Ga0373937_0238723 | 3300036401 | Bacteria | 1712 |
| 745 | Ga0373937_0387063 | 3300036401 | Bacteria | 1326 |
| 746 | Ga0373937_0691184 | 3300036401 | Bacteria | 966 |
| 747 | Ga0265778_007972 | 3300036457 | Bacteria | 1171 |
| 748 | Ga0316582_0058537 | 3300036647 | Bacteria | 2464 |
| 749 | Ga0316582_0121182 | 3300036647 | Bacteria | 1750 |
| 750 | Ga0316582_0218990 | 3300036647 | Bacteria | 1301 |
| 751 | Ga0316582_0399222 | 3300036647 | Bacteria | 947 |
| 752 | Ga0316584_0009978 | 3300036712 | Bacteria | 6616 |
| 753 | Ga0316584_0025357 | 3300036712 | Bacteria | 4347 |
| 754 | Ga0316584_0182353 | 3300036712 | Bacteria | 1554 |
| 755 | Ga0316584_0220563 | 3300036712 | Bacteria | 1393 |
| 756 | Ga0316584_0245852 | 3300036712 | Bacteria | 1308 |
| 757 | Ga0316584_0791205 | 3300036712 | Bacteria | 645 |
| 758 | Ga0373925_0165163 | 3300037068 | Bacteria | 1745 |
| 759 | Ga0395899_0232654 | 3300037312 | Bacteria | 1272 |
| 760 | Ga0395900_0479417 | 3300037418 | Bacteria | 1197 |
| 761 | Ga0316581_0054063 | 3300037588 | Bacteria | 1231 |
| 762 | Ga0436364_1196741 | 3300037853 | Bacteria | 11745 |
| 763 | Ga0436364_1430661 | 3300037853 | Bacteria | 3099 |
| 764 | Ga0400489_80694 | 3300039093 | Bacteria | 3149 |
| 765 | Ga0400487_59508 | 3300039110 | Bacteria | 2380 |
| 766 | Ga0436365_0831894 | 3300039437 | Bacteria | 2398 |
| 767 | Ga0436365_0896462 | 3300039437 | Bacteria | 3816 |
| 768 | Ga0436365_1742949 | 3300039437 | Bacteria | 4244 |
| 769 | Ga0436365_1846658 | 3300039437 | Bacteria | 1008 |
| 770 | Ga0436360_0655945 | 3300039438 | Bacteria | 3833 |
| 771 | Ga0436361_1007716 | 3300039447 | Bacteria | 1557 |
| 772 | Ga0439465_0001490 | 3300041413 | Bacteria | 7594 |
| 773 | Ga0451807_0548069 | 3300041486 | Bacteria | 840 |
| 774 | Ga0451849_1494037 | 3300041505 | Bacteria | 3718 |
| 775 | Ga0451853_2126451 | 3300041512 | Bacteria | 4530 |
| 776 | Ga0439443_007826 | 3300042003 | Bacteria | 1495 |
| 777 | Ga0439445_0030206 | 3300042004 | Bacteria | 1403 |
| 778 | Ga0439445_0053427 | 3300042004 | Bacteria | 1094 |
| 779 | Ga0439456_058212 | 3300042013 | Bacteria | 848 |
| 780 | Ga0439462_0004174 | 3300042015 | Bacteria | 3514 |
| 781 | Ga0450923_010186 | 3300042125 | Bacteria | 1661 |
| 782 | Ga0450918_005831 | 3300042531 | Bacteria | 2205 |
| 783 | Ga0450918_019040 | 3300042531 | Bacteria | 1198 |
| 784 | Ga0451577_0000139 | 3300042876 | Bacteria | 161883 |
| 785 | Ga0451577_0332671 | 3300042876 | Bacteria | 1378 |
| 786 | Ga0453683_0000392 | 3300044673 | Bacteria | 52154 |
| 787 | Ga0453683_0068937 | 3300044673 | Bacteria | 2211 |
| 788 | Ga0453684_0003616 | 3300044712 | Bacteria | 34458 |
| 789 | Ga0453684_0010619 | 3300044712 | Bacteria | 15695 |
| 790 | Ga0453684_0011627 | 3300044712 | Bacteria | 14698 |
| 791 | Ga0453684_0020399 | 3300044712 | Bacteria | 9997 |
| 792 | Ga0453684_0178052 | 3300044712 | Bacteria | 2499 |
| 793 | Ga0453684_0251157 | 3300044712 | Bacteria | 2031 |
| 794 | Ga0466968_0104281 | 3300044735 | Bacteria | 1269 |
| 795 | Ga0451576_0026183 | 3300045051 | Bacteria | 6275 |
| 796 | Ga0451576_0029400 | 3300045051 | Bacteria | 5881 |
| 797 | Ga0451576_0392249 | 3300045051 | Bacteria | 1455 |
| 798 | Ga0466967_0003862 | 3300045976 | Bacteria | 9928 |
| 799 | Ga0495592_0005038 | 3300046454 | Bacteria | 9719 |
| 800 | Ga0495592_0052007 | 3300046454 | Bacteria | 3042 |
| 801 | Ga0495592_0054997 | 3300046454 | Bacteria | 2946 |
| 802 | Ga0495592_0203556 | 3300046454 | Bacteria | 1334 |
| 803 | Ga0495603_0058776 | 3300046455 | Bacteria | 2273 |
| 804 | Ga0495603_0072551 | 3300046455 | Bacteria | 2022 |
| 805 | Ga0495629_0007511 | 3300046459 | Bacteria | 8036 |
| 806 | Ga0495629_0513808 | 3300046459 | Bacteria | 807 |
| 807 | Ga0495638_0024402 | 3300046460 | Bacteria | 3943 |
| 808 | Ga0495638_0157345 | 3300046460 | Bacteria | 1313 |
| 809 | Ga0495641_0095648 | 3300046461 | Bacteria | 1326 |
| 810 | Ga0495651_0000335 | 3300046462 | Bacteria | 36339 |
| 811 | Ga0495651_0003305 | 3300046462 | Bacteria | 12380 |
| 812 | Ga0495651_0006885 | 3300046462 | Bacteria | 8686 |
| 813 | Ga0495651_0085033 | 3300046462 | Bacteria | 2383 |
| 814 | Ga0495651_0228857 | 3300046462 | Bacteria | 1282 |
| 815 | Ga0495653_0008639 | 3300046463 | Bacteria | 8351 |
| 816 | Ga0495653_0151654 | 3300046463 | Bacteria | 1619 |
| 817 | Ga0495580_0002835 | 3300046472 | Bacteria | 14909 |
| 818 | Ga0495580_0028841 | 3300046472 | Bacteria | 4032 |
| 819 | Ga0495580_0046881 | 3300046472 | Bacteria | 3065 |
| 820 | Ga0495580_0086482 | 3300046472 | Bacteria | 2183 |
| 821 | Ga0495580_0136192 | 3300046472 | Bacteria | 1702 |
| 822 | Ga0495580_0530334 | 3300046472 | Bacteria | 784 |
| 823 | Ga0495582_0000227 | 3300046473 | Bacteria | 31128 |
| 824 | Ga0495582_0001649 | 3300046473 | Bacteria | 12583 |
| 825 | Ga0495582_0181963 | 3300046473 | Bacteria | 1198 |
| 826 | Ga0495639_0003836 | 3300046475 | Bacteria | 6454 |
| 827 | Ga0495639_0225422 | 3300046475 | Bacteria | 922 |
| 828 | Ga0495662_0050628 | 3300046476 | Bacteria | 2005 |
| 829 | Ga0495664_0246106 | 3300046477 | Bacteria | 1081 |
| 830 | Ga0495664_0440270 | 3300046477 | Bacteria | 781 |
| 831 | Ga0495664_0503502 | 3300046477 | Bacteria | 723 |
| 832 | Ga0495594_0139940 | 3300046499 | Bacteria | 1372 |
| 833 | Ga0495608_0006109 | 3300046511 | Bacteria | 8543 |
| 834 | Ga0495608_0016359 | 3300046511 | Bacteria | 5132 |
| 835 | Ga0495608_0054588 | 3300046511 | Bacteria | 2641 |
| 836 | Ga0495608_0142185 | 3300046511 | Bacteria | 1531 |
| 837 | Ga0495618_0046504 | 3300046514 | Bacteria | 2739 |
| 838 | Ga0495618_0083189 | 3300046514 | Bacteria | 2045 |
| 839 | Ga0495628_0030708 | 3300046516 | Bacteria | 4349 |
| 840 | Ga0495628_0048496 | 3300046516 | Bacteria | 3366 |
| 841 | Ga0495628_0078943 | 3300046516 | Bacteria | 2559 |
| 842 | Ga0495628_0197503 | 3300046516 | Bacteria | 1517 |
| 843 | Ga0495630_0008656 | 3300046517 | Bacteria | 7304 |
| 844 | Ga0495630_0090329 | 3300046517 | Bacteria | 2314 |
| 845 | Ga0495630_0117603 | 3300046517 | Bacteria | 2015 |
| 846 | Ga0495630_0269913 | 3300046517 | Bacteria | 1300 |
| 847 | Ga0495630_0300077 | 3300046517 | Bacteria | 1227 |
| 848 | Ga0495643_0015955 | 3300046522 | Bacteria | 4423 |
| 849 | Ga0495666_0005964 | 3300046526 | Bacteria | 6143 |
| 850 | Ga0495652_0013927 | 3300046529 | Bacteria | 7230 |
| 851 | Ga0495652_0020061 | 3300046529 | Bacteria | 5945 |
| 852 | Ga0495665_0001996 | 3300046531 | Bacteria | 11035 |
| 853 | Ga0495665_0054933 | 3300046531 | Bacteria | 2104 |
| 854 | Ga0495640_0095321 | 3300046533 | Bacteria | 1959 |
| 855 | Ga0495640_0145489 | 3300046533 | Bacteria | 1525 |
| 856 | Ga0495640_0271873 | 3300046533 | Bacteria | 1057 |
| 857 | Ga0495586_0002069 | 3300046535 | Bacteria | 10898 |
| 858 | Ga0495586_0030459 | 3300046535 | Bacteria | 2887 |
| 859 | Ga0495586_0116737 | 3300046535 | Bacteria | 1489 |
| 860 | Ga0495586_0142015 | 3300046535 | Bacteria | 1348 |
| 861 | Ga0495587_0002155 | 3300046536 | Bacteria | 13171 |
| 862 | Ga0495587_0044560 | 3300046536 | Bacteria | 2638 |
| 863 | Ga0495621_0007223 | 3300046539 | Bacteria | 3281 |
| 864 | Ga0495645_0019971 | 3300046543 | Bacteria | 4830 |
| 865 | Ga0495645_0056273 | 3300046543 | Bacteria | 2856 |
| 866 | Ga0495645_0162961 | 3300046543 | Bacteria | 1540 |
| 867 | Ga0495645_0291381 | 3300046543 | Bacteria | 1070 |
| 868 | Ga0495645_0429474 | 3300046543 | Bacteria | 837 |
| 869 | Ga0495667_0002241 | 3300046559 | Bacteria | 12927 |
| 870 | Ga0495667_0030860 | 3300046559 | Bacteria | 3600 |
| 871 | Ga0495634_0018345 | 3300046642 | Bacteria | 4983 |
| 872 | Ga0495635_0004284 | 3300046663 | Bacteria | 9876 |
| 873 | Ga0495635_0132528 | 3300046663 | Bacteria | 1699 |
| 874 | Ga0495635_0339231 | 3300046663 | Bacteria | 1004 |
| 875 | Ga0495657_0003416 | 3300046675 | Bacteria | 12960 |
| 876 | Ga0495657_0057267 | 3300046675 | Bacteria | 2592 |
| 877 | Ga0495599_0114149 | 3300046678 | Bacteria | 1681 |
| 878 | Ga0495599_0229996 | 3300046678 | Bacteria | 1132 |
| 879 | Ga0495623_0012203 | 3300046679 | Bacteria | 5566 |
| 880 | Ga0495646_0000703 | 3300046680 | Bacteria | 18504 |
| 881 | Ga0495647_0005580 | 3300046681 | Bacteria | 4130 |
| 882 | Ga0495658_0043580 | 3300046683 | Bacteria | 2510 |
| 883 | Ga0495658_0082856 | 3300046683 | Bacteria | 1885 |
| 884 | Ga0495658_0196338 | 3300046683 | Bacteria | 1256 |
| 885 | Ga0495658_0222527 | 3300046683 | Bacteria | 1182 |
| 886 | Ga0495613_0010783 | 3300046689 | Bacteria | 6780 |
| 887 | Ga0495613_0045662 | 3300046689 | Bacteria | 3239 |
| 888 | Ga0495613_0250488 | 3300046689 | Bacteria | 1236 |
| 889 | Ga0495613_0500232 | 3300046689 | Bacteria | 818 |
| 890 | Ga0495600_0012011 | 3300046809 | Bacteria | 5408 |
| 891 | Ga0495600_0086143 | 3300046809 | Bacteria | 2050 |
| 892 | Ga0495600_0281774 | 3300046809 | Bacteria | 1052 |
| 893 | Ga0495581_0001452 | 3300047315 | Bacteria | 13170 |
| 894 | Ga0495604_0098928 | 3300047317 | Bacteria | 2147 |
| 895 | Ga0495604_0219352 | 3300047317 | Bacteria | 1310 |
| 896 | Ga0495636_0001365 | 3300047318 | Bacteria | 9237 |
| 897 | Ga0495636_0107688 | 3300047318 | Bacteria | 1224 |
| 898 | Ga0495674_0037039 | 3300047319 | Bacteria | 4385 |
| 899 | Ga0495674_0088681 | 3300047319 | Bacteria | 2645 |
| 900 | Ga0495674_0121225 | 3300047319 | Bacteria | 2209 |
| 901 | Ga0495674_0322663 | 3300047319 | Bacteria | 1258 |
| 902 | Ga0495676_0024812 | 3300047321 | Bacteria | 5182 |
| 903 | Ga0495676_0098517 | 3300047321 | Bacteria | 2169 |
| 904 | Ga0495676_0352916 | 3300047321 | Bacteria | 983 |
| 905 | Ga0495680_0000106 | 3300047322 | Bacteria | 77255 |
| 906 | Ga0495680_0006887 | 3300047322 | Bacteria | 10492 |
| 907 | Ga0495680_0029632 | 3300047322 | Bacteria | 4480 |
| 908 | Ga0495680_0120388 | 3300047322 | Bacteria | 1938 |
| 909 | Ga0495680_0204960 | 3300047322 | Bacteria | 1414 |
| 910 | Ga0495675_0000643 | 3300047444 | Bacteria | 22174 |
| 911 | Ga0495675_0002269 | 3300047444 | Bacteria | 11479 |
| 912 | Ga0495675_0079541 | 3300047444 | Bacteria | 2065 |
| 913 | Ga0495675_0099183 | 3300047444 | Bacteria | 1824 |
| 914 | Ga0495684_0000488 | 3300047471 | Bacteria | 32453 |
| 915 | Ga0495684_0007566 | 3300047471 | Bacteria | 8405 |
| 916 | Ga0495684_0064208 | 3300047471 | Bacteria | 2790 |
| 917 | Ga0495684_0222806 | 3300047471 | Bacteria | 1382 |
| 918 | Ga0495593_0004921 | 3300047673 | Bacteria | 7920 |
| 919 | Ga0495602_0003151 | 3300048088 | Bacteria | 16985 |
| 920 | Ga0495602_0024638 | 3300048088 | Bacteria | 5835 |
| 921 | Ga0495602_0147734 | 3300048088 | Bacteria | 1852 |
| 922 | Ga0495602_0356930 | 3300048088 | Bacteria | 1053 |
| 923 | Ga0495614_0116376 | 3300048089 | Bacteria | 1176 |
| 924 | Ga0495615_0010063 | 3300048090 | Bacteria | 1879 |
| 925 | Ga0496100_0067361 | 3300048903 | Bacteria | 2378 |
| 926 | Ga0496100_0307378 | 3300048903 | Bacteria | 1188 |
| 927 | Ga0496101_0757208 | 3300048904 | Bacteria | 766 |
| 928 | Ga0496103_0002010 | 3300048906 | Bacteria | 13104 |
| 929 | Ga0496104_0051204 | 3300048907 | Bacteria | 3897 |
| 930 | Ga0496104_0063828 | 3300048907 | Bacteria | 3494 |
| 931 | Ga0496104_0199320 | 3300048907 | Bacteria | 1914 |
| 932 | Ga0496105_0108637 | 3300048908 | Bacteria | 2290 |
| 933 | Ga0496106_0008373 | 3300048909 | Bacteria | 7653 |
| 934 | Ga0496107_0271620 | 3300048910 | Bacteria | 1262 |
| 935 | Ga0496108_0007055 | 3300048911 | Bacteria | 9097 |
| 936 | Ga0496109_0040920 | 3300048912 | Bacteria | 4198 |
| 937 | Ga0496110_0044043 | 3300048913 | Bacteria | 3897 |
| 938 | Ga0496110_0333127 | 3300048913 | Bacteria | 1383 |
| 939 | Ga0496111_0020980 | 3300048914 | Bacteria | 4555 |
| 940 | Ga0496111_0145684 | 3300048914 | Bacteria | 1756 |
| 941 | Ga0496112_0053099 | 3300048915 | Bacteria | 3979 |
| 942 | Ga0496112_0112902 | 3300048915 | Bacteria | 2688 |
| 943 | Ga0496112_0236835 | 3300048915 | Bacteria | 1779 |
| 944 | Ga0496114_0175117 | 3300048917 | Bacteria | 1872 |
| 945 | Ga0496114_0203527 | 3300048917 | Bacteria | 1734 |
| 946 | Ga0496114_0294937 | 3300048917 | Bacteria | 1431 |
| 947 | Ga0496114_0372525 | 3300048917 | Bacteria | 1264 |
| 948 | Ga0496115_0000977 | 3300048918 | Bacteria | 20712 |
| 949 | Ga0496115_0028556 | 3300048918 | Bacteria | 4374 |
| 950 | Ga0496115_0046403 | 3300048918 | Bacteria | 3472 |
| 951 | Ga0496118_0011507 | 3300048921 | Bacteria | 8626 |
| 952 | Ga0496119_0037631 | 3300048922 | Bacteria | 3140 |
| 953 | Ga0496121_0018026 | 3300048924 | Bacteria | 7151 |
| 954 | Ga0496123_0117712 | 3300048926 | Bacteria | 1502 |
| 955 | Ga0496126_0032158 | 3300048929 | Bacteria | 4946 |
| 956 | Ga0501305_000074 | 3300049161 | Bacteria | 5694 |
| 957 | Ga0501315_020018 | 3300049531 | Bacteria | 895 |
| 958 | Ga0501323_001695 | 3300049539 | Bacteria | 2019 |
| 959 | Ga0501031_0031770 | 3300049568 | Bacteria | 3444 |
| 960 | Ga0501031_0147207 | 3300049568 | Bacteria | 1539 |
| 961 | Ga0501031_0254269 | 3300049568 | Bacteria | 1142 |
| 962 | Ga0501034_0003614 | 3300049571 | Bacteria | 17553 |
| 963 | Ga0501034_0008086 | 3300049571 | Bacteria | 11154 |
| 964 | Ga0501034_0424783 | 3300049571 | Bacteria | 1250 |
| 965 | Ga0501034_0526046 | 3300049571 | Bacteria | 1094 |
| 966 | Ga0501036_0208565 | 3300049572 | Bacteria | 1642 |
| 967 | Ga0501036_0251923 | 3300049572 | Bacteria | 1480 |
| 968 | Ga0501038_0399863 | 3300049574 | Bacteria | 1063 |
| 969 | Ga0501039_0134957 | 3300049575 | Bacteria | 1937 |
| 970 | Ga0501039_0474616 | 3300049575 | Bacteria | 982 |
| 971 | Ga0501040_0180022 | 3300049576 | Bacteria | 1498 |
| 972 | Ga0501041_0056572 | 3300049577 | Bacteria | 2397 |
| 973 | Ga0501042_0008502 | 3300049578 | Bacteria | 6780 |
| 974 | Ga0501042_0174625 | 3300049578 | Bacteria | 1550 |
| 975 | Ga0501046_0070217 | 3300049580 | Bacteria | 2724 |
| 976 | Ga0501046_0375285 | 3300049580 | Bacteria | 1030 |
| 977 | Ga0501047_0231494 | 3300049581 | Bacteria | 1701 |
| 978 | Ga0501048_0003213 | 3300049582 | Bacteria | 12444 |
| 979 | Ga0501067_0013192 | 3300049583 | Bacteria | 4575 |
| 980 | Ga0501067_0135074 | 3300049583 | Bacteria | 1373 |
| 981 | Ga0501067_0196631 | 3300049583 | Bacteria | 1123 |
| 982 | Ga0501069_0015105 | 3300049585 | Bacteria | 4136 |
| 983 | Ga0501069_0034622 | 3300049585 | Bacteria | 2781 |
| 984 | Ga0501070_0360042 | 3300049586 | Bacteria | 1180 |
| 985 | Ga0501071_0004803 | 3300049587 | Bacteria | 8603 |
| 986 | Ga0501071_0313739 | 3300049587 | Bacteria | 1190 |
| 987 | Ga0501072_0016348 | 3300049588 | Bacteria | 5693 |
| 988 | Ga0501072_0058802 | 3300049588 | Bacteria | 3030 |
| 989 | Ga0501073_0005689 | 3300049589 | Bacteria | 9324 |
| 990 | Ga0501074_0240097 | 3300049590 | Bacteria | 1289 |
| 991 | Ga0501075_0011893 | 3300049591 | Bacteria | 6174 |
| 992 | Ga0501075_0016294 | 3300049591 | Bacteria | 5351 |
| 993 | Ga0501075_0134359 | 3300049591 | Bacteria | 1884 |
| 994 | Ga0501075_0264931 | 3300049591 | Bacteria | 1310 |
| 995 | Ga0501076_0009211 | 3300049592 | Bacteria | 7281 |
| 996 | Ga0501076_0056448 | 3300049592 | Bacteria | 3117 |
| 997 | Ga0501076_0115789 | 3300049592 | Bacteria | 2169 |
| 998 | Ga0501077_0087652 | 3300049593 | Bacteria | 1973 |
| 999 | Ga0501077_0104087 | 3300049593 | Bacteria | 1799 |
| 1000 | Ga0501077_0243081 | 3300049593 | Bacteria | 1144 |
| 1001 | Ga0501079_0053043 | 3300049741 | Bacteria | 3129 |
| 1002 | Ga0501079_0465431 | 3300049741 | Bacteria | 993 |
| 1003 | Ga0501079_0667556 | 3300049741 | Bacteria | 818 |
| 1004 | Ga0501080_0321316 | 3300049742 | Bacteria | 1401 |
| 1005 | Ga0501080_0574583 | 3300049742 | Bacteria | 1002 |
| 1006 | Ga0501081_0215001 | 3300049743 | Bacteria | 1397 |
| 1007 | Ga0501081_0296578 | 3300049743 | Bacteria | 1186 |
| 1008 | Ga0501083_0402086 | 3300049744 | Bacteria | 891 |
| 1009 | Ga0501035_0051311 | 3300049822 | Bacteria | 3694 |
| 1010 | Ga0501035_0404190 | 3300049822 | Bacteria | 1136 |
| 1011 | Ga0501044_0000121 | 3300049823 | Bacteria | 93902 |
| 1012 | Ga0501044_0143341 | 3300049823 | Bacteria | 2377 |
| 1013 | Ga0501044_0217000 | 3300049823 | Bacteria | 1865 |
| 1014 | Ga0501044_0387311 | 3300049823 | Bacteria | 1312 |
| 1015 | Ga0501044_0529673 | 3300049823 | Bacteria | 1077 |
| 1016 | Ga0501045_0004485 | 3300049824 | Bacteria | 9645 |
| 1017 | nmdc:mga03683_129_c1 | 3300050489 | Bacteria | 25227 |
| 1018 | nmdc:mga00v17_13212_c1 | 3300050491 | Bacteria | 4576 |
| 1019 | nmdc:mga00v17_200814_c1 | 3300050491 | Bacteria | 1289 |
| 1020 | nmdc:mga0yw44_508548_c1 | 3300050492 | Bacteria | 817 |
| 1021 | nmdc:mga0k408_11688_c1 | 3300050493 | Bacteria | 4786 |
| 1022 | nmdc:mga0k408_144694_c1 | 3300050493 | Bacteria | 1415 |
| 1023 | nmdc:mga06z11_122_c1 | 3300050494 | Bacteria | 32025 |
| 1024 | nmdc:mga07m45_32_c1 | 3300050496 | Bacteria | 78063 |
| 1025 | nmdc:mga05p37_122920_c1 | 3300050507 | Bacteria | 3188 |
| 1026 | nmdc:mga05p37_337590_c2 | 3300050507 | Bacteria | 1439 |
| 1027 | nmdc:mga05p37_36050_c1 | 3300050507 | Bacteria | 6069 |
| 1028 | nmdc:mga05p37_80215_c1 | 3300050507 | Bacteria | 4020 |
| 1029 | nmdc:mga05p37_81276_c1 | 3300050507 | Bacteria | 3992 |
| 1030 | nmdc:mga09592_232146_c1 | 3300050508 | Bacteria | 1599 |
| 1031 | nmdc:mga09592_521896_c1 | 3300050508 | Bacteria | 1021 |
| 1032 | nmdc:mga09592_96641_c1 | 3300050508 | Bacteria | 2527 |
| 1033 | nmdc:mga0qj67_3985_c1 | 3300050509 | Bacteria | 6623 |
| 1034 | nmdc:mga06r32_718632_c1 | 3300050510 | Bacteria | 964 |
| 1035 | nmdc:mga06r32_73091_c1 | 3300050510 | Bacteria | 3321 |
| 1036 | nmdc:mga08y16_1471_c1 | 3300050511 | Bacteria | 23637 |
| 1037 | nmdc:mga08y16_205774_c1 | 3300050511 | Bacteria | 2039 |
| 1038 | nmdc:mga08y16_216002_c1 | 3300050511 | Bacteria | 1986 |
| 1039 | nmdc:mga08y16_22400_c1 | 3300050511 | Bacteria | 6668 |
| 1040 | nmdc:mga08y16_330478_c1 | 3300050511 | Bacteria | 1568 |
| 1041 | nmdc:mga08y16_42715_c1 | 3300050511 | Bacteria | 4747 |
| 1042 | nmdc:mga08y16_546602_c1 | 3300050511 | Bacteria | 1172 |
| 1043 | nmdc:mga08y16_641077_c1 | 3300050511 | Bacteria | 1067 |
| 1044 | nmdc:mga08y16_64310_c1 | 3300050511 | Bacteria | 3831 |
| 1045 | nmdc:mga08y16_6740_c1 | 3300050511 | Bacteria | 12043 |
| 1046 | nmdc:mga08y16_699456_c1 | 3300050511 | Bacteria | 1014 |
| 1047 | nmdc:mga0n895_152814_c1 | 3300050512 | Bacteria | 2339 |
| 1048 | nmdc:mga0n895_211173_c1 | 3300050512 | Bacteria | 1971 |
| 1049 | nmdc:mga0n895_303697_c1 | 3300050512 | Bacteria | 1618 |
| 1050 | nmdc:mga0n895_560099_c1 | 3300050512 | Bacteria | 1148 |
| 1051 | nmdc:mga0n895_918341_c1 | 3300050512 | Bacteria | 860 |
| 1052 | nmdc:mga0rr50_176693_c1 | 3300050513 | Bacteria | 1743 |
| 1053 | nmdc:mga0rr50_326234_c1 | 3300050513 | Bacteria | 1288 |
| 1054 | nmdc:mga0rr50_52636_c1 | 3300050513 | Bacteria | 3026 |
| 1055 | nmdc:mga08x19_10729_c1 | 3300050514 | Bacteria | 5505 |
| 1056 | nmdc:mga08x19_77608_c1 | 3300050514 | Bacteria | 2175 |
| 1057 | nmdc:mga0a205_125519_c1 | 3300050515 | Bacteria | 2466 |
| 1058 | nmdc:mga0a205_184445_c1 | 3300050515 | Bacteria | 1980 |
| 1059 | nmdc:mga0a205_210619_c1 | 3300050515 | Bacteria | 1832 |
| 1060 | nmdc:mga0a205_390444_c1 | 3300050515 | Bacteria | 1256 |
| 1061 | nmdc:mga0a205_69391_c1 | 3300050515 | Bacteria | 3403 |
| 1062 | nmdc:mga0a205_75696_c1 | 3300050515 | Bacteria | 3252 |
| 1063 | nmdc:mga0a205_79703_c1 | 3300050515 | Bacteria | 3164 |
| 1064 | nmdc:mga0sz30_330_c1 | 3300050516 | Bacteria | 18114 |
| 1065 | Ga0495601_0110986 | 3300053077 | Bacteria | 1776 |
| 1066 | Ga0495601_0276349 | 3300053077 | Bacteria | 1095 |
| 1067 | Ga0495612_0001883 | 3300053078 | Bacteria | 8632 |
| 1068 | Ga0495612_0157631 | 3300053078 | Bacteria | 990 |
| 1069 | Ga0495595_0051307 | 3300053084 | Bacteria | 1912 |
| 1070 | Ga0495619_0230491 | 3300053085 | Bacteria | 1283 |
| 1071 | Ga0495619_0240162 | 3300053085 | Bacteria | 1255 |
| 1072 | Ga0495619_0311284 | 3300053085 | Bacteria | 1090 |
| 1073 | Ga0500643_000039 | 3300053087 | Bacteria | 169629 |
| 1074 | Ga0500651_0111488 | 3300053093 | Bacteria | 1669 |
| 1075 | Ga0500555_000967 | 3300053103 | Bacteria | 9951 |
| 1076 | Ga0500562_030033 | 3300053108 | Bacteria | 1431 |
| 1077 | Ga0500607_000721 | 3300053121 | Bacteria | 31928 |
| 1078 | Ga0500616_0000357 | 3300053153 | Bacteria | 64980 |
| 1079 | Ga0500616_0001815 | 3300053153 | Bacteria | 19409 |
| 1080 | Ga0500645_003002 | 3300053730 | Bacteria | 7140 |
| 1081 | Ga0500599_001640 | 3300053736 | Bacteria | 2606 |
| 1082 | Ga0590071_003207 | 3300059421 | Bacteria | 4039 |
| 1083 | Ga0590077_002487 | 3300059426 | Bacteria | 3925 |
| 1084 | Ga0587080_022122 | 3300059503 | Bacteria | 1051 |
| 1085 | Ga0587083_0022932 | 3300059505 | Bacteria | 1174 |
| 1086 | Ga0501082_0017104 | 3300060353 | Bacteria | 6247 |
| 1087 | Ga0501082_0050658 | 3300060353 | Bacteria | 3580 |
| 1088 | Ga0501082_0179474 | 3300060353 | Bacteria | 1841 |
| 1089 | Ga0530510_0109553 | 3300061734 | Bacteria | 2022 |
| 1090 | Ga0530510_0165157 | 3300061734 | Bacteria | 1638 |
| 1091 | 2643951638 | 2643221588 | Bacteria | 3692460 |
| 1092 | 2848298602 | 2848297114 | Bacteria | 3608511 |
| 1093 | 2895881455 | 2895880812 | Bacteria | 11255272 |
| 1094 | 2896256219 | 2896253425 | Bacteria | 3418029 |
| 1095 | Ga0097621_100227164 | |||
| 1096 | JGI24741J21665_1019232 | |||
| 1097 | JGI24738J21930_10013322 | |||
| 1098 | Ga0006762J43184_106338 | |||
| 1099 | rootL2_10370863 | |||
| 1100 | rootH1_10061610 | |||
| 1101 | JGI25407J50210_10003427 | |||
| 1102 | Ga0058863_10052666 | |||
| 1103 | Ga0058863_10170080 | |||
| 1104 | Ga0058861_10168291 | |||
| 1105 | Ga0058860_12210992 | |||
| 1106 | Ga0058862_10289804 | |||
| 1107 | Ga0065704_10092589 | |||
| 1108 | Ga0065704_10096689 | |||
| 1109 | Ga0065712_10075001 | |||
| 1110 | Ga0065712_10075551 | |||
| 1111 | Ga0065712_10093133 | |||
| 1112 | Ga0065715_10114950 | |||
| 1113 | Ga0065715_10130388 | |||
| 1114 | Ga0065715_10154036 | |||
| 1115 | Ga0070658_10109288 | |||
| 1116 | Ga0070676_10062231 | |||
| 1117 | Ga0070676_10136059 | |||
| 1118 | Ga0070683_100054844 | |||
| 1119 | Ga0070683_100112701 | |||
| 1120 | Ga0070690_100048689 | |||
| 1121 | Ga0070690_100238709 | |||
| 1122 | Ga0070670_100002037 | |||
| 1123 | Ga0070670_100020542 | |||
| 1124 | Ga0070670_100028660 | |||
| 1125 | Ga0070670_100051264 | |||
| 1126 | Ga0070670_100115234 | |||
| 1127 | Ga0070670_100447223 | |||
| 1128 | Ga0070677_10189635 | |||
| 1129 | Ga0068869_100050303 | |||
| 1130 | Ga0068869_100310311 | |||
| 1131 | Ga0070666_10010932 | |||
| 1132 | Ga0070680_100001103 | |||
| 1133 | Ga0070682_100038642 | |||
| 1134 | Ga0070682_100099053 | |||
| 1135 | Ga0070682_100313001 | |||
| 1136 | Ga0068868_100003244 | |||
| 1137 | Ga0068868_100065914 | |||
| 1138 | Ga0068868_100268547 | |||
| 1139 | Ga0068868_100279510 | |||
| 1140 | Ga0070660_100002528 | |||
| 1141 | Ga0070660_100047206 | |||
| 1142 | Ga0070660_100236668 | |||
| 1143 | Ga0070689_100055251 | |||
| 1144 | Ga0070689_100056159 | |||
| 1145 | Ga0070689_100116781 | |||
| 1146 | Ga0070689_100279803 | |||
| 1147 | Ga0070689_100413701 | |||
| 1148 | Ga0070689_100493516 | |||
| 1149 | Ga0070687_100139516 | |||
| 1150 | Ga0070661_100005158 | |||
| 1151 | Ga0070661_100060578 | |||
| 1152 | Ga0070661_100074038 | |||
| 1153 | Ga0070661_100084440 | |||
| 1154 | Ga0070692_10141598 | |||
| 1155 | Ga0070668_100144156 | |||
| 1156 | Ga0070669_100004448 | |||
| 1157 | Ga0070675_100006570 | |||
| 1158 | Ga0070675_100029347 | |||
| 1159 | Ga0070675_100053172 | |||
| 1160 | Ga0070675_100133271 | |||
| 1161 | Ga0070675_100188398 | |||
| 1162 | Ga0070675_100555303 | |||
| 1163 | Ga0070675_100909768 | |||
| 1164 | Ga0070671_100001395 | |||
| 1165 | Ga0070671_100003462 | |||
| 1166 | Ga0070671_100038179 | |||
| 1167 | Ga0070671_100234024 | |||
| 1168 | Ga0070674_100082765 | |||
| 1169 | Ga0070673_100042705 | |||
| 1170 | Ga0070673_100049506 | |||
| 1171 | Ga0070673_100068302 | |||
| 1172 | Ga0070673_100070911 | |||
| 1173 | Ga0070673_100354362 | |||
| 1174 | Ga0070688_100019652 | |||
| 1175 | Ga0070688_100051080 | |||
| 1176 | Ga0070667_100005841 | |||
| 1177 | Ga0070667_100024096 | |||
| 1178 | Ga0070667_100103151 | |||
| 1179 | Ga0070709_10010452 | |||
| 1180 | Ga0070709_10169441 | |||
| 1181 | Ga0070714_100267983 | |||
| 1182 | Ga0070713_100199272 | |||
| 1183 | Ga0070710_10041040 | |||
| 1184 | Ga0070710_10164859 | |||
| 1185 | Ga0070701_10135483 | |||
| 1186 | Ga0070711_100029381 | |||
| 1187 | Ga0070711_100270155 | |||
| 1188 | Ga0070711_100521809 | |||
| 1189 | Ga0070705_100205873 | |||
| 1190 | Ga0070694_100103391 | |||
| 1191 | Ga0070694_100264176 | |||
| 1192 | Ga0070694_100507763 | |||
| 1193 | Ga0070708_100000449 | |||
| 1194 | Ga0070708_100016101 | |||
| 1195 | Ga0070708_100081988 | |||
| 1196 | Ga0070708_100514838 | |||
| 1197 | Ga0070708_100659104 | |||
| 1198 | Ga0070663_100339387 | |||
| 1199 | Ga0070678_100203913 | |||
| 1200 | Ga0070678_100220038 | |||
| 1201 | Ga0070678_100303975 | |||
| 1202 | Ga0070662_100029624 | |||
| 1203 | Ga0070662_100032181 | |||
| 1204 | Ga0070681_10087087 | |||
| 1205 | Ga0068867_100057238 | |||
| 1206 | Ga0068867_100251482 | |||
| 1207 | Ga0070685_10001304 | |||
| 1208 | Ga0070685_10021547 | |||
| 1209 | Ga0070685_10052834 | |||
| 1210 | Ga0070685_10054316 | |||
| 1211 | Ga0070706_100004637 | |||
| 1212 | Ga0070706_100616300 | |||
| 1213 | Ga0070707_100006642 | |||
| 1214 | Ga0070707_100012678 | |||
| 1215 | Ga0070707_100048300 | |||
| 1216 | Ga0070707_100108612 | |||
| 1217 | Ga0070707_100202029 | |||
| 1218 | Ga0070707_100437566 | |||
| 1219 | Ga0070707_100567766 | |||
| 1220 | Ga0070698_100005408 | |||
| 1221 | Ga0070698_100437425 | |||
| 1222 | Ga0070699_100393235 | |||
| 1223 | Ga0070679_100034483 | |||
| 1224 | Ga0070679_100198221 | |||
| 1225 | Ga0070679_100321529 | |||
| 1226 | Ga0070684_100034883 | |||
| 1227 | Ga0070684_100411507 | |||
| 1228 | Ga0070684_100537817 | |||
| 1229 | Ga0070697_100000421 | |||
| 1230 | Ga0070697_100128234 | |||
| 1231 | Ga0070697_100337107 | |||
| 1232 | Ga0068853_100008003 | |||
| 1233 | Ga0070672_100019065 | |||
| 1234 | Ga0070672_100030640 | |||
| 1235 | Ga0070672_100204378 | |||
| 1236 | Ga0070672_100292590 | |||
| 1237 | Ga0070672_100809693 | |||
| 1238 | Ga0070686_100090815 | |||
| 1239 | Ga0070695_100165636 | |||
| 1240 | Ga0070696_100033545 | |||
| 1241 | Ga0070696_100043851 | |||
| 1242 | Ga0070696_100425358 | |||
| 1243 | Ga0070665_100000269 | |||
| 1244 | Ga0070665_100003003 | |||
| 1245 | Ga0070665_100035708 | |||
| 1246 | Ga0070665_100084036 | |||
| 1247 | Ga0070665_100202373 | |||
| 1248 | Ga0070665_100456954 | |||
| 1249 | Ga0070704_100121260 | |||
| 1250 | Ga0070704_100235952 | |||
| 1251 | Ga0068855_100006099 | |||
| 1252 | Ga0068855_100012247 | |||
| 1253 | Ga0070664_100003979 | |||
| 1254 | Ga0070664_100020586 | |||
| 1255 | Ga0070664_100071441 | |||
| 1256 | Ga0070664_100214501 | |||
| 1257 | Ga0068857_100027185 | |||
| 1258 | Ga0068857_100068453 | |||
| 1259 | Ga0068857_100431895 | |||
| 1260 | Ga0068854_100001336 | |||
| 1261 | Ga0068856_100277726 | |||
| 1262 | Ga0070702_100155882 | |||
| 1263 | Ga0068852_100231142 | |||
| 1264 | Ga0068852_100510264 | |||
| 1265 | Ga0068852_100512776 | |||
| 1266 | Ga0068859_100079340 | |||
| 1267 | Ga0068859_100107960 | |||
| 1268 | Ga0068859_100144299 | |||
| 1269 | Ga0068859_100416509 | |||
| 1270 | Ga0068859_100885240 | |||
| 1271 | Ga0068864_100008861 | |||
| 1272 | Ga0068864_100062599 | |||
| 1273 | Ga0068864_100279752 | |||
| 1274 | Ga0068864_100333325 | |||
| 1275 | Ga0068864_100799685 | |||
| 1276 | Ga0068861_100250954 | |||
| 1277 | Ga0068861_100562106 | |||
| 1278 | Ga0068870_10165125 | |||
| 1279 | Ga0068870_10518570 | |||
| 1280 | Ga0068863_100000969 | |||
| 1281 | Ga0068863_100012620 | |||
| 1282 | Ga0068863_100036154 | |||
| 1283 | Ga0068863_100138603 | |||
| 1284 | Ga0068863_100261002 | |||
| 1285 | Ga0068863_100268294 | |||
| 1286 | Ga0068858_100007152 | |||
| 1287 | Ga0068858_100078881 | |||
| 1288 | Ga0068858_100271131 | |||
| 1289 | Ga0068858_100386397 | |||
| 1290 | Ga0068860_100028140 | |||
| 1291 | Ga0068860_100131686 | |||
| 1292 | Ga0068860_100229215 | |||
| 1293 | Ga0068860_100567637 | |||
| 1294 | Ga0068860_100789425 | |||
| 1295 | Ga0068862_100185583 | |||
| 1296 | Ga0068862_100246105 | |||
| 1297 | Ga0081455_10004528 | |||
| 1298 | Ga0081455_10153630 | |||
| 1299 | Ga0081538_10000250 | |||
| 1300 | Ga0081538_10002047 | |||
| 1301 | Ga0081538_10044880 | |||
| 1302 | Ga0070717_10627985 | |||
| 1303 | Ga0075368_10005180 | |||
| 1304 | Ga0075364_10115498 | |||
| 1305 | Ga0070712_100058727 | |||
| 1306 | Ga0070712_100280953 | |||
| 1307 | Ga0075362_10000613 | |||
| 1308 | Ga0075367_10011391 | |||
| 1309 | Ga0075369_10002444 | |||
| 1310 | Ga0075366_10163935 | |||
| 1311 | Ga0097621_100020011 | |||
| 1312 | Ga0097621_100043872 | |||
| 1313 | Ga0097621_100046954 | |||
| 1314 | Ga0097621_100067794 | |||
| 1315 | Ga0097621_100100789 | |||
| 1316 | Ga0097621_100147274 | |||
| 1317 | Ga0097621_100156444 | |||
| 1318 | Ga0097621_100397873 | |||
| 1319 | Ga0075370_10164808 | |||
| 1320 | Ga0068871_100013592 | |||
| 1321 | Ga0068871_100028407 | |||
| 1322 | Ga0068871_100041568 | |||
| 1323 | Ga0068871_100061214 | |||
| 1324 | Ga0068871_100104558 | |||
| 1325 | Ga0068871_100331665 | |||
| 1326 | Ga0068871_100413750 | |||
| 1327 | Ga0068871_100505636 | |||
| 1328 | Ga0075428_100555731 | |||
| 1329 | Ga0075428_100759421 | |||
| 1330 | Ga0075430_100189597 | |||
| 1331 | Ga0075431_100071481 | |||
| 1332 | Ga0075431_100081000 | |||
| 1333 | Ga0075431_100131547 | |||
| 1334 | Ga0075431_100316046 | |||
| 1335 | Ga0075431_101002333 | |||
| 1336 | Ga0075433_10049769 | |||
| 1337 | Ga0075433_10170130 | |||
| 1338 | Ga0075433_10187506 | |||
| 1339 | Ga0075433_10209882 | |||
| 1340 | Ga0075433_10502774 | |||
| 1341 | Ga0075434_100058033 | |||
| 1342 | Ga0075434_100084832 | |||
| 1343 | Ga0075434_100086909 | |||
| 1344 | Ga0075434_100142561 | |||
| 1345 | Ga0075429_100066027 | |||
| 1346 | Ga0075429_100196316 | |||
| 1347 | Ga0075429_100497079 | |||
| 1348 | Ga0068865_100055272 | |||
| 1349 | Ga0068865_100058801 | |||
| 1350 | Ga0068865_100177213 | |||
| 1351 | Ga0068865_100486097 | |||
| 1352 | Ga0068865_100815937 | |||
| 1353 | Ga0097620_100079345 | |||
| 1354 | Ga0097620_100107978 | |||
| 1355 | Ga0097620_100144286 | |||
| 1356 | Ga0097620_100416506 | |||
| 1357 | Ga0097620_100885205 | |||
| 1358 | Ga0079104_1051324 | |||
| 1359 | Ga0075435_100064802 | |||
| 1360 | Ga0075435_100660785 | |||
| 1361 | Ga0099794_10073987 | |||
| 1362 | Ga0099794_10075534 | |||
| 1363 | Ga0099794_10155250 | |||
| 1364 | Ga0099795_10022459 | |||
| 1365 | Ga0105251_10005138 | |||
| 1366 | Ga0105250_10110446 | |||
| 1367 | Ga0105240_10341619 | |||
| 1368 | Ga0111539_10007710 | |||
| 1369 | Ga0111539_10021601 | |||
| 1370 | Ga0111539_10044169 | |||
| 1371 | Ga0111539_10048633 | |||
| 1372 | Ga0111539_10053750 | |||
| 1373 | Ga0111539_10060925 | |||
| 1374 | Ga0111539_10160076 | |||
| 1375 | Ga0111539_10207560 | |||
| 1376 | Ga0111539_10365710 | |||
| 1377 | Ga0111539_10442518 | |||
| 1378 | Ga0111539_10984265 | |||
| 1379 | Ga0105245_10514704 | |||
| 1380 | Ga0114129_10024758 | |||
| 1381 | Ga0114129_10066829 | |||
| 1382 | Ga0114129_10128790 | |||
| 1383 | Ga0114129_10274343 | |||
| 1384 | Ga0114129_10388655 | |||
| 1385 | Ga0114129_10467275 | |||
| 1386 | Ga0114129_10521481 | |||
| 1387 | Ga0114129_11067456 | |||
| 1388 | Ga0105243_10010720 | |||
| 1389 | Ga0105243_10081632 | |||
| 1390 | Ga0105242_10003471 | |||
| 1391 | Ga0105242_10097645 | |||
| 1392 | Ga0105242_10099116 | |||
| 1393 | Ga0105242_10164471 | |||
| 1394 | Ga0105242_10830964 | |||
| 1395 | Ga0105248_10001106 | |||
| 1396 | Ga0105248_10009115 | |||
| 1397 | Ga0105248_10026939 | |||
| 1398 | Ga0105248_10061024 | |||
| 1399 | Ga0105248_10093930 | |||
| 1400 | Ga0105249_10075568 | |||
| 1401 | Ga0105249_10111457 | |||
| 1402 | Ga0105249_10287756 | |||
| 1403 | Ga0105249_10942128 | |||
| 1404 | Ga0105249_10969848 | |||
| 1405 | Ga0099796_10114967 | |||
| 1406 | Ga0105239_10050469 | |||
| 1407 | Ga0105239_11348957 | |||
| 1408 | Ga0105246_10002809 | |||
| 1409 | Ga0105246_10268373 | |||
| 1410 | Ga0105246_10271338 | |||
| 1411 | Ga0105246_10327917 | |||
| 1412 | Ga0157373_10005741 | |||
| 1413 | Ga0157373_10211073 | |||
| 1414 | Ga0157373_10622710 | |||
| 1415 | Ga0157371_10000847 | |||
| 1416 | Ga0157371_10069396 | |||
| 1417 | Ga0157370_10000897 | |||
| 1418 | Ga0157370_10278373 | |||
| 1419 | Ga0157370_10537202 | |||
| 1420 | Ga0157369_10005204 | |||
| 1421 | Ga0157374_10011913 | |||
| 1422 | Ga0157374_10115202 | |||
| 1423 | Ga0157374_10361456 | |||
| 1424 | Ga0157374_11112997 | |||
| 1425 | Ga0157378_10032994 | |||
| 1426 | Ga0157378_10037612 | |||
| 1427 | Ga0157378_10072564 | |||
| 1428 | Ga0157378_10096220 | |||
| 1429 | Ga0157378_10110233 | |||
| 1430 | Ga0157378_10135288 | |||
| 1431 | Ga0157378_10347197 | |||
| 1432 | Ga0157378_10895426 | |||
| 1433 | Ga0163162_10022654 | |||
| 1434 | Ga0163162_10057886 | |||
| 1435 | Ga0163162_10090809 | |||
| 1436 | Ga0163162_10309798 | |||
| 1437 | Ga0163162_11237993 | |||
| 1438 | Ga0157372_10004693 | |||
| 1439 | Ga0157375_10004866 | |||
| 1440 | Ga0157375_10008115 | |||
| 1441 | Ga0157375_10051985 | |||
| 1442 | Ga0157375_10061324 | |||
| 1443 | Ga0157375_10137739 | |||
| 1444 | Ga0157375_10148350 | |||
| 1445 | Ga0157375_10256642 | |||
| 1446 | Ga0163163_10000446 | |||
| 1447 | Ga0163163_10055176 | |||
| 1448 | Ga0163163_10096297 | |||
| 1449 | Ga0163163_10131576 | |||
| 1450 | Ga0163163_10204195 | |||
| 1451 | Ga0163163_10245365 | |||
| 1452 | Ga0163163_10425161 | |||
| 1453 | Ga0157380_10145568 | |||
| 1454 | Ga0157380_10217623 | |||
| 1455 | Ga0157380_10250345 | |||
| 1456 | Ga0157380_10473177 | |||
| 1457 | Ga0157380_10502709 | |||
| 1458 | Ga0157380_10564165 | |||
| 1459 | Ga0157380_10768303 | |||
| 1460 | Ga0157379_10000562 | |||
| 1461 | Ga0157379_10100279 | |||
| 1462 | Ga0157376_10000014 | |||
| 1463 | Ga0157376_10036580 | |||
| 1464 | Ga0157376_10057875 | |||
| 1465 | Ga0157376_10060869 | |||
| 1466 | Ga0157376_10074456 | |||
| 1467 | Ga0157376_10085537 | |||
| 1468 | Ga0157376_10151767 | |||
| 1469 | Ga0157376_10159200 | |||
| 1470 | Ga0157376_10206815 | |||
| 1471 | Ga0157376_10229726 | |||
| 1472 | Ga0157376_10288977 | |||
| 1473 | Ga0157376_11188262 | |||
| 1474 | Ga0163161_10030399 | |||
| 1475 | Ga0163161_10506165 | |||
| 1476 | Ga0184599_122998 | |||
| 1477 | Ga0206349_1555407 | |||
| 1478 | Ga0206351_10760636 | |||
| 1479 | Ga0206352_10266958 | |||
| 1480 | Ga0206354_10096804 | |||
| 1481 | Ga0213876_10025237 | |||
| 1482 | Ga0213876_10027791 | |||
| 1483 | Ga0213876_10115472 | |||
| 1484 | Ga0213875_10007729 | |||
| 1485 | Ga0224712_10002961 | |||
| 1486 | Ga0224712_10026872 | |||
| 1487 | Ga0228598_1011982 | |||
| 1488 | Ga0207697_10017447 | |||
| 1489 | Ga0207697_10047774 | |||
| 1490 | Ga0207697_10124793 | |||
| 1491 | Ga0207656_10133099 | |||
| 1492 | Ga0207713_1001799 | |||
| 1493 | Ga0207653_10000517 | |||
| 1494 | Ga0207680_10000784 | |||
| 1495 | Ga0207699_10008729 | |||
| 1496 | Ga0207699_10023466 | |||
| 1497 | Ga0207645_10236826 | |||
| 1498 | Ga0207643_10161510 | |||
| 1499 | Ga0207643_10259611 | |||
| 1500 | Ga0207705_10052692 | |||
| 1501 | Ga0207705_10086103 | |||
| 1502 | Ga0207705_10207334 | |||
| 1503 | Ga0207684_10133583 | |||
| 1504 | Ga0207684_10571806 | |||
| 1505 | Ga0207654_10047172 | |||
| 1506 | Ga0207707_10016149 | |||
| 1507 | Ga0207707_10028950 | |||
| 1508 | Ga0207707_10075784 | |||
| 1509 | Ga0207695_10140453 | |||
| 1510 | Ga0207693_10010686 | |||
| 1511 | Ga0207693_10030426 | |||
| 1512 | Ga0207693_10137685 | |||
| 1513 | Ga0207693_10146737 | |||
| 1514 | Ga0207663_10004574 | |||
| 1515 | Ga0207660_10009046 | |||
| 1516 | Ga0207660_10018722 | |||
| 1517 | Ga0207660_10027520 | |||
| 1518 | Ga0207660_10130856 | |||
| 1519 | Ga0207660_10211390 | |||
| 1520 | Ga0207660_10623446 | |||
| 1521 | Ga0207662_10013063 | |||
| 1522 | Ga0207662_10133008 | |||
| 1523 | Ga0207662_10162624 | |||
| 1524 | Ga0207657_10000083 | |||
| 1525 | Ga0207657_10014470 | |||
| 1526 | Ga0207657_10447531 | |||
| 1527 | Ga0207649_10001847 | |||
| 1528 | Ga0207649_10028375 | |||
| 1529 | Ga0207649_10065156 | |||
| 1530 | Ga0207652_10012202 | |||
| 1531 | Ga0207652_10025964 | |||
| 1532 | Ga0207652_10033139 | |||
| 1533 | Ga0207652_10059080 | |||
| 1534 | Ga0207646_10001680 | |||
| 1535 | Ga0207646_10017051 | |||
| 1536 | Ga0207646_10092622 | |||
| 1537 | Ga0207646_10097917 | |||
| 1538 | Ga0207646_10100701 | |||
| 1539 | Ga0207646_10159720 | |||
| 1540 | Ga0207646_10370025 | |||
| 1541 | Ga0207681_10003272 | |||
| 1542 | Ga0207681_10036207 | |||
| 1543 | Ga0207681_10050520 | |||
| 1544 | Ga0207681_10326746 | |||
| 1545 | Ga0207650_10002276 | |||
| 1546 | Ga0207650_10038113 | |||
| 1547 | Ga0207650_10108714 | |||
| 1548 | Ga0207650_10163969 | |||
| 1549 | Ga0207650_10287093 | |||
| 1550 | Ga0207659_10000169 | |||
| 1551 | Ga0207659_10000843 | |||
| 1552 | Ga0207659_10002914 | |||
| 1553 | Ga0207659_10056582 | |||
| 1554 | Ga0207659_10253138 | |||
| 1555 | Ga0207659_10304650 | |||
| 1556 | Ga0207659_10593370 | |||
| 1557 | Ga0207700_10040381 | |||
| 1558 | Ga0207700_10263954 | |||
| 1559 | Ga0207644_10001196 | |||
| 1560 | Ga0207644_10006842 | |||
| 1561 | Ga0207644_10026639 | |||
| 1562 | Ga0207644_10097083 | |||
| 1563 | Ga0207644_10167225 | |||
| 1564 | Ga0207690_10000356 | |||
| 1565 | Ga0207690_10025822 | |||
| 1566 | Ga0207706_10005054 | |||
| 1567 | Ga0207706_10010712 | |||
| 1568 | Ga0207706_10253038 | |||
| 1569 | Ga0207686_10000496 | |||
| 1570 | Ga0207709_10001154 | |||
| 1571 | Ga0207709_10147840 | |||
| 1572 | Ga0207709_10157949 | |||
| 1573 | Ga0207709_10239338 | |||
| 1574 | Ga0207709_10653526 | |||
| 1575 | Ga0207670_10007709 | |||
| 1576 | Ga0207670_10071199 | |||
| 1577 | Ga0207670_10165066 | |||
| 1578 | Ga0207670_10202826 | |||
| 1579 | Ga0207670_10295411 | |||
| 1580 | Ga0207669_10337532 | |||
| 1581 | Ga0207704_10003207 | |||
| 1582 | Ga0207704_10023061 | |||
| 1583 | Ga0207704_10084243 | |||
| 1584 | Ga0207704_10097938 | |||
| 1585 | Ga0207704_10245352 | |||
| 1586 | Ga0207665_10016663 | |||
| 1587 | Ga0207665_10041443 | |||
| 1588 | Ga0207691_10023258 | |||
| 1589 | Ga0207691_10059354 | |||
| 1590 | Ga0207691_10121064 | |||
| 1591 | Ga0207711_10002561 | |||
| 1592 | Ga0207711_10002690 | |||
| 1593 | Ga0207711_10016136 | |||
| 1594 | Ga0207711_10070683 | |||
| 1595 | Ga0207711_10136373 | |||
| 1596 | Ga0207689_10052132 | |||
| 1597 | Ga0207689_10095467 | |||
| 1598 | Ga0207689_10097667 | |||
| 1599 | Ga0207661_10071811 | |||
| 1600 | Ga0207679_10002743 | |||
| 1601 | Ga0207679_10003915 | |||
| 1602 | Ga0207679_10191930 | |||
| 1603 | Ga0207679_10303118 | |||
| 1604 | Ga0207679_10439920 | |||
| 1605 | Ga0207679_10443729 | |||
| 1606 | Ga0207667_10004004 | |||
| 1607 | Ga0207667_10004990 | |||
| 1608 | Ga0207651_10039011 | |||
| 1609 | Ga0207651_10041980 | |||
| 1610 | Ga0207651_10145313 | |||
| 1611 | Ga0207651_10227752 | |||
| 1612 | Ga0207651_10469648 | |||
| 1613 | Ga0207712_10156408 | |||
| 1614 | Ga0207712_10626211 | |||
| 1615 | Ga0207668_10049299 | |||
| 1616 | Ga0207668_10129579 | |||
| 1617 | Ga0207640_10003576 | |||
| 1618 | Ga0207640_10004793 | |||
| 1619 | Ga0207658_10005136 | |||
| 1620 | Ga0207658_10014653 | |||
| 1621 | Ga0207658_10030281 | |||
| 1622 | Ga0207677_10010265 | |||
| 1623 | Ga0207677_10043856 | |||
| 1624 | Ga0207677_10274519 | |||
| 1625 | Ga0207703_10005252 | |||
| 1626 | Ga0207703_10006761 | |||
| 1627 | Ga0207703_10255747 | |||
| 1628 | Ga0207703_10314334 | |||
| 1629 | Ga0207639_10000175 | |||
| 1630 | Ga0207678_10009536 | |||
| 1631 | Ga0207708_10052924 | |||
| 1632 | Ga0207708_10132098 | |||
| 1633 | Ga0207708_10184539 | |||
| 1634 | Ga0207708_10480439 | |||
| 1635 | Ga0207702_10560982 | |||
| 1636 | Ga0207641_10000293 | |||
| 1637 | Ga0207641_10006158 | |||
| 1638 | Ga0207641_10036534 | |||
| 1639 | Ga0207641_10115321 | |||
| 1640 | Ga0207641_10123947 | |||
| 1641 | Ga0207641_10198459 | |||
| 1642 | Ga0207641_10206307 | |||
| 1643 | Ga0207641_10361827 | |||
| 1644 | Ga0207648_10135911 | |||
| 1645 | Ga0207648_10301506 | |||
| 1646 | Ga0207676_10003247 | |||
| 1647 | Ga0207676_10008606 | |||
| 1648 | Ga0207676_10072948 | |||
| 1649 | Ga0207676_10292740 | |||
| 1650 | Ga0207674_10013628 | |||
| 1651 | Ga0207674_10041311 | |||
| 1652 | Ga0207674_10082680 | |||
| 1653 | Ga0207674_10083057 | |||
| 1654 | Ga0207674_10217764 | |||
| 1655 | Ga0207674_10381506 | |||
| 1656 | Ga0207675_100106120 | |||
| 1657 | Ga0207675_100125229 | |||
| 1658 | Ga0207675_100251201 | |||
| 1659 | Ga0207675_100418708 | |||
| 1660 | Ga0207683_10041648 | |||
| 1661 | Ga0207683_10060510 | |||
| 1662 | Ga0207683_10079749 | |||
| 1663 | Ga0207683_10112116 | |||
| 1664 | Ga0207698_10342520 | |||
| 1665 | Ga0207698_10899905 | |||
| 1666 | Ga0209281_1018955 | |||
| 1667 | Ga0209983_1043383 | |||
| 1668 | Ga0209588_1023526 | |||
| 1669 | Ga0209588_1023623 | |||
| 1670 | Ga0209588_1069668 | |||
| 1671 | Ga0209588_1077578 | |||
| 1672 | Ga0209971_1008691 | |||
| 1673 | Ga0209998_10009176 | |||
| 1674 | Ga0209998_10072430 | |||
| 1675 | Ga0209813_10000030 | |||
| 1676 | Ga0209974_10123585 | |||
| 1677 | Ga0207428_10029211 | |||
| 1678 | Ga0207428_10031565 | |||
| 1679 | Ga0207428_10047561 | |||
| 1680 | Ga0207428_10047950 | |||
| 1681 | Ga0207428_10059423 | |||
| 1682 | Ga0207428_10115063 | |||
| 1683 | Ga0207428_10141228 | |||
| 1684 | Ga0207428_10232879 | |||
| 1685 | Ga0268266_10000072 | |||
| 1686 | Ga0268266_10000334 | |||
| 1687 | Ga0268266_10048996 | |||
| 1688 | Ga0268266_10055880 | |||
| 1689 | Ga0268266_10452167 | |||
| 1690 | Ga0268265_10433870 | |||
| 1691 | Ga0268265_10915173 | |||
| 1692 | Ga0268264_10019574 | |||
| 1693 | Ga0268264_10116808 | |||
| 1694 | Ga0268264_10294590 | |||
| 1695 | Ga0268264_10301783 | |||
| 1696 | Ga0265318_10000165 | |||
| 1697 | Ga0265318_10002420 | |||
| 1698 | Ga0265323_10022789 | |||
| 1699 | Ga0265323_10093870 | |||
| 1700 | Ga0265336_10044859 | |||
| 1701 | Ga0265338_10021503 | |||
| 1702 | Ga0265338_10033841 | |||
| 1703 | Ga0265324_10039063 | |||
| 1704 | Ga0265760_10036476 | |||
| 1705 | Ga0265330_10001250 | |||
| 1706 | Ga0265330_10036666 | |||
| 1707 | Ga0265332_10001069 | |||
| 1708 | Ga0265332_10004047 | |||
| 1709 | Ga0265328_10020981 | |||
| 1710 | Ga0265320_10000099 | |||
| 1711 | Ga0265320_10002218 | |||
| 1712 | Ga0265320_10063433 | |||
| 1713 | Ga0265325_10006073 | |||
| 1714 | Ga0265325_10016063 | |||
| 1715 | Ga0265325_10045537 | |||
| 1716 | Ga0265329_10000665 | |||
| 1717 | Ga0265329_10009674 | |||
| 1718 | Ga0265329_10030961 | |||
| 1719 | Ga0265340_10007939 | |||
| 1720 | Ga0265340_10017706 | |||
| 1721 | Ga0265339_10000649 | |||
| 1722 | Ga0265339_10001807 | |||
| 1723 | Ga0265339_10036620 | |||
| 1724 | Ga0265339_10071013 | |||
| 1725 | Ga0265331_10000196 | |||
| 1726 | Ga0265331_10008193 | |||
| 1727 | Ga0265331_10015188 | |||
| 1728 | Ga0265316_10001327 | |||
| 1729 | Ga0265316_10001597 | |||
| 1730 | Ga0265316_10003381 | |||
| 1731 | Ga0265316_10003941 | |||
| 1732 | Ga0265316_10029196 | |||
| 1733 | Ga0265316_10034724 | |||
| 1734 | Ga0265316_10048066 | |||
| 1735 | Ga0265316_10140851 | |||
| 1736 | Ga0265316_10177972 | |||
| 1737 | Ga0307408_100020865 | |||
| 1738 | Ga0307408_100298797 | |||
| 1739 | Ga0265313_10000953 | |||
| 1740 | Ga0265313_10002411 | |||
| 1741 | Ga0265313_10040192 | |||
| 1742 | Ga0265313_10076134 | |||
| 1743 | Ga0316575_10000098 | |||
| 1744 | Ga0316575_10112139 | |||
| 1745 | Ga0316579_10019813 | |||
| 1746 | Ga0316579_10086583 | |||
| 1747 | Ga0316579_10093522 | |||
| 1748 | Ga0265314_10000003 | |||
| 1749 | Ga0265314_10000071 | |||
| 1750 | Ga0265314_10004438 | |||
| 1751 | Ga0265314_10031172 | |||
| 1752 | Ga0265314_10063500 | |||
| 1753 | Ga0265342_10000679 | |||
| 1754 | Ga0265342_10002488 | |||
| 1755 | Ga0316576_10000548 | |||
| 1756 | Ga0316576_10002466 | |||
| 1757 | Ga0316576_10009928 | |||
| 1758 | Ga0316576_10030207 | |||
| 1759 | Ga0316576_10169945 | |||
| 1760 | Ga0316576_10364365 | |||
| 1761 | Ga0316576_10381837 | |||
| 1762 | Ga0307405_10050168 | |||
| 1763 | Ga0316577_10015566 | |||
| 1764 | Ga0316577_10136248 | |||
| 1765 | Ga0316577_10185104 | |||
| 1766 | Ga0316577_10232584 | |||
| 1767 | Ga0307413_10121092 | |||
| 1768 | Ga0307413_10188987 | |||
| 1769 | Ga0307413_10265855 | |||
| 1770 | Ga0307410_10167213 | |||
| 1771 | Ga0307406_10015119 | |||
| 1772 | Ga0307406_10047965 | |||
| 1773 | Ga0307406_10059420 | |||
| 1774 | Ga0307407_10013301 | |||
| 1775 | Ga0307412_10010507 | |||
| 1776 | Ga0307412_10130228 | |||
| 1777 | Ga0307412_10280242 | |||
| 1778 | Ga0307412_10635686 | |||
| 1779 | Ga0307409_100218540 | |||
| 1780 | Ga0307409_100433549 | |||
| 1781 | Ga0307409_100751137 | |||
| 1782 | Ga0307416_100061839 | |||
| 1783 | Ga0307416_100909823 | |||
| 1784 | Ga0307414_10201046 | |||
| 1785 | Ga0307411_10168166 | |||
| 1786 | Ga0307415_100355852 | |||
| 1787 | Ga0316593_10007662 | |||
| 1788 | Ga0316593_10024652 | |||
| 1789 | Ga0316593_10043261 | |||
| 1790 | Ga0316593_10056979 | |||
| 1791 | Ga0316592_1002050 | |||
| 1792 | Ga0316592_1003442 | |||
| 1793 | Ga0316592_1008760 | |||
| 1794 | Ga0316592_1038779 | |||
| 1795 | Ga0316588_1000219 | |||
| 1796 | Ga0316588_1002297 | |||
| 1797 | Ga0316588_1002933 | |||
| 1798 | Ga0316588_1006171 | |||
| 1799 | Ga0316588_1018566 | |||
| 1800 | Ga0316587_1000001 | |||
| 1801 | Ga0316596_1000985 | |||
| 1802 | Ga0316596_1006947 | |||
| 1803 | Ga0373926_0000781 | |||
| 1804 | Ga0373926_0132103 | |||
| 1805 | Ga0373928_0069145 | |||
| 1806 | Ga0373944_0010372 | |||
| 1807 | Ga0373944_0154259 | |||
| 1808 | Ga0373923_0002039 | |||
| 1809 | Ga0373936_0193741 | |||
| 1810 | Ga0373945_0053899 | |||
| 1811 | Ga0373954_0034762 | |||
| 1812 | Ga0373954_0133995 | |||
| 1813 | Ga0373956_0057189 | |||
| 1814 | Ga0373957_0128152 | |||
| 1815 | Ga0373943_0228552 | |||
| 1816 | Ga0373946_0151205 | |||
| 1817 | Ga0373946_0231329 | |||
| 1818 | Ga0373955_0063537 | |||
| 1819 | Ga0373955_0073240 | |||
| 1820 | Ga0373961_0000446 | |||
| 1821 | Ga0316574_0009330 | |||
| 1822 | Ga0316574_0106711 | |||
| 1823 | Ga0373924_0044014 | |||
| 1824 | Ga0373931_0027382 | |||
| 1825 | Ga0373931_0106752 | |||
| 1826 | Ga0373931_0147691 | |||
| 1827 | Ga0373935_0027204 | |||
| 1828 | Ga0373935_0126145 | |||
| 1829 | Ga0373927_0005384 | |||
| 1830 | Ga0373933_0014827 | |||
| 1831 | Ga0373933_0381401 | |||
| 1832 | Ga0373947_0010227 | |||
| 1833 | Ga0373937_0000078 | |||
| 1834 | Ga0373937_0021252 | |||
| 1835 | Ga0373937_0025354 | |||
| 1836 | Ga0373937_0031983 | |||
| 1837 | Ga0373937_0107774 | |||
| 1838 | Ga0373937_0238723 | |||
| 1839 | Ga0373937_0387063 | |||
| 1840 | Ga0373937_0691184 | |||
| 1841 | Ga0265778_007972 | |||
| 1842 | Ga0316582_0058537 | |||
| 1843 | Ga0316582_0121182 | |||
| 1844 | Ga0316582_0218990 | |||
| 1845 | Ga0316582_0399222 | |||
| 1846 | Ga0316584_0009978 | |||
| 1847 | Ga0316584_0025357 | |||
| 1848 | Ga0316584_0182353 | |||
| 1849 | Ga0316584_0220563 | |||
| 1850 | Ga0316584_0245852 | |||
| 1851 | Ga0316584_0791205 | |||
| 1852 | Ga0373925_0165163 | |||
| 1853 | Ga0395899_0232654 | |||
| 1854 | Ga0395900_0479417 | |||
| 1855 | Ga0316581_0054063 | |||
| 1856 | Ga0436364_1196741 | |||
| 1857 | Ga0436364_1430661 | |||
| 1858 | Ga0400489_80694 | |||
| 1859 | Ga0400487_59508 | |||
| 1860 | Ga0436365_0831894 | |||
| 1861 | Ga0436365_0896462 | |||
| 1862 | Ga0436365_1742949 | |||
| 1863 | Ga0436365_1846658 | |||
| 1864 | Ga0436360_0655945 | |||
| 1865 | Ga0436361_1007716 | |||
| 1866 | Ga0439465_0001490 | |||
| 1867 | Ga0451807_0548069 | |||
| 1868 | Ga0451849_1494037 | |||
| 1869 | Ga0451853_2126451 | |||
| 1870 | Ga0439443_007826 | |||
| 1871 | Ga0439445_0030206 | |||
| 1872 | Ga0439445_0053427 | |||
| 1873 | Ga0439456_058212 | |||
| 1874 | Ga0439462_0004174 | |||
| 1875 | Ga0450923_010186 | |||
| 1876 | Ga0450918_005831 | |||
| 1877 | Ga0450918_019040 | |||
| 1878 | Ga0451577_0000139 | |||
| 1879 | Ga0451577_0332671 | |||
| 1880 | Ga0453683_0000392 | |||
| 1881 | Ga0453683_0068937 | |||
| 1882 | Ga0453684_0003616 | |||
| 1883 | Ga0453684_0010619 | |||
| 1884 | Ga0453684_0011627 | |||
| 1885 | Ga0453684_0020399 | |||
| 1886 | Ga0453684_0178052 | |||
| 1887 | Ga0453684_0251157 | |||
| 1888 | Ga0466968_0104281 | |||
| 1889 | Ga0451576_0026183 | |||
| 1890 | Ga0451576_0029400 | |||
| 1891 | Ga0451576_0392249 | |||
| 1892 | Ga0466967_0003862 | |||
| 1893 | Ga0495592_0005038 | |||
| 1894 | Ga0495592_0052007 | |||
| 1895 | Ga0495592_0054997 | |||
| 1896 | Ga0495592_0203556 | |||
| 1897 | Ga0495603_0058776 | |||
| 1898 | Ga0495603_0072551 | |||
| 1899 | Ga0495629_0007511 | |||
| 1900 | Ga0495629_0513808 | |||
| 1901 | Ga0495638_0024402 | |||
| 1902 | Ga0495638_0157345 | |||
| 1903 | Ga0495641_0095648 | |||
| 1904 | Ga0495651_0000335 | |||
| 1905 | Ga0495651_0003305 | |||
| 1906 | Ga0495651_0006885 | |||
| 1907 | Ga0495651_0085033 | |||
| 1908 | Ga0495651_0228857 | |||
| 1909 | Ga0495653_0008639 | |||
| 1910 | Ga0495653_0151654 | |||
| 1911 | Ga0495580_0002835 | |||
| 1912 | Ga0495580_0028841 | |||
| 1913 | Ga0495580_0046881 | |||
| 1914 | Ga0495580_0086482 | |||
| 1915 | Ga0495580_0136192 | |||
| 1916 | Ga0495580_0530334 | |||
| 1917 | Ga0495582_0000227 | |||
| 1918 | Ga0495582_0001649 | |||
| 1919 | Ga0495582_0181963 | |||
| 1920 | Ga0495639_0003836 | |||
| 1921 | Ga0495639_0225422 | |||
| 1922 | Ga0495662_0050628 | |||
| 1923 | Ga0495664_0246106 | |||
| 1924 | Ga0495664_0440270 | |||
| 1925 | Ga0495664_0503502 | |||
| 1926 | Ga0495594_0139940 | |||
| 1927 | Ga0495608_0006109 | |||
| 1928 | Ga0495608_0016359 | |||
| 1929 | Ga0495608_0054588 | |||
| 1930 | Ga0495608_0142185 | |||
| 1931 | Ga0495618_0046504 | |||
| 1932 | Ga0495618_0083189 | |||
| 1933 | Ga0495628_0030708 | |||
| 1934 | Ga0495628_0048496 | |||
| 1935 | Ga0495628_0078943 | |||
| 1936 | Ga0495628_0197503 | |||
| 1937 | Ga0495630_0008656 | |||
| 1938 | Ga0495630_0090329 | |||
| 1939 | Ga0495630_0117603 | |||
| 1940 | Ga0495630_0269913 | |||
| 1941 | Ga0495630_0300077 | |||
| 1942 | Ga0495643_0015955 | |||
| 1943 | Ga0495666_0005964 | |||
| 1944 | Ga0495652_0013927 | |||
| 1945 | Ga0495652_0020061 | |||
| 1946 | Ga0495665_0001996 | |||
| 1947 | Ga0495665_0054933 | |||
| 1948 | Ga0495640_0095321 | |||
| 1949 | Ga0495640_0145489 | |||
| 1950 | Ga0495640_0271873 | |||
| 1951 | Ga0495586_0002069 | |||
| 1952 | Ga0495586_0030459 | |||
| 1953 | Ga0495586_0116737 | |||
| 1954 | Ga0495586_0142015 | |||
| 1955 | Ga0495587_0002155 | |||
| 1956 | Ga0495587_0044560 | |||
| 1957 | Ga0495621_0007223 | |||
| 1958 | Ga0495645_0019971 | |||
| 1959 | Ga0495645_0056273 | |||
| 1960 | Ga0495645_0162961 | |||
| 1961 | Ga0495645_0291381 | |||
| 1962 | Ga0495645_0429474 | |||
| 1963 | Ga0495667_0002241 | |||
| 1964 | Ga0495667_0030860 | |||
| 1965 | Ga0495634_0018345 | |||
| 1966 | Ga0495635_0004284 | |||
| 1967 | Ga0495635_0132528 | |||
| 1968 | Ga0495635_0339231 | |||
| 1969 | Ga0495657_0003416 | |||
| 1970 | Ga0495657_0057267 | |||
| 1971 | Ga0495599_0114149 | |||
| 1972 | Ga0495599_0229996 | |||
| 1973 | Ga0495623_0012203 | |||
| 1974 | Ga0495646_0000703 | |||
| 1975 | Ga0495647_0005580 | |||
| 1976 | Ga0495658_0043580 | |||
| 1977 | Ga0495658_0082856 | |||
| 1978 | Ga0495658_0196338 | |||
| 1979 | Ga0495658_0222527 | |||
| 1980 | Ga0495613_0010783 | |||
| 1981 | Ga0495613_0045662 | |||
| 1982 | Ga0495613_0250488 | |||
| 1983 | Ga0495613_0500232 | |||
| 1984 | Ga0495600_0012011 | |||
| 1985 | Ga0495600_0086143 | |||
| 1986 | Ga0495600_0281774 | |||
| 1987 | Ga0495581_0001452 | |||
| 1988 | Ga0495604_0098928 | |||
| 1989 | Ga0495604_0219352 | |||
| 1990 | Ga0495636_0001365 | |||
| 1991 | Ga0495636_0107688 | |||
| 1992 | Ga0495674_0037039 | |||
| 1993 | Ga0495674_0088681 | |||
| 1994 | Ga0495674_0121225 | |||
| 1995 | Ga0495674_0322663 | |||
| 1996 | Ga0495676_0024812 | |||
| 1997 | Ga0495676_0098517 | |||
| 1998 | Ga0495676_0352916 | |||
| 1999 | Ga0495680_0000106 | |||
| 2000 | Ga0495680_0006887 | |||
| 2001 | Ga0495680_0029632 | |||
| 2002 | Ga0495680_0120388 | |||
| 2003 | Ga0495680_0204960 | |||
| 2004 | Ga0495675_0000643 | |||
| 2005 | Ga0495675_0002269 | |||
| 2006 | Ga0495675_0079541 | |||
| 2007 | Ga0495675_0099183 | |||
| 2008 | Ga0495684_0000488 | |||
| 2009 | Ga0495684_0007566 | |||
| 2010 | Ga0495684_0064208 | |||
| 2011 | Ga0495684_0222806 | |||
| 2012 | Ga0495593_0004921 | |||
| 2013 | Ga0495602_0003151 | |||
| 2014 | Ga0495602_0024638 | |||
| 2015 | Ga0495602_0147734 | |||
| 2016 | Ga0495602_0356930 | |||
| 2017 | Ga0495614_0116376 | |||
| 2018 | Ga0495615_0010063 | |||
| 2019 | Ga0496100_0067361 | |||
| 2020 | Ga0496100_0307378 | |||
| 2021 | Ga0496101_0757208 | |||
| 2022 | Ga0496103_0002010 | |||
| 2023 | Ga0496104_0051204 | |||
| 2024 | Ga0496104_0063828 | |||
| 2025 | Ga0496104_0199320 | |||
| 2026 | Ga0496105_0108637 | |||
| 2027 | Ga0496106_0008373 | |||
| 2028 | Ga0496107_0271620 | |||
| 2029 | Ga0496108_0007055 | |||
| 2030 | Ga0496109_0040920 | |||
| 2031 | Ga0496110_0044043 | |||
| 2032 | Ga0496110_0333127 | |||
| 2033 | Ga0496111_0020980 | |||
| 2034 | Ga0496111_0145684 | |||
| 2035 | Ga0496112_0053099 | |||
| 2036 | Ga0496112_0112902 | |||
| 2037 | Ga0496112_0236835 | |||
| 2038 | Ga0496114_0175117 | |||
| 2039 | Ga0496114_0203527 | |||
| 2040 | Ga0496114_0294937 | |||
| 2041 | Ga0496114_0372525 | |||
| 2042 | Ga0496115_0000977 | |||
| 2043 | Ga0496115_0028556 | |||
| 2044 | Ga0496115_0046403 | |||
| 2045 | Ga0496118_0011507 | |||
| 2046 | Ga0496119_0037631 | |||
| 2047 | Ga0496121_0018026 | |||
| 2048 | Ga0496123_0117712 | |||
| 2049 | Ga0496126_0032158 | |||
| 2050 | Ga0501305_000074 | |||
| 2051 | Ga0501315_020018 | |||
| 2052 | Ga0501323_001695 | |||
| 2053 | Ga0501031_0031770 | |||
| 2054 | Ga0501031_0147207 | |||
| 2055 | Ga0501031_0254269 | |||
| 2056 | Ga0501034_0003614 | |||
| 2057 | Ga0501034_0008086 | |||
| 2058 | Ga0501034_0424783 | |||
| 2059 | Ga0501034_0526046 | |||
| 2060 | Ga0501036_0208565 | |||
| 2061 | Ga0501036_0251923 | |||
| 2062 | Ga0501038_0399863 | |||
| 2063 | Ga0501039_0134957 | |||
| 2064 | Ga0501039_0474616 | |||
| 2065 | Ga0501040_0180022 | |||
| 2066 | Ga0501041_0056572 | |||
| 2067 | Ga0501042_0008502 | |||
| 2068 | Ga0501042_0174625 | |||
| 2069 | Ga0501046_0070217 | |||
| 2070 | Ga0501046_0375285 | |||
| 2071 | Ga0501047_0231494 | |||
| 2072 | Ga0501048_0003213 | |||
| 2073 | Ga0501067_0013192 | |||
| 2074 | Ga0501067_0135074 | |||
| 2075 | Ga0501067_0196631 | |||
| 2076 | Ga0501069_0015105 | |||
| 2077 | Ga0501069_0034622 | |||
| 2078 | Ga0501070_0360042 | |||
| 2079 | Ga0501071_0004803 | |||
| 2080 | Ga0501071_0313739 | |||
| 2081 | Ga0501072_0016348 | |||
| 2082 | Ga0501072_0058802 | |||
| 2083 | Ga0501073_0005689 | |||
| 2084 | Ga0501074_0240097 | |||
| 2085 | Ga0501075_0011893 | |||
| 2086 | Ga0501075_0016294 | |||
| 2087 | Ga0501075_0134359 | |||
| 2088 | Ga0501075_0264931 | |||
| 2089 | Ga0501076_0009211 | |||
| 2090 | Ga0501076_0056448 | |||
| 2091 | Ga0501076_0115789 | |||
| 2092 | Ga0501077_0087652 | |||
| 2093 | Ga0501077_0104087 | |||
| 2094 | Ga0501077_0243081 | |||
| 2095 | Ga0501079_0053043 | |||
| 2096 | Ga0501079_0465431 | |||
| 2097 | Ga0501079_0667556 | |||
| 2098 | Ga0501080_0321316 | |||
| 2099 | Ga0501080_0574583 | |||
| 2100 | Ga0501081_0215001 | |||
| 2101 | Ga0501081_0296578 | |||
| 2102 | Ga0501083_0402086 | |||
| 2103 | Ga0501035_0051311 | |||
| 2104 | Ga0501035_0404190 | |||
| 2105 | Ga0501044_0000121 | |||
| 2106 | Ga0501044_0143341 | |||
| 2107 | Ga0501044_0217000 | |||
| 2108 | Ga0501044_0387311 | |||
| 2109 | Ga0501044_0529673 | |||
| 2110 | Ga0501045_0004485 | |||
| 2111 | nmdc:mga03683_129_c1 | |||
| 2112 | nmdc:mga00v17_13212_c1 | |||
| 2113 | nmdc:mga00v17_200814_c1 | |||
| 2114 | nmdc:mga0yw44_508548_c1 | |||
| 2115 | nmdc:mga0k408_11688_c1 | |||
| 2116 | nmdc:mga0k408_144694_c1 | |||
| 2117 | nmdc:mga06z11_122_c1 | |||
| 2118 | nmdc:mga07m45_32_c1 | |||
| 2119 | nmdc:mga05p37_122920_c1 | |||
| 2120 | nmdc:mga05p37_337590_c2 | |||
| 2121 | nmdc:mga05p37_36050_c1 | |||
| 2122 | nmdc:mga05p37_80215_c1 | |||
| 2123 | nmdc:mga05p37_81276_c1 | |||
| 2124 | nmdc:mga09592_232146_c1 | |||
| 2125 | nmdc:mga09592_521896_c1 | |||
| 2126 | nmdc:mga09592_96641_c1 | |||
| 2127 | nmdc:mga0qj67_3985_c1 | |||
| 2128 | nmdc:mga06r32_718632_c1 | |||
| 2129 | nmdc:mga06r32_73091_c1 | |||
| 2130 | nmdc:mga08y16_1471_c1 | |||
| 2131 | nmdc:mga08y16_205774_c1 | |||
| 2132 | nmdc:mga08y16_216002_c1 | |||
| 2133 | nmdc:mga08y16_22400_c1 | |||
| 2134 | nmdc:mga08y16_330478_c1 | |||
| 2135 | nmdc:mga08y16_42715_c1 | |||
| 2136 | nmdc:mga08y16_546602_c1 | |||
| 2137 | nmdc:mga08y16_641077_c1 | |||
| 2138 | nmdc:mga08y16_64310_c1 | |||
| 2139 | nmdc:mga08y16_6740_c1 | |||
| 2140 | nmdc:mga08y16_699456_c1 | |||
| 2141 | nmdc:mga0n895_152814_c1 | |||
| 2142 | nmdc:mga0n895_211173_c1 | |||
| 2143 | nmdc:mga0n895_303697_c1 | |||
| 2144 | nmdc:mga0n895_560099_c1 | |||
| 2145 | nmdc:mga0n895_918341_c1 | |||
| 2146 | nmdc:mga0rr50_176693_c1 | |||
| 2147 | nmdc:mga0rr50_326234_c1 | |||
| 2148 | nmdc:mga0rr50_52636_c1 | |||
| 2149 | nmdc:mga08x19_10729_c1 | |||
| 2150 | nmdc:mga08x19_77608_c1 | |||
| 2151 | nmdc:mga0a205_125519_c1 | |||
| 2152 | nmdc:mga0a205_184445_c1 | |||
| 2153 | nmdc:mga0a205_210619_c1 | |||
| 2154 | nmdc:mga0a205_390444_c1 | |||
| 2155 | nmdc:mga0a205_69391_c1 | |||
| 2156 | nmdc:mga0a205_75696_c1 | |||
| 2157 | nmdc:mga0a205_79703_c1 | |||
| 2158 | nmdc:mga0sz30_330_c1 | |||
| 2159 | Ga0495601_0110986 | |||
| 2160 | Ga0495601_0276349 | |||
| 2161 | Ga0495612_0001883 | |||
| 2162 | Ga0495612_0157631 | |||
| 2163 | Ga0495595_0051307 | |||
| 2164 | Ga0495619_0230491 | |||
| 2165 | Ga0495619_0240162 | |||
| 2166 | Ga0495619_0311284 | |||
| 2167 | Ga0500643_000039 | |||
| 2168 | Ga0500651_0111488 | |||
| 2169 | Ga0500555_000967 | |||
| 2170 | Ga0500562_030033 | |||
| 2171 | Ga0500607_000721 | |||
| 2172 | Ga0500616_0000357 | |||
| 2173 | Ga0500616_0001815 | |||
| 2174 | Ga0500645_003002 | |||
| 2175 | Ga0500599_001640 | |||
| 2176 | Ga0590071_003207 | |||
| 2177 | Ga0590077_002487 | |||
| 2178 | Ga0587080_022122 | |||
| 2179 | Ga0587083_0022932 | |||
| 2180 | Ga0501082_0017104 | |||
| 2181 | Ga0501082_0050658 | |||
| 2182 | Ga0501082_0179474 | |||
| 2183 | Ga0530510_0109553 | |||
| 2184 | Ga0530510_0165157 | |||
| 2185 | 2643951638 | |||
| 2186 | 2848298602 | |||
| 2187 | 2895881455 | |||
| 2188 | 2896256219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9664 | 5 | 225 |
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9567 | 19 | 225 |
| 7msz-assembly1.cif.gz_8 | mtb 70sic in complex with mtbetta at trans_r1 state | 0.9549 | 5 | 229 |
| 4qvi-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein m218l tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9543 | 1 | 225 |
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9532 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9801 | 16 | 225 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9747 | 74 | 159 | 3.40.50.790 |
| af_Q9P6M9_97_182_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9621 | 73 | 156 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9576 | 16 | 225 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9569 | 18 | 232 | 3.30.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0T2Q8X2-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9842 | 1 | 232 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-A0A2A3MUJ0-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9829 | 1 | 232 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-A0A1D2TYW0-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9825 | 1 | 232 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-A0A437JBT7-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9821 | 1 | 232 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-A0A2D8B214-F1-model_v4 | Ribosomal protein | 0.9805 | 48 | 232 |
GO:0003735
GO:0006412 GO:0006417 GO:0019843 GO:0022625 |