F489577

General Info

Members Datasets Scaffolds Average Seq Length
1076 486 1017 327

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10034778|Ga0070676_100347783
Length 327
Sequence MSADVTSFGKVAVLMGGTSAERQISIMSGTGVLAALRSQGVDAHAFDPAERELVELKREGFARCFIALHGRHGEDGSVQGALELLGIPYTGSGVLASAIAMDKVMTKRVWIAEGLPTPRYQWLSPEQRRAENLREHLRAVPDALGLPLIVKPPREGSSIGITKVAGYSDMQAAVELAAKYDADVLCEEFIDGDEVTCPVLGEGEQAQALPVIRIVAPEGAYDYQNKYFTDDVKYQCPSGLPEAEEREIQRIVVQAYRTLGCRGWGRADLMIRASDRKPFLLEMNTSPGMTTHSLVPMSAKAAGLSYEALCVQILGAAALDAPALATP

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
15 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
16 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221652 Acidovorax sp. Root402 Isolate Unclassified
19 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221660 Methylibium sp. Root1272 Isolate Unclassified
22 2643221672 Variovorax sp. Root434 Isolate Unclassified
23 2643221683 Variovorax sp. Root473 Isolate Unclassified
24 2643221717 Acidovorax sp. Root267 Isolate Unclassified
25 2738541277 Variovorax sp. GV051 Isolate Unclassified
26 2738541307 Variovorax sp. GV008 Isolate Unclassified
27 2738543013 Variovorax sp. BT01 Isolate Unclassified
28 2738543019 Variovorax sp. GV040 Isolate Unclassified
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2818991446 Variovorax sp. 1180 Isolate Unclassified
31 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
32 2831864461 Roseateles noduli HZ7 Isolate Nodule
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2842677519 Variovorax sp. R-72495 Isolate Unclassified
35 2842733646 Variovorax sp. R-72446 Isolate Unclassified
36 2842747753 Variovorax sp. R-72060 Isolate Unclassified
37 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
38 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
39 2885198086 Variovorax sp. 679 Isolate Unclassified
40 2885211737 Variovorax sp. 553 Isolate Unclassified
41 2899924645 Variovorax sp. 369 Isolate Unclassified
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
45 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
54 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
55 2929520902 Variovorax beijingensis 502 Isolate Unclassified
56 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
57 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
62 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
63 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
66 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
77 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
78 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
79 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
80 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
81 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
82 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
99 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
100 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
101 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
102 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
103 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
104 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
105 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
106 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
113 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
129 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
132 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
133 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
134 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
138 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
139 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
140 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
141 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
142 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
143 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
144 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
145 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
146 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
174 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
187 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
188 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
189 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
190 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
191 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
192 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
193 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
194 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
195 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
196 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
206 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
207 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
208 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
211 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
279 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
282 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
284 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
288 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
289 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
290 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
291 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
292 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
293 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
294 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
295 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
296 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
297 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
298 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
299 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
300 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
301 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
302 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
305 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
308 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
309 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
314 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
315 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
316 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
317 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
318 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
319 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
320 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
323 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
324 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
334 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
335 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
336 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
337 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
338 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
339 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
340 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
341 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
342 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
343 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
344 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
345 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
346 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
347 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
348 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
349 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
350 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
351 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
352 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
353 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
354 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
355 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
356 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
357 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
358 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
359 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
364 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
365 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
366 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
367 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
368 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
369 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
370 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
373 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
374 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
375 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
376 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
377 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
378 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
388 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
389 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
390 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
391 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
394 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
401 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
414 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
415 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
416 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
419 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
439 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
449 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
450 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
451 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
453 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
454 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
459 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
462 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
463 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
464 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
465 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
466 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
467 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
468 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
469 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
470 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
471 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
472 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
473 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
474 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
475 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
476 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
477 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
478 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
479 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
482 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
483 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
484 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
485 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
486 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 0.46
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.89
Nodule 0.74
Rhizoplane 2.88
Rhizosphere 64.96
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002227 3300001979 Bacteria 8855
2 JGI25156J39149_1001782 3300002705 Bacteria 8509
3 JGI25156J39149_1007524 3300002705 Bacteria 2846
4 JGI25162J39368_1000063 3300002737 Bacteria 134747
5 JGI25154J39366_1001302 3300002738 Bacteria 9272
6 JGI25154J39366_1004037 3300002738 Bacteria 2783
7 JGI25157J39369_1000148 3300002741 Bacteria 58782
8 JGI25163J39215_1001308 3300002771 Bacteria 4398
9 JGI25164J39214_1004328 3300002772 Bacteria 1652
10 JGI25152J39213_1010277 3300002773 Bacteria 2156
11 JGI25150J39212_1006072 3300002774 Bacteria 2526
12 JGI25165J46597_1000069 3300003214 Bacteria 195460
13 JGI25153J46596_10003671 3300003215 Bacteria 8496
14 JGI25153J46596_10004835 3300003215 Bacteria 7177
15 rootH1_10010206 3300003316 Bacteria 1833
16 rootH1_10015203 3300003316 Bacteria 4095
17 rootL2_10000966 3300003322 Bacteria 57184
18 rootH1_10000830 3300003323 Bacteria 4608
19 rootH1_10114267 3300003323 Bacteria 1418
20 Ga0007409J51694_1045597 3300003575 Bacteria 1557
21 Ga0006562J51391_1013325 3300003578 Bacteria 17825
22 Ga0006562J51391_1013332 3300003578 Bacteria 3530
23 Ga0006562J51391_1029542 3300003578 Bacteria 12747
24 Ga0006562J51391_1029546 3300003578 Bacteria 2420
25 Ga0055538_1000034 3300003751 Bacteria 195460
26 Ga0055539_1000044 3300003752 Bacteria 195460
27 Ga0055539_1000763 3300003752 Bacteria 7795
28 Ga0055539_1002964 3300003752 Bacteria 2454
29 Ga0055533_1000016 3300003756 Bacteria 396179
30 Ga0055533_1000055 3300003756 Bacteria 195460
31 Ga0055525_1000066 3300003759 Bacteria 195460
32 Ga0055525_1001386 3300003759 Bacteria 4586
33 Ga0055535_1000934 3300003761 Bacteria 19510
34 Ga0055535_1002036 3300003761 Bacteria 8207
35 Ga0055542_1000051 3300003762 Bacteria 175242
36 Ga0055529_1000333 3300003763 Bacteria 52783
37 Ga0055526_1000826 3300003771 Bacteria 23122
38 Ga0055526_1001991 3300003771 Bacteria 14078
39 Ga0055524_1000052 3300003775 Bacteria 144959
40 Ga0055536_1012919 3300003781 Bacteria 3055
41 Ga0055536_1018427 3300003781 Bacteria 2238
42 Ga0055534_1001847 3300003784 Bacteria 7905
43 Ga0055534_1002526 3300003784 Bacteria 6276
44 Ga0055534_1005182 3300003784 Bacteria 3566
45 Ga0055528_1013683 3300003790 Bacteria 3057
46 Ga0055528_1022218 3300003790 Bacteria 1982
47 Ga0055530_10006857 3300003791 Bacteria 4941
48 Ga0055530_10008783 3300003791 Bacteria 3989
49 Ga0055530_10015568 3300003791 Bacteria 2474
50 Ga0055540_1000019 3300003792 Bacteria 210593
51 Ga0055540_1001799 3300003792 Bacteria 12186
52 Ga0055540_1006211 3300003792 Bacteria 4800
53 Ga0055540_1007850 3300003792 Bacteria 3948
54 Ga0055540_1008402 3300003792 Bacteria 3724
55 Ga0055540_1011021 3300003792 Bacteria 2954
56 Ga0055540_1031797 3300003792 Bacteria 1210
57 Ga0055531_10000360 3300003794 Bacteria 44186
58 Ga0055531_10001074 3300003794 Bacteria 21465
59 Ga0055531_10003311 3300003794 Bacteria 10311
60 Ga0055531_10009158 3300003794 Bacteria 5102
61 Ga0055531_10012618 3300003794 Bacteria 3963
62 Ga0055531_10020656 3300003794 Bacteria 2593
63 Ga0055541_1000032 3300003841 Bacteria 195460
64 Ga0055543_1005706 3300004625 Bacteria 3134
65 Ga0065165_1000080 3300005262 Bacteria 159638
66 Ga0065165_1000101 3300005262 Bacteria 141486
67 Ga0065165_1003865 3300005262 Bacteria 9941
68 Ga0065165_1043062 3300005262 Bacteria 1328
69 Ga0065707_10100423 3300005295 Bacteria 2930
70 Ga0070658_10100789 3300005327 Bacteria 2387
71 Ga0070658_10227236 3300005327 Bacteria 1580
72 Ga0070676_10011159 3300005328 Bacteria 4881
73 Ga0070676_10012151 3300005328 Bacteria 4695
74 Ga0070676_10034778 3300005328 Bacteria 2894
75 Ga0070676_10127828 3300005328 Bacteria 1603
76 Ga0070683_100029368 3300005329 Bacteria 4977
77 Ga0070683_100087729 3300005329 Bacteria 2919
78 Ga0070690_100022459 3300005330 Bacteria 3859
79 Ga0070690_100055811 3300005330 Bacteria 2530
80 Ga0070670_100086045 3300005331 Bacteria 2701
81 Ga0070670_100115775 3300005331 Bacteria 2311
82 Ga0070670_100138057 3300005331 Bacteria 2107
83 Ga0070670_100199404 3300005331 Bacteria 1739
84 Ga0070670_100209046 3300005331 Bacteria 1697
85 Ga0070670_100252130 3300005331 Bacteria 1538
86 Ga0070677_10032005 3300005333 Bacteria 2014
87 Ga0070677_10140655 3300005333 Bacteria 1113
88 Ga0068869_100010879 3300005334 Bacteria 5951
89 Ga0068869_100027914 3300005334 Bacteria 3939
90 Ga0068869_100061795 3300005334 Bacteria 2748
91 Ga0068869_100065097 3300005334 Bacteria 2683
92 Ga0070666_10050920 3300005335 Bacteria 2787
93 Ga0070666_10128748 3300005335 Bacteria 1758
94 Ga0070682_100085166 3300005337 Bacteria 2056
95 Ga0068868_100014027 3300005338 Bacteria 5896
96 Ga0068868_100025884 3300005338 Bacteria 4467
97 Ga0068868_100057346 3300005338 Bacteria 3077
98 Ga0068868_100073336 3300005338 Bacteria 2733
99 Ga0070660_100013524 3300005339 Bacteria 5856
100 Ga0070660_100034480 3300005339 Bacteria 3825
101 Ga0070660_100128252 3300005339 Bacteria 2028
102 Ga0070689_100328387 3300005340 Bacteria 1279
103 Ga0070687_100030101 3300005343 Bacteria 2651
104 Ga0070661_100001817 3300005344 Bacteria 14798
105 Ga0070661_100100058 3300005344 Bacteria 2155
106 Ga0070668_100024251 3300005347 Bacteria 4594
107 Ga0070668_100117189 3300005347 Bacteria 2125
108 Ga0070668_100119935 3300005347 Bacteria 2101
109 Ga0070669_100034251 3300005353 Bacteria 3677
110 Ga0070669_100071168 3300005353 Bacteria 2572
111 Ga0070669_100072824 3300005353 Bacteria 2544
112 Ga0070675_100027434 3300005354 Bacteria 4574
113 Ga0070675_100064813 3300005354 Bacteria 3020
114 Ga0070675_100076311 3300005354 Bacteria 2787
115 Ga0070675_100318094 3300005354 Bacteria 1374
116 Ga0070671_100011406 3300005355 Bacteria 7146
117 Ga0070671_100021838 3300005355 Bacteria 5228
118 Ga0070671_100076886 3300005355 Bacteria 2789
119 Ga0070671_100095343 3300005355 Bacteria 2494
120 Ga0070671_100216587 3300005355 Bacteria 1624
121 Ga0070674_100020660 3300005356 Bacteria 4213
122 Ga0070674_100136341 3300005356 Bacteria 1836
123 Ga0070674_100146065 3300005356 Bacteria 1780
124 Ga0070673_100010575 3300005364 Bacteria 6251
125 Ga0070673_100029046 3300005364 Bacteria 4120
126 Ga0070673_100060598 3300005364 Bacteria 2999
127 Ga0070659_100000579 3300005366 Bacteria 26725
128 Ga0070659_100138085 3300005366 Bacteria 1983
129 Ga0070659_100141084 3300005366 Bacteria 1962
130 Ga0070667_100017022 3300005367 Bacteria 6019
131 Ga0070667_100048321 3300005367 Bacteria 3581
132 Ga0070667_100063689 3300005367 Bacteria 3125
133 Ga0070708_100143642 3300005445 Bacteria 2215
134 Ga0070663_100001569 3300005455 Bacteria 12571
135 Ga0070663_100005909 3300005455 Bacteria 7323
136 Ga0070663_100416172 3300005455 Bacteria 1102
137 Ga0070678_100013580 3300005456 Bacteria 5113
138 Ga0070678_100086673 3300005456 Bacteria 2389
139 Ga0070678_100164593 3300005456 Bacteria 1800
140 Ga0070678_100172516 3300005456 Bacteria 1763
141 Ga0070678_100185324 3300005456 Bacteria 1707
142 Ga0070678_100408253 3300005456 Bacteria 1181
143 Ga0070662_100034033 3300005457 Bacteria 3591
144 Ga0070662_100054096 3300005457 Bacteria 2908
145 Ga0070662_100055624 3300005457 Bacteria 2871
146 Ga0070662_100158535 3300005457 Bacteria 1768
147 Ga0070681_10232499 3300005458 Bacteria 1758
148 Ga0068867_100000072 3300005459 Bacteria 61663
149 Ga0068867_100014337 3300005459 Bacteria 5614
150 Ga0068867_100014505 3300005459 Bacteria 5585
151 Ga0068867_100025831 3300005459 Bacteria 4213
152 Ga0068867_100039511 3300005459 Bacteria 3440
153 Ga0068867_100084146 3300005459 Bacteria 2402
154 Ga0068867_100160344 3300005459 Bacteria 1773
155 Ga0070706_100003148 3300005467 Bacteria 16310
156 Ga0070679_100016827 3300005530 Bacteria 7067
157 Ga0070679_100458852 3300005530 Bacteria 1219
158 Ga0070684_100233184 3300005535 Bacteria 1681
159 Ga0068853_100022735 3300005539 Bacteria 5240
160 Ga0068853_100080199 3300005539 Bacteria 2855
161 Ga0070672_100027758 3300005543 Bacteria 4225
162 Ga0070672_100053209 3300005543 Bacteria 3164
163 Ga0070672_100100519 3300005543 Bacteria 2345
164 Ga0070672_100161318 3300005543 Bacteria 1860
165 Ga0070672_100228763 3300005543 Bacteria 1562
166 Ga0070693_100011646 3300005547 Bacteria 4432
167 Ga0070665_100050202 3300005548 Bacteria 4186
168 Ga0070665_100093595 3300005548 Bacteria 3010
169 Ga0070665_100304456 3300005548 Bacteria 1597
170 Ga0068855_100013525 3300005563 Bacteria 9840
171 Ga0068855_100020802 3300005563 Bacteria 7867
172 Ga0068855_100050047 3300005563 Bacteria 4925
173 Ga0068855_100176827 3300005563 Bacteria 2415
174 Ga0068855_100450372 3300005563 Bacteria 1405
175 Ga0070664_100003888 3300005564 Bacteria 12054
176 Ga0070664_100017203 3300005564 Bacteria 5936
177 Ga0070664_100026915 3300005564 Bacteria 4776
178 Ga0070664_100095364 3300005564 Bacteria 2580
179 Ga0070664_100308447 3300005564 Bacteria 1432
180 Ga0070664_100480371 3300005564 Bacteria 1143
181 Ga0068857_100068892 3300005577 Bacteria 3149
182 Ga0068857_100088867 3300005577 Bacteria 2764
183 Ga0068857_100112626 3300005577 Bacteria 2446
184 Ga0068854_100023360 3300005578 Bacteria 4222
185 Ga0068856_100012944 3300005614 Bacteria 8076
186 Ga0068856_100059328 3300005614 Bacteria 3780
187 Ga0068856_100059918 3300005614 Bacteria 3760
188 Ga0068856_100443477 3300005614 Bacteria 1319
189 Ga0068852_100028494 3300005616 Bacteria 4572
190 Ga0068852_100031065 3300005616 Bacteria 4402
191 Ga0068852_100085784 3300005616 Bacteria 2805
192 Ga0068852_100095692 3300005616 Bacteria 2667
193 Ga0068852_100114168 3300005616 Bacteria 2461
194 Ga0068852_100198506 3300005616 Bacteria 1897
195 Ga0068852_100208459 3300005616 Bacteria 1853
196 Ga0068859_100010805 3300005617 Bacteria 9191
197 Ga0068859_100033863 3300005617 Bacteria 5129
198 Ga0068859_100208397 3300005617 Bacteria 2041
199 Ga0068859_100231075 3300005617 Bacteria 1938
200 Ga0068859_100327980 3300005617 Bacteria 1625
201 Ga0068864_100002362 3300005618 Bacteria 15612
202 Ga0068864_100049681 3300005618 Bacteria 3609
203 Ga0068864_100056292 3300005618 Bacteria 3397
204 Ga0068864_100082398 3300005618 Bacteria 2822
205 Ga0068864_100157482 3300005618 Bacteria 2062
206 Ga0068866_10033347 3300005718 Bacteria 2497
207 Ga0068866_10180079 3300005718 Bacteria 1248
208 Ga0068861_100001649 3300005719 Bacteria 14258
209 Ga0068861_100022805 3300005719 Bacteria 4513
210 Ga0068861_100024567 3300005719 Bacteria 4359
211 Ga0068861_100146023 3300005719 Bacteria 1936
212 Ga0068851_10035063 3300005834 Bacteria 2507
213 Ga0068851_10115492 3300005834 Bacteria 1438
214 Ga0068870_10025942 3300005840 Bacteria 2915
215 Ga0068870_10054833 3300005840 Bacteria 2122
216 Ga0068870_10115178 3300005840 Bacteria 1541
217 Ga0068863_100031768 3300005841 Bacteria 5037
218 Ga0068863_100038412 3300005841 Bacteria 4554
219 Ga0068863_100040765 3300005841 Bacteria 4415
220 Ga0068863_100051637 3300005841 Bacteria 3896
221 Ga0068863_100083801 3300005841 Bacteria 3021
222 Ga0068863_100189569 3300005841 Bacteria 1976
223 Ga0068858_100000947 3300005842 Bacteria 30015
224 Ga0068858_100028870 3300005842 Bacteria 5151
225 Ga0068858_100188292 3300005842 Bacteria 1950
226 Ga0068860_100000590 3300005843 Bacteria 43453
227 Ga0068860_100013253 3300005843 Bacteria 8089
228 Ga0068860_100156493 3300005843 Bacteria 2196
229 Ga0068860_100197279 3300005843 Bacteria 1950
230 Ga0068860_100204213 3300005843 Bacteria 1916
231 Ga0068862_100028602 3300005844 Bacteria 4695
232 Ga0068862_100056931 3300005844 Bacteria 3351
233 Ga0068862_100058125 3300005844 Bacteria 3317
234 Ga0075365_10001679 3300006038 Bacteria 10232
235 Ga0075365_10034744 3300006038 Bacteria 3257
236 Ga0075363_100012906 3300006048 Bacteria 4034
237 Ga0075363_100053453 3300006048 Bacteria 2158
238 Ga0075364_10023395 3300006051 Bacteria 3912
239 Ga0075364_10194821 3300006051 Bacteria 1373
240 Ga0075362_10006614 3300006177 Bacteria 4327
241 Ga0075367_10013667 3300006178 Bacteria 4372
242 Ga0075367_10030265 3300006178 Bacteria 3102
243 Ga0075367_10065816 3300006178 Bacteria 2171
244 Ga0075367_10085205 3300006178 Bacteria 1917
245 Ga0075367_10125705 3300006178 Bacteria 1582
246 Ga0075369_10038509 3300006186 Bacteria 2040
247 Ga0075366_10032419 3300006195 Bacteria 3075
248 Ga0075366_10040155 3300006195 Bacteria 2767
249 Ga0075366_10051496 3300006195 Bacteria 2446
250 Ga0075366_10075317 3300006195 Bacteria 2013
251 Ga0075366_10103866 3300006195 Bacteria 1707
252 Ga0097621_100064293 3300006237 Bacteria 3017
253 Ga0097621_100081669 3300006237 Bacteria 2690
254 Ga0097621_100159403 3300006237 Bacteria 1939
255 Ga0075370_10000547 3300006353 Bacteria 14418
256 Ga0075370_10002604 3300006353 Bacteria 8412
257 Ga0075370_10007775 3300006353 Bacteria 5477
258 Ga0075370_10011725 3300006353 Bacteria 4614
259 Ga0075370_10021986 3300006353 Bacteria 3497
260 Ga0075370_10037246 3300006353 Bacteria 2734
261 Ga0075370_10040108 3300006353 Bacteria 2640
262 Ga0075370_10075281 3300006353 Bacteria 1935
263 Ga0068871_100074554 3300006358 Bacteria 2799
264 Ga0068871_100093767 3300006358 Bacteria 2505
265 Ga0068871_100130241 3300006358 Bacteria 2132
266 Ga0075430_100078142 3300006846 Bacteria 2774
267 Ga0075429_100000199 3300006880 Bacteria 39995
268 Ga0068865_100079132 3300006881 Bacteria 2353
269 Ga0068865_100145558 3300006881 Bacteria 1792
270 Ga0097620_100010805 3300006931 Bacteria 9191
271 Ga0097620_100033861 3300006931 Bacteria 5129
272 Ga0097620_100208406 3300006931 Bacteria 2041
273 Ga0097620_100231087 3300006931 Bacteria 1938
274 Ga0097620_100327959 3300006931 Bacteria 1625
275 Ga0079104_1000206 3300006946 Bacteria 82424
276 Ga0079104_1017870 3300006946 Bacteria 2026
277 Ga0099826_10041983 3300006948 Bacteria 3167
278 Ga0099826_10085707 3300006948 Bacteria 1944
279 Ga0105244_10007138 3300009036 Bacteria 7139
280 Ga0105240_10024611 3300009093 Bacteria 7930
281 Ga0105240_10062071 3300009093 Bacteria 4654
282 Ga0105245_10102204 3300009098 Bacteria 2654
283 Ga0105245_10442779 3300009098 Bacteria 1306
284 Ga0114129_10149580 3300009147 Bacteria 3196
285 Ga0105243_10001108 3300009148 Bacteria 24452
286 Ga0105243_10010327 3300009148 Bacteria 7091
287 Ga0105243_10019712 3300009148 Bacteria 5114
288 Ga0105242_10018229 3300009176 Bacteria 5486
289 Ga0105242_10079059 3300009176 Bacteria 2746
290 Ga0105242_10615719 3300009176 Bacteria 1051
291 Ga0105248_10000507 3300009177 Bacteria 44310
292 Ga0105248_10123485 3300009177 Bacteria 2921
293 Ga0105248_10154142 3300009177 Bacteria 2592
294 Ga0105248_10333990 3300009177 Bacteria 1707
295 Ga0105237_10367620 3300009545 Bacteria 1443
296 Ga0105238_10020663 3300009551 Bacteria 6707
297 Ga0105238_10081997 3300009551 Bacteria 3215
298 Ga0105238_10227899 3300009551 Bacteria 1840
299 Ga0105249_10010561 3300009553 Bacteria 8116
300 Ga0105249_10022308 3300009553 Bacteria 5671
301 Ga0105239_10072072 3300010375 Bacteria 3797
302 Ga0105239_10166314 3300010375 Bacteria 2466
303 Ga0157319_1000008 3300012497 Bacteria 315600
304 Ga0157373_10022910 3300013100 Bacteria 4530
305 Ga0157373_10037740 3300013100 Bacteria 3462
306 Ga0157373_10178132 3300013100 Bacteria 1497
307 Ga0157371_10102629 3300013102 Bacteria 2029
308 Ga0157370_10117019 3300013104 Bacteria 2490
309 Ga0157369_10013318 3300013105 Bacteria 9299
310 Ga0157369_10059000 3300013105 Bacteria 4139
311 Ga0157374_10097347 3300013296 Bacteria 2815
312 Ga0157374_10170314 3300013296 Bacteria 2124
313 Ga0157378_10008627 3300013297 Bacteria 8870
314 Ga0163162_10002118 3300013306 Bacteria 18641
315 Ga0163162_10007695 3300013306 Bacteria 10495
316 Ga0163162_10026342 3300013306 Bacteria 5747
317 Ga0157372_10051925 3300013307 Bacteria 4564
318 Ga0157375_10046187 3300013308 Bacteria 4244
319 Ga0157375_10064111 3300013308 Bacteria 3657
320 Ga0157375_10095187 3300013308 Bacteria 3048
321 Ga0157375_10099385 3300013308 Bacteria 2989
322 Ga0157375_10112718 3300013308 Bacteria 2820
323 Ga0157375_10130614 3300013308 Bacteria 2631
324 Ga0157375_10318209 3300013308 Bacteria 1721
325 Ga0163163_10007361 3300014325 Bacteria 9711
326 Ga0163163_10165401 3300014325 Bacteria 2258
327 Ga0163163_10251023 3300014325 Bacteria 1820
328 Ga0163163_10580674 3300014325 Bacteria 1184
329 Ga0157380_10015463 3300014326 Bacteria 5610
330 Ga0157380_10056674 3300014326 Bacteria 3118
331 Ga0157380_10102260 3300014326 Bacteria 2389
332 Ga0157380_10112388 3300014326 Bacteria 2292
333 Ga0157380_10281039 3300014326 Bacteria 1523
334 Ga0157380_10548396 3300014326 Bacteria 1134
335 Ga0182008_10001156 3300014497 Bacteria 18204
336 Ga0182008_10004095 3300014497 Bacteria 8593
337 Ga0182008_10008484 3300014497 Bacteria 5610
338 Ga0182008_10116007 3300014497 Bacteria 1328
339 Ga0157377_10000075 3300014745 Bacteria 76405
340 Ga0157377_10023652 3300014745 Bacteria 3259
341 Ga0157379_10025992 3300014968 Bacteria 5207
342 Ga0157379_10030374 3300014968 Bacteria 4809
343 Ga0157379_10034913 3300014968 Bacteria 4483
344 Ga0157379_10061361 3300014968 Bacteria 3362
345 Ga0157379_10069401 3300014968 Bacteria 3152
346 Ga0157379_10093358 3300014968 Bacteria 2700
347 Ga0157379_10097801 3300014968 Bacteria 2635
348 Ga0157379_10122709 3300014968 Bacteria 2338
349 Ga0157379_10266193 3300014968 Bacteria 1558
350 Ga0157376_10017920 3300014969 Bacteria 5415
351 Ga0157376_10142978 3300014969 Bacteria 2149
352 Ga0157376_10206022 3300014969 Bacteria 1813
353 Ga0157376_10227786 3300014969 Bacteria 1730
354 Ga0182006_1003275 3300015261 Bacteria 8372
355 Ga0182007_10002915 3300015262 Bacteria 8314
356 Ga0182007_10031538 3300015262 Bacteria 1804
357 Ga0182005_1000283 3300015265 Bacteria 31970
358 Ga0182005_1017831 3300015265 Bacteria 1964
359 Ga0183362_10003 3300015683 Bacteria 977584
360 Ga0163161_10039684 3300017792 Bacteria 3381
361 Ga0163161_10053752 3300017792 Bacteria 2921
362 Ga0163161_10090355 3300017792 Bacteria 2266
363 Ga0213872_10000382 3300021361 Bacteria 37031
364 Ga0209435_101147 3300025206 Bacteria 3652
365 Ga0209784_100049 3300025224 Bacteria 195512
366 Ga0209566_100061 3300025225 Bacteria 195512
367 Ga0209674_100041 3300025226 Bacteria 396231
368 Ga0209674_100069 3300025226 Bacteria 243948
369 Ga0209672_100538 3300025228 Bacteria 20576
370 Ga0209672_102207 3300025228 Bacteria 5083
371 Ga0209147_102676 3300025229 Bacteria 4127
372 Ga0209563_100043 3300025230 Bacteria 397271
373 Ga0209563_100083 3300025230 Bacteria 195512
374 Ga0207427_100345 3300025231 Bacteria 30030
375 Ga0207427_100646 3300025231 Bacteria 16896
376 Ga0209437_100091 3300025233 Bacteria 243344
377 Ga0209258_100132 3300025242 Bacteria 175292
378 Ga0209258_100344 3300025242 Bacteria 68131
379 Ga0209258_100785 3300025242 Bacteria 19212
380 Ga0207425_1000226 3300025245 Bacteria 44291
381 Ga0207425_1007249 3300025245 Bacteria 2948
382 Ga0209646_1000069 3300025246 Bacteria 230340
383 Ga0209646_1002496 3300025246 Bacteria 4043
384 Ga0209026_1000006 3300025250 Bacteria 677225
385 Ga0209677_100039 3300025253 Bacteria 243974
386 Ga0209677_100096 3300025253 Bacteria 99089
387 Ga0209677_101194 3300025253 Bacteria 11889
388 Ga0209148_1000007 3300025254 Bacteria 1592273
389 Ga0209148_1008882 3300025254 Bacteria 1993
390 Ga0209759_1000075 3300025256 Bacteria 176235
391 Ga0209759_1001215 3300025256 Bacteria 15837
392 Ga0209759_1001295 3300025256 Bacteria 14863
393 Ga0209759_1003631 3300025256 Bacteria 6070
394 Ga0209759_1012969 3300025256 Bacteria 2279
395 Ga0209759_1014554 3300025256 Bacteria 2074
396 Ga0209129_1000012 3300025258 Bacteria 541516
397 Ga0209129_1000084 3300025258 Bacteria 182554
398 Ga0209233_1000115 3300025261 Bacteria 243344
399 Ga0209565_1000169 3300025263 Bacteria 84839
400 Ga0209565_1000364 3300025263 Bacteria 38944
401 Ga0209565_1015528 3300025263 Bacteria 1715
402 Ga0209455_1000242 3300025272 Bacteria 68131
403 Ga0209673_1000114 3300025273 Bacteria 178557
404 Ga0209673_1000916 3300025273 Bacteria 37512
405 Ga0209673_1001117 3300025273 Bacteria 29869
406 Ga0209673_1009349 3300025273 Bacteria 4258
407 Ga0209673_1018628 3300025273 Bacteria 2517
408 Ga0209673_1019820 3300025273 Bacteria 2403
409 Ga0209673_1023627 3300025273 Bacteria 2088
410 Ga0209673_1032796 3300025273 Bacteria 1595
411 Ga0209130_1000571 3300025284 Bacteria 36074
412 Ga0209130_1004615 3300025284 Bacteria 5136
413 Ga0209675_1000062 3300025291 Bacteria 178557
414 Ga0209675_1006399 3300025291 Bacteria 4731
415 Ga0209676_1000817 3300025292 Bacteria 40674
416 Ga0209676_1003376 3300025292 Bacteria 9919
417 Ga0209676_1006433 3300025292 Bacteria 5803
418 Ga0209676_1006821 3300025292 Bacteria 5537
419 Ga0209025_1000719 3300025294 Bacteria 56292
420 Ga0209025_1000861 3300025294 Bacteria 47942
421 Ga0209025_1018573 3300025294 Bacteria 3927
422 Ga0209025_1045276 3300025294 Bacteria 1826
423 Ga0209564_1000008 3300025295 Bacteria 953227
424 Ga0209564_1000022 3300025295 Bacteria 555109
425 Ga0209564_1000414 3300025295 Bacteria 75224
426 Ga0209564_1000613 3300025295 Bacteria 55031
427 Ga0209758_1000099 3300025297 Bacteria 230054
428 Ga0209758_1002249 3300025297 Bacteria 20036
429 Ga0209050_1000052 3300025298 Bacteria 351785
430 Ga0209050_1001635 3300025298 Bacteria 22939
431 Ga0209050_1001761 3300025298 Bacteria 21453
432 Ga0209050_1001765 3300025298 Bacteria 21356
433 Ga0209256_1000036 3300025299 Bacteria 386664
434 Ga0209256_1000206 3300025299 Bacteria 111425
435 Ga0209256_1000239 3300025299 Bacteria 97580
436 Ga0207426_1000049 3300025302 Bacteria 401954
437 Ga0207426_1000086 3300025302 Bacteria 292089
438 Ga0207426_1000346 3300025302 Bacteria 85832
439 Ga0209051_1000015 3300025303 Bacteria 546798
440 Ga0209051_1000025 3300025303 Bacteria 415397
441 Ga0209051_1000071 3300025303 Bacteria 210843
442 Ga0209051_1000420 3300025303 Bacteria 58383
443 Ga0209051_1000492 3300025303 Bacteria 51006
444 Ga0209051_1001081 3300025303 Bacteria 25280
445 Ga0209051_1001503 3300025303 Bacteria 19479
446 Ga0209051_1002112 3300025303 Bacteria 14864
447 Ga0209257_1000037 3300025304 Bacteria 612915
448 Ga0209257_1000039 3300025304 Bacteria 591694
449 Ga0209257_1000367 3300025304 Bacteria 91077
450 Ga0209257_1003430 3300025304 Bacteria 13611
451 Ga0209257_1005624 3300025304 Bacteria 8678
452 Ga0207656_10042172 3300025321 Bacteria 1941
453 Ga0207656_10062157 3300025321 Bacteria 1641
454 Ga0207656_10080253 3300025321 Bacteria 1465
455 Ga0207655_1000477 3300025728 Bacteria 51677
456 Ga0207682_10040791 3300025893 Bacteria 1892
457 Ga0207682_10042315 3300025893 Bacteria 1861
458 Ga0207642_10010253 3300025899 Bacteria 3294
459 Ga0207642_10182304 3300025899 Bacteria 1145
460 Ga0207680_10143169 3300025903 Bacteria 1586
461 Ga0207680_10145423 3300025903 Bacteria 1575
462 Ga0207680_10168886 3300025903 Bacteria 1472
463 Ga0207680_10224614 3300025903 Bacteria 1289
464 Ga0207647_10089114 3300025904 Bacteria 1842
465 Ga0207645_10008088 3300025907 Bacteria 7379
466 Ga0207645_10037909 3300025907 Bacteria 3093
467 Ga0207645_10064845 3300025907 Bacteria 2334
468 Ga0207645_10102595 3300025907 Bacteria 1846
469 Ga0207643_10029897 3300025908 Bacteria 3031
470 Ga0207643_10067632 3300025908 Bacteria 2051
471 Ga0207705_10017381 3300025909 Bacteria 5151
472 Ga0207705_10061682 3300025909 Bacteria 2708
473 Ga0207705_10121110 3300025909 Bacteria 1942
474 Ga0207695_10019040 3300025913 Bacteria 7918
475 Ga0207695_10092973 3300025913 Bacteria 3026
476 Ga0207695_10108240 3300025913 Bacteria 2764
477 Ga0207695_10116955 3300025913 Bacteria 2640
478 Ga0207662_10029185 3300025918 Bacteria 3194
479 Ga0207657_10021426 3300025919 Bacteria 6082
480 Ga0207657_10065236 3300025919 Bacteria 3105
481 Ga0207657_10081075 3300025919 Bacteria 2726
482 Ga0207657_10113479 3300025919 Bacteria 2236
483 Ga0207657_10156024 3300025919 Bacteria 1856
484 Ga0207649_10001310 3300025920 Bacteria 14847
485 Ga0207649_10022011 3300025920 Bacteria 3679
486 Ga0207649_10176533 3300025920 Bacteria 1492
487 Ga0207652_10018335 3300025921 Bacteria 5739
488 Ga0207652_10130236 3300025921 Bacteria 2243
489 Ga0207652_10194118 3300025921 Bacteria 1826
490 Ga0207681_10000593 3300025923 Bacteria 24630
491 Ga0207681_10016551 3300025923 Bacteria 4615
492 Ga0207681_10052469 3300025923 Bacteria 2765
493 Ga0207681_10112309 3300025923 Bacteria 1984
494 Ga0207694_10036617 3300025924 Bacteria 3766
495 Ga0207694_10056930 3300025924 Bacteria 3038
496 Ga0207650_10001668 3300025925 Bacteria 15808
497 Ga0207650_10007368 3300025925 Bacteria 7487
498 Ga0207650_10008263 3300025925 Bacteria 7106
499 Ga0207650_10077646 3300025925 Bacteria 2511
500 Ga0207650_10343548 3300025925 Bacteria 1226
501 Ga0207659_10002674 3300025926 Bacteria 10616
502 Ga0207659_10016256 3300025926 Bacteria 4839
503 Ga0207659_10021228 3300025926 Bacteria 4307
504 Ga0207659_10025527 3300025926 Bacteria 3972
505 Ga0207659_10105397 3300025926 Bacteria 2133
506 Ga0207687_10014488 3300025927 Bacteria 5159
507 Ga0207644_10001504 3300025931 Bacteria 15026
508 Ga0207644_10001724 3300025931 Bacteria 14137
509 Ga0207644_10022871 3300025931 Bacteria 4274
510 Ga0207690_10012412 3300025932 Bacteria 5094
511 Ga0207690_10117694 3300025932 Bacteria 1924
512 Ga0207690_10150421 3300025932 Bacteria 1725
513 Ga0207706_10001677 3300025933 Bacteria 21872
514 Ga0207706_10011352 3300025933 Bacteria 8118
515 Ga0207706_10095958 3300025933 Bacteria 2608
516 Ga0207686_10010318 3300025934 Bacteria 5083
517 Ga0207686_10038467 3300025934 Bacteria 2895
518 Ga0207709_10000625 3300025935 Bacteria 29011
519 Ga0207709_10008688 3300025935 Bacteria 5605
520 Ga0207709_10085744 3300025935 Bacteria 2043
521 Ga0207670_10062873 3300025936 Bacteria 2538
522 Ga0207669_10022100 3300025937 Bacteria 3373
523 Ga0207669_10093576 3300025937 Bacteria 1964
524 Ga0207704_10001522 3300025938 Bacteria 10396
525 Ga0207704_10190598 3300025938 Bacteria 1491
526 Ga0207691_10002901 3300025940 Bacteria 16713
527 Ga0207691_10012766 3300025940 Bacteria 8042
528 Ga0207691_10016738 3300025940 Bacteria 6961
529 Ga0207691_10043548 3300025940 Bacteria 4136
530 Ga0207691_10080536 3300025940 Bacteria 2929
531 Ga0207691_10093842 3300025940 Bacteria 2686
532 Ga0207691_10239744 3300025940 Bacteria 1568
533 Ga0207711_10007584 3300025941 Bacteria 9078
534 Ga0207711_10041907 3300025941 Bacteria 3899
535 Ga0207711_10076292 3300025941 Bacteria 2919
536 Ga0207711_10146699 3300025941 Bacteria 2126
537 Ga0207711_10256121 3300025941 Bacteria 1608
538 Ga0207689_10009850 3300025942 Bacteria 8237
539 Ga0207689_10022702 3300025942 Bacteria 5271
540 Ga0207689_10034031 3300025942 Bacteria 4232
541 Ga0207689_10061308 3300025942 Bacteria 3093
542 Ga0207689_10063571 3300025942 Bacteria 3036
543 Ga0207689_10118101 3300025942 Bacteria 2181
544 Ga0207689_10277214 3300025942 Bacteria 1388
545 Ga0207661_10135339 3300025944 Bacteria 2115
546 Ga0207661_10142760 3300025944 Bacteria 2062
547 Ga0207679_10000730 3300025945 Bacteria 21864
548 Ga0207679_10010415 3300025945 Bacteria 5985
549 Ga0207679_10011896 3300025945 Bacteria 5656
550 Ga0207679_10131331 3300025945 Bacteria 2010
551 Ga0207679_10205195 3300025945 Bacteria 1649
552 Ga0207667_10024656 3300025949 Bacteria 6599
553 Ga0207667_10026800 3300025949 Bacteria 6289
554 Ga0207667_10030273 3300025949 Bacteria 5858
555 Ga0207667_10087544 3300025949 Bacteria 3222
556 Ga0207667_10154567 3300025949 Bacteria 2361
557 Ga0207651_10003471 3300025960 Bacteria 7745
558 Ga0207651_10028358 3300025960 Bacteria 3530
559 Ga0207651_10069685 3300025960 Bacteria 2484
560 Ga0207651_10252192 3300025960 Bacteria 1444
561 Ga0207712_10067108 3300025961 Bacteria 2566
562 Ga0207668_10004390 3300025972 Bacteria 8286
563 Ga0207668_10053015 3300025972 Bacteria 2809
564 Ga0207640_10023034 3300025981 Bacteria 3738
565 Ga0207640_10082383 3300025981 Bacteria 2203
566 Ga0207658_10005270 3300025986 Bacteria 8895
567 Ga0207658_10007685 3300025986 Bacteria 7342
568 Ga0207658_10015971 3300025986 Bacteria 5157
569 Ga0207658_10021533 3300025986 Bacteria 4478
570 Ga0207658_10021561 3300025986 Bacteria 4476
571 Ga0207658_10167556 3300025986 Bacteria 1806
572 Ga0207677_10002324 3300026023 Bacteria 9980
573 Ga0207677_10023530 3300026023 Bacteria 3808
574 Ga0207677_10043382 3300026023 Bacteria 2989
575 Ga0207703_10003131 3300026035 Bacteria 13968
576 Ga0207703_10005198 3300026035 Bacteria 10519
577 Ga0207703_10033516 3300026035 Bacteria 4072
578 Ga0207703_10163573 3300026035 Bacteria 1951
579 Ga0207639_10010457 3300026041 Bacteria 6429
580 Ga0207639_10035863 3300026041 Bacteria 3672
581 Ga0207639_10106409 3300026041 Bacteria 2277
582 Ga0207639_10122505 3300026041 Bacteria 2139
583 Ga0207639_10227734 3300026041 Bacteria 1614
584 Ga0207639_10279091 3300026041 Bacteria 1469
585 Ga0207678_10002200 3300026067 Bacteria 17609
586 Ga0207678_10053222 3300026067 Bacteria 3489
587 Ga0207678_10147260 3300026067 Bacteria 2010
588 Ga0207708_10044032 3300026075 Bacteria 3401
589 Ga0207702_10000305 3300026078 Bacteria 56491
590 Ga0207702_10032304 3300026078 Bacteria 4368
591 Ga0207702_10058880 3300026078 Bacteria 3270
592 Ga0207641_10006528 3300026088 Bacteria 9811
593 Ga0207641_10012012 3300026088 Bacteria 7106
594 Ga0207641_10124207 3300026088 Bacteria 2308
595 Ga0207641_10322836 3300026088 Bacteria 1464
596 Ga0207648_10000286 3300026089 Bacteria 54985
597 Ga0207648_10000878 3300026089 Bacteria 33868
598 Ga0207648_10008332 3300026089 Bacteria 10058
599 Ga0207648_10024038 3300026089 Bacteria 5446
600 Ga0207648_10042896 3300026089 Bacteria 3972
601 Ga0207648_10066867 3300026089 Bacteria 3134
602 Ga0207648_10105019 3300026089 Bacteria 2478
603 Ga0207676_10001457 3300026095 Bacteria 17601
604 Ga0207676_10021802 3300026095 Bacteria 4704
605 Ga0207676_10036150 3300026095 Bacteria 3755
606 Ga0207676_10114179 3300026095 Bacteria 2265
607 Ga0207676_10218332 3300026095 Bacteria 1696
608 Ga0207676_10258686 3300026095 Bacteria 1570
609 Ga0207674_10067815 3300026116 Bacteria 3591
610 Ga0207674_10091078 3300026116 Bacteria 3040
611 Ga0207674_10102936 3300026116 Bacteria 2835
612 Ga0207675_100001900 3300026118 Bacteria 20834
613 Ga0207675_100008217 3300026118 Bacteria 9835
614 Ga0207675_100037604 3300026118 Bacteria 4514
615 Ga0207683_10016577 3300026121 Bacteria 6273
616 Ga0207683_10028752 3300026121 Bacteria 4808
617 Ga0207683_10092116 3300026121 Bacteria 2701
618 Ga0207683_10116820 3300026121 Bacteria 2392
619 Ga0207683_10164423 3300026121 Bacteria 2007
620 Ga0207698_10004685 3300026142 Bacteria 8360
621 Ga0207698_10009520 3300026142 Bacteria 6200
622 Ga0207698_10045582 3300026142 Bacteria 3305
623 Ga0207698_10055995 3300026142 Bacteria 3042
624 Ga0207698_10059137 3300026142 Bacteria 2974
625 Ga0207698_10062309 3300026142 Bacteria 2912
626 Ga0207698_10086423 3300026142 Bacteria 2550
627 Ga0207698_10118010 3300026142 Bacteria 2240
628 Ga0209281_1000259 3300027111 Bacteria 101905
629 Ga0209968_1000129 3300027526 Bacteria 13402
630 Ga0209999_1002190 3300027543 Bacteria 3420
631 Ga0209282_1001433 3300027666 Bacteria 13109
632 Ga0209966_1000035 3300027695 Bacteria 56067
633 Ga0207428_10035993 3300027907 Bacteria 4041
634 Ga0268266_10117070 3300028379 Bacteria 2368
635 Ga0268266_10559763 3300028379 Bacteria 1096
636 Ga0268265_10114311 3300028380 Bacteria 2210
637 Ga0268264_10000991 3300028381 Bacteria 28937
638 Ga0268264_10062766 3300028381 Bacteria 3121
639 Ga0268264_10112149 3300028381 Bacteria 2390
640 Ga0268264_10115229 3300028381 Bacteria 2361
641 Ga0265336_10000013 3300028666 Bacteria 252156
642 Ga0307517_10000131 3300028786 Bacteria 113233
643 Ga0307517_10069239 3300028786 Bacteria 3201
644 Ga0307517_10155715 3300028786 Bacteria 1551
645 Ga0307515_10000011 3300028794 Bacteria 633903
646 Ga0307515_10000278 3300028794 Bacteria 125493
647 Ga0307515_10006352 3300028794 Bacteria 23656
648 Ga0307515_10009653 3300028794 Bacteria 18622
649 Ga0307515_10028588 3300028794 Bacteria 9473
650 Ga0307515_10035182 3300028794 Bacteria 8160
651 Ga0307515_10037795 3300028794 Bacteria 7745
652 Ga0307515_10040145 3300028794 Bacteria 7410
653 Ga0307515_10066582 3300028794 Bacteria 4987
654 Ga0307515_10089622 3300028794 Bacteria 3870
655 Ga0307515_10120653 3300028794 Bacteria 2972
656 Ga0307515_10165132 3300028794 Bacteria 2236
657 Ga0265324_10000193 3300029957 Bacteria 46981
658 Ga0265324_10007057 3300029957 Bacteria 4607
659 Ga0316177_1175648 3300030731 Bacteria 4726
660 Ga0316176_1195019 3300030732 Bacteria 2474
661 Ga0314311_1020317 3300030733 Bacteria 3252
662 Ga0316179_1040040 3300030734 Bacteria 2406
663 Ga0316178_1025743 3300030735 Bacteria 6114
664 Ga0316180_1050502 3300030736 Bacteria 4264
665 Ga0316183_1188254 3300030742 Bacteria 3217
666 Ga0316183_1202539 3300030742 Bacteria 1790
667 Ga0316181_1041597 3300030744 Bacteria 3900
668 Ga0316182_1104984 3300030745 Bacteria 4450
669 Ga0316182_1417019 3300030745 Bacteria 3598
670 Ga0265330_10000453 3300031235 Bacteria 27395
671 Ga0265332_10000012 3300031238 Bacteria 272641
672 Ga0265325_10017431 3300031241 Bacteria 3990
673 Ga0265327_10001807 3300031251 Bacteria 25067
674 Ga0307513_10043473 3300031456 Bacteria 4933
675 Ga0307513_10051134 3300031456 Bacteria 4461
676 Ga0307513_10069012 3300031456 Bacteria 3700
677 Ga0307513_10155369 3300031456 Bacteria 2189
678 Ga0307509_10000871 3300031507 Bacteria 52060
679 Ga0307509_10009460 3300031507 Bacteria 12180
680 Ga0307509_10062290 3300031507 Bacteria 3934
681 Ga0307509_10071281 3300031507 Bacteria 3625
682 Ga0307509_10072259 3300031507 Bacteria 3595
683 Ga0307509_10086638 3300031507 Bacteria 3220
684 Ga0307509_10158271 3300031507 Bacteria 2167
685 Ga0307509_10271113 3300031507 Bacteria 1465
686 Ga0307408_100000274 3300031548 Bacteria 51724
687 Ga0307408_100104590 3300031548 Bacteria 2163
688 Ga0307408_100106258 3300031548 Bacteria 2147
689 Ga0307508_10000123 3300031616 Bacteria 92439
690 Ga0307508_10000349 3300031616 Bacteria 56002
691 Ga0307508_10046060 3300031616 Bacteria 3894
692 Ga0307508_10061411 3300031616 Bacteria 3321
693 Ga0307508_10189187 3300031616 Bacteria 1660
694 Ga0307508_10245087 3300031616 Bacteria 1389
695 Ga0307514_10000355 3300031649 Bacteria 106758
696 Ga0307514_10001708 3300031649 Bacteria 25207
697 Ga0307514_10010918 3300031649 Bacteria 7584
698 Ga0307514_10024565 3300031649 Bacteria 4876
699 Ga0307514_10057518 3300031649 Bacteria 2978
700 Ga0265314_10000029 3300031711 Bacteria 272506
701 Ga0307516_10001568 3300031730 Bacteria 31474
702 Ga0307516_10001850 3300031730 Bacteria 29022
703 Ga0307516_10004605 3300031730 Bacteria 16911
704 Ga0307516_10044066 3300031730 Bacteria 4417
705 Ga0307516_10146531 3300031730 Bacteria 2126
706 Ga0307405_10014665 3300031731 Bacteria 4222
707 Ga0307405_10014975 3300031731 Bacteria 4186
708 Ga0307405_10369473 3300031731 Bacteria 1113
709 Ga0307413_10026524 3300031824 Bacteria 3194
710 Ga0307410_10185676 3300031852 Bacteria 1578
711 Ga0307406_10001131 3300031901 Bacteria 14904
712 Ga0307406_10001699 3300031901 Bacteria 12095
713 Ga0307406_10027882 3300031901 Bacteria 3407
714 Ga0307406_10042058 3300031901 Bacteria 2851
715 Ga0307412_10054471 3300031911 Bacteria 2656
716 Ga0307412_10097082 3300031911 Bacteria 2075
717 Ga0307412_10117802 3300031911 Bacteria 1907
718 Ga0307412_10125216 3300031911 Bacteria 1857
719 Ga0307412_10353632 3300031911 Bacteria 1180
720 Ga0307409_100000926 3300031995 Bacteria 13646
721 Ga0307416_100003028 3300032002 Bacteria 9820
722 Ga0307416_100168892 3300032002 Bacteria 2033
723 Ga0307416_100179728 3300032002 Bacteria 1981
724 Ga0307416_100502519 3300032002 Bacteria 1277
725 Ga0307414_10026215 3300032004 Bacteria 3748
726 Ga0307414_10064209 3300032004 Bacteria 2613
727 Ga0307414_10159590 3300032004 Bacteria 1789
728 Ga0307411_10041081 3300032005 Bacteria 2940
729 Ga0307415_100003743 3300032126 Bacteria 7793
730 Ga0307510_10008226 3300033180 Bacteria 12423
731 Ga0307510_10069826 3300033180 Bacteria 3514
732 Ga0307510_10201778 3300033180 Bacteria 1522
733 Ga0373959_0006082 3300034820 Bacteria 1994
734 Ga0373955_0184150 3300035172 Bacteria 1240
735 Ga0373962_0011061 3300035242 Bacteria 2257
736 Ga0373931_0058186 3300035691 Bacteria 2075
737 Ga0373931_0122546 3300035691 Bacteria 1487
738 Ga0373947_0070940 3300035725 Bacteria 2136
739 Ga0373925_0435975 3300037068 Bacteria 1072
740 Ga0395899_0000586 3300037312 Bacteria 38344
741 Ga0395899_0001071 3300037312 Bacteria 24692
742 Ga0395899_0074231 3300037312 Bacteria 2485
743 Ga0395900_0000058 3300037418 Bacteria 206785
744 Ga0395900_0005380 3300037418 Bacteria 13414
745 Ga0395900_0039728 3300037418 Bacteria 4847
746 Ga0395900_0054509 3300037418 Bacteria 4117
747 Ga0395898_0000283 3300037466 Bacteria 122630
748 Ga0395898_0004069 3300037466 Bacteria 16053
749 Ga0395898_0006225 3300037466 Bacteria 12784
750 Ga0395905_0000474 3300037471 Bacteria 55503
751 Ga0395905_0006877 3300037471 Bacteria 11371
752 Ga0395905_0013432 3300037471 Bacteria 7846
753 Ga0395905_0022875 3300037471 Bacteria 5908
754 Ga0395905_0023384 3300037471 Bacteria 5840
755 Ga0395905_0023805 3300037471 Bacteria 5782
756 Ga0395905_0060047 3300037471 Bacteria 3555
757 Ga0395905_0070264 3300037471 Bacteria 3280
758 Ga0395905_0113331 3300037471 Bacteria 2547
759 Ga0395905_0232081 3300037471 Bacteria 1725
760 Ga0395905_0373377 3300037471 Bacteria 1319
761 Ga0395901_0001676 3300038443 Bacteria 22857
762 Ga0395901_0002111 3300038443 Bacteria 20385
763 Ga0395901_0010431 3300038443 Bacteria 9413
764 Ga0395901_0130823 3300038443 Bacteria 2637
765 Ga0436365_0730477 3300039437 Bacteria 2085
766 Ga0436361_0566522 3300039447 Bacteria 37173
767 Ga0436361_0591904 3300039447 Bacteria 6639
768 Ga0436361_0627254 3300039447 Bacteria 2153
769 Ga0436361_1134487 3300039447 Bacteria 5287
770 Ga0439436_0002079 3300041404 Bacteria 5974
771 Ga0439439_0017596 3300041406 Bacteria 1759
772 Ga0439465_0001094 3300041413 Bacteria 8687
773 Ga0451795_0816552 3300041456 Bacteria 1931
774 Ga0451802_0878914 3300041460 Bacteria 1396
775 Ga0451839_1446416 3300041496 Bacteria 2231
776 Ga0451853_2222586 3300041512 Bacteria 1257
777 Ga0439431_0011396 3300041997 Bacteria 2031
778 Ga0439432_006841 3300042006 Bacteria 4061
779 Ga0439432_013501 3300042006 Bacteria 2777
780 Ga0439449_0000840 3300042007 Bacteria 11913
781 Ga0439449_0004494 3300042007 Bacteria 5388
782 Ga0439449_0016763 3300042007 Bacteria 2752
783 Ga0439449_0053043 3300042007 Bacteria 1499
784 Ga0439452_013992 3300042010 Bacteria 2239
785 Ga0439457_020415 3300042014 Bacteria 1470
786 Ga0439462_0013086 3300042015 Bacteria 2125
787 Ga0439462_0015525 3300042015 Bacteria 1963
788 Ga0450911_001146 3300042115 Bacteria 6532
789 Ga0450919_000198 3300042121 Bacteria 6591
790 Ga0450920_012224 3300042122 Bacteria 1608
791 Ga0450890_006419 3300042127 Bacteria 1504
792 Ga0450897_001948 3300042128 Bacteria 1484
793 Ga0439446_0012002 3300042156 Bacteria 2362
794 Ga0450908_011281 3300042184 Bacteria 1637
795 Ga0439434_0004081 3300042435 Bacteria 4264
796 Ga0439434_0043675 3300042435 Bacteria 1380
797 Ga0439459_0006802 3300042438 Bacteria 1916
798 Ga0450918_000047 3300042531 Bacteria 24725
799 Ga0450918_000609 3300042531 Bacteria 7669
800 Ga0451577_0010228 3300042876 Bacteria 8985
801 Ga0451577_0013180 3300042876 Bacteria 7747
802 Ga0451577_0019182 3300042876 Bacteria 6290
803 Ga0466969_0000013 3300044656 Bacteria 111537
804 Ga0466969_0001902 3300044656 Bacteria 11167
805 Ga0466969_0038002 3300044656 Bacteria 2425
806 Ga0466969_0098117 3300044656 Bacteria 1381
807 Ga0466972_0074601 3300044658 Bacteria 1616
808 Ga0466972_0078819 3300044658 Bacteria 1569
809 Ga0466965_0072665 3300044683 Bacteria 1731
810 Ga0466966_0007367 3300044684 Bacteria 7299
811 Ga0466966_0009518 3300044684 Bacteria 6435
812 Ga0466966_0019848 3300044684 Bacteria 4420
813 Ga0466966_0063907 3300044684 Bacteria 2318
814 Ga0466963_0006190 3300044694 Bacteria 7066
815 Ga0466964_0023321 3300044706 Bacteria 2406
816 Ga0466964_0049836 3300044706 Bacteria 1715
817 Ga0453684_0027299 3300044712 Bacteria 8193
818 Ga0466971_0003284 3300044719 Bacteria 6900
819 Ga0466970_0041588 3300044765 Bacteria 2442
820 Ga0466957_0028042 3300044842 Bacteria 3350
821 Ga0466957_0068411 3300044842 Bacteria 2192
822 Ga0466959_0012078 3300045049 Bacteria 6231
823 Ga0466959_0086352 3300045049 Bacteria 2257
824 Ga0466958_0007549 3300045836 Bacteria 5986
825 Ga0466967_0159737 3300045976 Bacteria 2114
826 Ga0495627_008213 3300046453 Bacteria 3928
827 Ga0495627_019457 3300046453 Bacteria 2276
828 Ga0495592_0000394 3300046454 Bacteria 33973
829 Ga0495592_0125944 3300046454 Bacteria 1797
830 Ga0495590_0005173 3300046457 Bacteria 5190
831 Ga0495638_0139249 3300046460 Bacteria 1418
832 Ga0495651_0019143 3300046462 Bacteria 5304
833 Ga0495651_0025317 3300046462 Bacteria 4618
834 Ga0495651_0040232 3300046462 Bacteria 3636
835 Ga0495653_0047008 3300046463 Bacteria 3339
836 Ga0495650_0019463 3300046471 Bacteria 3340
837 Ga0495583_0000081 3300046506 Bacteria 168304
838 Ga0495606_0001086 3300046507 Bacteria 38950
839 Ga0495608_0013966 3300046511 Bacteria 5571
840 Ga0495608_0056440 3300046511 Bacteria 2593
841 Ga0495610_0025702 3300046512 Bacteria 3155
842 Ga0495610_0056162 3300046512 Bacteria 1894
843 Ga0495610_0061924 3300046512 Bacteria 1776
844 Ga0495616_0011779 3300046513 Bacteria 4993
845 Ga0495618_0154218 3300046514 Bacteria 1466
846 Ga0495628_0001687 3300046516 Bacteria 20156
847 Ga0495628_0013853 3300046516 Bacteria 6773
848 Ga0495628_0322765 3300046516 Bacteria 1139
849 Ga0495630_0154828 3300046517 Bacteria 1745
850 Ga0495631_0001417 3300046518 Bacteria 14572
851 Ga0495632_0010162 3300046519 Bacteria 5598
852 Ga0495637_0008174 3300046520 Bacteria 5150
853 Ga0495643_0067736 3300046522 Bacteria 1880
854 Ga0495643_0149048 3300046522 Bacteria 1160
855 Ga0495652_0008424 3300046529 Bacteria 9412
856 Ga0495586_0054921 3300046535 Bacteria 2159
857 Ga0495621_0018955 3300046539 Bacteria 2241
858 Ga0495621_0024847 3300046539 Bacteria 2006
859 Ga0495645_0062491 3300046543 Bacteria 2697
860 Ga0495656_0000093 3300046615 Bacteria 38558
861 Ga0495656_0019941 3300046615 Bacteria 2594
862 Ga0495656_0093610 3300046615 Bacteria 1378
863 Ga0495668_0046750 3300046616 Bacteria 2404
864 Ga0495611_0087562 3300046648 Bacteria 1437
865 Ga0495625_0001179 3300046660 Bacteria 33575
866 Ga0495625_0006045 3300046660 Bacteria 10869
867 Ga0495625_0034941 3300046660 Bacteria 3707
868 Ga0495635_0064709 3300046663 Bacteria 2510
869 Ga0495588_0049426 3300046674 Bacteria 2162
870 Ga0495657_0064886 3300046675 Bacteria 2403
871 Ga0495623_0006819 3300046679 Bacteria 7430
872 Ga0495646_0002576 3300046680 Bacteria 11150
873 Ga0495646_0031501 3300046680 Bacteria 3304
874 Ga0495646_0141327 3300046680 Bacteria 1346
875 Ga0495658_0035262 3300046683 Bacteria 2751
876 Ga0495658_0037493 3300046683 Bacteria 2680
877 Ga0495658_0046686 3300046683 Bacteria 2436
878 Ga0495658_0214289 3300046683 Bacteria 1204
879 Ga0495669_0012571 3300046684 Bacteria 3605
880 Ga0495613_0165418 3300046689 Bacteria 1572
881 Ga0495624_0062388 3300046690 Bacteria 2332
882 Ga0495670_0034634 3300046691 Bacteria 2516
883 Ga0495671_0021694 3300046692 Bacteria 3370
884 Ga0495649_0000287 3300046694 Bacteria 44649
885 Ga0495649_0015647 3300046694 Bacteria 4313
886 Ga0495589_0008991 3300046794 Bacteria 5197
887 Ga0495604_0044585 3300047317 Bacteria 3463
888 Ga0495604_0096919 3300047317 Bacteria 2176
889 Ga0495676_0107019 3300047321 Bacteria 2059
890 Ga0495687_000582 3300047443 Bacteria 42863
891 Ga0495687_003988 3300047443 Bacteria 10280
892 Ga0495684_0157686 3300047471 Bacteria 1695
893 Ga0495686_0012435 3300047472 Bacteria 5953
894 Ga0495686_0075315 3300047472 Bacteria 2069
895 Ga0495593_0101135 3300047673 Bacteria 1478
896 Ga0495602_0019713 3300048088 Bacteria 6684
897 Ga0495602_0089757 3300048088 Bacteria 2555
898 Ga0495602_0135349 3300048088 Bacteria 1958
899 Ga0495615_0007340 3300048090 Bacteria 2088
900 Ga0496100_0043054 3300048903 Bacteria 2886
901 Ga0496100_0092730 3300048903 Bacteria 2065
902 Ga0496101_0034545 3300048904 Bacteria 3571
903 Ga0496101_0342128 3300048904 Bacteria 1175
904 Ga0496102_0025715 3300048905 Bacteria 5243
905 Ga0496103_0050295 3300048906 Bacteria 2578
906 Ga0496104_0008511 3300048907 Bacteria 9120
907 Ga0496105_0024726 3300048908 Bacteria 4882
908 Ga0496105_0078475 3300048908 Bacteria 2726
909 Ga0496106_0022941 3300048909 Bacteria 4635
910 Ga0496106_0048622 3300048909 Bacteria 3194
911 Ga0496106_0053548 3300048909 Bacteria 3048
912 Ga0496107_0006316 3300048910 Bacteria 8145
913 Ga0496108_0236330 3300048911 Bacteria 1589
914 Ga0496109_0073499 3300048912 Bacteria 3142
915 Ga0496110_0079805 3300048913 Bacteria 2914
916 Ga0496110_0358531 3300048913 Bacteria 1329
917 Ga0496111_0067545 3300048914 Bacteria 2597
918 Ga0496111_0078010 3300048914 Bacteria 2415
919 Ga0496112_0011308 3300048915 Bacteria 8144
920 Ga0496112_0460602 3300048915 Bacteria 1209
921 Ga0496114_0003046 3300048917 Bacteria 12833
922 Ga0496114_0056306 3300048917 Bacteria 3281
923 Ga0496114_0124210 3300048917 Bacteria 2223
924 Ga0496114_0159508 3300048917 Bacteria 1960
925 Ga0496115_0067578 3300048918 Bacteria 2891
926 Ga0496117_0044192 3300048920 Bacteria 3229
927 Ga0496117_0081894 3300048920 Bacteria 2116
928 Ga0496118_0007613 3300048921 Bacteria 11409
929 Ga0496121_0035310 3300048924 Bacteria 4482
930 Ga0496121_0061186 3300048924 Bacteria 3091
931 Ga0496121_0065545 3300048924 Bacteria 2954
932 Ga0496121_0083876 3300048924 Bacteria 2514
933 Ga0496122_0000383 3300048925 Bacteria 94797
934 Ga0496123_0000249 3300048926 Bacteria 108969
935 Ga0496124_0002378 3300048927 Bacteria 24780
936 Ga0496124_0016354 3300048927 Bacteria 7058
937 Ga0496124_0097272 3300048927 Bacteria 2390
938 Ga0496125_0000785 3300048928 Bacteria 51744
939 Ga0496125_0013437 3300048928 Bacteria 8046
940 Ga0496125_0049441 3300048928 Bacteria 3494
941 Ga0496125_0070483 3300048928 Bacteria 2736
942 Ga0501034_0239499 3300049571 Bacteria 1761
943 Ga0501038_0058954 3300049574 Bacteria 3290
944 Ga0501043_0000009 3300049579 Bacteria 214823
945 Ga0501046_0000022 3300049580 Bacteria 215451
946 Ga0501046_0063108 3300049580 Bacteria 2893
947 Ga0501047_0000021 3300049581 Bacteria 254841
948 Ga0501048_0006915 3300049582 Bacteria 8623
949 Ga0501252_001618 3300049682 Bacteria 2115
950 Ga0501225_0007622 3300049705 Bacteria 3135
951 Ga0501262_001452 3300049759 Bacteria 2660
952 Ga0501035_0238000 3300049822 Bacteria 1549
953 Ga0501045_0020284 3300049824 Bacteria 4747
954 nmdc:mga03683_26256_c1 3300050489 Bacteria 2296
955 nmdc:mga03683_32284_c1 3300050489 Bacteria 2106
956 nmdc:mga03683_52391_c1 3300050489 Bacteria 1706
957 nmdc:mga03n38_21542_c1 3300050490 Bacteria 2596
958 nmdc:mga0yw44_14380_c1 3300050492 Bacteria 4202
959 nmdc:mga0yw44_38057_c1 3300050492 Bacteria 2844
960 nmdc:mga0k408_14868_c1 3300050493 Bacteria 4297
961 nmdc:mga0k408_28083_c1 3300050493 Bacteria 3198
962 nmdc:mga0k408_47081_c1 3300050493 Bacteria 2492
963 nmdc:mga0k408_51063_c1 3300050493 Bacteria 2395
964 nmdc:mga0k408_55984_c1 3300050493 Bacteria 2287
965 nmdc:mga0k408_8358_c1 3300050493 Bacteria 5553
966 nmdc:mga0k408_86717_c1 3300050493 Bacteria 1838
967 nmdc:mga06z11_115211_c1 3300050494 Bacteria 1493
968 nmdc:mga06z11_190863_c1 3300050494 Bacteria 1186
969 nmdc:mga06z11_42479_c1 3300050494 Bacteria 2281
970 nmdc:mga06z11_52833_c1 3300050494 Bacteria 2087
971 nmdc:mga07m45_12201_c1 3300050496 Bacteria 4535
972 nmdc:mga07m45_221111_c1 3300050496 Bacteria 1102
973 nmdc:mga07m45_29688_c1 3300050496 Bacteria 3026
974 nmdc:mga07m45_36397_c1 3300050496 Bacteria 2741
975 nmdc:mga07m45_43867_c1 3300050496 Bacteria 2508
976 nmdc:mga07m45_81_c1 3300050496 Bacteria 35778
977 nmdc:mga09592_14596_c1 3300050508 Bacteria 6411
978 nmdc:mga0qj67_69170_c1 3300050509 Bacteria 2815
979 nmdc:mga0sz30_21551_c1 3300050516 Bacteria 2609
980 Ga0495601_0044290 3300053077 Bacteria 2797
981 Ga0500578_0000652 3300053086 Bacteria 41736
982 Ga0500643_018305 3300053087 Bacteria 2328
983 Ga0500646_0020168 3300053090 Bacteria 1769
984 Ga0500651_0000067 3300053093 Bacteria 67673
985 Ga0500651_0008514 3300053093 Bacteria 6043
986 Ga0500562_016498 3300053108 Bacteria 1900
987 Ga0500571_000952 3300053110 Bacteria 12727
988 Ga0500572_065181 3300053111 Bacteria 1115
989 Ga0500593_001535 3300053117 Bacteria 8290
990 Ga0500593_005315 3300053117 Bacteria 5060
991 Ga0500594_0005643 3300053118 Bacteria 2778
992 Ga0500595_013753 3300053119 Bacteria 3094
993 Ga0500628_002238 3300053129 Bacteria 3228
994 Ga0500652_005856 3300053131 Bacteria 3910
995 Ga0500652_089169 3300053131 Bacteria 1287
996 Ga0500658_0019270 3300053134 Bacteria 2566
997 Ga0500658_0022824 3300053134 Bacteria 2383
998 Ga0500658_0106674 3300053134 Bacteria 1228
999 Ga0500559_0000446 3300053136 Bacteria 29360
1000 Ga0500559_0009437 3300053136 Bacteria 4222
1001 Ga0500559_0022035 3300053136 Bacteria 2702
1002 Ga0500568_0009510 3300053139 Bacteria 4608
1003 Ga0500568_0033306 3300053139 Bacteria 2115
1004 Ga0500574_000749 3300053141 Bacteria 4334
1005 Ga0500590_002813 3300053148 Bacteria 7859
1006 Ga0500616_0012717 3300053153 Bacteria 4918
1007 Ga0500619_000568 3300053154 Bacteria 6293
1008 Ga0500619_004153 3300053154 Bacteria 3075
1009 Ga0500622_0000124 3300053156 Bacteria 81245
1010 Ga0500622_0004516 3300053156 Bacteria 8701
1011 Ga0500622_0009123 3300053156 Bacteria 5505
1012 Ga0500627_0012737 3300053158 Bacteria 3163
1013 Ga0500587_000477 3300053739 Bacteria 4798
1014 Ga0590075_010416 3300059424 Bacteria 2237
1015 Ga0466962_0003944 3300061719 Bacteria 7100
1016 Ga0466962_0049703 3300061719 Bacteria 2004
1017 Ga0466962_0098610 3300061719 Bacteria 1402

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053111 Ga0500572_065181 Ga0500572_065181_10_912 292
2 3300025913 Ga0207695_10092973 Ga0207695_100929733 294
3 3300053131 Ga0500652_089169 Ga0500652_089169_131_1042 302
4 iso_pu_bacteria 2842733646 2842737619 305
5 3300005339 Ga0070660_100034480 Ga0070660_1000344804 306
6 3300025921 Ga0207652_10130236 Ga0207652_101302362 306
7 3300009176 Ga0105242_10018229 Ga0105242_100182295 308
8 3300046689 Ga0495613_0165418 Ga0495613_0165418_609_1544 308
9 3300044656 Ga0466969_0001902 Ga0466969_0001902_7897_8919 311
10 3300044706 Ga0466964_0023321 Ga0466964_0023321_1192_2214 311
11 3300044719 Ga0466971_0003284 Ga0466971_0003284_883_1905 311
12 3300044842 Ga0466957_0028042 Ga0466957_0028042_536_1558 311
13 3300045049 Ga0466959_0012078 Ga0466959_0012078_4778_5800 311
14 3300061719 Ga0466962_0003944 Ga0466962_0003944_987_2009 311
15 3300010375 Ga0105239_10072072 Ga0105239_100720723 312
16 3300028794 Ga0307515_10066582 Ga0307515_100665824 313
17 3300053108 Ga0500562_016498 Ga0500562_016498_75_1043 313
18 3300005339 Ga0070660_100013524 Ga0070660_1000135245 314
19 3300005563 Ga0068855_100450372 Ga0068855_1004503721 314
20 3300025949 Ga0207667_10154567 Ga0207667_101545672 314
21 3300027526 Ga0209968_1000129 Ga0209968_100012912 314
22 3300027543 Ga0209999_1002190 Ga0209999_10021903 314
23 3300027695 Ga0209966_1000035 Ga0209966_100003512 314
24 3300028794 Ga0307515_10000011 Ga0307515_10000011247 314
25 3300048924 Ga0496121_0065545 Ga0496121_0065545_1176_2186 314
26 iso_pu_bacteria 2643221660 2644340825 314
27 iso_pu_bacteria 2831864461 2831869140 314
28 iso_pu_bacteria 2881101125 2881103523 314
29 3300005331 Ga0070670_100209046 Ga0070670_1002090462 315
30 3300005459 Ga0068867_100084146 Ga0068867_1000841463 315
31 3300025942 Ga0207689_10118101 Ga0207689_101181012 315
32 3300026089 Ga0207648_10066867 Ga0207648_100668672 315
33 3300038443 Ga0395901_0001676 Ga0395901_0001676_13884_14858 315
34 3300046462 Ga0495651_0040232 Ga0495651_0040232_1971_2945 315
35 3300046535 Ga0495586_0054921 Ga0495586_0054921_601_1626 315
36 3300046615 Ga0495656_0093610 Ga0495656_0093610_410_1360 315
37 3300046680 Ga0495646_0031501 Ga0495646_0031501_1178_2152 315
38 3300046691 Ga0495670_0034634 Ga0495670_0034634_652_1611 315
39 3300047317 Ga0495604_0096919 Ga0495604_0096919_193_1152 315
40 3300048088 Ga0495602_0135349 Ga0495602_0135349_419_1393 315
41 iso_pu_bacteria 2643221644 2644243366 315
42 iso_pu_bacteria 2818991436 2819543489 315
43 iso_pu_bacteria 2885192300 2885196698 315
44 3300005614 Ga0068856_100059328 Ga0068856_1000593284 316
45 3300014968 Ga0157379_10030374 Ga0157379_100303744 316
46 3300021361 Ga0213872_10000382 Ga0213872_1000038212 316
47 3300026041 Ga0207639_10279091 Ga0207639_102790912 316
48 3300026078 Ga0207702_10032304 Ga0207702_100323043 316
49 3300028794 Ga0307515_10028588 Ga0307515_100285888 316
50 3300031507 Ga0307509_10062290 Ga0307509_100622902 316
51 3300039447 Ga0436361_0566522 Ga0436361_0566522_22755_23741 316
52 3300044712 Ga0453684_0027299 Ga0453684_0027299_1532_2485 316
53 3300047472 Ga0495686_0012435 Ga0495686_0012435_1288_2241 316
54 3300050493 nmdc:mga0k408_8358_c1 nmdc:mga0k408_8358_c1_1045_1998 316
55 3300003316 rootH1_10015203 rootH1_100152035 317
56 3300003322 rootL2_10000966 rootL2_100009663 317
57 3300003323 rootH1_10000830 rootH1_100008305 317
58 3300003771 Ga0055526_1001991 Ga0055526_10019915 317
59 3300003794 Ga0055531_10009158 Ga0055531_100091583 317
60 3300005262 Ga0065165_1000101 Ga0065165_1000101108 317
61 3300005262 Ga0065165_1043062 Ga0065165_10430622 317
62 3300005338 Ga0068868_100025884 Ga0068868_1000258842 317
63 3300005347 Ga0070668_100117189 Ga0070668_1001171892 317
64 3300005353 Ga0070669_100071168 Ga0070669_1000711683 317
65 3300005354 Ga0070675_100076311 Ga0070675_1000763113 317
66 3300005355 Ga0070671_100021838 Ga0070671_1000218382 317
67 3300005456 Ga0070678_100086673 Ga0070678_1000866733 317
68 3300005618 Ga0068864_100157482 Ga0068864_1001574823 317
69 3300005840 Ga0068870_10054833 Ga0068870_100548332 317
70 3300006178 Ga0075367_10013667 Ga0075367_100136673 317
71 3300009147 Ga0114129_10149580 Ga0114129_101495802 317
72 3300009177 Ga0105248_10000507 Ga0105248_1000050718 317
73 3300012497 Ga0157319_1000008 Ga0157319_1000008100 317
74 3300014969 Ga0157376_10017920 Ga0157376_100179203 317
75 3300025273 Ga0209673_1023627 Ga0209673_10236272 317
76 3300025295 Ga0209564_1000008 Ga0209564_1000008635 317
77 3300025304 Ga0209257_1005624 Ga0209257_10056245 317
78 3300025893 Ga0207682_10042315 Ga0207682_100423152 317
79 3300025903 Ga0207680_10224614 Ga0207680_102246142 317
80 3300025908 Ga0207643_10067632 Ga0207643_100676322 317
81 3300025923 Ga0207681_10016551 Ga0207681_100165513 317
82 3300025926 Ga0207659_10021228 Ga0207659_100212282 317
83 3300025927 Ga0207687_10014488 Ga0207687_100144882 317
84 3300025937 Ga0207669_10022100 Ga0207669_100221002 317
85 3300025940 Ga0207691_10016738 Ga0207691_100167386 317
86 3300025941 Ga0207711_10146699 Ga0207711_101466992 317
87 3300026095 Ga0207676_10258686 Ga0207676_102586862 317
88 3300026121 Ga0207683_10116820 Ga0207683_101168202 317
89 3300028794 Ga0307515_10165132 Ga0307515_101651323 317
90 3300031456 Ga0307513_10069012 Ga0307513_100690122 317
91 3300037312 Ga0395899_0000586 Ga0395899_0000586_9987_10967 317
92 3300037312 Ga0395899_0074231 Ga0395899_0074231_1109_2077 317
93 3300037418 Ga0395900_0039728 Ga0395900_0039728_2651_3619 317
94 3300037418 Ga0395900_0054509 Ga0395900_0054509_3031_4011 317
95 3300037466 Ga0395898_0006225 Ga0395898_0006225_4866_5834 317
96 3300037471 Ga0395905_0013432 Ga0395905_0013432_5835_6815 317
97 3300037471 Ga0395905_0023384 Ga0395905_0023384_576_1544 317
98 3300037471 Ga0395905_0232081 Ga0395905_0232081_597_1562 317
99 3300038443 Ga0395901_0010431 Ga0395901_0010431_5043_6011 317
100 3300038443 Ga0395901_0130823 Ga0395901_0130823_1296_2276 317
101 3300039447 Ga0436361_0627254 Ga0436361_0627254_481_1461 317
102 3300042127 Ga0450890_006419 Ga0450890_006419_363_1370 317
103 3300042438 Ga0439459_0006802 Ga0439459_0006802_298_1305 317
104 3300042876 Ga0451577_0013180 Ga0451577_0013180_4185_5156 317
105 3300044658 Ga0466972_0074601 Ga0466972_0074601_234_1214 317
106 3300044684 Ga0466966_0063907 Ga0466966_0063907_1143_2123 317
107 3300046539 Ga0495621_0024847 Ga0495621_0024847_864_1823 317
108 3300048915 Ga0496112_0011308 Ga0496112_0011308_6787_7746 317
109 3300048928 Ga0496125_0000785 Ga0496125_0000785_45996_46985 317
110 3300049571 Ga0501034_0239499 Ga0501034_0239499_365_1345 317
111 3300050489 nmdc:mga03683_26256_c1 nmdc:mga03683_26256_c1_594_1547 317
112 3300050492 nmdc:mga0yw44_38057_c1 nmdc:mga0yw44_38057_c1_289_1254 317
113 3300050494 nmdc:mga06z11_42479_c1 nmdc:mga06z11_42479_c1_981_1946 317
114 3300053148 Ga0500590_002813 Ga0500590_002813_5852_6817 317
115 3300053156 Ga0500622_0004516 Ga0500622_0004516_4401_5468 317
116 3300059424 Ga0590075_010416 Ga0590075_010416_567_1523 317
117 3300061719 Ga0466962_0098610 Ga0466962_0098610_66_1046 317
118 iso_pu_bacteria 2585428062 2587759369 317
119 3300002705 JGI25156J39149_1007524 JGI25156J39149_10075242 318
120 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006364 318
121 3300002738 JGI25154J39366_1004037 JGI25154J39366_10040372 318
122 3300002771 JGI25163J39215_1001308 JGI25163J39215_10013084 318
123 3300002772 JGI25164J39214_1004328 JGI25164J39214_10043282 318
124 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006964 318
125 3300003575 Ga0007409J51694_1045597 Ga0007409J51694_10455972 318
126 3300003751 Ga0055538_1000034 Ga0055538_100003463 318
127 3300003752 Ga0055539_1000044 Ga0055539_100004463 318
128 3300003756 Ga0055533_1000055 Ga0055533_100005563 318
129 3300003759 Ga0055525_1000066 Ga0055525_1000066119 318
130 3300003775 Ga0055524_1000052 Ga0055524_100005293 318
131 3300003791 Ga0055530_10006857 Ga0055530_100068572 318
132 3300003792 Ga0055540_1000019 Ga0055540_100001917 318
133 3300003794 Ga0055531_10001074 Ga0055531_100010745 318
134 3300003841 Ga0055541_1000032 Ga0055541_1000032120 318
135 3300005344 Ga0070661_100001817 Ga0070661_1000018173 318
136 3300005366 Ga0070659_100000579 Ga0070659_1000005794 318
137 3300005366 Ga0070659_100141084 Ga0070659_1001410842 318
138 3300005564 Ga0070664_100003888 Ga0070664_10000388810 318
139 3300006237 Ga0097621_100159403 Ga0097621_1001594032 318
140 3300006946 Ga0079104_1000206 Ga0079104_100020636 318
141 3300009093 Ga0105240_10024611 Ga0105240_100246116 318
142 3300015262 Ga0182007_10031538 Ga0182007_100315382 318
143 3300015265 Ga0182005_1000283 Ga0182005_100028311 318
144 3300015265 Ga0182005_1017831 Ga0182005_10178311 318
145 3300025206 Ga0209435_101147 Ga0209435_1011472 318
146 3300025224 Ga0209784_100049 Ga0209784_100049119 318
147 3300025225 Ga0209566_100061 Ga0209566_100061119 318
148 3300025226 Ga0209674_100069 Ga0209674_100069168 318
149 3300025230 Ga0209563_100083 Ga0209563_100083119 318
150 3300025231 Ga0207427_100345 Ga0207427_1003454 318
151 3300025233 Ga0209437_100091 Ga0209437_100091167 318
152 3300025246 Ga0209646_1002496 Ga0209646_10024963 318
153 3300025253 Ga0209677_100039 Ga0209677_100039168 318
154 3300025256 Ga0209759_1001215 Ga0209759_100121511 318
155 3300025261 Ga0209233_1000115 Ga0209233_1000115167 318
156 3300025263 Ga0209565_1015528 Ga0209565_10155281 318
157 3300025298 Ga0209050_1001761 Ga0209050_100176117 318
158 3300025299 Ga0209256_1000036 Ga0209256_1000036223 318
159 3300025303 Ga0209051_1000071 Ga0209051_1000071164 318
160 3300025304 Ga0209257_1000367 Ga0209257_100036717 318
161 3300025913 Ga0207695_10019040 Ga0207695_100190402 318
162 3300025919 Ga0207657_10081075 Ga0207657_100810753 318
163 3300025920 Ga0207649_10001310 Ga0207649_100013104 318
164 3300025932 Ga0207690_10012412 Ga0207690_100124122 318
165 3300025945 Ga0207679_10000730 Ga0207679_100007305 318
166 3300025945 Ga0207679_10010415 Ga0207679_100104152 318
167 3300027111 Ga0209281_1000259 Ga0209281_100025935 318
168 3300028794 Ga0307515_10035182 Ga0307515_100351826 318
169 3300031456 Ga0307513_10155369 Ga0307513_101553692 318
170 3300032004 Ga0307414_10064209 Ga0307414_100642093 318
171 3300037312 Ga0395899_0001071 Ga0395899_0001071_4984_5967 318
172 3300037418 Ga0395900_0005380 Ga0395900_0005380_3125_4114 318
173 3300037471 Ga0395905_0022875 Ga0395905_0022875_639_1607 318
174 3300037471 Ga0395905_0113331 Ga0395905_0113331_49_1008 318
175 3300042121 Ga0450919_000198 Ga0450919_000198_3185_4150 318
176 3300042122 Ga0450920_012224 Ga0450920_012224_30_995 318
177 3300042531 Ga0450918_000047 Ga0450918_000047_751_1716 318
178 3300044656 Ga0466969_0038002 Ga0466969_0038002_290_1288 318
179 3300044656 Ga0466969_0098117 Ga0466969_0098117_289_1254 318
180 3300044684 Ga0466966_0007367 Ga0466966_0007367_1936_2901 318
181 3300044684 Ga0466966_0009518 Ga0466966_0009518_2840_3838 318
182 3300044694 Ga0466963_0006190 Ga0466963_0006190_1689_2654 318
183 3300044706 Ga0466964_0049836 Ga0466964_0049836_412_1377 318
184 3300044765 Ga0466970_0041588 Ga0466970_0041588_1037_2002 318
185 3300044842 Ga0466957_0068411 Ga0466957_0068411_520_1518 318
186 3300045976 Ga0466967_0159737 Ga0466967_0159737_1126_2091 318
187 3300046454 Ga0495592_0125944 Ga0495592_0125944_652_1638 318
188 3300046462 Ga0495651_0019143 Ga0495651_0019143_3181_4167 318
189 3300046462 Ga0495651_0025317 Ga0495651_0025317_1593_2579 318
190 3300046463 Ga0495653_0047008 Ga0495653_0047008_160_1146 318
191 3300046511 Ga0495608_0013966 Ga0495608_0013966_1350_2336 318
192 3300046511 Ga0495608_0056440 Ga0495608_0056440_414_1400 318
193 3300046514 Ga0495618_0154218 Ga0495618_0154218_340_1326 318
194 3300046516 Ga0495628_0001687 Ga0495628_0001687_2931_3917 318
195 3300046516 Ga0495628_0013853 Ga0495628_0013853_1525_2511 318
196 3300046516 Ga0495628_0322765 Ga0495628_0322765_99_1085 318
197 3300046529 Ga0495652_0008424 Ga0495652_0008424_5697_6683 318
198 3300046663 Ga0495635_0064709 Ga0495635_0064709_455_1441 318
199 3300046675 Ga0495657_0064886 Ga0495657_0064886_732_1718 318
200 3300046679 Ga0495623_0006819 Ga0495623_0006819_531_1517 318
201 3300046680 Ga0495646_0002576 Ga0495646_0002576_6721_7731 318
202 3300046683 Ga0495658_0035262 Ga0495658_0035262_866_1852 318
203 3300047317 Ga0495604_0044585 Ga0495604_0044585_1144_2130 318
204 3300048088 Ga0495602_0019713 Ga0495602_0019713_5591_6577 318
205 3300048904 Ga0496101_0342128 Ga0496101_0342128_170_1156 318
206 3300048905 Ga0496102_0025715 Ga0496102_0025715_1273_2235 318
207 3300048908 Ga0496105_0078475 Ga0496105_0078475_658_1668 318
208 3300048909 Ga0496106_0048622 Ga0496106_0048622_2025_2987 318
209 3300048917 Ga0496114_0003046 Ga0496114_0003046_1721_2686 318
210 3300048924 Ga0496121_0061186 Ga0496121_0061186_526_1488 318
211 3300048924 Ga0496121_0083876 Ga0496121_0083876_1227_2210 318
212 3300049574 Ga0501038_0058954 Ga0501038_0058954_1216_2190 318
213 3300049580 Ga0501046_0063108 Ga0501046_0063108_1262_2236 318
214 3300049682 Ga0501252_001618 Ga0501252_001618_331_1296 318
215 3300053077 Ga0495601_0044290 Ga0495601_0044290_1799_2785 318
216 3300053117 Ga0500593_001535 Ga0500593_001535_1351_2328 318
217 3300053119 Ga0500595_013753 Ga0500595_013753_1012_1998 318
218 3300053141 Ga0500574_000749 Ga0500574_000749_1875_2861 318
219 3300053154 Ga0500619_004153 Ga0500619_004153_1013_1999 318
220 iso_pu_bacteria 2643221592 2643971301 318
221 iso_pu_bacteria 2643221625 2644142057 318
222 iso_pu_bacteria 2643221648 2644275464 318
223 iso_pu_bacteria 2643221654 2644303038 318
224 iso_pu_bacteria 2643221672 2644400761 318
225 iso_pu_bacteria 2842747753 2842749718 318
226 3300004625 Ga0055543_1005706 Ga0055543_10057062 319
227 3300005262 Ga0065165_1000080 Ga0065165_1000080132 319
228 3300005295 Ga0065707_10100423 Ga0065707_101004233 319
229 3300005356 Ga0070674_100136341 Ga0070674_1001363412 319
230 3300005455 Ga0070663_100001569 Ga0070663_1000015697 319
231 3300005459 Ga0068867_100000072 Ga0068867_10000007246 319
232 3300006178 Ga0075367_10030265 Ga0075367_100302653 319
233 3300006178 Ga0075367_10085205 Ga0075367_100852052 319
234 3300006353 Ga0075370_10002604 Ga0075370_100026045 319
235 3300006353 Ga0075370_10011725 Ga0075370_100117253 319
236 3300006353 Ga0075370_10037246 Ga0075370_100372462 319
237 3300006846 Ga0075430_100078142 Ga0075430_1000781422 319
238 3300006880 Ga0075429_100000199 Ga0075429_10000019927 319
239 3300009148 Ga0105243_10001108 Ga0105243_1000110816 319
240 3300014745 Ga0157377_10000075 Ga0157377_1000007550 319
241 3300025321 Ga0207656_10080253 Ga0207656_100802532 319
242 3300025935 Ga0207709_10000625 Ga0207709_1000062518 319
243 3300025942 Ga0207689_10063571 Ga0207689_100635713 319
244 3300026067 Ga0207678_10002200 Ga0207678_1000220010 319
245 3300026089 Ga0207648_10000286 Ga0207648_1000028620 319
246 3300028381 Ga0268264_10115229 Ga0268264_101152292 319
247 3300028794 Ga0307515_10000278 Ga0307515_1000027867 319
248 3300031456 Ga0307513_10051134 Ga0307513_100511342 319
249 3300032002 Ga0307416_100168892 Ga0307416_1001688922 319
250 3300032002 Ga0307416_100179728 Ga0307416_1001797282 319
251 3300041404 Ga0439436_0002079 Ga0439436_0002079_1273_2232 319
252 3300041406 Ga0439439_0017596 Ga0439439_0017596_410_1369 319
253 3300041413 Ga0439465_0001094 Ga0439465_0001094_6480_7439 319
254 3300041997 Ga0439431_0011396 Ga0439431_0011396_37_996 319
255 3300042006 Ga0439432_006841 Ga0439432_006841_684_1643 319
256 3300042006 Ga0439432_013501 Ga0439432_013501_1102_2061 319
257 3300042007 Ga0439449_0004494 Ga0439449_0004494_2036_2995 319
258 3300042007 Ga0439449_0016763 Ga0439449_0016763_816_1775 319
259 3300042010 Ga0439452_013992 Ga0439452_013992_1262_2221 319
260 3300042014 Ga0439457_020415 Ga0439457_020415_321_1280 319
261 3300042015 Ga0439462_0015525 Ga0439462_0015525_888_1847 319
262 3300042156 Ga0439446_0012002 Ga0439446_0012002_901_1860 319
263 3300042435 Ga0439434_0004081 Ga0439434_0004081_3295_4254 319
264 3300044656 Ga0466969_0000013 Ga0466969_0000013_30461_31432 319
265 3300044684 Ga0466966_0019848 Ga0466966_0019848_124_1092 319
266 3300046522 Ga0495643_0149048 Ga0495643_0149048_13_975 319
267 3300046683 Ga0495658_0046686 Ga0495658_0046686_61_1101 319
268 3300046694 Ga0495649_0015647 Ga0495649_0015647_682_1644 319
269 3300047443 Ga0495687_000582 Ga0495687_000582_35959_36921 319
270 3300047443 Ga0495687_003988 Ga0495687_003988_6824_7786 319
271 3300048913 Ga0496110_0358531 Ga0496110_0358531_289_1299 319
272 3300048927 Ga0496124_0002378 Ga0496124_0002378_22170_23135 319
273 3300048928 Ga0496125_0049441 Ga0496125_0049441_952_1917 319
274 3300049579 Ga0501043_0000009 Ga0501043_0000009_46059_47024 319
275 3300049580 Ga0501046_0000022 Ga0501046_0000022_46048_47013 319
276 3300049581 Ga0501047_0000021 Ga0501047_0000021_46106_47071 319
277 3300049582 Ga0501048_0006915 Ga0501048_0006915_1099_2064 319
278 3300049824 Ga0501045_0020284 Ga0501045_0020284_1017_1982 319
279 3300050493 nmdc:mga0k408_51063_c1 nmdc:mga0k408_51063_c1_964_1923 319
280 3300050496 nmdc:mga07m45_12201_c1 nmdc:mga07m45_12201_c1_1498_2460 319
281 3300050496 nmdc:mga07m45_29688_c1 nmdc:mga07m45_29688_c1_233_1192 319
282 3300050496 nmdc:mga07m45_36397_c1 nmdc:mga07m45_36397_c1_177_1139 319
283 3300050508 nmdc:mga09592_14596_c1 nmdc:mga09592_14596_c1_4064_5026 319
284 3300050509 nmdc:mga0qj67_69170_c1 nmdc:mga0qj67_69170_c1_965_1927 319
285 3300053134 Ga0500658_0019270 Ga0500658_0019270_528_1490 319
286 3300053139 Ga0500568_0033306 Ga0500568_0033306_450_1436 319
287 3300053154 Ga0500619_000568 Ga0500619_000568_2623_3588 319
288 iso_pu_bacteria 2513020051 2513228784 319
289 iso_pu_bacteria 2599185214 2599620875 319
290 iso_pu_bacteria 2599185226 2599674319 319
291 iso_pu_bacteria 2599185227 2599678509 319
292 iso_pu_bacteria 2599185229 2599690386 319
293 iso_pu_bacteria 2643221628 2644161338 319
294 iso_pu_bacteria 2643221658 2644324055 319
295 iso_pu_bacteria 2643221683 2644466000 319
296 iso_pu_bacteria 2738541277 2738720723 319
297 iso_pu_bacteria 2738541307 2738882323 319
298 iso_pu_bacteria 2738543013 2739251909 319
299 iso_pu_bacteria 2738543019 2739279922 319
300 iso_pu_bacteria 2818991446 2819601998 319
301 iso_pu_bacteria 2831265667 2831269827 319
302 iso_pu_bacteria 2838054893 2838055155 319
303 iso_pu_bacteria 2842677519 2842680911 319
304 iso_pu_bacteria 2885198086 2885201848 319
305 iso_pu_bacteria 2885211737 2885215442 319
306 iso_pu_bacteria 2899924645 2899927245 319
307 iso_pu_bacteria 2904449895 2904453999 319
308 iso_pu_bacteria 2904456579 2904459463 319
309 iso_pu_bacteria 2904479285 2904479540 319
310 iso_pu_bacteria 2904541872 2904546117 319
311 iso_pu_bacteria 2919462493 2919465421 319
312 iso_pu_bacteria 2928037797 2928042840 319
313 iso_pu_bacteria 2928044640 2928048733 319
314 iso_pu_bacteria 2928051484 2928055065 319
315 iso_pu_bacteria 2928064002 2928068491 319
316 iso_pu_bacteria 2928070936 2928073603 319
317 iso_pu_bacteria 2928084124 2928089694 319
318 iso_pu_bacteria 2929160207 2929161314 319
319 iso_pu_bacteria 2929520902 2929521577 319
320 iso_pu_bacteria 2945945610 2945949787 319
321 iso_pu_bacteria 2945972063 2945973810 319
322 3300002705 JGI25156J39149_1001782 JGI25156J39149_10017823 320
323 3300002738 JGI25154J39366_1001302 JGI25154J39366_10013026 320
324 3300002741 JGI25157J39369_1000148 JGI25157J39369_100014839 320
325 3300003323 rootH1_10114267 rootH1_101142672 320
326 3300003752 Ga0055539_1000763 Ga0055539_10007632 320
327 3300003752 Ga0055539_1002964 Ga0055539_10029642 320
328 3300003756 Ga0055533_1000016 Ga0055533_1000016198 320
329 3300003759 Ga0055525_1001386 Ga0055525_10013863 320
330 3300003761 Ga0055535_1002036 Ga0055535_10020363 320
331 3300003763 Ga0055529_1000333 Ga0055529_100033331 320
332 3300003792 Ga0055540_1011021 Ga0055540_10110212 320
333 3300005327 Ga0070658_10100789 Ga0070658_101007892 320
334 3300005328 Ga0070676_10034778 Ga0070676_100347783 320
335 3300005330 Ga0070690_100055811 Ga0070690_1000558113 320
336 3300005331 Ga0070670_100199404 Ga0070670_1001994041 320
337 3300005334 Ga0068869_100010879 Ga0068869_1000108795 320
338 3300005334 Ga0068869_100065097 Ga0068869_1000650973 320
339 3300005355 Ga0070671_100095343 Ga0070671_1000953433 320
340 3300005364 Ga0070673_100029046 Ga0070673_1000290463 320
341 3300005459 Ga0068867_100039511 Ga0068867_1000395113 320
342 3300005530 Ga0070679_100016827 Ga0070679_1000168272 320
343 3300005543 Ga0070672_100027758 Ga0070672_1000277583 320
344 3300005548 Ga0070665_100050202 Ga0070665_1000502024 320
345 3300005577 Ga0068857_100112626 Ga0068857_1001126262 320
346 3300005578 Ga0068854_100023360 Ga0068854_1000233603 320
347 3300005614 Ga0068856_100012944 Ga0068856_1000129442 320
348 3300005614 Ga0068856_100443477 Ga0068856_1004434772 320
349 3300005719 Ga0068861_100146023 Ga0068861_1001460232 320
350 3300006178 Ga0075367_10125705 Ga0075367_101257052 320
351 3300006195 Ga0075366_10075317 Ga0075366_100753172 320
352 3300006195 Ga0075366_10103866 Ga0075366_101038662 320
353 3300009098 Ga0105245_10442779 Ga0105245_104427792 320
354 3300009545 Ga0105237_10367620 Ga0105237_103676202 320
355 3300009551 Ga0105238_10081997 Ga0105238_100819972 320
356 3300010375 Ga0105239_10166314 Ga0105239_101663142 320
357 3300013105 Ga0157369_10059000 Ga0157369_100590002 320
358 3300014968 Ga0157379_10266193 Ga0157379_102661932 320
359 3300025226 Ga0209674_100041 Ga0209674_100041187 320
360 3300025228 Ga0209672_102207 Ga0209672_1022071 320
361 3300025230 Ga0209563_100043 Ga0209563_100043187 320
362 3300025231 Ga0207427_100646 Ga0207427_1006465 320
363 3300025242 Ga0209258_100344 Ga0209258_10034427 320
364 3300025242 Ga0209258_100785 Ga0209258_1007853 320
365 3300025246 Ga0209646_1000069 Ga0209646_1000069105 320
366 3300025250 Ga0209026_1000006 Ga0209026_1000006200 320
367 3300025253 Ga0209677_100096 Ga0209677_10009680 320
368 3300025253 Ga0209677_101194 Ga0209677_10119410 320
369 3300025254 Ga0209148_1008882 Ga0209148_10088822 320
370 3300025256 Ga0209759_1000075 Ga0209759_1000075105 320
371 3300025256 Ga0209759_1001295 Ga0209759_10012953 320
372 3300025256 Ga0209759_1003631 Ga0209759_10036313 320
373 3300025256 Ga0209759_1012969 Ga0209759_10129692 320
374 3300025256 Ga0209759_1014554 Ga0209759_10145542 320
375 3300025272 Ga0209455_1000242 Ga0209455_100024232 320
376 3300025303 Ga0209051_1001503 Ga0209051_100150319 320
377 3300025907 Ga0207645_10037909 Ga0207645_100379092 320
378 3300025909 Ga0207705_10017381 Ga0207705_100173814 320
379 3300025909 Ga0207705_10061682 Ga0207705_100616823 320
380 3300025913 Ga0207695_10108240 Ga0207695_101082402 320
381 3300025913 Ga0207695_10116955 Ga0207695_101169551 320
382 3300025919 Ga0207657_10156024 Ga0207657_101560242 320
383 3300025921 Ga0207652_10018335 Ga0207652_100183354 320
384 3300025925 Ga0207650_10077646 Ga0207650_100776463 320
385 3300025940 Ga0207691_10043548 Ga0207691_100435483 320
386 3300025942 Ga0207689_10061308 Ga0207689_100613083 320
387 3300025942 Ga0207689_10277214 Ga0207689_102772142 320
388 3300025949 Ga0207667_10024656 Ga0207667_100246564 320
389 3300025981 Ga0207640_10023034 Ga0207640_100230343 320
390 3300026078 Ga0207702_10000305 Ga0207702_1000030515 320
391 3300026089 Ga0207648_10000878 Ga0207648_1000087830 320
392 3300026116 Ga0207674_10102936 Ga0207674_101029362 320
393 3300026118 Ga0207675_100008217 Ga0207675_1000082177 320
394 3300026142 Ga0207698_10062309 Ga0207698_100623092 320
395 3300028666 Ga0265336_10000013 Ga0265336_10000013178 320
396 3300028794 Ga0307515_10009653 Ga0307515_1000965312 320
397 3300028794 Ga0307515_10037795 Ga0307515_100377958 320
398 3300028794 Ga0307515_10040145 Ga0307515_100401457 320
399 3300029957 Ga0265324_10000193 Ga0265324_1000019335 320
400 3300031456 Ga0307513_10043473 Ga0307513_100434734 320
401 3300031507 Ga0307509_10072259 Ga0307509_100722593 320
402 3300031507 Ga0307509_10271113 Ga0307509_102711132 320
403 3300031616 Ga0307508_10000123 Ga0307508_100001233 320
404 3300031616 Ga0307508_10189187 Ga0307508_101891871 320
405 3300031616 Ga0307508_10245087 Ga0307508_102450872 320
406 3300031649 Ga0307514_10000355 Ga0307514_1000035554 320
407 3300031649 Ga0307514_10010918 Ga0307514_100109187 320
408 3300031730 Ga0307516_10001850 Ga0307516_1000185012 320
409 3300031730 Ga0307516_10044066 Ga0307516_100440664 320
410 3300034820 Ga0373959_0006082 Ga0373959_0006082_762_1778 320
411 3300035691 Ga0373931_0122546 Ga0373931_0122546_409_1431 320
412 3300037466 Ga0395898_0004069 Ga0395898_0004069_1090_2106 320
413 3300037471 Ga0395905_0000474 Ga0395905_0000474_27229_28206 320
414 3300037471 Ga0395905_0023805 Ga0395905_0023805_4397_5380 320
415 3300037471 Ga0395905_0060047 Ga0395905_0060047_208_1188 320
416 3300038443 Ga0395901_0002111 Ga0395901_0002111_3296_4312 320
417 3300039447 Ga0436361_0591904 Ga0436361_0591904_996_2018 320
418 3300039447 Ga0436361_1134487 Ga0436361_1134487_1758_2780 320
419 3300041496 Ga0451839_1446416 Ga0451839_1446416_43_1011 320
420 3300042007 Ga0439449_0000840 Ga0439449_0000840_2893_3870 320
421 3300042007 Ga0439449_0053043 Ga0439449_0053043_500_1474 320
422 3300042015 Ga0439462_0013086 Ga0439462_0013086_1094_2071 320
423 3300042128 Ga0450897_001948 Ga0450897_001948_58_1032 320
424 3300042435 Ga0439434_0043675 Ga0439434_0043675_378_1358 320
425 3300045836 Ga0466958_0007549 Ga0466958_0007549_35_1057 320
426 3300046457 Ga0495590_0005173 Ga0495590_0005173_4064_5047 320
427 3300046506 Ga0495583_0000081 Ga0495583_0000081_49044_50057 320
428 3300046507 Ga0495606_0001086 Ga0495606_0001086_2776_3789 320
429 3300046512 Ga0495610_0025702 Ga0495610_0025702_1242_2210 320
430 3300046616 Ga0495668_0046750 Ga0495668_0046750_30_1043 320
431 3300046660 Ga0495625_0006045 Ga0495625_0006045_6846_7814 320
432 3300046660 Ga0495625_0034941 Ga0495625_0034941_2624_3637 320
433 3300046684 Ga0495669_0012571 Ga0495669_0012571_2012_3025 320
434 3300046694 Ga0495649_0000287 Ga0495649_0000287_1066_2079 320
435 3300046794 Ga0495589_0008991 Ga0495589_0008991_4054_5067 320
436 3300047472 Ga0495686_0075315 Ga0495686_0075315_72_1088 320
437 3300048903 Ga0496100_0092730 Ga0496100_0092730_507_1523 320
438 3300048912 Ga0496109_0073499 Ga0496109_0073499_2015_3031 320
439 3300050493 nmdc:mga0k408_86717_c1 nmdc:mga0k408_86717_c1_18_986 320
440 3300050494 nmdc:mga06z11_190863_c1 nmdc:mga06z11_190863_c1_94_1062 320
441 3300053136 Ga0500559_0022035 Ga0500559_0022035_1541_2563 320
442 3300053739 Ga0500587_000477 Ga0500587_000477_2726_3694 320
443 iso_pu_bacteria 2547132374 2548499213 320
444 iso_pu_bacteria 2643221570 2643866047 320
445 iso_pu_bacteria 2643221596 2643994044 320
446 iso_pu_bacteria 2643221652 2644292858 320
447 iso_pu_bacteria 2643221717 2644647876 320
448 iso_pu_bacteria 2954767861 2954770597 320
449 iso_pu_bacteria 2990710928 2990714101 320
450 3300003316 rootH1_10010206 rootH1_100102062 321
451 3300003784 Ga0055534_1001847 Ga0055534_10018475 321
452 3300003791 Ga0055530_10015568 Ga0055530_100155682 321
453 3300003792 Ga0055540_1006211 Ga0055540_10062113 321
454 3300003794 Ga0055531_10000360 Ga0055531_100003603 321
455 3300003794 Ga0055531_10003311 Ga0055531_100033115 321
456 3300005262 Ga0065165_1003865 Ga0065165_10038655 321
457 3300005327 Ga0070658_10227236 Ga0070658_102272362 321
458 3300005328 Ga0070676_10012151 Ga0070676_100121512 321
459 3300005329 Ga0070683_100087729 Ga0070683_1000877292 321
460 3300005330 Ga0070690_100022459 Ga0070690_1000224592 321
461 3300005331 Ga0070670_100086045 Ga0070670_1000860453 321
462 3300005331 Ga0070670_100138057 Ga0070670_1001380572 321
463 3300005333 Ga0070677_10032005 Ga0070677_100320052 321
464 3300005333 Ga0070677_10140655 Ga0070677_101406551 321
465 3300005334 Ga0068869_100061795 Ga0068869_1000617953 321
466 3300005343 Ga0070687_100030101 Ga0070687_1000301012 321
467 3300005347 Ga0070668_100024251 Ga0070668_1000242513 321
468 3300005354 Ga0070675_100318094 Ga0070675_1003180942 321
469 3300005355 Ga0070671_100216587 Ga0070671_1002165872 321
470 3300005356 Ga0070674_100146065 Ga0070674_1001460652 321
471 3300005367 Ga0070667_100017022 Ga0070667_1000170223 321
472 3300005367 Ga0070667_100063689 Ga0070667_1000636892 321
473 3300005445 Ga0070708_100143642 Ga0070708_1001436422 321
474 3300005455 Ga0070663_100416172 Ga0070663_1004161721 321
475 3300005456 Ga0070678_100164593 Ga0070678_1001645932 321
476 3300005456 Ga0070678_100408253 Ga0070678_1004082532 321
477 3300005457 Ga0070662_100034033 Ga0070662_1000340333 321
478 3300005459 Ga0068867_100014505 Ga0068867_1000145053 321
479 3300005467 Ga0070706_100003148 Ga0070706_10000314813 321
480 3300005530 Ga0070679_100458852 Ga0070679_1004588522 321
481 3300005535 Ga0070684_100233184 Ga0070684_1002331842 321
482 3300005543 Ga0070672_100053209 Ga0070672_1000532092 321
483 3300005548 Ga0070665_100093595 Ga0070665_1000935952 321
484 3300005563 Ga0068855_100013525 Ga0068855_1000135255 321
485 3300005564 Ga0070664_100095364 Ga0070664_1000953642 321
486 3300005564 Ga0070664_100308447 Ga0070664_1003084472 321
487 3300005564 Ga0070664_100480371 Ga0070664_1004803711 321
488 3300005616 Ga0068852_100028494 Ga0068852_1000284944 321
489 3300005616 Ga0068852_100085784 Ga0068852_1000857843 321
490 3300005616 Ga0068852_100198506 Ga0068852_1001985062 321
491 3300005617 Ga0068859_100231075 Ga0068859_1002310752 321
492 3300005617 Ga0068859_100327980 Ga0068859_1003279802 321
493 3300005618 Ga0068864_100082398 Ga0068864_1000823982 321
494 3300005718 Ga0068866_10033347 Ga0068866_100333473 321
495 3300005719 Ga0068861_100001649 Ga0068861_10000164911 321
496 3300005834 Ga0068851_10115492 Ga0068851_101154922 321
497 3300005841 Ga0068863_100083801 Ga0068863_1000838013 321
498 3300005841 Ga0068863_100189569 Ga0068863_1001895692 321
499 3300005842 Ga0068858_100028870 Ga0068858_1000288703 321
500 3300005842 Ga0068858_100188292 Ga0068858_1001882922 321
501 3300005843 Ga0068860_100013253 Ga0068860_1000132536 321
502 3300005843 Ga0068860_100156493 Ga0068860_1001564932 321
503 3300005844 Ga0068862_100028602 Ga0068862_1000286022 321
504 3300006038 Ga0075365_10034744 Ga0075365_100347443 321
505 3300006048 Ga0075363_100053453 Ga0075363_1000534532 321
506 3300006051 Ga0075364_10194821 Ga0075364_101948212 321
507 3300006195 Ga0075366_10040155 Ga0075366_100401552 321
508 3300006353 Ga0075370_10000547 Ga0075370_1000054711 321
509 3300006353 Ga0075370_10040108 Ga0075370_100401083 321
510 3300006353 Ga0075370_10075281 Ga0075370_100752812 321
511 3300006358 Ga0068871_100130241 Ga0068871_1001302413 321
512 3300006931 Ga0097620_100231087 Ga0097620_1002310872 321
513 3300006931 Ga0097620_100327959 Ga0097620_1003279592 321
514 3300009093 Ga0105240_10062071 Ga0105240_100620713 321
515 3300009176 Ga0105242_10615719 Ga0105242_106157191 321
516 3300009551 Ga0105238_10020663 Ga0105238_100206634 321
517 3300009553 Ga0105249_10022308 Ga0105249_100223085 321
518 3300013306 Ga0163162_10026342 Ga0163162_100263423 321
519 3300013308 Ga0157375_10046187 Ga0157375_100461875 321
520 3300013308 Ga0157375_10095187 Ga0157375_100951873 321
521 3300013308 Ga0157375_10112718 Ga0157375_101127182 321
522 3300014325 Ga0163163_10165401 Ga0163163_101654012 321
523 3300014325 Ga0163163_10580674 Ga0163163_105806741 321
524 3300014326 Ga0157380_10015463 Ga0157380_100154635 321
525 3300014326 Ga0157380_10102260 Ga0157380_101022602 321
526 3300014968 Ga0157379_10034913 Ga0157379_100349134 321
527 3300014968 Ga0157379_10061361 Ga0157379_100613613 321
528 3300014968 Ga0157379_10093358 Ga0157379_100933582 321
529 3300014969 Ga0157376_10142978 Ga0157376_101429783 321
530 3300025273 Ga0209673_1018628 Ga0209673_10186282 321
531 3300025273 Ga0209673_1032796 Ga0209673_10327962 321
532 3300025291 Ga0209675_1006399 Ga0209675_10063994 321
533 3300025292 Ga0209676_1006433 Ga0209676_10064334 321
534 3300025298 Ga0209050_1001765 Ga0209050_100176517 321
535 3300025303 Ga0209051_1000025 Ga0209051_1000025287 321
536 3300025304 Ga0209257_1000039 Ga0209257_1000039321 321
537 3300025899 Ga0207642_10010253 Ga0207642_100102534 321
538 3300025903 Ga0207680_10168886 Ga0207680_101688862 321
539 3300025907 Ga0207645_10008088 Ga0207645_100080886 321
540 3300025907 Ga0207645_10102595 Ga0207645_101025952 321
541 3300025918 Ga0207662_10029185 Ga0207662_100291852 321
542 3300025919 Ga0207657_10021426 Ga0207657_100214265 321
543 3300025920 Ga0207649_10176533 Ga0207649_101765332 321
544 3300025921 Ga0207652_10194118 Ga0207652_101941182 321
545 3300025923 Ga0207681_10000593 Ga0207681_100005933 321
546 3300025925 Ga0207650_10001668 Ga0207650_1000166810 321
547 3300025925 Ga0207650_10008263 Ga0207650_100082632 321
548 3300025926 Ga0207659_10105397 Ga0207659_101053972 321
549 3300025940 Ga0207691_10080536 Ga0207691_100805363 321
550 3300025942 Ga0207689_10022702 Ga0207689_100227024 321
551 3300025944 Ga0207661_10142760 Ga0207661_101427602 321
552 3300025945 Ga0207679_10131331 Ga0207679_101313312 321
553 3300025949 Ga0207667_10026800 Ga0207667_100268002 321
554 3300025960 Ga0207651_10028358 Ga0207651_100283582 321
555 3300025960 Ga0207651_10252192 Ga0207651_102521922 321
556 3300025961 Ga0207712_10067108 Ga0207712_100671082 321
557 3300025972 Ga0207668_10004390 Ga0207668_100043905 321
558 3300025986 Ga0207658_10005270 Ga0207658_100052704 321
559 3300025986 Ga0207658_10007685 Ga0207658_100076852 321
560 3300025986 Ga0207658_10021561 Ga0207658_100215614 321
561 3300026035 Ga0207703_10005198 Ga0207703_100051983 321
562 3300026035 Ga0207703_10033516 Ga0207703_100335163 321
563 3300026035 Ga0207703_10163573 Ga0207703_101635732 321
564 3300026041 Ga0207639_10227734 Ga0207639_102277342 321
565 3300026067 Ga0207678_10147260 Ga0207678_101472601 321
566 3300026075 Ga0207708_10044032 Ga0207708_100440322 321
567 3300026088 Ga0207641_10006528 Ga0207641_100065283 321
568 3300026088 Ga0207641_10322836 Ga0207641_103228362 321
569 3300026089 Ga0207648_10024038 Ga0207648_100240383 321
570 3300026089 Ga0207648_10105019 Ga0207648_101050193 321
571 3300026095 Ga0207676_10021802 Ga0207676_100218024 321
572 3300026118 Ga0207675_100037604 Ga0207675_1000376045 321
573 3300026142 Ga0207698_10004685 Ga0207698_100046855 321
574 3300026142 Ga0207698_10059137 Ga0207698_100591373 321
575 3300028379 Ga0268266_10559763 Ga0268266_105597631 321
576 3300028381 Ga0268264_10062766 Ga0268264_100627663 321
577 3300028381 Ga0268264_10112149 Ga0268264_101121492 321
578 3300028786 Ga0307517_10000131 Ga0307517_1000013126 321
579 3300028786 Ga0307517_10069239 Ga0307517_100692393 321
580 3300028786 Ga0307517_10155715 Ga0307517_101557152 321
581 3300028794 Ga0307515_10089622 Ga0307515_100896222 321
582 3300028794 Ga0307515_10120653 Ga0307515_101206533 321
583 3300031507 Ga0307509_10000871 Ga0307509_1000087140 321
584 3300031507 Ga0307509_10009460 Ga0307509_100094602 321
585 3300031507 Ga0307509_10071281 Ga0307509_100712813 321
586 3300031507 Ga0307509_10086638 Ga0307509_100866383 321
587 3300031507 Ga0307509_10158271 Ga0307509_101582712 321
588 3300031616 Ga0307508_10000349 Ga0307508_1000034929 321
589 3300031616 Ga0307508_10046060 Ga0307508_100460602 321
590 3300031616 Ga0307508_10061411 Ga0307508_100614113 321
591 3300031649 Ga0307514_10001708 Ga0307514_100017085 321
592 3300031649 Ga0307514_10057518 Ga0307514_100575182 321
593 3300031730 Ga0307516_10004605 Ga0307516_1000460511 321
594 3300031730 Ga0307516_10146531 Ga0307516_101465312 321
595 3300031731 Ga0307405_10014665 Ga0307405_100146654 321
596 3300031901 Ga0307406_10042058 Ga0307406_100420582 321
597 3300031911 Ga0307412_10054471 Ga0307412_100544712 321
598 3300031995 Ga0307409_100000926 Ga0307409_1000009266 321
599 3300032002 Ga0307416_100003028 Ga0307416_1000030282 321
600 3300032002 Ga0307416_100502519 Ga0307416_1005025192 321
601 3300032005 Ga0307411_10041081 Ga0307411_100410812 321
602 3300032126 Ga0307415_100003743 Ga0307415_1000037436 321
603 3300033180 Ga0307510_10008226 Ga0307510_100082266 321
604 3300033180 Ga0307510_10069826 Ga0307510_100698263 321
605 3300033180 Ga0307510_10201778 Ga0307510_102017782 321
606 3300035725 Ga0373947_0070940 Ga0373947_0070940_682_1662 321
607 3300037068 Ga0373925_0435975 Ga0373925_0435975_27_998 321
608 3300037418 Ga0395900_0000058 Ga0395900_0000058_141661_142635 321
609 3300037466 Ga0395898_0000283 Ga0395898_0000283_90210_91184 321
610 3300037471 Ga0395905_0070264 Ga0395905_0070264_1505_2497 321
611 3300041456 Ga0451795_0816552 Ga0451795_0816552_720_1706 321
612 3300041460 Ga0451802_0878914 Ga0451802_0878914_12_989 321
613 3300041512 Ga0451853_2222586 Ga0451853_2222586_131_1111 321
614 3300042115 Ga0450911_001146 Ga0450911_001146_2595_3569 321
615 3300042876 Ga0451577_0010228 Ga0451577_0010228_7672_8658 321
616 3300044658 Ga0466972_0078819 Ga0466972_0078819_369_1343 321
617 3300044683 Ga0466965_0072665 Ga0466965_0072665_435_1406 321
618 3300045049 Ga0466959_0086352 Ga0466959_0086352_1138_2148 321
619 3300046454 Ga0495592_0000394 Ga0495592_0000394_32775_33746 321
620 3300046460 Ga0495638_0139249 Ga0495638_0139249_166_1152 321
621 3300046471 Ga0495650_0019463 Ga0495650_0019463_1275_2249 321
622 3300046512 Ga0495610_0061924 Ga0495610_0061924_591_1562 321
623 3300046517 Ga0495630_0154828 Ga0495630_0154828_427_1398 321
624 3300046519 Ga0495632_0010162 Ga0495632_0010162_1443_2429 321
625 3300046522 Ga0495643_0067736 Ga0495643_0067736_611_1579 321
626 3300046543 Ga0495645_0062491 Ga0495645_0062491_368_1348 321
627 3300046648 Ga0495611_0087562 Ga0495611_0087562_125_1141 321
628 3300046680 Ga0495646_0141327 Ga0495646_0141327_43_1014 321
629 3300046683 Ga0495658_0037493 Ga0495658_0037493_985_1965 321
630 3300046690 Ga0495624_0062388 Ga0495624_0062388_44_1015 321
631 3300047471 Ga0495684_0157686 Ga0495684_0157686_608_1588 321
632 3300047673 Ga0495593_0101135 Ga0495593_0101135_487_1458 321
633 3300048911 Ga0496108_0236330 Ga0496108_0236330_211_1197 321
634 3300048924 Ga0496121_0035310 Ga0496121_0035310_772_1746 321
635 3300048927 Ga0496124_0097272 Ga0496124_0097272_968_1942 321
636 3300048928 Ga0496125_0013437 Ga0496125_0013437_2835_3818 321
637 3300048928 Ga0496125_0070483 Ga0496125_0070483_802_1776 321
638 3300049822 Ga0501035_0238000 Ga0501035_0238000_244_1239 321
639 3300050489 nmdc:mga03683_32284_c1 nmdc:mga03683_32284_c1_219_1190 321
640 3300050493 nmdc:mga0k408_14868_c1 nmdc:mga0k408_14868_c1_3031_4002 321
641 3300050493 nmdc:mga0k408_28083_c1 nmdc:mga0k408_28083_c1_1057_2043 321
642 3300050494 nmdc:mga06z11_115211_c1 nmdc:mga06z11_115211_c1_105_1079 321
643 3300050494 nmdc:mga06z11_52833_c1 nmdc:mga06z11_52833_c1_979_1950 321
644 3300050496 nmdc:mga07m45_221111_c1 nmdc:mga07m45_221111_c1_83_1051 321
645 3300050496 nmdc:mga07m45_81_c1 nmdc:mga07m45_81_c1_14365_15336 321
646 3300050516 nmdc:mga0sz30_21551_c1 nmdc:mga0sz30_21551_c1_1062_2033 321
647 3300053086 Ga0500578_0000652 Ga0500578_0000652_13006_13980 321
648 3300053090 Ga0500646_0020168 Ga0500646_0020168_574_1560 321
649 3300053093 Ga0500651_0008514 Ga0500651_0008514_449_1435 321
650 3300053118 Ga0500594_0005643 Ga0500594_0005643_1232_2203 321
651 3300053129 Ga0500628_002238 Ga0500628_002238_1146_2132 321
652 3300053131 Ga0500652_005856 Ga0500652_005856_1602_2588 321
653 3300053136 Ga0500559_0000446 Ga0500559_0000446_2671_3642 321
654 3300053156 Ga0500622_0000124 Ga0500622_0000124_12418_13404 321
655 3300053156 Ga0500622_0009123 Ga0500622_0009123_611_1582 321
656 iso_pu_bacteria 2585428057 2587728306 321
657 iso_pu_bacteria 2585428058 2587734486 321
658 iso_pu_bacteria 2588253510 2588295024 321
659 iso_pu_bacteria 2928115317 2928117250 321
660 3300003792 Ga0055540_1007850 Ga0055540_10078503 322
661 3300003794 Ga0055531_10012618 Ga0055531_100126183 322
662 3300005328 Ga0070676_10011159 Ga0070676_100111592 322
663 3300005329 Ga0070683_100029368 Ga0070683_1000293682 322
664 3300005331 Ga0070670_100115775 Ga0070670_1001157752 322
665 3300005331 Ga0070670_100252130 Ga0070670_1002521302 322
666 3300005334 Ga0068869_100027914 Ga0068869_1000279142 322
667 3300005335 Ga0070666_10050920 Ga0070666_100509202 322
668 3300005337 Ga0070682_100085166 Ga0070682_1000851662 322
669 3300005338 Ga0068868_100057346 Ga0068868_1000573463 322
670 3300005338 Ga0068868_100073336 Ga0068868_1000733363 322
671 3300005339 Ga0070660_100128252 Ga0070660_1001282522 322
672 3300005344 Ga0070661_100100058 Ga0070661_1001000582 322
673 3300005347 Ga0070668_100119935 Ga0070668_1001199352 322
674 3300005353 Ga0070669_100034251 Ga0070669_1000342512 322
675 3300005353 Ga0070669_100072824 Ga0070669_1000728242 322
676 3300005354 Ga0070675_100064813 Ga0070675_1000648132 322
677 3300005355 Ga0070671_100076886 Ga0070671_1000768862 322
678 3300005364 Ga0070673_100060598 Ga0070673_1000605982 322
679 3300005366 Ga0070659_100138085 Ga0070659_1001380852 322
680 3300005455 Ga0070663_100005909 Ga0070663_1000059096 322
681 3300005456 Ga0070678_100013580 Ga0070678_1000135802 322
682 3300005456 Ga0070678_100185324 Ga0070678_1001853241 322
683 3300005457 Ga0070662_100054096 Ga0070662_1000540963 322
684 3300005457 Ga0070662_100055624 Ga0070662_1000556242 322
685 3300005458 Ga0070681_10232499 Ga0070681_102324992 322
686 3300005543 Ga0070672_100161318 Ga0070672_1001613182 322
687 3300005543 Ga0070672_100228763 Ga0070672_1002287631 322
688 3300005547 Ga0070693_100011646 Ga0070693_1000116462 322
689 3300005563 Ga0068855_100050047 Ga0068855_1000500472 322
690 3300005563 Ga0068855_100176827 Ga0068855_1001768272 322
691 3300005564 Ga0070664_100017203 Ga0070664_1000172032 322
692 3300005577 Ga0068857_100068892 Ga0068857_1000688923 322
693 3300005614 Ga0068856_100059918 Ga0068856_1000599182 322
694 3300005616 Ga0068852_100095692 Ga0068852_1000956922 322
695 3300005616 Ga0068852_100114168 Ga0068852_1001141682 322
696 3300005616 Ga0068852_100208459 Ga0068852_1002084592 322
697 3300005617 Ga0068859_100033863 Ga0068859_1000338633 322
698 3300005618 Ga0068864_100049681 Ga0068864_1000496812 322
699 3300005618 Ga0068864_100056292 Ga0068864_1000562923 322
700 3300005719 Ga0068861_100024567 Ga0068861_1000245673 322
701 3300005840 Ga0068870_10115178 Ga0068870_101151782 322
702 3300005841 Ga0068863_100031768 Ga0068863_1000317684 322
703 3300005841 Ga0068863_100038412 Ga0068863_1000384122 322
704 3300005841 Ga0068863_100051637 Ga0068863_1000516372 322
705 3300005843 Ga0068860_100197279 Ga0068860_1001972792 322
706 3300005843 Ga0068860_100204213 Ga0068860_1002042132 322
707 3300005844 Ga0068862_100058125 Ga0068862_1000581253 322
708 3300006186 Ga0075369_10038509 Ga0075369_100385092 322
709 3300006237 Ga0097621_100081669 Ga0097621_1000816693 322
710 3300006358 Ga0068871_100093767 Ga0068871_1000937673 322
711 3300006881 Ga0068865_100079132 Ga0068865_1000791322 322
712 3300006931 Ga0097620_100033861 Ga0097620_1000338613 322
713 3300009098 Ga0105245_10102204 Ga0105245_101022042 322
714 3300009176 Ga0105242_10079059 Ga0105242_100790593 322
715 3300009177 Ga0105248_10123485 Ga0105248_101234853 322
716 3300009177 Ga0105248_10154142 Ga0105248_101541422 322
717 3300009551 Ga0105238_10227899 Ga0105238_102278992 322
718 3300009553 Ga0105249_10010561 Ga0105249_100105617 322
719 3300013100 Ga0157373_10037740 Ga0157373_100377403 322
720 3300013296 Ga0157374_10097347 Ga0157374_100973473 322
721 3300013296 Ga0157374_10170314 Ga0157374_101703142 322
722 3300013306 Ga0163162_10007695 Ga0163162_1000769511 322
723 3300013307 Ga0157372_10051925 Ga0157372_100519253 322
724 3300013308 Ga0157375_10099385 Ga0157375_100993852 322
725 3300013308 Ga0157375_10130614 Ga0157375_101306142 322
726 3300014325 Ga0163163_10251023 Ga0163163_102510232 322
727 3300014326 Ga0157380_10112388 Ga0157380_101123882 322
728 3300014326 Ga0157380_10281039 Ga0157380_102810392 322
729 3300014326 Ga0157380_10548396 Ga0157380_105483961 322
730 3300014497 Ga0182008_10001156 Ga0182008_1000115615 322
731 3300014497 Ga0182008_10004095 Ga0182008_100040955 322
732 3300014745 Ga0157377_10023652 Ga0157377_100236523 322
733 3300014968 Ga0157379_10122709 Ga0157379_101227093 322
734 3300014969 Ga0157376_10206022 Ga0157376_102060222 322
735 3300014969 Ga0157376_10227786 Ga0157376_102277862 322
736 3300015683 Ga0183362_10003 Ga0183362_10003879 322
737 3300017792 Ga0163161_10090355 Ga0163161_100903552 322
738 3300025292 Ga0209676_1006821 Ga0209676_10068214 322
739 3300025298 Ga0209050_1001635 Ga0209050_100163516 322
740 3300025303 Ga0209051_1001081 Ga0209051_100108118 322
741 3300025304 Ga0209257_1003430 Ga0209257_100343011 322
742 3300025321 Ga0207656_10062157 Ga0207656_100621572 322
743 3300025893 Ga0207682_10040791 Ga0207682_100407912 322
744 3300025899 Ga0207642_10182304 Ga0207642_101823041 322
745 3300025903 Ga0207680_10145423 Ga0207680_101454232 322
746 3300025907 Ga0207645_10064845 Ga0207645_100648452 322
747 3300025909 Ga0207705_10121110 Ga0207705_101211102 322
748 3300025919 Ga0207657_10065236 Ga0207657_100652363 322
749 3300025919 Ga0207657_10113479 Ga0207657_101134792 322
750 3300025920 Ga0207649_10022011 Ga0207649_100220112 322
751 3300025923 Ga0207681_10112309 Ga0207681_101123092 322
752 3300025924 Ga0207694_10036617 Ga0207694_100366172 322
753 3300025925 Ga0207650_10343548 Ga0207650_103435481 322
754 3300025926 Ga0207659_10025527 Ga0207659_100255272 322
755 3300025931 Ga0207644_10001504 Ga0207644_100015046 322
756 3300025932 Ga0207690_10117694 Ga0207690_101176942 322
757 3300025932 Ga0207690_10150421 Ga0207690_101504212 322
758 3300025933 Ga0207706_10001677 Ga0207706_100016772 322
759 3300025933 Ga0207706_10011352 Ga0207706_100113523 322
760 3300025934 Ga0207686_10038467 Ga0207686_100384672 322
761 3300025938 Ga0207704_10190598 Ga0207704_101905982 322
762 3300025940 Ga0207691_10093842 Ga0207691_100938423 322
763 3300025940 Ga0207691_10239744 Ga0207691_102397441 322
764 3300025941 Ga0207711_10007584 Ga0207711_100075846 322
765 3300025941 Ga0207711_10041907 Ga0207711_100419072 322
766 3300025941 Ga0207711_10076292 Ga0207711_100762923 322
767 3300025942 Ga0207689_10009850 Ga0207689_100098506 322
768 3300025944 Ga0207661_10135339 Ga0207661_101353392 322
769 3300025945 Ga0207679_10011896 Ga0207679_100118962 322
770 3300025949 Ga0207667_10030273 Ga0207667_100302735 322
771 3300025949 Ga0207667_10087544 Ga0207667_100875443 322
772 3300025960 Ga0207651_10069685 Ga0207651_100696852 322
773 3300025981 Ga0207640_10082383 Ga0207640_100823832 322
774 3300025986 Ga0207658_10021533 Ga0207658_100215332 322
775 3300026023 Ga0207677_10023530 Ga0207677_100235304 322
776 3300026023 Ga0207677_10043382 Ga0207677_100433823 322
777 3300026041 Ga0207639_10035863 Ga0207639_100358633 322
778 3300026041 Ga0207639_10122505 Ga0207639_101225052 322
779 3300026067 Ga0207678_10053222 Ga0207678_100532222 322
780 3300026078 Ga0207702_10058880 Ga0207702_100588803 322
781 3300026088 Ga0207641_10124207 Ga0207641_101242072 322
782 3300026095 Ga0207676_10036150 Ga0207676_100361502 322
783 3300026095 Ga0207676_10114179 Ga0207676_101141793 322
784 3300026095 Ga0207676_10218332 Ga0207676_102183322 322
785 3300026116 Ga0207674_10067815 Ga0207674_100678153 322
786 3300026121 Ga0207683_10016577 Ga0207683_100165774 322
787 3300026121 Ga0207683_10164423 Ga0207683_101644233 322
788 3300026142 Ga0207698_10045582 Ga0207698_100455823 322
789 3300026142 Ga0207698_10086423 Ga0207698_100864232 322
790 3300026142 Ga0207698_10118010 Ga0207698_101180102 322
791 3300028380 Ga0268265_10114311 Ga0268265_101143112 322
792 3300028794 Ga0307515_10006352 Ga0307515_100063529 322
793 3300029957 Ga0265324_10007057 Ga0265324_100070572 322
794 3300031251 Ga0265327_10001807 Ga0265327_100018075 322
795 3300031730 Ga0307516_10001568 Ga0307516_1000156813 322
796 3300031731 Ga0307405_10369473 Ga0307405_103694731 322
797 3300031852 Ga0307410_10185676 Ga0307410_101856762 322
798 3300035242 Ga0373962_0011061 Ga0373962_0011061_583_1575 322
799 3300035691 Ga0373931_0058186 Ga0373931_0058186_10_1002 322
800 3300037471 Ga0395905_0006877 Ga0395905_0006877_4499_5473 322
801 3300037471 Ga0395905_0373377 Ga0395905_0373377_173_1156 322
802 3300039437 Ga0436365_0730477 Ga0436365_0730477_693_1685 322
803 3300042184 Ga0450908_011281 Ga0450908_011281_174_1142 322
804 3300042876 Ga0451577_0019182 Ga0451577_0019182_2549_3526 322
805 3300046615 Ga0495656_0000093 Ga0495656_0000093_27410_28393 322
806 3300046615 Ga0495656_0019941 Ga0495656_0019941_1227_2237 322
807 3300048090 Ga0495615_0007340 Ga0495615_0007340_434_1441 322
808 3300048903 Ga0496100_0043054 Ga0496100_0043054_1276_2259 322
809 3300048904 Ga0496101_0034545 Ga0496101_0034545_1083_2066 322
810 3300048906 Ga0496103_0050295 Ga0496103_0050295_1122_2105 322
811 3300048907 Ga0496104_0008511 Ga0496104_0008511_6920_7903 322
812 3300048908 Ga0496105_0024726 Ga0496105_0024726_1151_2134 322
813 3300048909 Ga0496106_0022941 Ga0496106_0022941_2116_3108 322
814 3300048909 Ga0496106_0053548 Ga0496106_0053548_933_1916 322
815 3300048910 Ga0496107_0006316 Ga0496107_0006316_1590_2582 322
816 3300048913 Ga0496110_0079805 Ga0496110_0079805_301_1293 322
817 3300048914 Ga0496111_0067545 Ga0496111_0067545_1332_2324 322
818 3300048914 Ga0496111_0078010 Ga0496111_0078010_986_1969 322
819 3300048915 Ga0496112_0460602 Ga0496112_0460602_87_1079 322
820 3300048917 Ga0496114_0124210 Ga0496114_0124210_899_1891 322
821 3300048917 Ga0496114_0159508 Ga0496114_0159508_318_1301 322
822 3300048918 Ga0496115_0067578 Ga0496115_0067578_1552_2544 322
823 3300048925 Ga0496122_0000383 Ga0496122_0000383_1432_2400 322
824 3300048926 Ga0496123_0000249 Ga0496123_0000249_92312_93280 322
825 3300050493 nmdc:mga0k408_55984_c1 nmdc:mga0k408_55984_c1_474_1442 322
826 3300053136 Ga0500559_0009437 Ga0500559_0009437_1252_2220 322
827 3300061719 Ga0466962_0049703 Ga0466962_0049703_222_1208 322
828 3300001979 JGI24740J21852_10002227 JGI24740J21852_100022273 323
829 3300002773 JGI25152J39213_1010277 JGI25152J39213_10102773 323
830 3300002774 JGI25150J39212_1006072 JGI25150J39212_10060722 323
831 3300003215 JGI25153J46596_10003671 JGI25153J46596_100036716 323
832 3300003215 JGI25153J46596_10004835 JGI25153J46596_100048353 323
833 3300003578 Ga0006562J51391_1013325 Ga0006562J51391_101332511 323
834 3300003578 Ga0006562J51391_1013332 Ga0006562J51391_10133323 323
835 3300003578 Ga0006562J51391_1029542 Ga0006562J51391_10295428 323
836 3300003578 Ga0006562J51391_1029546 Ga0006562J51391_10295463 323
837 3300003761 Ga0055535_1000934 Ga0055535_100093410 323
838 3300003762 Ga0055542_1000051 Ga0055542_100005199 323
839 3300003771 Ga0055526_1000826 Ga0055526_100082617 323
840 3300003781 Ga0055536_1012919 Ga0055536_10129192 323
841 3300003781 Ga0055536_1018427 Ga0055536_10184272 323
842 3300003784 Ga0055534_1002526 Ga0055534_10025265 323
843 3300003784 Ga0055534_1005182 Ga0055534_10051823 323
844 3300003790 Ga0055528_1013683 Ga0055528_10136832 323
845 3300003790 Ga0055528_1022218 Ga0055528_10222182 323
846 3300003791 Ga0055530_10008783 Ga0055530_100087833 323
847 3300003792 Ga0055540_1001799 Ga0055540_10017993 323
848 3300003792 Ga0055540_1008402 Ga0055540_10084023 323
849 3300003792 Ga0055540_1031797 Ga0055540_10317971 323
850 3300003794 Ga0055531_10020656 Ga0055531_100206562 323
851 3300005328 Ga0070676_10127828 Ga0070676_101278281 323
852 3300005335 Ga0070666_10128748 Ga0070666_101287481 323
853 3300005338 Ga0068868_100014027 Ga0068868_1000140273 323
854 3300005340 Ga0070689_100328387 Ga0070689_1003283871 323
855 3300005354 Ga0070675_100027434 Ga0070675_1000274343 323
856 3300005355 Ga0070671_100011406 Ga0070671_1000114063 323
857 3300005356 Ga0070674_100020660 Ga0070674_1000206602 323
858 3300005364 Ga0070673_100010575 Ga0070673_1000105755 323
859 3300005367 Ga0070667_100048321 Ga0070667_1000483213 323
860 3300005456 Ga0070678_100172516 Ga0070678_1001725162 323
861 3300005457 Ga0070662_100158535 Ga0070662_1001585352 323
862 3300005459 Ga0068867_100014337 Ga0068867_1000143373 323
863 3300005459 Ga0068867_100025831 Ga0068867_1000258313 323
864 3300005459 Ga0068867_100160344 Ga0068867_1001603442 323
865 3300005539 Ga0068853_100022735 Ga0068853_1000227354 323
866 3300005539 Ga0068853_100080199 Ga0068853_1000801992 323
867 3300005543 Ga0070672_100100519 Ga0070672_1001005192 323
868 3300005548 Ga0070665_100304456 Ga0070665_1003044562 323
869 3300005563 Ga0068855_100020802 Ga0068855_1000208028 323
870 3300005564 Ga0070664_100026915 Ga0070664_1000269152 323
871 3300005577 Ga0068857_100088867 Ga0068857_1000888673 323
872 3300005616 Ga0068852_100031065 Ga0068852_1000310653 323
873 3300005617 Ga0068859_100010805 Ga0068859_1000108052 323
874 3300005617 Ga0068859_100208397 Ga0068859_1002083972 323
875 3300005618 Ga0068864_100002362 Ga0068864_1000023624 323
876 3300005718 Ga0068866_10180079 Ga0068866_101800792 323
877 3300005719 Ga0068861_100022805 Ga0068861_1000228052 323
878 3300005834 Ga0068851_10035063 Ga0068851_100350632 323
879 3300005840 Ga0068870_10025942 Ga0068870_100259422 323
880 3300005841 Ga0068863_100040765 Ga0068863_1000407655 323
881 3300005842 Ga0068858_100000947 Ga0068858_10000094713 323
882 3300005843 Ga0068860_100000590 Ga0068860_10000059013 323
883 3300005844 Ga0068862_100056931 Ga0068862_1000569312 323
884 3300006038 Ga0075365_10001679 Ga0075365_1000167911 323
885 3300006048 Ga0075363_100012906 Ga0075363_1000129063 323
886 3300006051 Ga0075364_10023395 Ga0075364_100233952 323
887 3300006177 Ga0075362_10006614 Ga0075362_100066144 323
888 3300006178 Ga0075367_10065816 Ga0075367_100658162 323
889 3300006195 Ga0075366_10032419 Ga0075366_100324192 323
890 3300006195 Ga0075366_10051496 Ga0075366_100514963 323
891 3300006237 Ga0097621_100064293 Ga0097621_1000642932 323
892 3300006353 Ga0075370_10007775 Ga0075370_100077754 323
893 3300006353 Ga0075370_10021986 Ga0075370_100219862 323
894 3300006358 Ga0068871_100074554 Ga0068871_1000745542 323
895 3300006881 Ga0068865_100145558 Ga0068865_1001455582 323
896 3300006931 Ga0097620_100010805 Ga0097620_1000108052 323
897 3300006931 Ga0097620_100208406 Ga0097620_1002084062 323
898 3300006946 Ga0079104_1017870 Ga0079104_10178702 323
899 3300006948 Ga0099826_10041983 Ga0099826_100419833 323
900 3300006948 Ga0099826_10085707 Ga0099826_100857073 323
901 3300009036 Ga0105244_10007138 Ga0105244_100071385 323
902 3300009148 Ga0105243_10010327 Ga0105243_100103274 323
903 3300009148 Ga0105243_10019712 Ga0105243_100197123 323
904 3300009177 Ga0105248_10333990 Ga0105248_103339902 323
905 3300013100 Ga0157373_10022910 Ga0157373_100229104 323
906 3300013100 Ga0157373_10178132 Ga0157373_101781322 323
907 3300013102 Ga0157371_10102629 Ga0157371_101026292 323
908 3300013104 Ga0157370_10117019 Ga0157370_101170192 323
909 3300013105 Ga0157369_10013318 Ga0157369_100133182 323
910 3300013297 Ga0157378_10008627 Ga0157378_100086277 323
911 3300013306 Ga0163162_10002118 Ga0163162_1000211810 323
912 3300013308 Ga0157375_10064111 Ga0157375_100641113 323
913 3300013308 Ga0157375_10318209 Ga0157375_103182092 323
914 3300014325 Ga0163163_10007361 Ga0163163_100073616 323
915 3300014326 Ga0157380_10056674 Ga0157380_100566742 323
916 3300014497 Ga0182008_10008484 Ga0182008_100084844 323
917 3300014497 Ga0182008_10116007 Ga0182008_101160072 323
918 3300014968 Ga0157379_10025992 Ga0157379_100259924 323
919 3300014968 Ga0157379_10069401 Ga0157379_100694012 323
920 3300014968 Ga0157379_10097801 Ga0157379_100978012 323
921 3300015261 Ga0182006_1003275 Ga0182006_10032755 323
922 3300015262 Ga0182007_10002915 Ga0182007_100029155 323
923 3300017792 Ga0163161_10039684 Ga0163161_100396843 323
924 3300017792 Ga0163161_10053752 Ga0163161_100537523 323
925 3300025228 Ga0209672_100538 Ga0209672_1005385 323
926 3300025229 Ga0209147_102676 Ga0209147_1026762 323
927 3300025242 Ga0209258_100132 Ga0209258_10013298 323
928 3300025245 Ga0207425_1000226 Ga0207425_10002266 323
929 3300025245 Ga0207425_1007249 Ga0207425_10072493 323
930 3300025254 Ga0209148_1000007 Ga0209148_10000071247 323
931 3300025258 Ga0209129_1000012 Ga0209129_1000012366 323
932 3300025258 Ga0209129_1000084 Ga0209129_100008434 323
933 3300025263 Ga0209565_1000169 Ga0209565_100016932 323
934 3300025263 Ga0209565_1000364 Ga0209565_100036434 323
935 3300025273 Ga0209673_1000114 Ga0209673_100011432 323
936 3300025273 Ga0209673_1000916 Ga0209673_10009163 323
937 3300025273 Ga0209673_1001117 Ga0209673_10011174 323
938 3300025273 Ga0209673_1009349 Ga0209673_10093493 323
939 3300025273 Ga0209673_1019820 Ga0209673_10198203 323
940 3300025284 Ga0209130_1000571 Ga0209130_100057112 323
941 3300025284 Ga0209130_1004615 Ga0209130_10046154 323
942 3300025291 Ga0209675_1000062 Ga0209675_100006232 323
943 3300025292 Ga0209676_1000817 Ga0209676_10008173 323
944 3300025292 Ga0209676_1003376 Ga0209676_10033765 323
945 3300025294 Ga0209025_1000719 Ga0209025_100071946 323
946 3300025294 Ga0209025_1000861 Ga0209025_100086137 323
947 3300025294 Ga0209025_1018573 Ga0209025_10185733 323
948 3300025294 Ga0209025_1045276 Ga0209025_10452762 323
949 3300025295 Ga0209564_1000022 Ga0209564_1000022148 323
950 3300025295 Ga0209564_1000414 Ga0209564_10004143 323
951 3300025295 Ga0209564_1000613 Ga0209564_10006133 323
952 3300025297 Ga0209758_1000099 Ga0209758_1000099101 323
953 3300025297 Ga0209758_1002249 Ga0209758_10022494 323
954 3300025298 Ga0209050_1000052 Ga0209050_100005236 323
955 3300025299 Ga0209256_1000206 Ga0209256_100020613 323
956 3300025299 Ga0209256_1000239 Ga0209256_100023934 323
957 3300025302 Ga0207426_1000049 Ga0207426_1000049149 323
958 3300025302 Ga0207426_1000086 Ga0207426_100008635 323
959 3300025302 Ga0207426_1000346 Ga0207426_100034634 323
960 3300025303 Ga0209051_1000015 Ga0209051_1000015482 323
961 3300025303 Ga0209051_1000420 Ga0209051_100042018 323
962 3300025303 Ga0209051_1000492 Ga0209051_100049229 323
963 3300025303 Ga0209051_1002112 Ga0209051_10021123 323
964 3300025304 Ga0209257_1000037 Ga0209257_1000037263 323
965 3300025321 Ga0207656_10042172 Ga0207656_100421722 323
966 3300025728 Ga0207655_1000477 Ga0207655_100047742 323
967 3300025903 Ga0207680_10143169 Ga0207680_101431692 323
968 3300025904 Ga0207647_10089114 Ga0207647_100891142 323
969 3300025908 Ga0207643_10029897 Ga0207643_100298972 323
970 3300025923 Ga0207681_10052469 Ga0207681_100524693 323
971 3300025924 Ga0207694_10056930 Ga0207694_100569303 323
972 3300025925 Ga0207650_10007368 Ga0207650_100073685 323
973 3300025926 Ga0207659_10002674 Ga0207659_100026747 323
974 3300025926 Ga0207659_10016256 Ga0207659_100162563 323
975 3300025931 Ga0207644_10001724 Ga0207644_100017243 323
976 3300025931 Ga0207644_10022871 Ga0207644_100228713 323
977 3300025933 Ga0207706_10095958 Ga0207706_100959583 323
978 3300025934 Ga0207686_10010318 Ga0207686_100103183 323
979 3300025935 Ga0207709_10008688 Ga0207709_100086883 323
980 3300025935 Ga0207709_10085744 Ga0207709_100857442 323
981 3300025936 Ga0207670_10062873 Ga0207670_100628732 323
982 3300025937 Ga0207669_10093576 Ga0207669_100935762 323
983 3300025938 Ga0207704_10001522 Ga0207704_100015224 323
984 3300025940 Ga0207691_10002901 Ga0207691_100029013 323
985 3300025940 Ga0207691_10012766 Ga0207691_100127667 323
986 3300025941 Ga0207711_10256121 Ga0207711_102561212 323
987 3300025942 Ga0207689_10034031 Ga0207689_100340314 323
988 3300025945 Ga0207679_10205195 Ga0207679_102051952 323
989 3300025960 Ga0207651_10003471 Ga0207651_100034713 323
990 3300025972 Ga0207668_10053015 Ga0207668_100530153 323
991 3300025986 Ga0207658_10015971 Ga0207658_100159714 323
992 3300025986 Ga0207658_10167556 Ga0207658_101675562 323
993 3300026023 Ga0207677_10002324 Ga0207677_100023244 323
994 3300026035 Ga0207703_10003131 Ga0207703_100031317 323
995 3300026041 Ga0207639_10010457 Ga0207639_100104573 323
996 3300026041 Ga0207639_10106409 Ga0207639_101064092 323
997 3300026088 Ga0207641_10012012 Ga0207641_100120126 323
998 3300026089 Ga0207648_10008332 Ga0207648_100083328 323
999 3300026089 Ga0207648_10042896 Ga0207648_100428963 323
1000 3300026095 Ga0207676_10001457 Ga0207676_1000145718 323
1001 3300026116 Ga0207674_10091078 Ga0207674_100910783 323
1002 3300026118 Ga0207675_100001900 Ga0207675_10000190019 323
1003 3300026121 Ga0207683_10028752 Ga0207683_100287524 323
1004 3300026121 Ga0207683_10092116 Ga0207683_100921163 323
1005 3300026142 Ga0207698_10009520 Ga0207698_100095201 323
1006 3300026142 Ga0207698_10055995 Ga0207698_100559952 323
1007 3300027666 Ga0209282_1001433 Ga0209282_10014333 323
1008 3300027907 Ga0207428_10035993 Ga0207428_100359935 323
1009 3300028379 Ga0268266_10117070 Ga0268266_101170702 323
1010 3300028381 Ga0268264_10000991 Ga0268264_1000099110 323
1011 3300030731 Ga0316177_1175648 Ga0316177_11756482 323
1012 3300030732 Ga0316176_1195019 Ga0316176_11950192 323
1013 3300030733 Ga0314311_1020317 Ga0314311_10203173 323
1014 3300030734 Ga0316179_1040040 Ga0316179_10400402 323
1015 3300030735 Ga0316178_1025743 Ga0316178_10257433 323
1016 3300030736 Ga0316180_1050502 Ga0316180_10505023 323
1017 3300030742 Ga0316183_1188254 Ga0316183_11882542 323
1018 3300030742 Ga0316183_1202539 Ga0316183_12025392 323
1019 3300030744 Ga0316181_1041597 Ga0316181_10415972 323
1020 3300030745 Ga0316182_1104984 Ga0316182_11049842 323
1021 3300030745 Ga0316182_1417019 Ga0316182_14170193 323
1022 3300031235 Ga0265330_10000453 Ga0265330_100004537 323
1023 3300031238 Ga0265332_10000012 Ga0265332_10000012250 323
1024 3300031241 Ga0265325_10017431 Ga0265325_100174312 323
1025 3300031548 Ga0307408_100000274 Ga0307408_10000027436 323
1026 3300031548 Ga0307408_100104590 Ga0307408_1001045903 323
1027 3300031548 Ga0307408_100106258 Ga0307408_1001062582 323
1028 3300031649 Ga0307514_10024565 Ga0307514_100245654 323
1029 3300031711 Ga0265314_10000029 Ga0265314_100000297 323
1030 3300031731 Ga0307405_10014975 Ga0307405_100149752 323
1031 3300031824 Ga0307413_10026524 Ga0307413_100265242 323
1032 3300031901 Ga0307406_10001131 Ga0307406_1000113111 323
1033 3300031901 Ga0307406_10001699 Ga0307406_100016995 323
1034 3300031901 Ga0307406_10027882 Ga0307406_100278823 323
1035 3300031911 Ga0307412_10097082 Ga0307412_100970822 323
1036 3300031911 Ga0307412_10117802 Ga0307412_101178022 323
1037 3300031911 Ga0307412_10125216 Ga0307412_101252162 323
1038 3300031911 Ga0307412_10353632 Ga0307412_103536322 323
1039 3300032004 Ga0307414_10026215 Ga0307414_100262152 323
1040 3300032004 Ga0307414_10159590 Ga0307414_101595902 323
1041 3300035172 Ga0373955_0184150 Ga0373955_0184150_129_1124 323
1042 3300042531 Ga0450918_000609 Ga0450918_000609_6384_7355 323
1043 3300046453 Ga0495627_008213 Ga0495627_008213_1807_2778 323
1044 3300046453 Ga0495627_019457 Ga0495627_019457_369_1340 323
1045 3300046512 Ga0495610_0056162 Ga0495610_0056162_371_1342 323
1046 3300046513 Ga0495616_0011779 Ga0495616_0011779_2846_3817 323
1047 3300046518 Ga0495631_0001417 Ga0495631_0001417_11055_12026 323
1048 3300046520 Ga0495637_0008174 Ga0495637_0008174_1076_2047 323
1049 3300046539 Ga0495621_0018955 Ga0495621_0018955_987_1958 323
1050 3300046660 Ga0495625_0001179 Ga0495625_0001179_12651_13622 323
1051 3300046674 Ga0495588_0049426 Ga0495588_0049426_297_1268 323
1052 3300046683 Ga0495658_0214289 Ga0495658_0214289_41_1036 323
1053 3300046692 Ga0495671_0021694 Ga0495671_0021694_1125_2096 323
1054 3300047321 Ga0495676_0107019 Ga0495676_0107019_617_1588 323
1055 3300048088 Ga0495602_0089757 Ga0495602_0089757_68_1039 323
1056 3300048917 Ga0496114_0056306 Ga0496114_0056306_864_1859 323
1057 3300048920 Ga0496117_0044192 Ga0496117_0044192_1119_2090 323
1058 3300048920 Ga0496117_0081894 Ga0496117_0081894_630_1601 323
1059 3300048921 Ga0496118_0007613 Ga0496118_0007613_1190_2161 323
1060 3300048927 Ga0496124_0016354 Ga0496124_0016354_1645_2616 323
1061 3300049705 Ga0501225_0007622 Ga0501225_0007622_1174_2145 323
1062 3300049759 Ga0501262_001452 Ga0501262_001452_1330_2301 323
1063 3300050489 nmdc:mga03683_52391_c1 nmdc:mga03683_52391_c1_504_1475 323
1064 3300050490 nmdc:mga03n38_21542_c1 nmdc:mga03n38_21542_c1_1038_2009 323
1065 3300050492 nmdc:mga0yw44_14380_c1 nmdc:mga0yw44_14380_c1_559_1530 323
1066 3300050493 nmdc:mga0k408_47081_c1 nmdc:mga0k408_47081_c1_963_1934 323
1067 3300050496 nmdc:mga07m45_43867_c1 nmdc:mga07m45_43867_c1_1125_2096 323
1068 3300053087 Ga0500643_018305 Ga0500643_018305_1052_2023 323
1069 3300053093 Ga0500651_0000067 Ga0500651_0000067_22877_23848 323
1070 3300053110 Ga0500571_000952 Ga0500571_000952_10629_11600 323
1071 3300053117 Ga0500593_005315 Ga0500593_005315_1022_1993 323
1072 3300053134 Ga0500658_0022824 Ga0500658_0022824_1194_2165 323
1073 3300053134 Ga0500658_0106674 Ga0500658_0106674_205_1176 323
1074 3300053139 Ga0500568_0009510 Ga0500568_0009510_3123_4094 323
1075 3300053153 Ga0500616_0012717 Ga0500616_0012717_1141_2112 323
1076 3300053158 Ga0500627_0012737 Ga0500627_0012737_952_1923 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

109

315

0.95

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

46

92

0.87

PF02655

ATP-grasp_3

ATP-grasp domain

100

291

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4egj-assembly5.cif.gz_A crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.9574 5 311
4zqi-assembly2.cif.gz_C crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.9535 11 314
5d8d-assembly3.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.9534 6 311
5dmx-assembly2.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121 0.9525 9 314
4zqi-assembly1.cif.gz_B crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.9524 11 314
ID Description Score Start End Superfamily
4egjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9933 5 90 3.40.50.20
4egjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.96 5 90 3.40.50.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9491 91 312 3.30.470.20
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9441 91 311 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9429 91 312 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A520H4J1-F1-model_v4 D-alanine--D-alanine ligase 0.9919 5 119 GO:0005829
GO:0008716
GO:0009252
AF-A0A7X8SRQ2-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9802 11 99 GO:0005829
GO:0008716
GO:0009252
AF-A0A258MF12-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9765 5 311 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A059WVN9-F1-model_v4 D-ala D-ala ligase C-terminus 0.9765 147 320 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A6L4B9S6-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.975 16 316 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Feature Viewer

pLDDT pTM Quality
91.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map