F489733

General Info

Members Datasets Scaffolds Average Seq Length
1084 473 1042 448

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1003090|Ga0055536_10030902
Length 503
Sequence MDGYPAALPGCLPAHPTGISAMTGTPASTLPTSAGTAVPAIDSPRPDLLPLPGSRPQVAGPVRGKLYIKTHGCQMNEYDSGKMADVLAAEEGLELTDDPAEADVLLMNTCSIREKAQEKVFSQLGYWKALKNNGRGVIIGVGGCVASQEGEAIIKRAPHVDLVFGPQTLHRLPELIRQRRESGKSQVDISFPEIEKFDRLPEPRAEGGSAFVSIMEGCSKYCSFCVVPYTRGTEVSRPFEDVVVEVAQLAAQGVREINLLGQNVNAYRGPYGEGDVADLGLLIRTIAEIDGVDRIRFTTSHPLEFSDSLVDAYRDVPQLANFLHLPVQAGSDRVLSAMKRGYTALEFKARIRKLRAVRPDISISSDFIVGFPGETEADFEKTMKLIEDVGFDHSFSFIYSRRPGTPAADLEDTISDAEKHARLSRLQARINEQAAAISQAMIGTVQTVLVEGPSRRDPNELTGKTENMRSVNFPGQARLVGQLVDVEITEAYSNSLRGRLVVA

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
5 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
6 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
7 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
8 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
9 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
14 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
15 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
16 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
17 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
18 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
19 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
20 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
23 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
26 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
27 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
28 2919513703 Luteimonas sp. 3794 Isolate Unclassified
29 2919675420 Luteimonas terrae 4099 Isolate Unclassified
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
32 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
33 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
34 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
35 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
36 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
37 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
38 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
56 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
99 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
106 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
107 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
108 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
144 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
147 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
148 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
151 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
152 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
161 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
165 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
182 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
183 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
184 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
187 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
280 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
281 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
282 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
283 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
284 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
285 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
286 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
287 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
288 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
289 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
290 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
291 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
292 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
293 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
294 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
295 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
296 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
297 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
298 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
299 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
300 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
301 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
302 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
303 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
304 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
305 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
306 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
307 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
308 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
309 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
310 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
312 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
313 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
314 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
315 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
316 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
317 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
320 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
321 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
322 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
323 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
324 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
325 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
329 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
330 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
332 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
333 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
337 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
338 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
339 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
340 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
341 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
342 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
343 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
344 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
345 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
346 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
347 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
348 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
349 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
350 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
351 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
352 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
356 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
362 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
367 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
368 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
369 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
370 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
371 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
397 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
398 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
399 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
412 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
413 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
414 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
415 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
438 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
446 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
447 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
450 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
453 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
454 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
455 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
456 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
457 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
458 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
465 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
466 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
467 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
470 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
471 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
472 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
473 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 0.18
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 9.13
Nodule 0.09
Rhizoplane 3.04
Rhizosphere 83.76
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000136 3300002737 Bacteria 79587
2 JGI25164J39214_1000260 3300002772 Bacteria 39803
3 JGI25152J39213_1000074 3300002773 Bacteria 66463
4 JGI25150J39212_1000056 3300002774 Bacteria 66462
5 JGI25151J46595_10000178 3300003187 Bacteria 80734
6 JGI25151J46595_10000430 3300003187 Bacteria 41709
7 JGI25165J46597_1000222 3300003214 Bacteria 79609
8 JGI25153J46596_10000131 3300003215 Bacteria 80734
9 Ga0055526_1000008 3300003771 Bacteria 300059
10 Ga0055526_1001472 3300003771 Bacteria 16701
11 Ga0055526_1013160 3300003771 Bacteria 3529
12 Ga0055537_1000343 3300003773 Bacteria 31889
13 Ga0055537_1000713 3300003773 Bacteria 17195
14 Ga0055524_1001290 3300003775 Bacteria 14699
15 Ga0055524_1008350 3300003775 Bacteria 4307
16 Ga0055536_1003090 3300003781 Bacteria 9068
17 Ga0055536_1005503 3300003781 Bacteria 6170
18 Ga0055536_1006485 3300003781 Bacteria 5447
19 Ga0055536_1006496 3300003781 Bacteria 5437
20 Ga0055534_1000003 3300003784 Bacteria 300063
21 Ga0055534_1000717 3300003784 Bacteria 16215
22 Ga0055528_1000019 3300003790 Bacteria 149715
23 Ga0055528_1003920 3300003790 Bacteria 7308
24 Ga0055530_10000036 3300003791 Bacteria 117493
25 Ga0055530_10002049 3300003791 Bacteria 13576
26 Ga0055530_10002228 3300003791 Bacteria 12767
27 Ga0055530_10003987 3300003791 Bacteria 7964
28 Ga0055540_1000072 3300003792 Bacteria 117493
29 Ga0055531_10001707 3300003794 Bacteria 15749
30 Ga0055531_10004113 3300003794 Bacteria 8993
31 Ga0055531_10007124 3300003794 Bacteria 6170
32 Ga0058692_1000002 3300003856 Bacteria 508401
33 Ga0065707_10003200 3300005295 Bacteria 4167
34 Ga0070658_10015935 3300005327 Bacteria 6011
35 Ga0070658_10038645 3300005327 Bacteria 3848
36 Ga0070683_100004250 3300005329 Bacteria 11747
37 Ga0070683_100013072 3300005329 Bacteria 7229
38 Ga0070683_100027452 3300005329 Bacteria 5134
39 Ga0070690_100003693 3300005330 Bacteria 8428
40 Ga0070690_100007788 3300005330 Bacteria 6139
41 Ga0070690_100020584 3300005330 Bacteria 4020
42 Ga0070670_100000002 3300005331 Bacteria 568775
43 Ga0070670_100006153 3300005331 Bacteria 10144
44 Ga0070670_100009718 3300005331 Bacteria 8213
45 Ga0070670_100084272 3300005331 Bacteria 2731
46 Ga0070670_100119198 3300005331 Bacteria 2276
47 Ga0070677_10015431 3300005333 Bacteria 2706
48 Ga0068869_100011009 3300005334 Bacteria 5924
49 Ga0068869_100027051 3300005334 Bacteria 3996
50 Ga0068869_100043138 3300005334 Bacteria 3238
51 Ga0068869_100053905 3300005334 Bacteria 2926
52 Ga0068869_100069021 3300005334 Bacteria 2612
53 Ga0070666_10004787 3300005335 Bacteria 8275
54 Ga0070666_10007365 3300005335 Bacteria 6779
55 Ga0070666_10010051 3300005335 Bacteria 5907
56 Ga0070666_10016249 3300005335 Bacteria 4760
57 Ga0070666_10017293 3300005335 Bacteria 4621
58 Ga0070680_100035809 3300005336 Bacteria 4008
59 Ga0070680_100096487 3300005336 Bacteria 2451
60 Ga0070680_100156843 3300005336 Bacteria 1912
61 Ga0070680_100205416 3300005336 Bacteria 1661
62 Ga0070682_100000380 3300005337 Bacteria 29800
63 Ga0068868_100004418 3300005338 Bacteria 9858
64 Ga0068868_100014076 3300005338 Bacteria 5888
65 Ga0068868_100041521 3300005338 Bacteria 3584
66 Ga0068868_100063241 3300005338 Bacteria 2936
67 Ga0070660_100028013 3300005339 Bacteria 4211
68 Ga0070660_100066755 3300005339 Bacteria 2801
69 Ga0070660_100079329 3300005339 Bacteria 2575
70 Ga0070689_100006598 3300005340 Bacteria 8054
71 Ga0070689_100008044 3300005340 Bacteria 7405
72 Ga0070689_100008330 3300005340 Bacteria 7299
73 Ga0070689_100019537 3300005340 Bacteria 5011
74 Ga0070689_100026938 3300005340 Bacteria 4331
75 Ga0070689_100041828 3300005340 Bacteria 3517
76 Ga0070689_100057648 3300005340 Bacteria 3015
77 Ga0070691_10053731 3300005341 Bacteria 1928
78 Ga0070687_100006690 3300005343 Bacteria 4744
79 Ga0070661_100004439 3300005344 Bacteria 9668
80 Ga0070661_100007342 3300005344 Bacteria 7603
81 Ga0070661_100020822 3300005344 Bacteria 4679
82 Ga0070661_100028288 3300005344 Bacteria 4042
83 Ga0070661_100040918 3300005344 Bacteria 3381
84 Ga0070692_10003861 3300005345 Bacteria 6174
85 Ga0070692_10006651 3300005345 Bacteria 5032
86 Ga0070692_10034034 3300005345 Bacteria 2571
87 Ga0070669_100004277 3300005353 Bacteria 10313
88 Ga0070669_100076355 3300005353 Bacteria 2487
89 Ga0070669_100103978 3300005353 Bacteria 2147
90 Ga0070669_100114814 3300005353 Bacteria 2047
91 Ga0070675_100009894 3300005354 Bacteria 7434
92 Ga0070675_100088797 3300005354 Bacteria 2587
93 Ga0070671_100000022 3300005355 Bacteria 124364
94 Ga0070671_100002957 3300005355 Bacteria 13218
95 Ga0070671_100018536 3300005355 Bacteria 5655
96 Ga0070671_100022375 3300005355 Bacteria 5162
97 Ga0070671_100076762 3300005355 Bacteria 2791
98 Ga0070673_100001706 3300005364 Bacteria 13051
99 Ga0070673_100011790 3300005364 Bacteria 5980
100 Ga0070673_100012540 3300005364 Bacteria 5823
101 Ga0070673_100031437 3300005364 Bacteria 3983
102 Ga0070673_100036017 3300005364 Bacteria 3757
103 Ga0070688_100000292 3300005365 Bacteria 25676
104 Ga0070688_100000882 3300005365 Bacteria 14934
105 Ga0070688_100039128 3300005365 Bacteria 2901
106 Ga0070659_100013147 3300005366 Bacteria 6155
107 Ga0070667_100000007 3300005367 Bacteria 292130
108 Ga0070667_100000150 3300005367 Bacteria 86639
109 Ga0070667_100026515 3300005367 Bacteria 4821
110 Ga0070709_10001553 3300005434 Bacteria 12395
111 Ga0070714_100000332 3300005435 Bacteria 35550
112 Ga0070714_100229316 3300005435 Bacteria 1710
113 Ga0070713_100003519 3300005436 Bacteria 10347
114 Ga0070713_100003782 3300005436 Bacteria 10019
115 Ga0070713_100024900 3300005436 Bacteria 4671
116 Ga0070713_100032686 3300005436 Bacteria 4158
117 Ga0070710_10004468 3300005437 Bacteria 6620
118 Ga0070701_10000319 3300005438 Bacteria 15741
119 Ga0070701_10044853 3300005438 Bacteria 2266
120 Ga0070711_100005649 3300005439 Bacteria 7490
121 Ga0070711_100011627 3300005439 Bacteria 5470
122 Ga0070711_100163499 3300005439 Bacteria 1690
123 Ga0070705_100017497 3300005440 Bacteria 3742
124 Ga0070705_100027675 3300005440 Bacteria 3098
125 Ga0070705_100099519 3300005440 Bacteria 1832
126 Ga0070700_100002665 3300005441 Bacteria 9128
127 Ga0070700_100138762 3300005441 Bacteria 1650
128 Ga0070694_100038329 3300005444 Bacteria 3185
129 Ga0070694_100041113 3300005444 Bacteria 3083
130 Ga0070694_100057539 3300005444 Bacteria 2643
131 Ga0070694_100066611 3300005444 Bacteria 2471
132 Ga0070708_100054686 3300005445 Bacteria 3546
133 Ga0070708_100090993 3300005445 Bacteria 2778
134 Ga0070663_100003494 3300005455 Bacteria 9066
135 Ga0070663_100013809 3300005455 Bacteria 5166
136 Ga0070663_100107051 3300005455 Bacteria 2095
137 Ga0070678_100001364 3300005456 Bacteria 12980
138 Ga0070678_100001708 3300005456 Bacteria 11795
139 Ga0070678_100006602 3300005456 Bacteria 6820
140 Ga0070662_100005429 3300005457 Bacteria 8142
141 Ga0070662_100035331 3300005457 Bacteria 3529
142 Ga0070662_100050051 3300005457 Bacteria 3014
143 Ga0070662_100156998 3300005457 Bacteria 1777
144 Ga0070662_100159289 3300005457 Bacteria 1764
145 Ga0070681_10002119 3300005458 Bacteria 18014
146 Ga0070681_10005255 3300005458 Bacteria 12504
147 Ga0070681_10210658 3300005458 Bacteria 1860
148 Ga0068867_100026979 3300005459 Bacteria 4127
149 Ga0070685_10000148 3300005466 Bacteria 45956
150 Ga0070685_10001092 3300005466 Bacteria 14518
151 Ga0070685_10020262 3300005466 Bacteria 3599
152 Ga0070706_100161198 3300005467 Bacteria 2094
153 Ga0070706_100221170 3300005467 Bacteria 1767
154 Ga0070707_100031393 3300005468 Bacteria 5060
155 Ga0070698_100105258 3300005471 Bacteria 2791
156 Ga0070698_100111171 3300005471 Bacteria 2705
157 Ga0070699_100022242 3300005518 Bacteria 5463
158 Ga0070699_100147439 3300005518 Bacteria 2079
159 Ga0070679_100044336 3300005530 Bacteria 4431
160 Ga0070684_100008392 3300005535 Bacteria 8071
161 Ga0070684_100020377 3300005535 Bacteria 5502
162 Ga0070697_100003127 3300005536 Bacteria 12721
163 Ga0070697_100087221 3300005536 Bacteria 2576
164 Ga0070697_100110115 3300005536 Bacteria 2294
165 Ga0068853_100001036 3300005539 Bacteria 19626
166 Ga0068853_100002186 3300005539 Bacteria 14576
167 Ga0068853_100142979 3300005539 Bacteria 2149
168 Ga0070672_100001829 3300005543 Bacteria 13270
169 Ga0070672_100002876 3300005543 Bacteria 11063
170 Ga0070686_100000740 3300005544 Bacteria 18920
171 Ga0070686_100011553 3300005544 Bacteria 5010
172 Ga0070686_100018117 3300005544 Bacteria 4127
173 Ga0070686_100059326 3300005544 Bacteria 2465
174 Ga0070695_100016539 3300005545 Bacteria 4466
175 Ga0070695_100028709 3300005545 Bacteria 3453
176 Ga0070696_100090501 3300005546 Bacteria 2177
177 Ga0070696_100090912 3300005546 Bacteria 2173
178 Ga0070696_100141385 3300005546 Bacteria 1759
179 Ga0070693_100000355 3300005547 Bacteria 20822
180 Ga0070693_100018554 3300005547 Bacteria 3637
181 Ga0070665_100002349 3300005548 Bacteria 20939
182 Ga0070665_100015445 3300005548 Bacteria 7669
183 Ga0070665_100020180 3300005548 Bacteria 6690
184 Ga0070665_100024535 3300005548 Bacteria 6075
185 Ga0070665_100055246 3300005548 Bacteria 3982
186 Ga0070665_100084976 3300005548 Bacteria 3170
187 Ga0070704_100005685 3300005549 Bacteria 7284
188 Ga0070704_100033773 3300005549 Bacteria 3462
189 Ga0070704_100051353 3300005549 Bacteria 2903
190 Ga0070704_100191315 3300005549 Bacteria 1645
191 Ga0068855_100008633 3300005563 Bacteria 12311
192 Ga0068855_100009797 3300005563 Bacteria 11560
193 Ga0068855_100023835 3300005563 Bacteria 7331
194 Ga0068855_100039911 3300005563 Bacteria 5572
195 Ga0068855_100082958 3300005563 Bacteria 3714
196 Ga0070664_100002191 3300005564 Bacteria 15697
197 Ga0070664_100002880 3300005564 Bacteria 13941
198 Ga0070664_100008398 3300005564 Bacteria 8351
199 Ga0070664_100017980 3300005564 Bacteria 5804
200 Ga0070664_100063715 3300005564 Bacteria 3143
201 Ga0070664_100208628 3300005564 Bacteria 1745
202 Ga0068857_100003513 3300005577 Bacteria 13093
203 Ga0068857_100017944 3300005577 Bacteria 6207
204 Ga0068854_100011844 3300005578 Bacteria 5695
205 Ga0068854_100019777 3300005578 Bacteria 4544
206 Ga0068854_100039035 3300005578 Bacteria 3342
207 Ga0068854_100053310 3300005578 Bacteria 2904
208 Ga0068854_100124579 3300005578 Bacteria 1961
209 Ga0068856_100005841 3300005614 Bacteria 12128
210 Ga0068856_100033965 3300005614 Bacteria 4994
211 Ga0068856_100137761 3300005614 Bacteria 2447
212 Ga0070702_100002726 3300005615 Bacteria 7718
213 Ga0070702_100006583 3300005615 Bacteria 5509
214 Ga0070702_100047510 3300005615 Bacteria 2438
215 Ga0068852_100001889 3300005616 Bacteria 14267
216 Ga0068852_100010864 3300005616 Bacteria 6822
217 Ga0068852_100232838 3300005616 Bacteria 1757
218 Ga0068859_100010871 3300005617 Bacteria 9159
219 Ga0068859_100083482 3300005617 Bacteria 3238
220 Ga0068859_100155567 3300005617 Bacteria 2363
221 Ga0068859_100160028 3300005617 Bacteria 2331
222 Ga0068859_100208277 3300005617 Bacteria 2041
223 Ga0068864_100000003 3300005618 Bacteria 568775
224 Ga0068864_100005774 3300005618 Bacteria 10157
225 Ga0068864_100014149 3300005618 Bacteria 6622
226 Ga0068864_100019036 3300005618 Bacteria 5739
227 Ga0068866_10001916 3300005718 Bacteria 8694
228 Ga0068866_10003766 3300005718 Bacteria 6217
229 Ga0068861_100002552 3300005719 Bacteria 11909
230 Ga0068861_100005187 3300005719 Bacteria 8784
231 Ga0068861_100006869 3300005719 Bacteria 7771
232 Ga0068861_100007103 3300005719 Bacteria 7662
233 Ga0068861_100042029 3300005719 Bacteria 3425
234 Ga0068861_100058879 3300005719 Bacteria 2939
235 Ga0068851_10000872 3300005834 Bacteria 13006
236 Ga0068851_10008908 3300005834 Bacteria 4653
237 Ga0068851_10009765 3300005834 Bacteria 4469
238 Ga0068870_10006457 3300005840 Bacteria 5171
239 Ga0068863_100009028 3300005841 Bacteria 9736
240 Ga0068863_100010280 3300005841 Bacteria 9093
241 Ga0068863_100021142 3300005841 Bacteria 6215
242 Ga0068863_100095539 3300005841 Bacteria 2821
243 Ga0068863_100174063 3300005841 Bacteria 2065
244 Ga0068863_100222846 3300005841 Bacteria 1817
245 Ga0068858_100002485 3300005842 Bacteria 18611
246 Ga0068858_100007459 3300005842 Bacteria 10571
247 Ga0068858_100007973 3300005842 Bacteria 10206
248 Ga0068858_100027261 3300005842 Bacteria 5308
249 Ga0068858_100060543 3300005842 Bacteria 3499
250 Ga0068858_100065191 3300005842 Bacteria 3370
251 Ga0068860_100001638 3300005843 Bacteria 24006
252 Ga0068860_100013859 3300005843 Bacteria 7905
253 Ga0068860_100030834 3300005843 Bacteria 5155
254 Ga0068860_100110409 3300005843 Bacteria 2628
255 Ga0068862_100000452 3300005844 Bacteria 44564
256 Ga0068862_100006537 3300005844 Bacteria 9673
257 Ga0068862_100009412 3300005844 Bacteria 8081
258 Ga0068862_100014383 3300005844 Bacteria 6565
259 Ga0068862_100043953 3300005844 Bacteria 3810
260 Ga0068862_100062042 3300005844 Bacteria 3214
261 Ga0068862_100091519 3300005844 Bacteria 2649
262 Ga0068862_100124290 3300005844 Bacteria 2277
263 Ga0081538_10073395 3300005981 Bacteria 1870
264 Ga0081540_1004336 3300005983 Bacteria 10868
265 Ga0075365_10000122 3300006038 Bacteria 23481
266 Ga0075363_100001163 3300006048 Bacteria 9653
267 Ga0075364_10000213 3300006051 Bacteria 27332
268 Ga0075364_10000562 3300006051 Bacteria 19043
269 Ga0070715_10014203 3300006163 Bacteria 2944
270 Ga0070716_100001077 3300006173 Bacteria 11962
271 Ga0070716_100019418 3300006173 Bacteria 3552
272 Ga0070712_100040974 3300006175 Bacteria 3177
273 Ga0075367_10001536 3300006178 Bacteria 9978
274 Ga0075369_10000212 3300006186 Bacteria 17155
275 Ga0097621_100002878 3300006237 Bacteria 11808
276 Ga0097621_100028624 3300006237 Bacteria 4392
277 Ga0075370_10032942 3300006353 Bacteria 2899
278 Ga0068871_100006555 3300006358 Bacteria 8249
279 Ga0068871_100008816 3300006358 Bacteria 7265
280 Ga0068871_100027588 3300006358 Bacteria 4442
281 Ga0075428_100000982 3300006844 Bacteria 30234
282 Ga0075428_100002975 3300006844 Bacteria 18464
283 Ga0075430_100000566 3300006846 Bacteria 28123
284 Ga0075430_100011327 3300006846 Bacteria 7564
285 Ga0075430_100022826 3300006846 Bacteria 5321
286 Ga0075430_100030371 3300006846 Bacteria 4589
287 Ga0075430_100145781 3300006846 Bacteria 1972
288 Ga0075430_100163607 3300006846 Bacteria 1852
289 Ga0075431_100002345 3300006847 Bacteria 18184
290 Ga0075431_100002432 3300006847 Bacteria 17917
291 Ga0075431_100035882 3300006847 Bacteria 5105
292 Ga0075431_100120469 3300006847 Bacteria 2707
293 Ga0075433_10054163 3300006852 Bacteria 3499
294 Ga0075434_100009366 3300006871 Bacteria 9130
295 Ga0075434_100105823 3300006871 Bacteria 2823
296 Ga0075434_100157039 3300006871 Bacteria 2294
297 Ga0075429_100000015 3300006880 Bacteria 78823
298 Ga0075429_100000217 3300006880 Bacteria 38727
299 Ga0075429_100024442 3300006880 Bacteria 5242
300 Ga0075429_100049651 3300006880 Bacteria 3649
301 Ga0068865_100005740 3300006881 Bacteria 7543
302 Ga0068865_100063933 3300006881 Bacteria 2588
303 Ga0075436_100065816 3300006914 Bacteria 2504
304 Ga0075436_100137968 3300006914 Bacteria 1713
305 Ga0097620_100010870 3300006931 Bacteria 9159
306 Ga0097620_100083480 3300006931 Bacteria 3238
307 Ga0097620_100155574 3300006931 Bacteria 2363
308 Ga0097620_100160027 3300006931 Bacteria 2331
309 Ga0097620_100208260 3300006931 Bacteria 2041
310 Ga0075435_100062780 3300007076 Bacteria 3016
311 Ga0075435_100103983 3300007076 Bacteria 2356
312 Ga0099794_10001346 3300007265 Bacteria 8525
313 Ga0105251_10025919 3300009011 Bacteria 2991
314 Ga0105240_10002074 3300009093 Bacteria 32842
315 Ga0105240_10007281 3300009093 Bacteria 16108
316 Ga0105240_10014161 3300009093 Bacteria 10895
317 Ga0105240_10073166 3300009093 Bacteria 4233
318 Ga0105240_10321353 3300009093 Bacteria 1764
319 Ga0111539_10002751 3300009094 Bacteria 23328
320 Ga0111539_10002953 3300009094 Bacteria 22574
321 Ga0111539_10058516 3300009094 Bacteria 4572
322 Ga0111539_10081464 3300009094 Bacteria 3807
323 Ga0111539_10124594 3300009094 Bacteria 3020
324 Ga0111539_10393720 3300009094 Bacteria 1614
325 Ga0105245_10004129 3300009098 Bacteria 12897
326 Ga0105245_10008792 3300009098 Bacteria 8809
327 Ga0105245_10051378 3300009098 Bacteria 3696
328 Ga0105245_10266813 3300009098 Bacteria 1668
329 Ga0105247_10005141 3300009101 Bacteria 8280
330 Ga0105247_10017181 3300009101 Bacteria 4342
331 Ga0114129_10000248 3300009147 Bacteria 60807
332 Ga0114129_10041162 3300009147 Bacteria 6512
333 Ga0105243_10003141 3300009148 Bacteria 13568
334 Ga0105243_10011531 3300009148 Bacteria 6687
335 Ga0105243_10065919 3300009148 Bacteria 2911
336 Ga0105241_10116676 3300009174 Bacteria 2144
337 Ga0105241_10125335 3300009174 Unclassified 2073
338 Ga0105242_10002322 3300009176 Bacteria 15001
339 Ga0105242_10005056 3300009176 Bacteria 10185
340 Ga0105242_10014096 3300009176 Bacteria 6189
341 Ga0105248_10000246 3300009177 Bacteria 62735
342 Ga0105248_10010195 3300009177 Bacteria 10348
343 Ga0105248_10039245 3300009177 Bacteria 5302
344 Ga0105248_10110131 3300009177 Bacteria 3105
345 Ga0105248_10229774 3300009177 Bacteria 2088
346 Ga0105248_10315134 3300009177 Bacteria 1762
347 Ga0105237_10000231 3300009545 Bacteria 79368
348 Ga0105237_10026395 3300009545 Bacteria 5936
349 Ga0105237_10059158 3300009545 Bacteria 3834
350 Ga0105237_10136504 3300009545 Bacteria 2447
351 Ga0105238_10035805 3300009551 Bacteria 5045
352 Ga0105238_10043127 3300009551 Bacteria 4565
353 Ga0105249_10005115 3300009553 Bacteria 11306
354 Ga0105249_10006419 3300009553 Bacteria 10222
355 Ga0105249_10012784 3300009553 Bacteria 7403
356 Ga0105249_10012863 3300009553 Bacteria 7385
357 Ga0105249_10013252 3300009553 Bacteria 7276
358 Ga0105249_10179243 3300009553 Bacteria 2060
359 Ga0099796_10024514 3300010159 Bacteria 1895
360 Ga0105239_10005689 3300010375 Bacteria 14562
361 Ga0105239_10109140 3300010375 Bacteria 3066
362 Ga0157373_10001374 3300013100 Bacteria 18676
363 Ga0157371_10000429 3300013102 Bacteria 51605
364 Ga0157371_10007777 3300013102 Bacteria 8615
365 Ga0157371_10014829 3300013102 Bacteria 5868
366 Ga0157370_10012042 3300013104 Bacteria 9003
367 Ga0157370_10049463 3300013104 Bacteria 4023
368 Ga0157374_10014292 3300013296 Bacteria 6946
369 Ga0157374_10016690 3300013296 Bacteria 6458
370 Ga0157374_10035124 3300013296 Bacteria 4585
371 Ga0157374_10053996 3300013296 Bacteria 3747
372 Ga0157378_10013710 3300013297 Bacteria 7088
373 Ga0157378_10016375 3300013297 Bacteria 6491
374 Ga0157378_10022130 3300013297 Bacteria 5594
375 Ga0157378_10045867 3300013297 Bacteria 3885
376 Ga0157378_10046570 3300013297 Bacteria 3854
377 Ga0157378_10133048 3300013297 Bacteria 2304
378 Ga0157378_10198705 3300013297 Bacteria 1895
379 Ga0163162_10072809 3300013306 Bacteria 3491
380 Ga0163162_10374648 3300013306 Bacteria 1557
381 Ga0157372_10004213 3300013307 Bacteria 15389
382 Ga0157372_10015001 3300013307 Bacteria 8292
383 Ga0157372_10021657 3300013307 Bacteria 6948
384 Ga0157372_10266499 3300013307 Bacteria 1989
385 Ga0157375_10109230 3300013308 Bacteria 2862
386 Ga0157375_10135352 3300013308 Bacteria 2587
387 Ga0163163_10000835 3300014325 Bacteria 26202
388 Ga0163163_10018597 3300014325 Bacteria 6509
389 Ga0163163_10054458 3300014325 Bacteria 3952
390 Ga0163163_10168564 3300014325 Bacteria 2236
391 Ga0157380_10015682 3300014326 Bacteria 5571
392 Ga0157380_10281250 3300014326 Unclassified 1522
393 Ga0182008_10000269 3300014497 Bacteria 40734
394 Ga0157377_10001111 3300014745 Bacteria 11384
395 Ga0157377_10002019 3300014745 Bacteria 8896
396 Ga0157377_10014693 3300014745 Bacteria 3988
397 Ga0157379_10005419 3300014968 Bacteria 10960
398 Ga0157379_10066007 3300014968 Bacteria 3235
399 Ga0157376_10002756 3300014969 Bacteria 12000
400 Ga0157376_10003114 3300014969 Bacteria 11397
401 Ga0157376_10013527 3300014969 Bacteria 6092
402 Ga0157376_10111927 3300014969 Bacteria 2404
403 Ga0182006_1007044 3300015261 Bacteria 5172
404 Ga0182007_10000127 3300015262 Bacteria 53385
405 Ga0182005_1000168 3300015265 Bacteria 45063
406 Ga0183360_10001 3300015689 Bacteria 3943671
407 Ga0163161_10044445 3300017792 Bacteria 3199
408 Ga0163161_10109759 3300017792 Bacteria 2061
409 Ga0213876_10039093 3300021384 Bacteria 2506
410 Ga0209760_100058 3300025207 Bacteria 98827
411 Ga0207427_100063 3300025231 Bacteria 177711
412 Ga0209437_100133 3300025233 Bacteria 178493
413 Ga0207425_1000108 3300025245 Bacteria 77709
414 Ga0207425_1004437 3300025245 Bacteria 4207
415 Ga0209129_1000178 3300025258 Bacteria 92006
416 Ga0209233_1000133 3300025261 Bacteria 202716
417 Ga0209565_1000001 3300025263 Bacteria 2950419
418 Ga0209565_1000014 3300025263 Bacteria 530302
419 Ga0209673_1000001 3300025273 Bacteria 3176258
420 Ga0209673_1000570 3300025273 Bacteria 58750
421 Ga0209130_1003922 3300025284 Bacteria 5961
422 Ga0209130_1017144 3300025284 Bacteria 1734
423 Ga0209675_1000001 3300025291 Bacteria 2950293
424 Ga0209675_1000021 3300025291 Bacteria 334833
425 Ga0209676_1000027 3300025292 Bacteria 560222
426 Ga0209676_1000047 3300025292 Bacteria 408645
427 Ga0209676_1000079 3300025292 Bacteria 290447
428 Ga0209676_1001090 3300025292 Bacteria 30462
429 Ga0209676_1007037 3300025292 Bacteria 5397
430 Ga0209676_1007436 3300025292 Bacteria 5143
431 Ga0209676_1010731 3300025292 Bacteria 3775
432 Ga0209025_1000012 3300025294 Bacteria 924362
433 Ga0209025_1000102 3300025294 Bacteria 228393
434 Ga0209025_1003190 3300025294 Bacteria 15903
435 Ga0209564_1000001 3300025295 Bacteria 3176258
436 Ga0209564_1000263 3300025295 Bacteria 112148
437 Ga0209758_1000018 3300025297 Bacteria 753320
438 Ga0209758_1021599 3300025297 Bacteria 2994
439 Ga0209050_1000080 3300025298 Bacteria 275154
440 Ga0209050_1000153 3300025298 Bacteria 160851
441 Ga0209050_1000311 3300025298 Bacteria 98948
442 Ga0209050_1002761 3300025298 Bacteria 14119
443 Ga0209256_1000002 3300025299 Bacteria 1906740
444 Ga0209256_1002605 3300025299 Bacteria 14307
445 Ga0209256_1002692 3300025299 Bacteria 13883
446 Ga0209256_1004733 3300025299 Bacteria 8322
447 Ga0209051_1000082 3300025303 Bacteria 193133
448 Ga0209051_1006455 3300025303 Bacteria 6603
449 Ga0209257_1000081 3300025304 Bacteria 306577
450 Ga0209257_1000274 3300025304 Bacteria 117076
451 Ga0209257_1000664 3300025304 Bacteria 54069
452 Ga0209257_1001912 3300025304 Bacteria 22505
453 Ga0209257_1002586 3300025304 Bacteria 17596
454 Ga0209257_1007820 3300025304 Bacteria 6329
455 Ga0209257_1009194 3300025304 Bacteria 5368
456 Ga0207697_10000149 3300025315 Bacteria 34272
457 Ga0207697_10020793 3300025315 Bacteria 2686
458 Ga0207656_10003769 3300025321 Bacteria 5249
459 Ga0207656_10012278 3300025321 Bacteria 3254
460 Ga0207655_1033072 3300025728 Bacteria 2351
461 Ga0207682_10000459 3300025893 Bacteria 18829
462 Ga0207642_10001236 3300025899 Bacteria 7908
463 Ga0207710_10027304 3300025900 Bacteria 2471
464 Ga0207688_10001830 3300025901 Bacteria 11341
465 Ga0207688_10007340 3300025901 Bacteria 5999
466 Ga0207680_10036342 3300025903 Bacteria 2836
467 Ga0207685_10045386 3300025905 Bacteria 1666
468 Ga0207645_10001936 3300025907 Bacteria 16708
469 Ga0207645_10100063 3300025907 Bacteria 1870
470 Ga0207643_10000257 3300025908 Bacteria 36775
471 Ga0207643_10002766 3300025908 Bacteria 9480
472 Ga0207643_10009427 3300025908 Bacteria 5246
473 Ga0207643_10043792 3300025908 Bacteria 2526
474 Ga0207643_10047912 3300025908 Bacteria 2420
475 Ga0207707_10010165 3300025912 Bacteria 8167
476 Ga0207707_10012870 3300025912 Bacteria 7282
477 Ga0207707_10048090 3300025912 Bacteria 3715
478 Ga0207695_10001882 3300025913 Bacteria 32824
479 Ga0207695_10006211 3300025913 Bacteria 15562
480 Ga0207695_10011988 3300025913 Bacteria 10431
481 Ga0207695_10015440 3300025913 Bacteria 8991
482 Ga0207695_10207552 3300025913 Bacteria 1871
483 Ga0207671_10008456 3300025914 Bacteria 8726
484 Ga0207693_10002740 3300025915 Bacteria 15256
485 Ga0207693_10020534 3300025915 Bacteria 5252
486 Ga0207663_10005447 3300025916 Bacteria 6413
487 Ga0207663_10018487 3300025916 Bacteria 3907
488 Ga0207660_10027866 3300025917 Bacteria 3860
489 Ga0207660_10033993 3300025917 Bacteria 3530
490 Ga0207660_10124814 3300025917 Bacteria 1954
491 Ga0207662_10009238 3300025918 Bacteria 5418
492 Ga0207662_10012415 3300025918 Bacteria 4744
493 Ga0207662_10024694 3300025918 Bacteria 3459
494 Ga0207662_10085548 3300025918 Bacteria 1931
495 Ga0207657_10001446 3300025919 Bacteria 25420
496 Ga0207657_10017013 3300025919 Bacteria 6995
497 Ga0207657_10051076 3300025919 Bacteria 3595
498 Ga0207657_10113044 3300025919 Bacteria 2241
499 Ga0207649_10023500 3300025920 Bacteria 3571
500 Ga0207649_10067791 3300025920 Bacteria 2267
501 Ga0207649_10102326 3300025920 Bacteria 1898
502 Ga0207652_10018305 3300025921 Bacteria 5745
503 Ga0207652_10215803 3300025921 Bacteria 1728
504 Ga0207646_10105596 3300025922 Bacteria 2526
505 Ga0207646_10154480 3300025922 Bacteria 2070
506 Ga0207646_10176713 3300025922 Bacteria 1928
507 Ga0207681_10003243 3300025923 Bacteria 10199
508 Ga0207681_10008178 3300025923 Bacteria 6396
509 Ga0207681_10011656 3300025923 Bacteria 5405
510 Ga0207681_10034434 3300025923 Bacteria 3330
511 Ga0207681_10066205 3300025923 Bacteria 2500
512 Ga0207681_10073914 3300025923 Bacteria 2386
513 Ga0207694_10026021 3300025924 Bacteria 4449
514 Ga0207694_10095594 3300025924 Bacteria 2349
515 Ga0207650_10000003 3300025925 Bacteria 1123235
516 Ga0207650_10001825 3300025925 Bacteria 15046
517 Ga0207650_10002621 3300025925 Bacteria 12446
518 Ga0207650_10085318 3300025925 Bacteria 2402
519 Ga0207659_10003990 3300025926 Bacteria 8905
520 Ga0207659_10014471 3300025926 Bacteria 5090
521 Ga0207659_10071353 3300025926 Bacteria 2536
522 Ga0207687_10006961 3300025927 Bacteria 7450
523 Ga0207687_10026690 3300025927 Bacteria 3870
524 Ga0207700_10003571 3300025928 Bacteria 9059
525 Ga0207700_10020142 3300025928 Bacteria 4522
526 Ga0207664_10000325 3300025929 Bacteria 35400
527 Ga0207664_10003311 3300025929 Bacteria 10715
528 Ga0207664_10100168 3300025929 Bacteria 2392
529 Ga0207644_10000037 3300025931 Bacteria 124306
530 Ga0207644_10002823 3300025931 Bacteria 11196
531 Ga0207644_10003679 3300025931 Bacteria 9942
532 Ga0207644_10032756 3300025931 Bacteria 3628
533 Ga0207644_10071271 3300025931 Bacteria 2542
534 Ga0207690_10133711 3300025932 Bacteria 1819
535 Ga0207706_10000775 3300025933 Bacteria 33144
536 Ga0207706_10007089 3300025933 Bacteria 10368
537 Ga0207706_10041143 3300025933 Bacteria 4098
538 Ga0207706_10108387 3300025933 Bacteria 2444
539 Ga0207706_10181447 3300025933 Bacteria 1849
540 Ga0207686_10004363 3300025934 Bacteria 7582
541 Ga0207686_10012082 3300025934 Bacteria 4743
542 Ga0207686_10036442 3300025934 Bacteria 2962
543 Ga0207686_10043800 3300025934 Bacteria 2744
544 Ga0207686_10109420 3300025934 Bacteria 1861
545 Ga0207709_10000930 3300025935 Bacteria 22057
546 Ga0207709_10007789 3300025935 Bacteria 5938
547 Ga0207709_10029160 3300025935 Bacteria 3197
548 Ga0207670_10009955 3300025936 Bacteria 5450
549 Ga0207670_10055151 3300025936 Bacteria 2685
550 Ga0207669_10009438 3300025937 Bacteria 4646
551 Ga0207669_10031724 3300025937 Bacteria 2956
552 Ga0207669_10168456 3300025937 Bacteria 1556
553 Ga0207704_10001220 3300025938 Bacteria 11452
554 Ga0207704_10005871 3300025938 Bacteria 5684
555 Ga0207704_10017993 3300025938 Bacteria 3678
556 Ga0207704_10024054 3300025938 Bacteria 3295
557 Ga0207665_10003114 3300025939 Bacteria 11122
558 Ga0207691_10001095 3300025940 Bacteria 26926
559 Ga0207691_10001701 3300025940 Bacteria 21735
560 Ga0207691_10003722 3300025940 Bacteria 14796
561 Ga0207691_10005811 3300025940 Bacteria 11937
562 Ga0207691_10025607 3300025940 Bacteria 5538
563 Ga0207691_10046818 3300025940 Bacteria 3972
564 Ga0207691_10142642 3300025940 Bacteria 2110
565 Ga0207711_10000782 3300025941 Bacteria 31251
566 Ga0207711_10003291 3300025941 Bacteria 14044
567 Ga0207711_10003296 3300025941 Bacteria 14031
568 Ga0207711_10006050 3300025941 Bacteria 10224
569 Ga0207711_10064392 3300025941 Bacteria 3166
570 Ga0207689_10000474 3300025942 Bacteria 37756
571 Ga0207689_10002613 3300025942 Bacteria 16674
572 Ga0207689_10003706 3300025942 Bacteria 13935
573 Ga0207689_10030707 3300025942 Bacteria 4477
574 Ga0207689_10038779 3300025942 Bacteria 3944
575 Ga0207661_10036429 3300025944 Bacteria 3840
576 Ga0207661_10070183 3300025944 Bacteria 2859
577 Ga0207661_10166349 3300025944 Bacteria 1917
578 Ga0207679_10037767 3300025945 Bacteria 3436
579 Ga0207679_10051272 3300025945 Bacteria 3020
580 Ga0207667_10004596 3300025949 Bacteria 16930
581 Ga0207667_10055847 3300025949 Bacteria 4149
582 Ga0207667_10144569 3300025949 Bacteria 2448
583 Ga0207667_10187414 3300025949 Bacteria 2123
584 Ga0207651_10002306 3300025960 Bacteria 9083
585 Ga0207651_10014477 3300025960 Bacteria 4557
586 Ga0207651_10015257 3300025960 Bacteria 4460
587 Ga0207651_10032842 3300025960 Bacteria 3339
588 Ga0207712_10000314 3300025961 Bacteria 44397
589 Ga0207712_10010887 3300025961 Bacteria 5789
590 Ga0207712_10058562 3300025961 Bacteria 2723
591 Ga0207712_10113733 3300025961 Bacteria 2035
592 Ga0207712_10131469 3300025961 Bacteria 1908
593 Ga0207640_10007253 3300025981 Bacteria 6115
594 Ga0207640_10007928 3300025981 Bacteria 5861
595 Ga0207640_10069786 3300025981 Bacteria 2361
596 Ga0207658_10000004 3300025986 Bacteria 569357
597 Ga0207658_10000013 3300025986 Bacteria 220396
598 Ga0207658_10006563 3300025986 Bacteria 7935
599 Ga0207658_10022252 3300025986 Bacteria 4413
600 Ga0207677_10000390 3300026023 Bacteria 30230
601 Ga0207677_10045330 3300026023 Bacteria 2936
602 Ga0207703_10002767 3300026035 Bacteria 15018
603 Ga0207703_10009021 3300026035 Bacteria 7854
604 Ga0207703_10013439 3300026035 Bacteria 6377
605 Ga0207703_10016031 3300026035 Bacteria 5844
606 Ga0207703_10017347 3300026035 Bacteria 5620
607 Ga0207639_10000791 3300026041 Bacteria 21545
608 Ga0207639_10001337 3300026041 Bacteria 16645
609 Ga0207639_10002604 3300026041 Bacteria 12099
610 Ga0207639_10006184 3300026041 Bacteria 8131
611 Ga0207678_10000306 3300026067 Bacteria 44067
612 Ga0207678_10001020 3300026067 Bacteria 25550
613 Ga0207678_10007277 3300026067 Bacteria 9810
614 Ga0207678_10092442 3300026067 Bacteria 2586
615 Ga0207708_10000382 3300026075 Bacteria 34635
616 Ga0207708_10001552 3300026075 Bacteria 17143
617 Ga0207708_10008147 3300026075 Bacteria 7761
618 Ga0207708_10070029 3300026075 Bacteria 2686
619 Ga0207708_10072844 3300026075 Bacteria 2632
620 Ga0207702_10022168 3300026078 Bacteria 5263
621 Ga0207702_10101256 3300026078 Bacteria 2543
622 Ga0207641_10008134 3300026088 Bacteria 8684
623 Ga0207641_10010582 3300026088 Bacteria 7568
624 Ga0207641_10039494 3300026088 Bacteria 3947
625 Ga0207641_10047478 3300026088 Bacteria 3621
626 Ga0207641_10079119 3300026088 Bacteria 2849
627 Ga0207641_10130049 3300026088 Bacteria 2259
628 Ga0207641_10202846 3300026088 Bacteria 1829
629 Ga0207648_10001543 3300026089 Bacteria 25355
630 Ga0207648_10004782 3300026089 Bacteria 13831
631 Ga0207648_10011595 3300026089 Bacteria 8299
632 Ga0207648_10023419 3300026089 Bacteria 5531
633 Ga0207648_10040757 3300026089 Bacteria 4080
634 Ga0207676_10000003 3300026095 Bacteria 1123235
635 Ga0207676_10004850 3300026095 Bacteria 9524
636 Ga0207676_10044317 3300026095 Bacteria 3432
637 Ga0207676_10120415 3300026095 Bacteria 2212
638 Ga0207676_10169815 3300026095 Bacteria 1899
639 Ga0207674_10000052 3300026116 Bacteria 115252
640 Ga0207674_10002975 3300026116 Bacteria 21037
641 Ga0207674_10005532 3300026116 Bacteria 15000
642 Ga0207674_10064951 3300026116 Bacteria 3680
643 Ga0207674_10131797 3300026116 Bacteria 2462
644 Ga0207675_100000178 3300026118 Bacteria 57002
645 Ga0207675_100000448 3300026118 Bacteria 40003
646 Ga0207675_100001443 3300026118 Bacteria 23801
647 Ga0207675_100008376 3300026118 Bacteria 9745
648 Ga0207675_100014452 3300026118 Bacteria 7360
649 Ga0207683_10000746 3300026121 Bacteria 29503
650 Ga0207683_10001065 3300026121 Bacteria 25020
651 Ga0207683_10001720 3300026121 Bacteria 19575
652 Ga0207683_10005776 3300026121 Bacteria 10605
653 Ga0207683_10006227 3300026121 Bacteria 10228
654 Ga0207683_10022573 3300026121 Bacteria 5403
655 Ga0207698_10013985 3300026142 Bacteria 5317
656 Ga0207698_10016541 3300026142 Bacteria 4976
657 Ga0209371_1000004 3300027312 Bacteria 1098197
658 Ga0209969_1000461 3300027360 Bacteria 5447
659 Ga0209967_1002692 3300027364 Bacteria 2314
660 Ga0209995_1000660 3300027471 Bacteria 5297
661 Ga0209179_1003929 3300027512 Bacteria 2197
662 Ga0209999_1005905 3300027543 Bacteria 2200
663 Ga0209588_1003131 3300027671 Bacteria 4562
664 Ga0209971_1000947 3300027682 Bacteria 7476
665 Ga0209974_10002636 3300027876 Bacteria 6505
666 Ga0209974_10004499 3300027876 Bacteria 4965
667 Ga0209974_10030390 3300027876 Bacteria 1790
668 Ga0207428_10008034 3300027907 Bacteria 9573
669 Ga0207428_10030182 3300027907 Bacteria 4484
670 Ga0268266_10012254 3300028379 Bacteria 7418
671 Ga0268266_10137036 3300028379 Bacteria 2193
672 Ga0268266_10164960 3300028379 Bacteria 2006
673 Ga0268266_10168477 3300028379 Bacteria 1986
674 Ga0268265_10000435 3300028380 Bacteria 44242
675 Ga0268265_10002275 3300028380 Bacteria 14630
676 Ga0268265_10003258 3300028380 Bacteria 11771
677 Ga0268265_10011011 3300028380 Bacteria 6109
678 Ga0268265_10066373 3300028380 Bacteria 2789
679 Ga0268265_10122229 3300028380 Bacteria 2147
680 Ga0268264_10018814 3300028381 Bacteria 5648
681 Ga0268264_10037447 3300028381 Bacteria 3999
682 Ga0268264_10087362 3300028381 Bacteria 2681
683 Ga0268264_10113232 3300028381 Bacteria 2380
684 Ga0268264_10114761 3300028381 Bacteria 2365
685 Ga0265334_10000005 3300028573 Bacteria 242590
686 Ga0265336_10000707 3300028666 Bacteria 17694
687 Ga0265338_10059795 3300028800 Bacteria 3355
688 Ga0265324_10000471 3300029957 Bacteria 28353
689 Ga0268256_1000005 3300030500 Bacteria 1082342
690 Ga0316183_1012956 3300030742 Bacteria 4183
691 Ga0265332_10002887 3300031238 Bacteria 8493
692 Ga0265328_10024962 3300031239 Bacteria 2254
693 Ga0265325_10001388 3300031241 Bacteria 17089
694 Ga0265331_10003541 3300031250 Bacteria 10022
695 Ga0265327_10000103 3300031251 Bacteria 185405
696 Ga0265327_10000218 3300031251 Bacteria 116690
697 Ga0265316_10018527 3300031344 Bacteria 5979
698 Ga0265316_10039994 3300031344 Bacteria 3762
699 Ga0265316_10098849 3300031344 Bacteria 2220
700 Ga0307509_10001479 3300031507 Bacteria 39686
701 Ga0307408_100000013 3300031548 Bacteria 386212
702 Ga0307408_100117636 3300031548 Bacteria 2053
703 Ga0265313_10000014 3300031595 Bacteria 156295
704 Ga0316575_10000160 3300031665 Bacteria 17023
705 Ga0316575_10009816 3300031665 Bacteria 3511
706 Ga0316579_10030649 3300031691 Bacteria 2459
707 Ga0265314_10001405 3300031711 Bacteria 26998
708 Ga0316576_10005155 3300031727 Bacteria 7937
709 Ga0316576_10007031 3300031727 Bacteria 7047
710 Ga0316578_10017487 3300031728 Bacteria 3903
711 Ga0316578_10035343 3300031728 Bacteria 2872
712 Ga0307413_10001956 3300031824 Bacteria 8180
713 Ga0307410_10000274 3300031852 Bacteria 19850
714 Ga0307410_10015369 3300031852 Bacteria 4538
715 Ga0307406_10018458 3300031901 Bacteria 4076
716 Ga0307407_10000538 3300031903 Bacteria 11807
717 Ga0307412_10178096 3300031911 Bacteria 1596
718 Ga0307409_100050745 3300031995 Bacteria 3170
719 Ga0307409_100213330 3300031995 Bacteria 1737
720 Ga0307416_100045347 3300032002 Bacteria 3461
721 Ga0307416_100191774 3300032002 Bacteria 1928
722 Ga0307414_10009479 3300032004 Bacteria 5596
723 Ga0307414_10010491 3300032004 Bacteria 5380
724 Ga0307414_10044868 3300032004 Bacteria 3023
725 Ga0307414_10264785 3300032004 Bacteria 1436
726 Ga0307411_10008785 3300032005 Bacteria 5257
727 Ga0307415_100101149 3300032126 Bacteria 2114
728 Ga0316585_10023576 3300032137 Bacteria 1899
729 Ga0316593_10011167 3300032168 Bacteria 2602
730 Ga0316593_10021935 3300032168 Bacteria 2001
731 Ga0373929_0011927 3300035085 Bacteria 1644
732 Ga0373944_0018739 3300035089 Bacteria 1979
733 Ga0373952_0001197 3300035092 Bacteria 4724
734 Ga0373953_0009832 3300035117 Bacteria 3309
735 Ga0373954_0023593 3300035118 Bacteria 2799
736 Ga0373954_0026496 3300035118 Bacteria 2657
737 Ga0373956_0000260 3300035119 Bacteria 21143
738 Ga0373957_0005151 3300035120 Bacteria 4038
739 Ga0373957_0006986 3300035120 Bacteria 3587
740 Ga0373943_0019349 3300035170 Bacteria 3130
741 Ga0373943_0065665 3300035170 Bacteria 1825
742 Ga0373946_0056597 3300035171 Bacteria 1656
743 Ga0373955_0007379 3300035172 Bacteria 5052
744 Ga0373955_0008151 3300035172 Bacteria 4848
745 Ga0373942_0010777 3300035207 Bacteria 2155
746 Ga0373961_0027768 3300035241 Bacteria 1556
747 Ga0316574_0004197 3300035398 Bacteria 7514
748 Ga0316574_0004943 3300035398 Bacteria 7060
749 Ga0316574_0005166 3300035398 Bacteria 6942
750 Ga0316574_0028567 3300035398 Bacteria 3365
751 Ga0316574_0143764 3300035398 Bacteria 1537
752 Ga0373931_0007954 3300035691 Bacteria 5015
753 Ga0373931_0064565 3300035691 Bacteria 1982
754 Ga0373935_0019092 3300035692 Bacteria 4180
755 Ga0373935_0172654 3300035692 Bacteria 1480
756 Ga0373927_0007760 3300035695 Bacteria 7256
757 Ga0373933_0005945 3300035724 Bacteria 6638
758 Ga0373933_0021324 3300035724 Bacteria 3679
759 Ga0373933_0042567 3300035724 Bacteria 2684
760 Ga0373933_0147562 3300035724 Bacteria 1488
761 Ga0373937_0000487 3300036401 Bacteria 36252
762 Ga0373937_0010040 3300036401 Bacteria 8254
763 Ga0373937_0012434 3300036401 Bacteria 7487
764 Ga0373937_0035761 3300036401 Bacteria 4522
765 Ga0316584_0057397 3300036712 Bacteria 2914
766 Ga0373925_0012770 3300037068 Bacteria 6085
767 Ga0373925_0021018 3300037068 Bacteria 4755
768 Ga0373925_0033900 3300037068 Bacteria 3762
769 Ga0395900_0007406 3300037418 Bacteria 11342
770 Ga0395900_0103945 3300037418 Bacteria 2918
771 Ga0395898_0030569 3300037466 Bacteria 5389
772 Ga0395905_0003749 3300037471 Bacteria 16101
773 Ga0395905_0027570 3300037471 Bacteria 5356
774 Ga0395905_0044927 3300037471 Bacteria 4144
775 Ga0436364_0432166 3300037853 Bacteria 2189
776 Ga0395901_0012006 3300038443 Bacteria 8787
777 Ga0395901_0068186 3300038443 Bacteria 3706
778 Ga0237819_00915 3300038705 Bacteria 9135
779 Ga0237819_03199 3300038705 Bacteria 2974
780 Ga0400487_46050 3300039110 Bacteria 2405
781 Ga0436365_0076061 3300039437 Bacteria 3598
782 Ga0436361_0050017 3300039447 Bacteria 26618
783 Ga0436363_1709594 3300039450 Bacteria 1577
784 Ga0439465_0008504 3300041413 Bacteria 3239
785 Ga0439437_000550 3300042000 Bacteria 3715
786 Ga0439445_0007253 3300042004 Bacteria 2569
787 Ga0439448_0020208 3300042005 Bacteria 2058
788 Ga0450911_000012 3300042115 Bacteria 129546
789 Ga0439446_0011478 3300042156 Bacteria 2405
790 Ga0451577_0000002 3300042876 Bacteria 1731375
791 Ga0451577_0000402 3300042876 Bacteria 78514
792 Ga0451577_0017088 3300042876 Bacteria 6709
793 Ga0451577_0021269 3300042876 Bacteria 5938
794 Ga0451577_0026706 3300042876 Bacteria 5229
795 Ga0451577_0053334 3300042876 Bacteria 3610
796 Ga0451577_0073138 3300042876 Bacteria 3059
797 Ga0453683_0000011 3300044673 Bacteria 412765
798 Ga0453683_0113823 3300044673 Bacteria 1702
799 Ga0453684_0000002 3300044712 Bacteria 1731375
800 Ga0453684_0000040 3300044712 Bacteria 690210
801 Ga0453684_0000065 3300044712 Bacteria 468481
802 Ga0453684_0000136 3300044712 Bacteria 323402
803 Ga0453684_0001174 3300044712 Bacteria 81261
804 Ga0453684_0126052 3300044712 Bacteria 3081
805 Ga0451576_0000004 3300045051 Bacteria 1312238
806 Ga0451576_0000025 3300045051 Bacteria 427980
807 Ga0451576_0000131 3300045051 Bacteria 190667
808 Ga0451576_0001381 3300045051 Bacteria 41721
809 Ga0451576_0025176 3300045051 Bacteria 6415
810 Ga0451576_0109027 3300045051 Bacteria 2881
811 Ga0466967_0141310 3300045976 Bacteria 2243
812 Ga0495592_0000449 3300046454 Bacteria 30874
813 Ga0495592_0080837 3300046454 Bacteria 2350
814 Ga0495638_0001128 3300046460 Bacteria 25882
815 Ga0495651_0001710 3300046462 Bacteria 16956
816 Ga0495651_0055429 3300046462 Bacteria 3046
817 Ga0495580_0067725 3300046472 Bacteria 2498
818 Ga0495580_0154162 3300046472 Bacteria 1591
819 Ga0495582_0013485 3300046473 Bacteria 4500
820 Ga0495639_0018316 3300046475 Bacteria 3047
821 Ga0495662_0033484 3300046476 Bacteria 2482
822 Ga0495664_0055171 3300046477 Bacteria 2364
823 Ga0495594_0040143 3300046499 Bacteria 2560
824 Ga0495606_0007681 3300046507 Bacteria 9560
825 Ga0495608_0127296 3300046511 Bacteria 1631
826 Ga0495628_0001138 3300046516 Bacteria 24250
827 Ga0495628_0027455 3300046516 Bacteria 4632
828 Ga0495628_0073782 3300046516 Bacteria 2658
829 Ga0495630_0034416 3300046517 Bacteria 3783
830 Ga0495648_0010210 3300046524 Bacteria 7172
831 Ga0495663_0000429 3300046525 Bacteria 15363
832 Ga0495663_0000891 3300046525 Bacteria 10055
833 Ga0495652_0009506 3300046529 Bacteria 8829
834 Ga0495652_0117524 3300046529 Bacteria 2127
835 Ga0495654_0001417 3300046530 Bacteria 16578
836 Ga0495665_0036691 3300046531 Bacteria 2616
837 Ga0495640_0094458 3300046533 Bacteria 1969
838 Ga0495621_0000016 3300046539 Bacteria 34269
839 Ga0495621_0003268 3300046539 Bacteria 4456
840 Ga0495621_0022890 3300046539 Bacteria 2075
841 Ga0495621_0036649 3300046539 Bacteria 1703
842 Ga0495645_0000567 3300046543 Bacteria 25287
843 Ga0495645_0004604 3300046543 Bacteria 9412
844 Ga0495633_0089538 3300046558 Bacteria 1431
845 Ga0495667_0042455 3300046559 Bacteria 3015
846 Ga0495635_0061737 3300046663 Bacteria 2573
847 Ga0495661_0000093 3300046665 Bacteria 109808
848 Ga0495657_0137967 3300046675 Bacteria 1522
849 Ga0495599_0003542 3300046678 Bacteria 9142
850 Ga0495646_0074552 3300046680 Bacteria 1991
851 Ga0495647_0017940 3300046681 Bacteria 2511
852 Ga0495647_0050195 3300046681 Bacteria 1618
853 Ga0495658_0014018 3300046683 Bacteria 4086
854 Ga0495613_0024840 3300046689 Bacteria 4465
855 Ga0495671_0002983 3300046692 Bacteria 10514
856 Ga0495600_0038582 3300046809 Bacteria 3109
857 Ga0495581_0001860 3300047315 Bacteria 11810
858 Ga0495604_0110347 3300047317 Bacteria 2007
859 Ga0495636_0005078 3300047318 Bacteria 5169
860 Ga0495674_0072954 3300047319 Bacteria 2960
861 Ga0495672_0000134 3300047320 Bacteria 110142
862 Ga0495672_0004693 3300047320 Bacteria 11058
863 Ga0495672_0086663 3300047320 Bacteria 1731
864 Ga0495680_0014464 3300047322 Bacteria 6832
865 Ga0495684_0016945 3300047471 Bacteria 5613
866 Ga0495593_0026222 3300047673 Bacteria 3220
867 Ga0495602_0080127 3300048088 Bacteria 2752
868 Ga0496100_0099654 3300048903 Bacteria 2000
869 Ga0496100_0128154 3300048903 Bacteria 1784
870 Ga0496101_0033519 3300048904 Bacteria 3622
871 Ga0496101_0070560 3300048904 Bacteria 2559
872 Ga0496101_0071353 3300048904 Bacteria 2546
873 Ga0496102_0041999 3300048905 Bacteria 4143
874 Ga0496103_0053346 3300048906 Bacteria 2506
875 Ga0496104_0006723 3300048907 Bacteria 10124
876 Ga0496104_0009610 3300048907 Bacteria 8612
877 Ga0496105_0006614 3300048908 Bacteria 8923
878 Ga0496105_0105344 3300048908 Bacteria 2328
879 Ga0496106_0007884 3300048909 Bacteria 7871
880 Ga0496106_0053112 3300048909 Bacteria 3060
881 Ga0496108_0003143 3300048911 Bacteria 13277
882 Ga0496108_0014932 3300048911 Bacteria 6338
883 Ga0496108_0019745 3300048911 Bacteria 5536
884 Ga0496109_0001481 3300048912 Bacteria 19497
885 Ga0496109_0149381 3300048912 Bacteria 2187
886 Ga0496109_0197925 3300048912 Bacteria 1889
887 Ga0496110_0005552 3300048913 Bacteria 9899
888 Ga0496110_0012614 3300048913 Bacteria 6951
889 Ga0496111_0003169 3300048914 Bacteria 10132
890 Ga0496112_0011093 3300048915 Bacteria 8212
891 Ga0496114_0035421 3300048917 Bacteria 4121
892 Ga0496115_0007091 3300048918 Bacteria 8234
893 Ga0496115_0036524 3300048918 Bacteria 3891
894 Ga0496115_0205269 3300048918 Bacteria 1628
895 Ga0496116_0000008 3300048919 Bacteria 726753
896 Ga0496117_0001343 3300048920 Bacteria 36067
897 Ga0496117_0028830 3300048920 Bacteria 4291
898 Ga0496118_0000145 3300048921 Bacteria 123886
899 Ga0496118_0001486 3300048921 Bacteria 35102
900 Ga0496118_0004832 3300048921 Bacteria 15713
901 Ga0496120_0000525 3300048923 Bacteria 59273
902 Ga0496121_0000012 3300048924 Bacteria 653131
903 Ga0496121_0045105 3300048924 Bacteria 3792
904 Ga0496121_0170810 3300048924 Bacteria 1580
905 Ga0496122_0000062 3300048925 Bacteria 241387
906 Ga0496122_0023731 3300048925 Bacteria 5392
907 Ga0496123_0010330 3300048926 Bacteria 8272
908 Ga0496123_0017728 3300048926 Bacteria 5710
909 Ga0496124_0000255 3300048927 Bacteria 102645
910 Ga0496124_0013804 3300048927 Bacteria 7857
911 Ga0496124_0071694 3300048927 Bacteria 2870
912 Ga0496125_0013402 3300048928 Bacteria 8062
913 Ga0496126_0017269 3300048929 Bacteria 7190
914 Ga0501031_0028864 3300049568 Bacteria 3616
915 Ga0501034_0000273 3300049571 Bacteria 93198
916 Ga0501034_0000571 3300049571 Bacteria 58421
917 Ga0501034_0054294 3300049571 Bacteria 4034
918 Ga0501036_0013100 3300049572 Bacteria 6890
919 Ga0501036_0041825 3300049572 Bacteria 3878
920 Ga0501036_0079955 3300049572 Bacteria 2764
921 Ga0501036_0117894 3300049572 Bacteria 2242
922 Ga0501037_0065601 3300049573 Bacteria 2645
923 Ga0501038_0004369 3300049574 Bacteria 13151
924 Ga0501038_0049384 3300049574 Bacteria 3638
925 Ga0501038_0107633 3300049574 Bacteria 2313
926 Ga0501039_0000126 3300049575 Bacteria 52890
927 Ga0501039_0010087 3300049575 Bacteria 7197
928 Ga0501039_0021369 3300049575 Bacteria 4966
929 Ga0501039_0037554 3300049575 Bacteria 3739
930 Ga0501040_0015976 3300049576 Bacteria 4964
931 Ga0501040_0023276 3300049576 Bacteria 4153
932 Ga0501040_0105094 3300049576 Bacteria 1972
933 Ga0501041_0000283 3300049577 Bacteria 24387
934 Ga0501041_0004904 3300049577 Bacteria 7772
935 Ga0501041_0030700 3300049577 Bacteria 3244
936 Ga0501041_0031447 3300049577 Bacteria 3207
937 Ga0501041_0057553 3300049577 Bacteria 2377
938 Ga0501042_0000022 3300049578 Bacteria 50211
939 Ga0501042_0009519 3300049578 Bacteria 6479
940 Ga0501043_0056571 3300049579 Bacteria 3081
941 Ga0501047_0017694 3300049581 Bacteria 6828
942 Ga0501068_0001639 3300049584 Bacteria 11952
943 Ga0501068_0047424 3300049584 Bacteria 2592
944 Ga0501068_0049744 3300049584 Bacteria 2532
945 Ga0501068_0052322 3300049584 Bacteria 2471
946 Ga0501069_0029361 3300049585 Bacteria 3017
947 Ga0501070_0026718 3300049586 Bacteria 4842
948 Ga0501070_0075477 3300049586 Bacteria 2791
949 Ga0501070_0099865 3300049586 Bacteria 2401
950 Ga0501070_0142883 3300049586 Bacteria 1976
951 Ga0501071_0029929 3300049587 Bacteria 3847
952 Ga0501071_0072462 3300049587 Bacteria 2512
953 Ga0501071_0087967 3300049587 Bacteria 2279
954 Ga0501072_0002838 3300049588 Bacteria 12999
955 Ga0501072_0060665 3300049588 Bacteria 2982
956 Ga0501072_0078424 3300049588 Bacteria 2615
957 Ga0501073_0003036 3300049589 Bacteria 12589
958 Ga0501073_0015610 3300049589 Bacteria 5510
959 Ga0501074_0008184 3300049590 Bacteria 7578
960 Ga0501074_0016754 3300049590 Bacteria 5318
961 Ga0501074_0035483 3300049590 Bacteria 3613
962 Ga0501074_0043599 3300049590 Bacteria 3247
963 Ga0501075_0000128 3300049591 Bacteria 37407
964 Ga0501075_0001228 3300049591 Bacteria 16603
965 Ga0501075_0034527 3300049591 Bacteria 3766
966 Ga0501076_0000135 3300049592 Bacteria 41430
967 Ga0501076_0018908 3300049592 Bacteria 5257
968 Ga0501076_0032101 3300049592 Bacteria 4097
969 Ga0501077_0056282 3300049593 Bacteria 2496
970 Ga0501077_0091211 3300049593 Bacteria 1931
971 Ga0501079_0000027 3300049741 Bacteria 60858
972 Ga0501079_0035468 3300049741 Bacteria 3839
973 Ga0501079_0050763 3300049741 Bacteria 3201
974 Ga0501079_0051902 3300049741 Bacteria 3167
975 Ga0501080_0013617 3300049742 Bacteria 7489
976 Ga0501080_0025658 3300049742 Bacteria 5474
977 Ga0501080_0036276 3300049742 Bacteria 4603
978 Ga0501080_0036955 3300049742 Bacteria 4559
979 Ga0501080_0069238 3300049742 Bacteria 3281
980 Ga0501081_0015302 3300049743 Bacteria 5060
981 Ga0501081_0023649 3300049743 Bacteria 4120
982 Ga0501081_0046535 3300049743 Bacteria 2982
983 Ga0501083_0008802 3300049744 Bacteria 7126
984 Ga0501083_0030314 3300049744 Bacteria 3717
985 Ga0501083_0085102 3300049744 Bacteria 2092
986 Ga0501280_002654 3300049776 Bacteria 2916
987 Ga0501035_0224906 3300049822 Bacteria 1601
988 Ga0501045_0004429 3300049824 Bacteria 9690
989 Ga0501045_0195914 3300049824 Bacteria 1505
990 nmdc:mga03683_3263_c1 3300050489 Bacteria 4598
991 nmdc:mga03n38_609_c1 3300050490 Bacteria 9144
992 nmdc:mga00v17_121_c1 3300050491 Bacteria 45916
993 nmdc:mga00v17_158_c1 3300050491 Bacteria 40080
994 nmdc:mga00v17_1845_c1 3300050491 Bacteria 10942
995 nmdc:mga0yw44_187_c1 3300050492 Bacteria 21904
996 nmdc:mga0k408_40587_c1 3300050493 Bacteria 2678
997 nmdc:mga0k408_5171_c2 3300050493 Bacteria 2440
998 nmdc:mga06z11_622_c1 3300050494 Bacteria 12894
999 nmdc:mga06z11_879_c1 3300050494 Bacteria 10969
1000 nmdc:mga07m45_456_c1 3300050496 Bacteria 17161
1001 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
1002 nmdc:mga05p37_1706_c1 3300050507 Bacteria 25587
1003 nmdc:mga05p37_8018_c1 3300050507 Bacteria 12468
1004 nmdc:mga09592_1764_c1 3300050508 Bacteria 17372
1005 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
1006 nmdc:mga09592_40987_c1 3300050508 Bacteria 3892
1007 nmdc:mga0qj67_103581_c1 3300050509 Bacteria 2296
1008 nmdc:mga0qj67_165691_c1 3300050509 Bacteria 1794
1009 nmdc:mga0qj67_40531_c1 3300050509 Bacteria 3660
1010 nmdc:mga0qj67_43602_c1 3300050509 Bacteria 3533
1011 nmdc:mga0qj67_573_c1 3300050509 Bacteria 25116
1012 nmdc:mga06r32_1651_c1 3300050510 Bacteria 20142
1013 nmdc:mga06r32_169948_c1 3300050510 Bacteria 2164
1014 nmdc:mga06r32_22223_c1 3300050510 Bacteria 5862
1015 nmdc:mga06r32_40_c1 3300050510 Bacteria 79168
1016 nmdc:mga06r32_584_c1 3300050510 Bacteria 31769
1017 nmdc:mga08y16_19070_c1 3300050511 Bacteria 7226
1018 nmdc:mga08y16_232000_c1 3300050511 Bacteria 1909
1019 nmdc:mga08y16_27121_c1 3300050511 Bacteria 6037
1020 nmdc:mga0n895_182812_c1 3300050512 Bacteria 2128
1021 nmdc:mga0n895_338503_c1 3300050512 Bacteria 1524
1022 nmdc:mga0n895_61001_c1 3300050512 Bacteria 3722
1023 nmdc:mga0a205_247855_c1 3300050515 Bacteria 1661
1024 nmdc:mga0a205_61236_c1 3300050515 Bacteria 3635
1025 nmdc:mga0a205_65285_c1 3300050515 Bacteria 3516
1026 nmdc:mga0sz30_369_c2 3300050516 Bacteria 16436
1027 Ga0495601_0022354 3300053077 Bacteria 3881
1028 Ga0495601_0054667 3300053077 Bacteria 2526
1029 Ga0495612_0047257 3300053078 Bacteria 1764
1030 Ga0495595_0049803 3300053084 Bacteria 1938
1031 Ga0500643_013356 3300053087 Bacteria 2903
1032 Ga0500651_0000636 3300053093 Bacteria 17469
1033 Ga0500634_0000070 3300053161 Bacteria 40723
1034 Ga0501084_0007572 3300054114 Bacteria 8952
1035 Ga0501082_0004029 3300060353 Bacteria 12824
1036 Ga0501082_0028682 3300060353 Bacteria 4794
1037 Ga0501082_0044053 3300060353 Bacteria 3849
1038 Ga0501082_0099393 3300060353 Bacteria 2515
1039 Ga0501082_0248610 3300060353 Bacteria 1548
1040 Ga0530510_0000111 3300061734 Bacteria 45793
1041 Ga0530510_0004913 3300061734 Bacteria 9234
1042 Ga0530510_0048773 3300061734 Bacteria 3061

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_61236_c1 nmdc:mga0a205_61236_c1_15_1106 350
2 3300049584 Ga0501068_0001639 Ga0501068_0001639_31_1314 365
3 3300006846 Ga0075430_100022826 Ga0075430_1000228267 395
4 3300050509 nmdc:mga0qj67_43602_c1 nmdc:mga0qj67_43602_c1_1698_3029 396
5 3300046558 Ga0495633_0089538 Ga0495633_0089538_16_1275 399
6 3300005444 Ga0070694_100041113 Ga0070694_1000411133 401
7 3300005471 Ga0070698_100105258 Ga0070698_1001052584 401
8 3300009148 Ga0105243_10065919 Ga0105243_100659194 401
9 3300025935 Ga0207709_10029160 Ga0207709_100291604 401
10 3300005614 Ga0068856_100137761 Ga0068856_1001377612 402
11 3300006880 Ga0075429_100000015 Ga0075429_10000001562 402
12 3300009147 Ga0114129_10041162 Ga0114129_100411622 402
13 3300032002 Ga0307416_100191774 Ga0307416_1001917742 402
14 3300050507 nmdc:mga05p37_133_c1 nmdc:mga05p37_133_c1_32240_33574 402
15 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_22847_24181 402
16 3300050510 nmdc:mga06r32_1651_c1 nmdc:mga06r32_1651_c1_6196_7530 402
17 3300005844 Ga0068862_100091519 Ga0068862_1000915193 403
18 3300009094 Ga0111539_10393720 Ga0111539_103937201 403
19 3300046516 Ga0495628_0073782 Ga0495628_0073782_1046_2353 404
20 3300046533 Ga0495640_0094458 Ga0495640_0094458_432_1739 404
21 3300014326 Ga0157380_10015682 Ga0157380_100156825 406
22 3300006163 Ga0070715_10014203 Ga0070715_100142034 407
23 3300006914 Ga0075436_100137968 Ga0075436_1001379682 407
24 3300025905 Ga0207685_10045386 Ga0207685_100453862 407
25 3300007076 Ga0075435_100062780 Ga0075435_1000627802 409
26 3300049586 Ga0501070_0099865 Ga0501070_0099865_711_2066 409
27 3300046454 Ga0495592_0080837 Ga0495592_0080837_292_1659 410
28 3300046511 Ga0495608_0127296 Ga0495608_0127296_82_1449 410
29 3300026088 Ga0207641_10047478 Ga0207641_100474782 412
30 3300035207 Ga0373942_0010777 Ga0373942_0010777_856_2139 412
31 iso_pu_bacteria 2842780639 2842781544 412
32 3300025961 Ga0207712_10113733 Ga0207712_101137331 413
33 3300026095 Ga0207676_10044317 Ga0207676_100443172 413
34 3300042156 Ga0439446_0011478 Ga0439446_0011478_402_1709 413
35 3300049577 Ga0501041_0030700 Ga0501041_0030700_1799_3226 413
36 3300049822 Ga0501035_0224906 Ga0501035_0224906_85_1551 413
37 3300005329 Ga0070683_100013072 Ga0070683_1000130723 414
38 3300005336 Ga0070680_100035809 Ga0070680_1000358092 414
39 3300005336 Ga0070680_100205416 Ga0070680_1002054162 414
40 3300005339 Ga0070660_100028013 Ga0070660_1000280133 414
41 3300005339 Ga0070660_100079329 Ga0070660_1000793291 414
42 3300005344 Ga0070661_100020822 Ga0070661_1000208222 414
43 3300005345 Ga0070692_10034034 Ga0070692_100340342 414
44 3300005440 Ga0070705_100099519 Ga0070705_1000995192 414
45 3300005539 Ga0068853_100002186 Ga0068853_10000218611 414
46 3300005545 Ga0070695_100028709 Ga0070695_1000287092 414
47 3300005546 Ga0070696_100141385 Ga0070696_1001413852 414
48 3300005549 Ga0070704_100191315 Ga0070704_1001913152 414
49 3300005564 Ga0070664_100017980 Ga0070664_1000179802 414
50 3300005614 Ga0068856_100005841 Ga0068856_1000058412 414
51 3300005834 Ga0068851_10008908 Ga0068851_100089083 414
52 3300025912 Ga0207707_10010165 Ga0207707_100101653 414
53 3300025913 Ga0207695_10006211 Ga0207695_1000621111 414
54 3300025917 Ga0207660_10027866 Ga0207660_100278662 414
55 3300025919 Ga0207657_10001446 Ga0207657_1000144616 414
56 3300025919 Ga0207657_10113044 Ga0207657_101130441 414
57 3300025921 Ga0207652_10018305 Ga0207652_100183054 414
58 3300025924 Ga0207694_10095594 Ga0207694_100955942 414
59 3300025929 Ga0207664_10100168 Ga0207664_101001682 414
60 3300025932 Ga0207690_10133711 Ga0207690_101337111 414
61 3300025944 Ga0207661_10070183 Ga0207661_100701832 414
62 3300025949 Ga0207667_10004596 Ga0207667_100045968 414
63 3300025981 Ga0207640_10007928 Ga0207640_100079282 414
64 3300026041 Ga0207639_10002604 Ga0207639_1000260410 414
65 3300026116 Ga0207674_10000052 Ga0207674_100000525 414
66 3300026142 Ga0207698_10016541 Ga0207698_100165413 414
67 3300035241 Ga0373961_0027768 Ga0373961_0027768_13_1302 414
68 3300049576 Ga0501040_0105094 Ga0501040_0105094_40_1359 414
69 3300049577 Ga0501041_0031447 Ga0501041_0031447_1196_2515 414
70 3300050511 nmdc:mga08y16_19070_c1 nmdc:mga08y16_19070_c1_5670_6971 414
71 3300050515 nmdc:mga0a205_247855_c1 nmdc:mga0a205_247855_c1_332_1633 414
72 3300005334 Ga0068869_100027051 Ga0068869_1000270513 415
73 3300005353 Ga0070669_100103978 Ga0070669_1001039782 415
74 3300005434 Ga0070709_10001553 Ga0070709_100015537 415
75 3300005435 Ga0070714_100229316 Ga0070714_1002293162 415
76 3300005436 Ga0070713_100032686 Ga0070713_1000326862 415
77 3300005437 Ga0070710_10004468 Ga0070710_100044686 415
78 3300005438 Ga0070701_10044853 Ga0070701_100448532 415
79 3300005439 Ga0070711_100011627 Ga0070711_1000116273 415
80 3300005441 Ga0070700_100138762 Ga0070700_1001387621 415
81 3300005518 Ga0070699_100022242 Ga0070699_1000222423 415
82 3300005719 Ga0068861_100006869 Ga0068861_1000068695 415
83 3300009098 Ga0105245_10004129 Ga0105245_1000412911 415
84 3300009148 Ga0105243_10011531 Ga0105243_100115314 415
85 3300009174 Ga0105241_10116676 Ga0105241_101166762 415
86 3300009176 Ga0105242_10005056 Ga0105242_100050566 415
87 3300009177 Ga0105248_10039245 Ga0105248_100392455 415
88 3300010375 Ga0105239_10109140 Ga0105239_101091401 415
89 3300013296 Ga0157374_10053996 Ga0157374_100539962 415
90 3300013306 Ga0163162_10072809 Ga0163162_100728093 415
91 3300014325 Ga0163163_10018597 Ga0163163_100185972 415
92 3300014325 Ga0163163_10054458 Ga0163163_100544584 415
93 3300014969 Ga0157376_10002756 Ga0157376_100027566 415
94 3300017792 Ga0163161_10044445 Ga0163161_100444452 415
95 3300025986 Ga0207658_10022252 Ga0207658_100222522 415
96 3300005329 Ga0070683_100004250 Ga0070683_1000042501 416
97 3300005330 Ga0070690_100007788 Ga0070690_1000077883 416
98 3300005335 Ga0070666_10010051 Ga0070666_100100512 416
99 3300005338 Ga0068868_100014076 Ga0068868_1000140763 416
100 3300005340 Ga0070689_100008044 Ga0070689_1000080442 416
101 3300005344 Ga0070661_100040918 Ga0070661_1000409182 416
102 3300005345 Ga0070692_10006651 Ga0070692_100066512 416
103 3300005355 Ga0070671_100002957 Ga0070671_1000029572 416
104 3300005365 Ga0070688_100000292 Ga0070688_10000029213 416
105 3300005366 Ga0070659_100013147 Ga0070659_1000131475 416
106 3300005455 Ga0070663_100003494 Ga0070663_1000034943 416
107 3300005457 Ga0070662_100050051 Ga0070662_1000500512 416
108 3300005466 Ga0070685_10001092 Ga0070685_100010927 416
109 3300005535 Ga0070684_100008392 Ga0070684_1000083923 416
110 3300005543 Ga0070672_100002876 Ga0070672_1000028769 416
111 3300005548 Ga0070665_100055246 Ga0070665_1000552462 416
112 3300005564 Ga0070664_100008398 Ga0070664_1000083983 416
113 3300005577 Ga0068857_100003513 Ga0068857_1000035134 416
114 3300005614 Ga0068856_100033965 Ga0068856_1000339654 416
115 3300005616 Ga0068852_100010864 Ga0068852_1000108644 416
116 3300005618 Ga0068864_100005774 Ga0068864_1000057744 416
117 3300005718 Ga0068866_10003766 Ga0068866_100037662 416
118 3300005719 Ga0068861_100005187 Ga0068861_1000051874 416
119 3300005834 Ga0068851_10000872 Ga0068851_100008725 416
120 3300005841 Ga0068863_100222846 Ga0068863_1002228461 416
121 3300005842 Ga0068858_100007973 Ga0068858_1000079732 416
122 3300005843 Ga0068860_100030834 Ga0068860_1000308342 416
123 3300009177 Ga0105248_10010195 Ga0105248_100101952 416
124 3300017792 Ga0163161_10109759 Ga0163161_101097591 416
125 3300025315 Ga0207697_10000149 Ga0207697_100001495 416
126 3300025321 Ga0207656_10012278 Ga0207656_100122782 416
127 3300025893 Ga0207682_10000459 Ga0207682_1000045913 416
128 3300025901 Ga0207688_10001830 Ga0207688_100018308 416
129 3300025907 Ga0207645_10001936 Ga0207645_1000193613 416
130 3300025918 Ga0207662_10009238 Ga0207662_100092383 416
131 3300025920 Ga0207649_10102326 Ga0207649_101023261 416
132 3300025923 Ga0207681_10066205 Ga0207681_100662052 416
133 3300025923 Ga0207681_10073914 Ga0207681_100739141 416
134 3300025925 Ga0207650_10001825 Ga0207650_100018252 416
135 3300025925 Ga0207650_10002621 Ga0207650_100026219 416
136 3300025926 Ga0207659_10003990 Ga0207659_100039904 416
137 3300025931 Ga0207644_10032756 Ga0207644_100327562 416
138 3300025933 Ga0207706_10000775 Ga0207706_1000077530 416
139 3300025933 Ga0207706_10041143 Ga0207706_100411432 416
140 3300025934 Ga0207686_10043800 Ga0207686_100438002 416
141 3300025937 Ga0207669_10009438 Ga0207669_100094382 416
142 3300025938 Ga0207704_10024054 Ga0207704_100240541 416
143 3300025940 Ga0207691_10003722 Ga0207691_100037229 416
144 3300025940 Ga0207691_10142642 Ga0207691_101426421 416
145 3300025941 Ga0207711_10006050 Ga0207711_100060503 416
146 3300025942 Ga0207689_10002613 Ga0207689_100026133 416
147 3300025945 Ga0207679_10037767 Ga0207679_100377672 416
148 3300025986 Ga0207658_10006563 Ga0207658_100065633 416
149 3300026035 Ga0207703_10013439 Ga0207703_100134392 416
150 3300026067 Ga0207678_10001020 Ga0207678_1000102012 416
151 3300026075 Ga0207708_10001552 Ga0207708_1000155213 416
152 3300026088 Ga0207641_10202846 Ga0207641_102028461 416
153 3300026089 Ga0207648_10004782 Ga0207648_100047825 416
154 3300026116 Ga0207674_10002975 Ga0207674_1000297513 416
155 3300026118 Ga0207675_100000448 Ga0207675_10000044828 416
156 3300026121 Ga0207683_10001065 Ga0207683_100010655 416
157 3300027682 Ga0209971_1000947 Ga0209971_10009473 416
158 3300027876 Ga0209974_10030390 Ga0209974_100303902 416
159 3300028379 Ga0268266_10168477 Ga0268266_101684772 416
160 3300028381 Ga0268264_10114761 Ga0268264_101147612 416
161 3300031911 Ga0307412_10178096 Ga0307412_101780962 416
162 3300048904 Ga0496101_0070560 Ga0496101_0070560_583_1929 416
163 3300005329 Ga0070683_100027452 Ga0070683_1000274525 417
164 3300005331 Ga0070670_100009718 Ga0070670_1000097188 417
165 3300005334 Ga0068869_100053905 Ga0068869_1000539051 417
166 3300005337 Ga0070682_100000380 Ga0070682_10000038027 417
167 3300005338 Ga0068868_100004418 Ga0068868_1000044188 417
168 3300005340 Ga0070689_100057648 Ga0070689_1000576481 417
169 3300005344 Ga0070661_100007342 Ga0070661_1000073425 417
170 3300005355 Ga0070671_100076762 Ga0070671_1000767622 417
171 3300005364 Ga0070673_100001706 Ga0070673_1000017067 417
172 3300005364 Ga0070673_100036017 Ga0070673_1000360173 417
173 3300005456 Ga0070678_100006602 Ga0070678_1000066028 417
174 3300005543 Ga0070672_100001829 Ga0070672_10000182914 417
175 3300005548 Ga0070665_100015445 Ga0070665_1000154452 417
176 3300005548 Ga0070665_100084976 Ga0070665_1000849762 417
177 3300005564 Ga0070664_100002191 Ga0070664_1000021917 417
178 3300005578 Ga0068854_100011844 Ga0068854_1000118446 417
179 3300005616 Ga0068852_100001889 Ga0068852_10000188911 417
180 3300005617 Ga0068859_100010871 Ga0068859_1000108716 417
181 3300005618 Ga0068864_100014149 Ga0068864_1000141496 417
182 3300005618 Ga0068864_100019036 Ga0068864_1000190362 417
183 3300005719 Ga0068861_100002552 Ga0068861_1000025525 417
184 3300005834 Ga0068851_10009765 Ga0068851_100097656 417
185 3300005842 Ga0068858_100002485 Ga0068858_10000248514 417
186 3300005842 Ga0068858_100060543 Ga0068858_1000605433 417
187 3300006175 Ga0070712_100040974 Ga0070712_1000409742 417
188 3300006358 Ga0068871_100006555 Ga0068871_1000065556 417
189 3300006844 Ga0075428_100002975 Ga0075428_10000297516 417
190 3300006846 Ga0075430_100145781 Ga0075430_1001457812 417
191 3300006847 Ga0075431_100002432 Ga0075431_10000243216 417
192 3300006871 Ga0075434_100157039 Ga0075434_1001570392 417
193 3300006880 Ga0075429_100049651 Ga0075429_1000496514 417
194 3300006881 Ga0068865_100063933 Ga0068865_1000639332 417
195 3300006931 Ga0097620_100010870 Ga0097620_1000108702 417
196 3300009093 Ga0105240_10002074 Ga0105240_100020744 417
197 3300009094 Ga0111539_10002751 Ga0111539_1000275120 417
198 3300009094 Ga0111539_10058516 Ga0111539_100585163 417
199 3300009094 Ga0111539_10081464 Ga0111539_100814644 417
200 3300009101 Ga0105247_10005141 Ga0105247_100051413 417
201 3300009177 Ga0105248_10110131 Ga0105248_101101312 417
202 3300013296 Ga0157374_10035124 Ga0157374_100351242 417
203 3300014969 Ga0157376_10111927 Ga0157376_101119272 417
204 3300025321 Ga0207656_10003769 Ga0207656_100037692 417
205 3300025899 Ga0207642_10001236 Ga0207642_100012365 417
206 3300025900 Ga0207710_10027304 Ga0207710_100273042 417
207 3300025908 Ga0207643_10009427 Ga0207643_100094272 417
208 3300025913 Ga0207695_10001882 Ga0207695_1000188222 417
209 3300025916 Ga0207663_10005447 Ga0207663_100054472 417
210 3300025917 Ga0207660_10124814 Ga0207660_101248142 417
211 3300025918 Ga0207662_10024694 Ga0207662_100246942 417
212 3300025925 Ga0207650_10085318 Ga0207650_100853182 417
213 3300025926 Ga0207659_10071353 Ga0207659_100713532 417
214 3300025927 Ga0207687_10026690 Ga0207687_100266902 417
215 3300025933 Ga0207706_10181447 Ga0207706_101814472 417
216 3300025936 Ga0207670_10055151 Ga0207670_100551512 417
217 3300025940 Ga0207691_10001095 Ga0207691_1000109518 417
218 3300025940 Ga0207691_10025607 Ga0207691_100256073 417
219 3300025940 Ga0207691_10046818 Ga0207691_100468182 417
220 3300025941 Ga0207711_10003296 Ga0207711_100032963 417
221 3300025942 Ga0207689_10038779 Ga0207689_100387792 417
222 3300025944 Ga0207661_10036429 Ga0207661_100364294 417
223 3300025945 Ga0207679_10051272 Ga0207679_100512722 417
224 3300025960 Ga0207651_10002306 Ga0207651_100023065 417
225 3300025960 Ga0207651_10014477 Ga0207651_100144773 417
226 3300026023 Ga0207677_10045330 Ga0207677_100453303 417
227 3300026089 Ga0207648_10001543 Ga0207648_1000154311 417
228 3300026089 Ga0207648_10023419 Ga0207648_100234192 417
229 3300026095 Ga0207676_10004850 Ga0207676_100048503 417
230 3300026095 Ga0207676_10120415 Ga0207676_101204153 417
231 3300026121 Ga0207683_10000746 Ga0207683_1000074612 417
232 3300028379 Ga0268266_10137036 Ga0268266_101370362 417
233 3300028381 Ga0268264_10037447 Ga0268264_100374472 417
234 3300031238 Ga0265332_10002887 Ga0265332_100028872 417
235 3300035118 Ga0373954_0026496 Ga0373954_0026496_663_2000 417
236 3300035120 Ga0373957_0005151 Ga0373957_0005151_2012_3349 417
237 3300035171 Ga0373946_0056597 Ga0373946_0056597_242_1579 417
238 3300035172 Ga0373955_0008151 Ga0373955_0008151_3307_4644 417
239 3300035724 Ga0373933_0042567 Ga0373933_0042567_463_1800 417
240 3300036401 Ga0373937_0035761 Ga0373937_0035761_593_1930 417
241 3300037068 Ga0373925_0012770 Ga0373925_0012770_4330_5667 417
242 3300044712 Ga0453684_0000040 Ga0453684_0000040_305876_307168 417
243 3300045051 Ga0451576_0025176 Ga0451576_0025176_3479_4804 417
244 3300046472 Ga0495580_0154162 Ga0495580_0154162_50_1387 417
245 3300046539 Ga0495621_0022890 Ga0495621_0022890_23_1360 417
246 3300046680 Ga0495646_0074552 Ga0495646_0074552_243_1580 417
247 3300047317 Ga0495604_0110347 Ga0495604_0110347_444_1781 417
248 3300048088 Ga0495602_0080127 Ga0495602_0080127_566_1903 417
249 3300048903 Ga0496100_0128154 Ga0496100_0128154_187_1494 417
250 3300048907 Ga0496104_0009610 Ga0496104_0009610_1730_3067 417
251 3300048908 Ga0496105_0006614 Ga0496105_0006614_3225_4562 417
252 3300048911 Ga0496108_0019745 Ga0496108_0019745_1800_3137 417
253 3300048912 Ga0496109_0149381 Ga0496109_0149381_333_1670 417
254 3300048912 Ga0496109_0197925 Ga0496109_0197925_327_1634 417
255 3300048915 Ga0496112_0011093 Ga0496112_0011093_4207_5544 417
256 3300048918 Ga0496115_0036524 Ga0496115_0036524_1206_2543 417
257 3300048918 Ga0496115_0205269 Ga0496115_0205269_35_1336 417
258 3300048919 Ga0496116_0000008 Ga0496116_0000008_468855_470141 417
259 3300048924 Ga0496121_0000012 Ga0496121_0000012_245611_246897 417
260 3300049572 Ga0501036_0079955 Ga0501036_0079955_777_2060 417
261 3300049573 Ga0501037_0065601 Ga0501037_0065601_406_1689 417
262 3300049575 Ga0501039_0037554 Ga0501039_0037554_1518_2801 417
263 3300049576 Ga0501040_0015976 Ga0501040_0015976_1495_2778 417
264 3300049577 Ga0501041_0057553 Ga0501041_0057553_717_2000 417
265 3300049579 Ga0501043_0056571 Ga0501043_0056571_1207_2490 417
266 3300049584 Ga0501068_0052322 Ga0501068_0052322_200_1483 417
267 3300049588 Ga0501072_0060665 Ga0501072_0060665_1290_2594 417
268 3300049591 Ga0501075_0034527 Ga0501075_0034527_2190_3473 417
269 3300049741 Ga0501079_0035468 Ga0501079_0035468_1540_2823 417
270 3300049742 Ga0501080_0036276 Ga0501080_0036276_1635_2918 417
271 3300049743 Ga0501081_0023649 Ga0501081_0023649_1952_3235 417
272 3300049744 Ga0501083_0030314 Ga0501083_0030314_1642_2925 417
273 3300049824 Ga0501045_0195914 Ga0501045_0195914_20_1303 417
274 3300050507 nmdc:mga05p37_8018_c1 nmdc:mga05p37_8018_c1_5753_7036 417
275 3300050509 nmdc:mga0qj67_165691_c1 nmdc:mga0qj67_165691_c1_95_1378 417
276 3300050510 nmdc:mga06r32_169948_c1 nmdc:mga06r32_169948_c1_676_1959 417
277 3300050510 nmdc:mga06r32_40_c1 nmdc:mga06r32_40_c1_10143_11426 417
278 3300050511 nmdc:mga08y16_232000_c1 nmdc:mga08y16_232000_c1_148_1443 417
279 3300050511 nmdc:mga08y16_27121_c1 nmdc:mga08y16_27121_c1_1647_2930 417
280 3300050512 nmdc:mga0n895_182812_c1 nmdc:mga0n895_182812_c1_464_1801 417
281 3300060353 Ga0501082_0044053 Ga0501082_0044053_2187_3470 417
282 3300005334 Ga0068869_100069021 Ga0068869_1000690213 418
283 3300005364 Ga0070673_100031437 Ga0070673_1000314376 418
284 3300006871 Ga0075434_100009366 Ga0075434_10000936612 418
285 3300007076 Ga0075435_100103983 Ga0075435_1001039834 418
286 3300014745 Ga0157377_10014693 Ga0157377_100146936 418
287 3300025926 Ga0207659_10014471 Ga0207659_100144715 418
288 3300025942 Ga0207689_10030707 Ga0207689_100307072 418
289 3300031852 Ga0307410_10015369 Ga0307410_100153695 418
290 3300049588 Ga0501072_0078424 Ga0501072_0078424_1240_2580 418
291 3300050512 nmdc:mga0n895_61001_c1 nmdc:mga0n895_61001_c1_591_1889 418
292 3300060353 Ga0501082_0248610 Ga0501082_0248610_196_1536 418
293 3300027360 Ga0209969_1000461 Ga0209969_10004615 419
294 3300027364 Ga0209967_1002692 Ga0209967_10026923 419
295 3300027471 Ga0209995_1000660 Ga0209995_10006602 419
296 3300027543 Ga0209999_1005905 Ga0209999_10059052 419
297 3300027876 Ga0209974_10004499 Ga0209974_100044992 419
298 3300031728 Ga0316578_10017487 Ga0316578_100174872 419
299 3300032168 Ga0316593_10021935 Ga0316593_100219351 419
300 3300005444 Ga0070694_100066611 Ga0070694_1000666114 420
301 3300005549 Ga0070704_100033773 Ga0070704_1000337734 420
302 3300005981 Ga0081538_10073395 Ga0081538_100733951 420
303 3300006846 Ga0075430_100030371 Ga0075430_1000303712 420
304 3300006847 Ga0075431_100035882 Ga0075431_1000358825 420
305 3300025922 Ga0207646_10154480 Ga0207646_101544802 420
306 3300031727 Ga0316576_10007031 Ga0316576_100070313 420
307 3300031995 Ga0307409_100213330 Ga0307409_1002133302 420
308 3300050509 nmdc:mga0qj67_103581_c1 nmdc:mga0qj67_103581_c1_53_1381 420
309 3300046476 Ga0495662_0033484 Ga0495662_0033484_418_1719 421
310 3300046517 Ga0495630_0034416 Ga0495630_0034416_246_1547 421
311 3300005458 Ga0070681_10002119 Ga0070681_100021194 422
312 3300035691 Ga0373931_0007954 Ga0373931_0007954_2154_3461 422
313 3300042876 Ga0451577_0026706 Ga0451577_0026706_1861_3195 422
314 3300044712 Ga0453684_0126052 Ga0453684_0126052_698_2032 422
315 3300031727 Ga0316576_10005155 Ga0316576_100051554 423
316 3300035398 Ga0316574_0004197 Ga0316574_0004197_4887_6200 423
317 3300035398 Ga0316574_0005166 Ga0316574_0005166_3536_4849 423
318 3300035398 Ga0316574_0028567 Ga0316574_0028567_70_1380 423
319 3300045976 Ga0466967_0141310 Ga0466967_0141310_718_2178 423
320 3300005544 Ga0070686_100059326 Ga0070686_1000593261 424
321 3300005617 Ga0068859_100083482 Ga0068859_1000834821 424
322 3300006852 Ga0075433_10054163 Ga0075433_100541632 424
323 3300006931 Ga0097620_100083480 Ga0097620_1000834801 424
324 3300013104 Ga0157370_10012042 Ga0157370_100120425 424
325 3300028381 Ga0268264_10087362 Ga0268264_100873622 424
326 3300049584 Ga0501068_0049744 Ga0501068_0049744_464_1792 424
327 3300049589 Ga0501073_0003036 Ga0501073_0003036_6698_8026 424
328 3300049590 Ga0501074_0043599 Ga0501074_0043599_1388_2716 424
329 3300050515 nmdc:mga0a205_65285_c1 nmdc:mga0a205_65285_c1_915_2225 424
330 3300005536 Ga0070697_100003127 Ga0070697_10000312711 425
331 3300009174 Ga0105241_10125335 Ga0105241_101253352 425
332 3300026078 Ga0207702_10022168 Ga0207702_100221683 425
333 3300035691 Ga0373931_0064565 Ga0373931_0064565_619_1950 425
334 3300046539 Ga0495621_0036649 Ga0495621_0036649_312_1640 425
335 iso_pu_bacteria 2547132103 2547375481 425
336 iso_pu_bacteria 2843690924 2843691361 425
337 iso_pu_bacteria 2998344455 2998344551 425
338 3300049568 Ga0501031_0028864 Ga0501031_0028864_611_2077 426
339 3300049572 Ga0501036_0013100 Ga0501036_0013100_99_1565 426
340 3300049572 Ga0501036_0041825 Ga0501036_0041825_1236_2702 426
341 3300049574 Ga0501038_0049384 Ga0501038_0049384_190_1656 426
342 3300049575 Ga0501039_0000126 Ga0501039_0000126_27668_29134 426
343 3300049575 Ga0501039_0010087 Ga0501039_0010087_165_1631 426
344 3300049577 Ga0501041_0000283 Ga0501041_0000283_15529_16995 426
345 3300049578 Ga0501042_0000022 Ga0501042_0000022_24080_25546 426
346 3300049578 Ga0501042_0009519 Ga0501042_0009519_762_2228 426
347 3300049587 Ga0501071_0072462 Ga0501071_0072462_261_1727 426
348 3300049587 Ga0501071_0087967 Ga0501071_0087967_632_2098 426
349 3300049588 Ga0501072_0002838 Ga0501072_0002838_5824_7290 426
350 3300049590 Ga0501074_0035483 Ga0501074_0035483_862_2328 426
351 3300049591 Ga0501075_0000128 Ga0501075_0000128_825_2291 426
352 3300049591 Ga0501075_0001228 Ga0501075_0001228_9325_10791 426
353 3300049592 Ga0501076_0000135 Ga0501076_0000135_15688_17154 426
354 3300049592 Ga0501076_0032101 Ga0501076_0032101_452_1918 426
355 3300049593 Ga0501077_0056282 Ga0501077_0056282_939_2405 426
356 3300049593 Ga0501077_0091211 Ga0501077_0091211_76_1542 426
357 3300049741 Ga0501079_0000027 Ga0501079_0000027_33109_34575 426
358 3300049741 Ga0501079_0050763 Ga0501079_0050763_141_1607 426
359 3300049742 Ga0501080_0036955 Ga0501080_0036955_656_2122 426
360 3300049743 Ga0501081_0015302 Ga0501081_0015302_411_1877 426
361 3300054114 Ga0501084_0007572 Ga0501084_0007572_7023_8489 426
362 3300060353 Ga0501082_0004029 Ga0501082_0004029_116_1582 426
363 3300060353 Ga0501082_0099393 Ga0501082_0099393_820_2286 426
364 3300061734 Ga0530510_0000111 Ga0530510_0000111_15633_17099 426
365 3300061734 Ga0530510_0048773 Ga0530510_0048773_874_2340 426
366 iso_pu_bacteria 2852649853 2852651273 426
367 iso_pu_bacteria 8054727385 8054732065 426
368 3300005444 Ga0070694_100038329 Ga0070694_1000383294 427
369 3300005547 Ga0070693_100018554 Ga0070693_1000185543 427
370 3300005578 Ga0068854_100053310 Ga0068854_1000533102 427
371 3300006847 Ga0075431_100120469 Ga0075431_1001204692 427
372 3300009093 Ga0105240_10014161 Ga0105240_1001416110 427
373 3300009545 Ga0105237_10026395 Ga0105237_100263956 427
374 3300013100 Ga0157373_10001374 Ga0157373_1000137413 427
375 3300013102 Ga0157371_10007777 Ga0157371_100077776 427
376 3300013104 Ga0157370_10049463 Ga0157370_100494632 427
377 3300013307 Ga0157372_10266499 Ga0157372_102664991 427
378 iso_pu_bacteria 2808606361 2808857279 427
379 iso_pu_bacteria 2808606376 2808926415 427
380 iso_pu_bacteria 2808606378 2808937417 427
381 iso_pu_bacteria 2808606380 2808948576 427
382 iso_pu_bacteria 2808606383 2808965747 427
383 iso_pu_bacteria 2808606389 2809000654 427
384 3300005295 Ga0065707_10003200 Ga0065707_100032001 428
385 3300005335 Ga0070666_10017293 Ga0070666_100172933 428
386 3300005336 Ga0070680_100096487 Ga0070680_1000964872 428
387 3300005340 Ga0070689_100026938 Ga0070689_1000269384 428
388 3300005354 Ga0070675_100088797 Ga0070675_1000887971 428
389 3300005364 Ga0070673_100011790 Ga0070673_1000117906 428
390 3300005440 Ga0070705_100027675 Ga0070705_1000276751 428
391 3300005459 Ga0068867_100026979 Ga0068867_1000269793 428
392 3300005536 Ga0070697_100110115 Ga0070697_1001101152 428
393 3300005615 Ga0070702_100006583 Ga0070702_1000065831 428
394 3300005617 Ga0068859_100208277 Ga0068859_1002082771 428
395 3300005719 Ga0068861_100058879 Ga0068861_1000588793 428
396 3300005841 Ga0068863_100174063 Ga0068863_1001740632 428
397 3300005842 Ga0068858_100065191 Ga0068858_1000651913 428
398 3300005843 Ga0068860_100013859 Ga0068860_1000138592 428
399 3300005844 Ga0068862_100014383 Ga0068862_1000143833 428
400 3300005844 Ga0068862_100043953 Ga0068862_1000439533 428
401 3300006237 Ga0097621_100028624 Ga0097621_1000286242 428
402 3300006358 Ga0068871_100008816 Ga0068871_1000088164 428
403 3300006931 Ga0097620_100208260 Ga0097620_1002082601 428
404 3300009093 Ga0105240_10007281 Ga0105240_100072813 428
405 3300009545 Ga0105237_10136504 Ga0105237_101365041 428
406 3300009553 Ga0105249_10012863 Ga0105249_100128635 428
407 3300013307 Ga0157372_10021657 Ga0157372_100216574 428
408 3300025315 Ga0207697_10020793 Ga0207697_100207933 428
409 3300025913 Ga0207695_10015440 Ga0207695_100154402 428
410 3300025916 Ga0207663_10018487 Ga0207663_100184871 428
411 3300025918 Ga0207662_10085548 Ga0207662_100855482 428
412 3300025923 Ga0207681_10011656 Ga0207681_100116566 428
413 3300025934 Ga0207686_10036442 Ga0207686_100364422 428
414 3300025938 Ga0207704_10017993 Ga0207704_100179934 428
415 3300025940 Ga0207691_10001701 Ga0207691_1000170117 428
416 3300025942 Ga0207689_10003706 Ga0207689_100037067 428
417 3300025960 Ga0207651_10032842 Ga0207651_100328423 428
418 3300025961 Ga0207712_10010887 Ga0207712_100108873 428
419 3300025961 Ga0207712_10131469 Ga0207712_101314692 428
420 3300026075 Ga0207708_10008147 Ga0207708_100081474 428
421 3300026075 Ga0207708_10072844 Ga0207708_100728442 428
422 3300026089 Ga0207648_10040757 Ga0207648_100407573 428
423 3300026118 Ga0207675_100008376 Ga0207675_1000083764 428
424 3300026121 Ga0207683_10022573 Ga0207683_100225734 428
425 3300028380 Ga0268265_10011011 Ga0268265_100110114 428
426 3300028380 Ga0268265_10066373 Ga0268265_100663732 428
427 3300028381 Ga0268264_10018814 Ga0268264_100188142 428
428 iso_pu_bacteria 2599185302 2599945047 428
429 iso_pu_bacteria 2599185304 2599955224 428
430 iso_pu_bacteria 2599185309 2599983957 428
431 iso_pu_bacteria 2599185310 2599990325 428
432 iso_pu_bacteria 2599185312 2600001733 428
433 iso_pu_bacteria 2599185320 2600048859 428
434 iso_pu_bacteria 2808606373 2808905290 428
435 iso_pu_bacteria 2946006987 2946007427 428
436 3300005330 Ga0070690_100003693 Ga0070690_1000036938 429
437 3300005331 Ga0070670_100084272 Ga0070670_1000842722 429
438 3300005333 Ga0070677_10015431 Ga0070677_100154312 429
439 3300005334 Ga0068869_100011009 Ga0068869_1000110093 429
440 3300005338 Ga0068868_100063241 Ga0068868_1000632414 429
441 3300005340 Ga0070689_100008330 Ga0070689_1000083306 429
442 3300005340 Ga0070689_100019537 Ga0070689_1000195375 429
443 3300005343 Ga0070687_100006690 Ga0070687_1000066903 429
444 3300005344 Ga0070661_100004439 Ga0070661_1000044398 429
445 3300005353 Ga0070669_100076355 Ga0070669_1000763552 429
446 3300005364 Ga0070673_100012540 Ga0070673_1000125403 429
447 3300005365 Ga0070688_100039128 Ga0070688_1000391283 429
448 3300005438 Ga0070701_10000319 Ga0070701_1000031915 429
449 3300005440 Ga0070705_100017497 Ga0070705_1000174974 429
450 3300005441 Ga0070700_100002665 Ga0070700_10000266512 429
451 3300005455 Ga0070663_100107051 Ga0070663_1001070512 429
452 3300005457 Ga0070662_100005429 Ga0070662_1000054291 429
453 3300005466 Ga0070685_10020262 Ga0070685_100202624 429
454 3300005544 Ga0070686_100000740 Ga0070686_1000007403 429
455 3300005544 Ga0070686_100011553 Ga0070686_1000115533 429
456 3300005544 Ga0070686_100018117 Ga0070686_1000181172 429
457 3300005545 Ga0070695_100016539 Ga0070695_1000165395 429
458 3300005546 Ga0070696_100090912 Ga0070696_1000909122 429
459 3300005548 Ga0070665_100020180 Ga0070665_1000201802 429
460 3300005564 Ga0070664_100002880 Ga0070664_10000288012 429
461 3300005615 Ga0070702_100002726 Ga0070702_1000027263 429
462 3300005615 Ga0070702_100047510 Ga0070702_1000475102 429
463 3300005617 Ga0068859_100155567 Ga0068859_1001555672 429
464 3300005617 Ga0068859_100160028 Ga0068859_1001600282 429
465 3300005718 Ga0068866_10001916 Ga0068866_100019167 429
466 3300005719 Ga0068861_100007103 Ga0068861_1000071034 429
467 3300005719 Ga0068861_100042029 Ga0068861_1000420292 429
468 3300005840 Ga0068870_10006457 Ga0068870_100064572 429
469 3300005841 Ga0068863_100009028 Ga0068863_1000090284 429
470 3300005843 Ga0068860_100110409 Ga0068860_1001104092 429
471 3300005844 Ga0068862_100000452 Ga0068862_1000004527 429
472 3300005844 Ga0068862_100006537 Ga0068862_1000065375 429
473 3300005844 Ga0068862_100062042 Ga0068862_1000620422 429
474 3300006173 Ga0070716_100019418 Ga0070716_1000194182 429
475 3300006237 Ga0097621_100002878 Ga0097621_10000287812 429
476 3300006844 Ga0075428_100000982 Ga0075428_1000009823 429
477 3300006846 Ga0075430_100000566 Ga0075430_1000005664 429
478 3300006846 Ga0075430_100011327 Ga0075430_1000113274 429
479 3300006846 Ga0075430_100163607 Ga0075430_1001636073 429
480 3300006847 Ga0075431_100002345 Ga0075431_10000234513 429
481 3300006880 Ga0075429_100000217 Ga0075429_10000021721 429
482 3300006881 Ga0068865_100005740 Ga0068865_1000057408 429
483 3300006914 Ga0075436_100065816 Ga0075436_1000658162 429
484 3300006931 Ga0097620_100155574 Ga0097620_1001555742 429
485 3300006931 Ga0097620_100160027 Ga0097620_1001600272 429
486 3300007265 Ga0099794_10001346 Ga0099794_100013462 429
487 3300009093 Ga0105240_10321353 Ga0105240_103213531 429
488 3300009094 Ga0111539_10002953 Ga0111539_1000295310 429
489 3300009094 Ga0111539_10124594 Ga0111539_101245941 429
490 3300009098 Ga0105245_10008792 Ga0105245_100087925 429
491 3300009147 Ga0114129_10000248 Ga0114129_1000024843 429
492 3300009148 Ga0105243_10003141 Ga0105243_1000314111 429
493 3300009176 Ga0105242_10002322 Ga0105242_1000232211 429
494 3300009176 Ga0105242_10014096 Ga0105242_100140961 429
495 3300009177 Ga0105248_10229774 Ga0105248_102297742 429
496 3300009553 Ga0105249_10006419 Ga0105249_100064198 429
497 3300009553 Ga0105249_10012784 Ga0105249_100127845 429
498 3300009553 Ga0105249_10013252 Ga0105249_100132525 429
499 3300009553 Ga0105249_10179243 Ga0105249_101792432 429
500 3300010159 Ga0099796_10024514 Ga0099796_100245142 429
501 3300013296 Ga0157374_10016690 Ga0157374_100166902 429
502 3300013297 Ga0157378_10013710 Ga0157378_100137102 429
503 3300013297 Ga0157378_10016375 Ga0157378_100163752 429
504 3300013297 Ga0157378_10198705 Ga0157378_101987052 429
505 3300013308 Ga0157375_10135352 Ga0157375_101353522 429
506 3300014745 Ga0157377_10001111 Ga0157377_100011114 429
507 3300014745 Ga0157377_10002019 Ga0157377_100020196 429
508 3300014968 Ga0157379_10005419 Ga0157379_100054192 429
509 3300014968 Ga0157379_10066007 Ga0157379_100660072 429
510 3300021384 Ga0213876_10039093 Ga0213876_100390931 429
511 3300025901 Ga0207688_10007340 Ga0207688_100073403 429
512 3300025907 Ga0207645_10100063 Ga0207645_101000632 429
513 3300025908 Ga0207643_10000257 Ga0207643_1000025718 429
514 3300025908 Ga0207643_10002766 Ga0207643_100027666 429
515 3300025908 Ga0207643_10043792 Ga0207643_100437922 429
516 3300025908 Ga0207643_10047912 Ga0207643_100479122 429
517 3300025918 Ga0207662_10012415 Ga0207662_100124152 429
518 3300025920 Ga0207649_10023500 Ga0207649_100235001 429
519 3300025923 Ga0207681_10034434 Ga0207681_100344342 429
520 3300025927 Ga0207687_10006961 Ga0207687_100069617 429
521 3300025933 Ga0207706_10007089 Ga0207706_100070898 429
522 3300025934 Ga0207686_10004363 Ga0207686_100043636 429
523 3300025935 Ga0207709_10007789 Ga0207709_100077898 429
524 3300025936 Ga0207670_10009955 Ga0207670_100099554 429
525 3300025938 Ga0207704_10001220 Ga0207704_100012207 429
526 3300025938 Ga0207704_10005871 Ga0207704_100058714 429
527 3300025940 Ga0207691_10005811 Ga0207691_100058119 429
528 3300025942 Ga0207689_10000474 Ga0207689_1000047412 429
529 3300025960 Ga0207651_10015257 Ga0207651_100152573 429
530 3300025961 Ga0207712_10058562 Ga0207712_100585623 429
531 3300026035 Ga0207703_10017347 Ga0207703_100173475 429
532 3300026075 Ga0207708_10000382 Ga0207708_1000038224 429
533 3300026075 Ga0207708_10070029 Ga0207708_100700292 429
534 3300026088 Ga0207641_10008134 Ga0207641_100081346 429
535 3300026089 Ga0207648_10011595 Ga0207648_100115955 429
536 3300026116 Ga0207674_10064951 Ga0207674_100649512 429
537 3300026118 Ga0207675_100000178 Ga0207675_10000017812 429
538 3300026118 Ga0207675_100001443 Ga0207675_1000014434 429
539 3300026118 Ga0207675_100014452 Ga0207675_1000144526 429
540 3300026121 Ga0207683_10001720 Ga0207683_1000172015 429
541 3300027512 Ga0209179_1003929 Ga0209179_10039292 429
542 3300027671 Ga0209588_1003131 Ga0209588_10031314 429
543 3300027907 Ga0207428_10008034 Ga0207428_100080345 429
544 3300027907 Ga0207428_10030182 Ga0207428_100301823 429
545 3300028379 Ga0268266_10164960 Ga0268266_101649602 429
546 3300028380 Ga0268265_10002275 Ga0268265_100022753 429
547 3300028380 Ga0268265_10003258 Ga0268265_100032587 429
548 3300028381 Ga0268264_10113232 Ga0268264_101132322 429
549 3300031344 Ga0265316_10098849 Ga0265316_100988492 429
550 3300031665 Ga0316575_10000160 Ga0316575_100001606 429
551 3300035092 Ga0373952_0001197 Ga0373952_0001197_1298_2638 429
552 3300035117 Ga0373953_0009832 Ga0373953_0009832_494_1825 429
553 3300035119 Ga0373956_0000260 Ga0373956_0000260_8960_10291 429
554 3300035120 Ga0373957_0006986 Ga0373957_0006986_2080_3411 429
555 3300035692 Ga0373935_0172654 Ga0373935_0172654_110_1450 429
556 3300035724 Ga0373933_0005945 Ga0373933_0005945_5057_6388 429
557 3300036401 Ga0373937_0000487 Ga0373937_0000487_24364_25695 429
558 3300037418 Ga0395900_0103945 Ga0395900_0103945_1324_2736 429
559 3300037466 Ga0395898_0030569 Ga0395898_0030569_771_2183 429
560 3300038443 Ga0395901_0068186 Ga0395901_0068186_856_2268 429
561 3300039437 Ga0436365_0076061 Ga0436365_0076061_1039_2358 429
562 3300039447 Ga0436361_0050017 Ga0436361_0050017_2324_3658 429
563 3300042005 Ga0439448_0020208 Ga0439448_0020208_675_1994 429
564 3300046454 Ga0495592_0000449 Ga0495592_0000449_24257_25588 429
565 3300046462 Ga0495651_0001710 Ga0495651_0001710_11168_12499 429
566 3300046516 Ga0495628_0001138 Ga0495628_0001138_22278_23609 429
567 3300046529 Ga0495652_0009506 Ga0495652_0009506_1536_2867 429
568 3300046543 Ga0495645_0004604 Ga0495645_0004604_3184_4515 429
569 3300046678 Ga0495599_0003542 Ga0495599_0003542_1608_2939 429
570 3300046681 Ga0495647_0050195 Ga0495647_0050195_127_1467 429
571 3300047320 Ga0495672_0086663 Ga0495672_0086663_285_1604 429
572 3300048904 Ga0496101_0033519 Ga0496101_0033519_2088_3428 429
573 3300048906 Ga0496103_0053346 Ga0496103_0053346_835_2175 429
574 3300048907 Ga0496104_0006723 Ga0496104_0006723_5995_7335 429
575 3300048908 Ga0496105_0105344 Ga0496105_0105344_530_1870 429
576 3300048909 Ga0496106_0007884 Ga0496106_0007884_3431_4771 429
577 3300048909 Ga0496106_0053112 Ga0496106_0053112_1029_2348 429
578 3300048911 Ga0496108_0003143 Ga0496108_0003143_7408_8748 429
579 3300048912 Ga0496109_0001481 Ga0496109_0001481_3918_5258 429
580 3300048913 Ga0496110_0005552 Ga0496110_0005552_2768_4108 429
581 3300048914 Ga0496111_0003169 Ga0496111_0003169_6708_8048 429
582 3300048917 Ga0496114_0035421 Ga0496114_0035421_1243_2583 429
583 3300048924 Ga0496121_0170810 Ga0496121_0170810_127_1446 429
584 3300050493 nmdc:mga0k408_5171_c2 nmdc:mga0k408_5171_c2_867_2225 429
585 3300050507 nmdc:mga05p37_1706_c1 nmdc:mga05p37_1706_c1_269_1588 429
586 3300050508 nmdc:mga09592_1764_c1 nmdc:mga09592_1764_c1_1657_2976 429
587 3300050509 nmdc:mga0qj67_40531_c1 nmdc:mga0qj67_40531_c1_609_1928 429
588 3300050509 nmdc:mga0qj67_573_c1 nmdc:mga0qj67_573_c1_3947_5266 429
589 3300050510 nmdc:mga06r32_22223_c1 nmdc:mga06r32_22223_c1_1811_3130 429
590 3300050510 nmdc:mga06r32_584_c1 nmdc:mga06r32_584_c1_18631_19950 429
591 3300053077 Ga0495601_0054667 Ga0495601_0054667_57_1388 429
592 iso_pu_bacteria 2919497567 2919498195 429
593 3300005330 Ga0070690_100020584 Ga0070690_1000205842 430
594 3300005331 Ga0070670_100006153 Ga0070670_1000061538 430
595 3300005331 Ga0070670_100119198 Ga0070670_1001191982 430
596 3300005334 Ga0068869_100043138 Ga0068869_1000431382 430
597 3300005335 Ga0070666_10004787 Ga0070666_100047878 430
598 3300005335 Ga0070666_10016249 Ga0070666_100162495 430
599 3300005336 Ga0070680_100156843 Ga0070680_1001568433 430
600 3300005338 Ga0068868_100041521 Ga0068868_1000415212 430
601 3300005339 Ga0070660_100066755 Ga0070660_1000667552 430
602 3300005340 Ga0070689_100006598 Ga0070689_1000065982 430
603 3300005341 Ga0070691_10053731 Ga0070691_100537312 430
604 3300005344 Ga0070661_100028288 Ga0070661_1000282882 430
605 3300005345 Ga0070692_10003861 Ga0070692_100038613 430
606 3300005353 Ga0070669_100114814 Ga0070669_1001148142 430
607 3300005354 Ga0070675_100009894 Ga0070675_1000098942 430
608 3300005355 Ga0070671_100018536 Ga0070671_1000185362 430
609 3300005365 Ga0070688_100000882 Ga0070688_1000008822 430
610 3300005367 Ga0070667_100000150 Ga0070667_10000015016 430
611 3300005367 Ga0070667_100026515 Ga0070667_1000265153 430
612 3300005436 Ga0070713_100003519 Ga0070713_1000035197 430
613 3300005436 Ga0070713_100003782 Ga0070713_1000037822 430
614 3300005439 Ga0070711_100005649 Ga0070711_1000056492 430
615 3300005444 Ga0070694_100057539 Ga0070694_1000575392 430
616 3300005445 Ga0070708_100054686 Ga0070708_1000546862 430
617 3300005445 Ga0070708_100090993 Ga0070708_1000909933 430
618 3300005455 Ga0070663_100013809 Ga0070663_1000138093 430
619 3300005456 Ga0070678_100001364 Ga0070678_1000013647 430
620 3300005456 Ga0070678_100001708 Ga0070678_1000017088 430
621 3300005457 Ga0070662_100035331 Ga0070662_1000353311 430
622 3300005457 Ga0070662_100156998 Ga0070662_1001569981 430
623 3300005457 Ga0070662_100159289 Ga0070662_1001592892 430
624 3300005458 Ga0070681_10005255 Ga0070681_1000525512 430
625 3300005458 Ga0070681_10210658 Ga0070681_102106582 430
626 3300005467 Ga0070706_100161198 Ga0070706_1001611982 430
627 3300005467 Ga0070706_100221170 Ga0070706_1002211702 430
628 3300005468 Ga0070707_100031393 Ga0070707_1000313932 430
629 3300005471 Ga0070698_100111171 Ga0070698_1001111712 430
630 3300005530 Ga0070679_100044336 Ga0070679_1000443362 430
631 3300005535 Ga0070684_100020377 Ga0070684_1000203773 430
632 3300005536 Ga0070697_100087221 Ga0070697_1000872212 430
633 3300005539 Ga0068853_100001036 Ga0068853_1000010364 430
634 3300005539 Ga0068853_100142979 Ga0068853_1001429792 430
635 3300005546 Ga0070696_100090501 Ga0070696_1000905012 430
636 3300005547 Ga0070693_100000355 Ga0070693_1000003557 430
637 3300005548 Ga0070665_100002349 Ga0070665_1000023497 430
638 3300005549 Ga0070704_100005685 Ga0070704_1000056858 430
639 3300005549 Ga0070704_100051353 Ga0070704_1000513533 430
640 3300005563 Ga0068855_100009797 Ga0068855_1000097978 430
641 3300005563 Ga0068855_100082958 Ga0068855_1000829581 430
642 3300005564 Ga0070664_100063715 Ga0070664_1000637152 430
643 3300005577 Ga0068857_100017944 Ga0068857_1000179445 430
644 3300005578 Ga0068854_100019777 Ga0068854_1000197772 430
645 3300005578 Ga0068854_100039035 Ga0068854_1000390352 430
646 3300005841 Ga0068863_100010280 Ga0068863_10001028010 430
647 3300005841 Ga0068863_100021142 Ga0068863_1000211425 430
648 3300005841 Ga0068863_100095539 Ga0068863_1000955392 430
649 3300005844 Ga0068862_100124290 Ga0068862_1001242902 430
650 3300006038 Ga0075365_10000122 Ga0075365_100001226 430
651 3300006048 Ga0075363_100001163 Ga0075363_1000011635 430
652 3300006051 Ga0075364_10000562 Ga0075364_1000056215 430
653 3300006173 Ga0070716_100001077 Ga0070716_1000010773 430
654 3300006178 Ga0075367_10001536 Ga0075367_100015369 430
655 3300006186 Ga0075369_10000212 Ga0075369_100002127 430
656 3300006353 Ga0075370_10032942 Ga0075370_100329422 430
657 3300006871 Ga0075434_100105823 Ga0075434_1001058232 430
658 3300006880 Ga0075429_100024442 Ga0075429_1000244424 430
659 3300009098 Ga0105245_10266813 Ga0105245_102668132 430
660 3300009177 Ga0105248_10000246 Ga0105248_1000024649 430
661 3300009545 Ga0105237_10000231 Ga0105237_100002314 430
662 3300009545 Ga0105237_10059158 Ga0105237_100591582 430
663 3300009551 Ga0105238_10035805 Ga0105238_100358052 430
664 3300009553 Ga0105249_10005115 Ga0105249_100051155 430
665 3300010375 Ga0105239_10005689 Ga0105239_100056895 430
666 3300013296 Ga0157374_10014292 Ga0157374_100142924 430
667 3300013297 Ga0157378_10022130 Ga0157378_100221302 430
668 3300013297 Ga0157378_10045867 Ga0157378_100458673 430
669 3300013297 Ga0157378_10046570 Ga0157378_100465702 430
670 3300013297 Ga0157378_10133048 Ga0157378_101330481 430
671 3300013306 Ga0163162_10374648 Ga0163162_103746482 430
672 3300013307 Ga0157372_10004213 Ga0157372_100042134 430
673 3300013308 Ga0157375_10109230 Ga0157375_101092302 430
674 3300014325 Ga0163163_10168564 Ga0163163_101685642 430
675 3300014326 Ga0157380_10281250 Ga0157380_102812501 430
676 3300014969 Ga0157376_10013527 Ga0157376_100135273 430
677 3300015261 Ga0182006_1007044 Ga0182006_10070446 430
678 3300015262 Ga0182007_10000127 Ga0182007_1000012712 430
679 3300015265 Ga0182005_1000168 Ga0182005_10001687 430
680 3300025912 Ga0207707_10012870 Ga0207707_100128703 430
681 3300025912 Ga0207707_10048090 Ga0207707_100480902 430
682 3300025913 Ga0207695_10207552 Ga0207695_102075522 430
683 3300025914 Ga0207671_10008456 Ga0207671_100084565 430
684 3300025915 Ga0207693_10002740 Ga0207693_100027404 430
685 3300025915 Ga0207693_10020534 Ga0207693_100205343 430
686 3300025917 Ga0207660_10033993 Ga0207660_100339932 430
687 3300025919 Ga0207657_10017013 Ga0207657_100170133 430
688 3300025919 Ga0207657_10051076 Ga0207657_100510762 430
689 3300025921 Ga0207652_10215803 Ga0207652_102158031 430
690 3300025922 Ga0207646_10105596 Ga0207646_101055962 430
691 3300025922 Ga0207646_10176713 Ga0207646_101767132 430
692 3300025923 Ga0207681_10008178 Ga0207681_100081781 430
693 3300025928 Ga0207700_10003571 Ga0207700_100035717 430
694 3300025929 Ga0207664_10000325 Ga0207664_100003252 430
695 3300025931 Ga0207644_10002823 Ga0207644_100028237 430
696 3300025933 Ga0207706_10108387 Ga0207706_101083872 430
697 3300025934 Ga0207686_10012082 Ga0207686_100120822 430
698 3300025937 Ga0207669_10031724 Ga0207669_100317242 430
699 3300025937 Ga0207669_10168456 Ga0207669_101684561 430
700 3300025939 Ga0207665_10003114 Ga0207665_100031143 430
701 3300025941 Ga0207711_10003291 Ga0207711_1000329111 430
702 3300025949 Ga0207667_10055847 Ga0207667_100558473 430
703 3300025961 Ga0207712_10000314 Ga0207712_1000031423 430
704 3300025981 Ga0207640_10007253 Ga0207640_100072532 430
705 3300025986 Ga0207658_10000013 Ga0207658_10000013144 430
706 3300026023 Ga0207677_10000390 Ga0207677_100003909 430
707 3300026035 Ga0207703_10009021 Ga0207703_100090213 430
708 3300026041 Ga0207639_10000791 Ga0207639_1000079121 430
709 3300026041 Ga0207639_10006184 Ga0207639_100061843 430
710 3300026067 Ga0207678_10000306 Ga0207678_100003067 430
711 3300026067 Ga0207678_10007277 Ga0207678_100072778 430
712 3300026067 Ga0207678_10092442 Ga0207678_100924423 430
713 3300026088 Ga0207641_10010582 Ga0207641_100105823 430
714 3300026088 Ga0207641_10039494 Ga0207641_100394943 430
715 3300026088 Ga0207641_10079119 Ga0207641_100791192 430
716 3300026116 Ga0207674_10005532 Ga0207674_100055329 430
717 3300026121 Ga0207683_10005776 Ga0207683_100057767 430
718 3300026121 Ga0207683_10006227 Ga0207683_100062278 430
719 3300027876 Ga0209974_10002636 Ga0209974_100026367 430
720 3300028379 Ga0268266_10012254 Ga0268266_100122546 430
721 3300028380 Ga0268265_10122229 Ga0268265_101222292 430
722 3300028666 Ga0265336_10000707 Ga0265336_1000070717 430
723 3300029957 Ga0265324_10000471 Ga0265324_1000047127 430
724 3300031241 Ga0265325_10001388 Ga0265325_100013883 430
725 3300031344 Ga0265316_10039994 Ga0265316_100399943 430
726 3300031665 Ga0316575_10009816 Ga0316575_100098163 430
727 3300031691 Ga0316579_10030649 Ga0316579_100306492 430
728 3300031728 Ga0316578_10035343 Ga0316578_100353433 430
729 3300031824 Ga0307413_10001956 Ga0307413_100019563 430
730 3300031852 Ga0307410_10000274 Ga0307410_1000027411 430
731 3300031901 Ga0307406_10018458 Ga0307406_100184583 430
732 3300031903 Ga0307407_10000538 Ga0307407_100005384 430
733 3300031995 Ga0307409_100050745 Ga0307409_1000507452 430
734 3300032002 Ga0307416_100045347 Ga0307416_1000453472 430
735 3300032004 Ga0307414_10009479 Ga0307414_100094792 430
736 3300032005 Ga0307411_10008785 Ga0307411_100087853 430
737 3300032126 Ga0307415_100101149 Ga0307415_1001011492 430
738 3300032137 Ga0316585_10023576 Ga0316585_100235762 430
739 3300032168 Ga0316593_10011167 Ga0316593_100111672 430
740 3300035089 Ga0373944_0018739 Ga0373944_0018739_199_1575 430
741 3300035170 Ga0373943_0019349 Ga0373943_0019349_1375_2751 430
742 3300035170 Ga0373943_0065665 Ga0373943_0065665_118_1446 430
743 3300035398 Ga0316574_0004943 Ga0316574_0004943_289_1656 430
744 3300035692 Ga0373935_0019092 Ga0373935_0019092_703_2079 430
745 3300035695 Ga0373927_0007760 Ga0373927_0007760_4571_5947 430
746 3300036401 Ga0373937_0010040 Ga0373937_0010040_2257_3585 430
747 3300036712 Ga0316584_0057397 Ga0316584_0057397_916_2283 430
748 3300037068 Ga0373925_0021018 Ga0373925_0021018_306_1682 430
749 3300037068 Ga0373925_0033900 Ga0373925_0033900_2049_3377 430
750 3300037418 Ga0395900_0007406 Ga0395900_0007406_2506_3828 430
751 3300042876 Ga0451577_0000002 Ga0451577_0000002_1309655_1310986 430
752 3300042876 Ga0451577_0000402 Ga0451577_0000402_44318_45652 430
753 3300042876 Ga0451577_0017088 Ga0451577_0017088_537_1871 430
754 3300042876 Ga0451577_0053334 Ga0451577_0053334_295_1665 430
755 3300044673 Ga0453683_0000011 Ga0453683_0000011_364174_365505 430
756 3300044673 Ga0453683_0113823 Ga0453683_0113823_297_1631 430
757 3300044712 Ga0453684_0000002 Ga0453684_0000002_420390_421721 430
758 3300044712 Ga0453684_0000065 Ga0453684_0000065_44318_45652 430
759 3300044712 Ga0453684_0001174 Ga0453684_0001174_35753_37087 430
760 3300045051 Ga0451576_0000004 Ga0451576_0000004_47030_48361 430
761 3300045051 Ga0451576_0001381 Ga0451576_0001381_35810_37144 430
762 3300045051 Ga0451576_0109027 Ga0451576_0109027_811_2181 430
763 3300046472 Ga0495580_0067725 Ga0495580_0067725_27_1403 430
764 3300046473 Ga0495582_0013485 Ga0495582_0013485_354_1730 430
765 3300046475 Ga0495639_0018316 Ga0495639_0018316_773_2149 430
766 3300046477 Ga0495664_0055171 Ga0495664_0055171_283_1659 430
767 3300046499 Ga0495594_0040143 Ga0495594_0040143_1072_2448 430
768 3300046525 Ga0495663_0000891 Ga0495663_0000891_4157_5530 430
769 3300046531 Ga0495665_0036691 Ga0495665_0036691_226_1602 430
770 3300046539 Ga0495621_0000016 Ga0495621_0000016_5292_6665 430
771 3300046663 Ga0495635_0061737 Ga0495635_0061737_279_1655 430
772 3300046675 Ga0495657_0137967 Ga0495657_0137967_23_1468 430
773 3300046681 Ga0495647_0017940 Ga0495647_0017940_1078_2454 430
774 3300046683 Ga0495658_0014018 Ga0495658_0014018_2485_3861 430
775 3300046689 Ga0495613_0024840 Ga0495613_0024840_2744_4120 430
776 3300047315 Ga0495581_0001860 Ga0495581_0001860_4567_5943 430
777 3300047319 Ga0495674_0072954 Ga0495674_0072954_813_2189 430
778 3300047322 Ga0495680_0014464 Ga0495680_0014464_3606_4982 430
779 3300047471 Ga0495684_0016945 Ga0495684_0016945_1005_2381 430
780 3300047673 Ga0495593_0026222 Ga0495593_0026222_901_2277 430
781 3300048903 Ga0496100_0099654 Ga0496100_0099654_236_1582 430
782 3300048904 Ga0496101_0071353 Ga0496101_0071353_1005_2351 430
783 3300048905 Ga0496102_0041999 Ga0496102_0041999_1827_3224 430
784 3300048911 Ga0496108_0014932 Ga0496108_0014932_2370_3716 430
785 3300048913 Ga0496110_0012614 Ga0496110_0012614_1440_2786 430
786 3300048918 Ga0496115_0007091 Ga0496115_0007091_30_1403 430
787 3300048920 Ga0496117_0028830 Ga0496117_0028830_1608_2954 430
788 3300048921 Ga0496118_0001486 Ga0496118_0001486_23240_24586 430
789 3300048924 Ga0496121_0045105 Ga0496121_0045105_446_1792 430
790 3300048925 Ga0496122_0000062 Ga0496122_0000062_192743_194086 430
791 3300048926 Ga0496123_0010330 Ga0496123_0010330_492_1835 430
792 3300048929 Ga0496126_0017269 Ga0496126_0017269_5604_6947 430
793 3300049572 Ga0501036_0117894 Ga0501036_0117894_630_1988 430
794 3300049574 Ga0501038_0004369 Ga0501038_0004369_6651_7979 430
795 3300049574 Ga0501038_0107633 Ga0501038_0107633_403_1761 430
796 3300049575 Ga0501039_0021369 Ga0501039_0021369_2824_4182 430
797 3300049576 Ga0501040_0023276 Ga0501040_0023276_1992_3350 430
798 3300049577 Ga0501041_0004904 Ga0501041_0004904_5324_6682 430
799 3300049586 Ga0501070_0075477 Ga0501070_0075477_1405_2736 430
800 3300049587 Ga0501071_0029929 Ga0501071_0029929_1706_3064 430
801 3300049590 Ga0501074_0016754 Ga0501074_0016754_836_2194 430
802 3300049592 Ga0501076_0018908 Ga0501076_0018908_420_1778 430
803 3300049742 Ga0501080_0013617 Ga0501080_0013617_957_2315 430
804 3300049742 Ga0501080_0025658 Ga0501080_0025658_541_1872 430
805 3300049743 Ga0501081_0046535 Ga0501081_0046535_826_2184 430
806 3300049776 Ga0501280_002654 Ga0501280_002654_1426_2775 430
807 3300049824 Ga0501045_0004429 Ga0501045_0004429_5457_6815 430
808 3300050489 nmdc:mga03683_3263_c1 nmdc:mga03683_3263_c1_3139_4467 430
809 3300050490 nmdc:mga03n38_609_c1 nmdc:mga03n38_609_c1_5895_7223 430
810 3300050491 nmdc:mga00v17_158_c1 nmdc:mga00v17_158_c1_5886_7214 430
811 3300050491 nmdc:mga00v17_1845_c1 nmdc:mga00v17_1845_c1_5921_7249 430
812 3300050492 nmdc:mga0yw44_187_c1 nmdc:mga0yw44_187_c1_4179_5507 430
813 3300050493 nmdc:mga0k408_40587_c1 nmdc:mga0k408_40587_c1_50_1378 430
814 3300050494 nmdc:mga06z11_622_c1 nmdc:mga06z11_622_c1_7514_8842 430
815 3300050494 nmdc:mga06z11_879_c1 nmdc:mga06z11_879_c1_5601_6929 430
816 3300050496 nmdc:mga07m45_456_c1 nmdc:mga07m45_456_c1_5203_6531 430
817 3300050508 nmdc:mga09592_40987_c1 nmdc:mga09592_40987_c1_1752_3080 430
818 3300050516 nmdc:mga0sz30_369_c2 nmdc:mga0sz30_369_c2_4467_5795 430
819 3300053078 Ga0495612_0047257 Ga0495612_0047257_170_1498 430
820 3300053084 Ga0495595_0049803 Ga0495595_0049803_405_1781 430
821 3300053093 Ga0500651_0000636 Ga0500651_0000636_813_2204 430
822 3300060353 Ga0501082_0028682 Ga0501082_0028682_686_2044 430
823 3300061734 Ga0530510_0004913 Ga0530510_0004913_2509_3867 430
824 iso_pu_bacteria 8034962539 8034966989 430
825 3300005327 Ga0070658_10038645 Ga0070658_100386451 431
826 3300005340 Ga0070689_100041828 Ga0070689_1000418282 431
827 3300005355 Ga0070671_100022375 Ga0070671_1000223753 431
828 3300005518 Ga0070699_100147439 Ga0070699_1001474392 431
829 3300005563 Ga0068855_100008633 Ga0068855_1000086339 431
830 3300005563 Ga0068855_100023835 Ga0068855_1000238352 431
831 3300005564 Ga0070664_100208628 Ga0070664_1002086281 431
832 3300005842 Ga0068858_100007459 Ga0068858_1000074592 431
833 3300006051 Ga0075364_10000213 Ga0075364_1000021327 431
834 3300006358 Ga0068871_100027588 Ga0068871_1000275884 431
835 3300009093 Ga0105240_10073166 Ga0105240_100731663 431
836 3300009098 Ga0105245_10051378 Ga0105245_100513782 431
837 3300009551 Ga0105238_10043127 Ga0105238_100431273 431
838 3300013307 Ga0157372_10015001 Ga0157372_100150017 431
839 3300025913 Ga0207695_10011988 Ga0207695_100119885 431
840 3300025924 Ga0207694_10026021 Ga0207694_100260212 431
841 3300025931 Ga0207644_10003679 Ga0207644_100036795 431
842 3300025931 Ga0207644_10071271 Ga0207644_100712712 431
843 3300025934 Ga0207686_10109420 Ga0207686_101094202 431
844 3300025941 Ga0207711_10064392 Ga0207711_100643922 431
845 3300025944 Ga0207661_10166349 Ga0207661_101663491 431
846 3300025949 Ga0207667_10187414 Ga0207667_101874142 431
847 3300026035 Ga0207703_10002767 Ga0207703_100027676 431
848 3300026078 Ga0207702_10101256 Ga0207702_101012561 431
849 3300026095 Ga0207676_10169815 Ga0207676_101698152 431
850 3300026142 Ga0207698_10013985 Ga0207698_100139851 431
851 3300031507 Ga0307509_10001479 Ga0307509_100014796 431
852 3300035085 Ga0373929_0011927 Ga0373929_0011927_233_1606 431
853 3300035172 Ga0373955_0007379 Ga0373955_0007379_3657_5009 431
854 3300036401 Ga0373937_0012434 Ga0373937_0012434_999_2351 431
855 3300037853 Ga0436364_0432166 Ga0436364_0432166_499_1932 431
856 3300046462 Ga0495651_0055429 Ga0495651_0055429_1636_2988 431
857 3300046507 Ga0495606_0007681 Ga0495606_0007681_7724_9049 431
858 3300046516 Ga0495628_0027455 Ga0495628_0027455_1273_2625 431
859 3300046529 Ga0495652_0117524 Ga0495652_0117524_566_1918 431
860 3300046543 Ga0495645_0000567 Ga0495645_0000567_16960_18312 431
861 3300046559 Ga0495667_0042455 Ga0495667_0042455_848_2200 431
862 3300046665 Ga0495661_0000093 Ga0495661_0000093_33662_34987 431
863 3300046809 Ga0495600_0038582 Ga0495600_0038582_1635_2987 431
864 3300050491 nmdc:mga00v17_121_c1 nmdc:mga00v17_121_c1_25317_26651 431
865 3300053077 Ga0495601_0022354 Ga0495601_0022354_972_2324 431
866 3300005563 Ga0068855_100039911 Ga0068855_1000399113 432
867 3300005578 Ga0068854_100124579 Ga0068854_1001245792 432
868 3300005983 Ga0081540_1004336 Ga0081540_100433611 432
869 3300014969 Ga0157376_10003114 Ga0157376_100031149 432
870 3300025981 Ga0207640_10069786 Ga0207640_100697862 432
871 3300028573 Ga0265334_10000005 Ga0265334_10000005161 432
872 3300031239 Ga0265328_10024962 Ga0265328_100249622 432
873 3300031251 Ga0265327_10000103 Ga0265327_10000103132 432
874 3300031548 Ga0307408_100117636 Ga0307408_1001176362 432
875 3300031595 Ga0265313_10000014 Ga0265313_1000001495 432
876 3300032004 Ga0307414_10010491 Ga0307414_100104915 432
877 3300035398 Ga0316574_0143764 Ga0316574_0143764_55_1395 432
878 3300035724 Ga0373933_0147562 Ga0373933_0147562_18_1349 432
879 3300039110 Ga0400487_46050 Ga0400487_46050_800_2158 432
880 3300042000 Ga0439437_000550 Ga0439437_000550_2226_3554 432
881 3300042115 Ga0450911_000012 Ga0450911_000012_2372_3700 432
882 3300042876 Ga0451577_0073138 Ga0451577_0073138_1556_2983 432
883 3300046530 Ga0495654_0001417 Ga0495654_0001417_6750_8078 432
884 3300046692 Ga0495671_0002983 Ga0495671_0002983_7266_8594 432
885 3300047320 Ga0495672_0004693 Ga0495672_0004693_4161_5489 432
886 3300049581 Ga0501047_0017694 Ga0501047_0017694_2839_4188 432
887 3300049584 Ga0501068_0047424 Ga0501068_0047424_861_2210 432
888 3300049585 Ga0501069_0029361 Ga0501069_0029361_245_1594 432
889 3300049586 Ga0501070_0026718 Ga0501070_0026718_1734_3083 432
890 3300049589 Ga0501073_0015610 Ga0501073_0015610_1306_2655 432
891 3300049590 Ga0501074_0008184 Ga0501074_0008184_390_1739 432
892 3300049741 Ga0501079_0051902 Ga0501079_0051902_1433_2782 432
893 3300049742 Ga0501080_0069238 Ga0501080_0069238_1649_2998 432
894 3300049744 Ga0501083_0008802 Ga0501083_0008802_2932_4281 432
895 3300050512 nmdc:mga0n895_338503_c1 nmdc:mga0n895_338503_c1_17_1351 432
896 3300005435 Ga0070714_100000332 Ga0070714_10000033226 433
897 3300005436 Ga0070713_100024900 Ga0070713_1000249003 433
898 3300025928 Ga0207700_10020142 Ga0207700_100201423 433
899 3300025929 Ga0207664_10003311 Ga0207664_100033117 433
900 3300032004 Ga0307414_10264785 Ga0307414_102647851 433
901 3300035118 Ga0373954_0023593 Ga0373954_0023593_746_2101 433
902 3300035724 Ga0373933_0021324 Ga0373933_0021324_342_1697 433
903 3300042876 Ga0451577_0021269 Ga0451577_0021269_50_1456 433
904 3300045051 Ga0451576_0000131 Ga0451576_0000131_40069_41442 433
905 3300047318 Ga0495636_0005078 Ga0495636_0005078_1852_3219 433
906 3300049571 Ga0501034_0054294 Ga0501034_0054294_677_2017 433
907 3300049586 Ga0501070_0142883 Ga0501070_0142883_234_1604 433
908 3300049744 Ga0501083_0085102 Ga0501083_0085102_535_1905 433
909 iso_pu_bacteria 2643221573 2643881520 433
910 iso_pu_bacteria 2643221720 2644662656 433
911 iso_pu_bacteria 2643221728 2644698390 433
912 iso_pu_bacteria 2894414249 2894414537 433
913 3300005439 Ga0070711_100163499 Ga0070711_1001634991 434
914 3300005616 Ga0068852_100232838 Ga0068852_1002328382 434
915 3300009011 Ga0105251_10025919 Ga0105251_100259192 434
916 3300025920 Ga0207649_10067791 Ga0207649_100677912 434
917 3300026041 Ga0207639_10001337 Ga0207639_1000133712 434
918 3300026116 Ga0207674_10131797 Ga0207674_101317973 434
919 3300028800 Ga0265338_10059795 Ga0265338_100597952 434
920 3300031250 Ga0265331_10003541 Ga0265331_100035419 434
921 3300031251 Ga0265327_10000218 Ga0265327_1000021893 434
922 3300031548 Ga0307408_100000013 Ga0307408_100000013245 434
923 3300031711 Ga0265314_10001405 Ga0265314_1000140525 434
924 3300039450 Ga0436363_1709594 Ga0436363_1709594_103_1446 434
925 3300044712 Ga0453684_0000136 Ga0453684_0000136_145959_147341 434
926 3300045051 Ga0451576_0000025 Ga0451576_0000025_280550_281932 434
927 3300003771 Ga0055526_1000008 Ga0055526_1000008102 435
928 3300003773 Ga0055537_1000343 Ga0055537_10003434 435
929 3300003775 Ga0055524_1001290 Ga0055524_100129010 435
930 3300003781 Ga0055536_1005503 Ga0055536_10055035 435
931 3300003784 Ga0055534_1000003 Ga0055534_1000003150 435
932 3300003790 Ga0055528_1000019 Ga0055528_100001997 435
933 3300003794 Ga0055531_10007124 Ga0055531_100071245 435
934 3300005327 Ga0070658_10015935 Ga0070658_100159355 435
935 3300025263 Ga0209565_1000001 Ga0209565_10000011300 435
936 3300025273 Ga0209673_1000001 Ga0209673_10000011300 435
937 3300025284 Ga0209130_1003922 Ga0209130_10039222 435
938 3300025291 Ga0209675_1000001 Ga0209675_10000011233 435
939 3300025292 Ga0209676_1001090 Ga0209676_100109027 435
940 3300025295 Ga0209564_1000001 Ga0209564_10000011395 435
941 3300025299 Ga0209256_1000002 Ga0209256_1000002158 435
942 3300025299 Ga0209256_1004733 Ga0209256_10047336 435
943 3300025304 Ga0209257_1002586 Ga0209257_100258617 435
944 3300025949 Ga0207667_10144569 Ga0207667_101445692 435
945 3300031344 Ga0265316_10018527 Ga0265316_100185275 435
946 iso_pu_bacteria 2571042365 2572255408 435
947 iso_pu_bacteria 2765235840 2765578442 435
948 iso_pu_bacteria 2816332141 2816516459 435
949 iso_pu_bacteria 2961064222 2961067169 435
950 3300003794 Ga0055531_10001707 Ga0055531_1000170711 436
951 3300015689 Ga0183360_10001 Ga0183360_100012567 436
952 3300025304 Ga0209257_1000664 Ga0209257_100066411 436
953 3300046539 Ga0495621_0003268 Ga0495621_0003268_1234_2649 436
954 iso_pu_bacteria 2919513703 2919516898 436
955 3300003771 Ga0055526_1013160 Ga0055526_10131604 437
956 3300003791 Ga0055530_10002228 Ga0055530_100022286 437
957 3300005331 Ga0070670_100000002 Ga0070670_100000002435 437
958 3300005335 Ga0070666_10007365 Ga0070666_100073657 437
959 3300005353 Ga0070669_100004277 Ga0070669_1000042772 437
960 3300005355 Ga0070671_100000022 Ga0070671_10000002297 437
961 3300005367 Ga0070667_100000007 Ga0070667_10000000766 437
962 3300005466 Ga0070685_10000148 Ga0070685_1000014820 437
963 3300005548 Ga0070665_100024535 Ga0070665_1000245353 437
964 3300005618 Ga0068864_100000003 Ga0068864_100000003448 437
965 3300005842 Ga0068858_100027261 Ga0068858_1000272615 437
966 3300005843 Ga0068860_100001638 Ga0068860_10000163812 437
967 3300005844 Ga0068862_100009412 Ga0068862_1000094127 437
968 3300009101 Ga0105247_10017181 Ga0105247_100171812 437
969 3300009177 Ga0105248_10315134 Ga0105248_103151341 437
970 3300014325 Ga0163163_10000835 Ga0163163_1000083515 437
971 3300025284 Ga0209130_1017144 Ga0209130_10171441 437
972 3300025298 Ga0209050_1002761 Ga0209050_100276110 437
973 3300025299 Ga0209256_1002692 Ga0209256_100269212 437
974 3300025304 Ga0209257_1007820 Ga0209257_10078205 437
975 3300025903 Ga0207680_10036342 Ga0207680_100363422 437
976 3300025923 Ga0207681_10003243 Ga0207681_100032439 437
977 3300025925 Ga0207650_10000003 Ga0207650_10000003985 437
978 3300025931 Ga0207644_10000037 Ga0207644_1000003723 437
979 3300025941 Ga0207711_10000782 Ga0207711_100007822 437
980 3300025986 Ga0207658_10000004 Ga0207658_10000004432 437
981 3300026035 Ga0207703_10016031 Ga0207703_100160317 437
982 3300026088 Ga0207641_10130049 Ga0207641_101300492 437
983 3300026095 Ga0207676_10000003 Ga0207676_10000003110 437
984 3300028380 Ga0268265_10000435 Ga0268265_1000043533 437
985 3300038705 Ga0237819_00915 Ga0237819_00915_7259_8701 437
986 3300053087 Ga0500643_013356 Ga0500643_013356_763_2145 437
987 iso_pu_bacteria 8002869464 8002869610 437
988 iso_pu_bacteria 8003014200 8003016643 437
989 3300002773 JGI25152J39213_1000074 JGI25152J39213_100007432 438
990 3300002774 JGI25150J39212_1000056 JGI25150J39212_100005632 438
991 3300003187 JGI25151J46595_10000178 JGI25151J46595_1000017829 438
992 3300003215 JGI25153J46596_10000131 JGI25153J46596_1000013144 438
993 3300025245 Ga0207425_1000108 Ga0207425_100010831 438
994 3300025258 Ga0209129_1000178 Ga0209129_100017843 438
995 3300025294 Ga0209025_1000012 Ga0209025_100001277 438
996 3300025294 Ga0209025_1003190 Ga0209025_100319011 438
997 3300025297 Ga0209758_1000018 Ga0209758_1000018581 438
998 iso_pu_bacteria 2576861471 2578458922 438
999 iso_pu_bacteria 2857442823 2857446762 438
1000 iso_pu_bacteria 2919675420 2919675534 438
1001 iso_pu_bacteria 2923516293 2923517634 438
1002 iso_pu_bacteria 2939589442 2939590568 438
1003 iso_pu_bacteria 2939622612 2939622736 438
1004 iso_pu_bacteria 2974307012 2974309385 438
1005 iso_pu_bacteria 2977247770 2977250105 438
1006 iso_pu_bacteria 2984514374 2984515405 438
1007 3300003187 JGI25151J46595_10000430 JGI25151J46595_100004304 439
1008 3300003781 Ga0055536_1006485 Ga0055536_10064851 439
1009 3300003856 Ga0058692_1000002 Ga0058692_1000002265 439
1010 3300013102 Ga0157371_10014829 Ga0157371_100148294 439
1011 3300025245 Ga0207425_1004437 Ga0207425_10044372 439
1012 3300025292 Ga0209676_1000047 Ga0209676_1000047240 439
1013 3300025292 Ga0209676_1007037 Ga0209676_10070372 439
1014 3300025292 Ga0209676_1010731 Ga0209676_10107311 439
1015 3300025294 Ga0209025_1000102 Ga0209025_100010276 439
1016 3300025297 Ga0209758_1021599 Ga0209758_10215992 439
1017 3300025299 Ga0209256_1002605 Ga0209256_100260513 439
1018 3300025304 Ga0209257_1000274 Ga0209257_1000274111 439
1019 3300025304 Ga0209257_1001912 Ga0209257_100191215 439
1020 3300025935 Ga0207709_10000930 Ga0207709_1000093014 439
1021 3300027312 Ga0209371_1000004 Ga0209371_1000004473 439
1022 3300030500 Ga0268256_1000005 Ga0268256_1000005573 439
1023 3300032004 Ga0307414_10044868 Ga0307414_100448681 439
1024 3300037471 Ga0395905_0003749 Ga0395905_0003749_9125_10534 439
1025 3300037471 Ga0395905_0027570 Ga0395905_0027570_1820_3229 439
1026 3300038443 Ga0395901_0012006 Ga0395901_0012006_5638_7047 439
1027 3300038705 Ga0237819_03199 Ga0237819_03199_1345_2760 439
1028 3300042004 Ga0439445_0007253 Ga0439445_0007253_1094_2506 439
1029 3300046524 Ga0495648_0010210 Ga0495648_0010210_3998_5362 439
1030 3300049571 Ga0501034_0000571 Ga0501034_0000571_6863_8287 439
1031 3300037471 Ga0395905_0044927 Ga0395905_0044927_2084_3481 440
1032 3300046460 Ga0495638_0001128 Ga0495638_0001128_5510_6967 440
1033 3300046525 Ga0495663_0000429 Ga0495663_0000429_11444_12901 440
1034 3300003771 Ga0055526_1001472 Ga0055526_100147216 442
1035 3300003773 Ga0055537_1000713 Ga0055537_10007134 442
1036 3300003781 Ga0055536_1006496 Ga0055536_10064965 442
1037 3300003784 Ga0055534_1000717 Ga0055534_100071716 442
1038 3300003790 Ga0055528_1003920 Ga0055528_10039204 442
1039 3300003791 Ga0055530_10003987 Ga0055530_100039872 442
1040 3300013102 Ga0157371_10000429 Ga0157371_100004295 442
1041 3300014497 Ga0182008_10000269 Ga0182008_1000026920 442
1042 3300025263 Ga0209565_1000014 Ga0209565_1000014291 442
1043 3300025273 Ga0209673_1000570 Ga0209673_100057014 442
1044 3300025291 Ga0209675_1000021 Ga0209675_1000021197 442
1045 3300025292 Ga0209676_1000027 Ga0209676_1000027118 442
1046 3300025292 Ga0209676_1000079 Ga0209676_100007965 442
1047 3300025295 Ga0209564_1000263 Ga0209564_100026324 442
1048 3300025298 Ga0209050_1000153 Ga0209050_1000153102 442
1049 3300025298 Ga0209050_1000311 Ga0209050_100031164 442
1050 3300025303 Ga0209051_1006455 Ga0209051_10064554 442
1051 3300025304 Ga0209257_1000081 Ga0209257_100008175 442
1052 3300030742 Ga0316183_1012956 Ga0316183_10129562 442
1053 3300041413 Ga0439465_0008504 Ga0439465_0008504_958_2394 442
1054 3300048920 Ga0496117_0001343 Ga0496117_0001343_26166_27623 442
1055 3300048921 Ga0496118_0000145 Ga0496118_0000145_36228_37685 442
1056 3300048923 Ga0496120_0000525 Ga0496120_0000525_15286_16749 442
1057 3300048925 Ga0496122_0023731 Ga0496122_0023731_305_1762 442
1058 3300048926 Ga0496123_0017728 Ga0496123_0017728_34_1491 442
1059 3300048927 Ga0496124_0000255 Ga0496124_0000255_62049_63497 442
1060 3300048927 Ga0496124_0071694 Ga0496124_0071694_1307_2764 442
1061 3300048928 Ga0496125_0013402 Ga0496125_0013402_5847_7304 442
1062 3300049571 Ga0501034_0000273 Ga0501034_0000273_38403_39839 442
1063 3300053161 Ga0500634_0000070 Ga0500634_0000070_5626_7074 442
1064 3300025292 Ga0209676_1007436 Ga0209676_10074362 444
1065 3300025304 Ga0209257_1009194 Ga0209257_10091945 444
1066 3300025728 Ga0207655_1033072 Ga0207655_10330723 444
1067 3300003775 Ga0055524_1008350 Ga0055524_10083502 446
1068 3300003781 Ga0055536_1003090 Ga0055536_10030902 446
1069 3300003791 Ga0055530_10002049 Ga0055530_100020492 446
1070 3300003794 Ga0055531_10004113 Ga0055531_100041132 446
1071 3300047320 Ga0495672_0000134 Ga0495672_0000134_44065_45576 446
1072 3300048921 Ga0496118_0004832 Ga0496118_0004832_5904_7415 446
1073 3300048927 Ga0496124_0013804 Ga0496124_0013804_4768_6279 446
1074 3300003791 Ga0055530_10000036 Ga0055530_10000036106 448
1075 3300003792 Ga0055540_1000072 Ga0055540_1000072106 448
1076 3300025298 Ga0209050_1000080 Ga0209050_1000080140 448
1077 3300025303 Ga0209051_1000082 Ga0209051_100008271 448
1078 3300002737 JGI25162J39368_1000136 JGI25162J39368_100013661 450
1079 3300002772 JGI25164J39214_1000260 JGI25164J39214_100026014 450
1080 3300003214 JGI25165J46597_1000222 JGI25165J46597_100022262 450
1081 3300025207 Ga0209760_100058 Ga0209760_10005883 450
1082 3300025231 Ga0207427_100063 Ga0207427_10006362 450
1083 3300025233 Ga0209437_100133 Ga0209437_100133122 450
1084 3300025261 Ga0209233_1000133 Ga0209233_1000133150 450

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

212

386

0.97

PF00919

UPF0004

Uncharacterized protein family UPF0004

65

165

0.96

PF01938

TRAM

TRAM domain

439

501

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9139 19 447
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.906 19 449
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.8862 19 447
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.8795 19 449
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.8598 162 447
ID Description Score Start End Superfamily
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9977 19 145 3.40.50.12160
af_P0AEI1_378_440_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9971 384 447 2.40.50.140
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.99 19 145 3.40.50.12160
af_P0AEI1_378_440_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9815 384 447 2.40.50.140
af_Q2FZ02_442_504_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9668 385 447 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2E2N0H9-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9952 17 137 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2M7XLY8-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9946 276 375 GO:0005829
GO:0035597
GO:0051539
AF-A0A6I5RNI4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9932 17 196 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2N5ABG4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9921 17 116 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2R7PI60-F1-model_v4 deleted 0.9902 17 122

Feature Viewer

pLDDT pTM Quality
88.41 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map