F489577
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 486 | 1017 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10034778|Ga0070676_100347783 |
| Length | 327 |
| Sequence | MSADVTSFGKVAVLMGGTSAERQISIMSGTGVLAALRSQGVDAHAFDPAERELVELKREGFARCFIALHGRHGEDGSVQGALELLGIPYTGSGVLASAIAMDKVMTKRVWIAEGLPTPRYQWLSPEQRRAENLREHLRAVPDALGLPLIVKPPREGSSIGITKVAGYSDMQAAVELAAKYDADVLCEEFIDGDEVTCPVLGEGEQAQALPVIRIVAPEGAYDYQNKYFTDDVKYQCPSGLPEAEEREIQRIVVQAYRTLGCRGWGRADLMIRASDRKPFLLEMNTSPGMTTHSLVPMSAKAAGLSYEALCVQILGAAALDAPALATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 12 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 13 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 14 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 15 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 16 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 17 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 18 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 19 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 20 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 21 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 22 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 23 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 24 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 25 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 26 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 27 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 28 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 29 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 30 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 31 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 32 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 33 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 34 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 35 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 36 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 37 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 38 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 39 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 40 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 41 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 42 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 43 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 44 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 45 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 46 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 47 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 48 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 49 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 50 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 51 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 52 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 53 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 54 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 55 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 56 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 57 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 58 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 59 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 60 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 61 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 62 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 63 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 64 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 65 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 66 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 67 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 68 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 75 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 76 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 94 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 102 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 105 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 107 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 123 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 131 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 133 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 134 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 138 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 139 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 140 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 141 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 142 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 143 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 144 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 145 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 146 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 147 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 148 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 149 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 150 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 151 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 152 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 153 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 155 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 156 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 157 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 161 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 162 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 174 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 186 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 191 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 192 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 193 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 195 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 208 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 211 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 282 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 284 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 289 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 290 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 291 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 292 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 293 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 294 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 295 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 296 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 297 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 298 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 299 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 300 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 301 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 305 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 306 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 307 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 308 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 309 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 310 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 311 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 313 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 314 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 315 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 316 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 317 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 318 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 319 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 320 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 323 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 325 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 326 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 334 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 335 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 336 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 337 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 338 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 341 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 342 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 343 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 344 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 345 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 346 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 347 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 348 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 349 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 350 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 351 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 352 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 353 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 354 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 355 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 356 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 357 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 358 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 359 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 360 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 361 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 362 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 363 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 364 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 365 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 366 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 367 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 368 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 369 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 370 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 371 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 372 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 423 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 424 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 425 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 426 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 427 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 428 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 431 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 432 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 433 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 434 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 435 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 438 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 439 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 440 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 441 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 449 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 450 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 451 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 462 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 466 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 467 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 468 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 471 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 472 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 473 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 474 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 475 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 478 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 482 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 483 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 485 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 486 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.05 |
| Metatranscriptomes | 0.46 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.89 |
| Nodule | 0.74 |
| Rhizoplane | 2.88 |
| Rhizosphere | 64.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002227 | 3300001979 | Bacteria | 8855 |
| 2 | JGI25156J39149_1001782 | 3300002705 | Bacteria | 8509 |
| 3 | JGI25156J39149_1007524 | 3300002705 | Bacteria | 2846 |
| 4 | JGI25162J39368_1000063 | 3300002737 | Bacteria | 134747 |
| 5 | JGI25154J39366_1001302 | 3300002738 | Bacteria | 9272 |
| 6 | JGI25154J39366_1004037 | 3300002738 | Bacteria | 2783 |
| 7 | JGI25157J39369_1000148 | 3300002741 | Bacteria | 58782 |
| 8 | JGI25163J39215_1001308 | 3300002771 | Bacteria | 4398 |
| 9 | JGI25164J39214_1004328 | 3300002772 | Bacteria | 1652 |
| 10 | JGI25152J39213_1010277 | 3300002773 | Bacteria | 2156 |
| 11 | JGI25150J39212_1006072 | 3300002774 | Bacteria | 2526 |
| 12 | JGI25165J46597_1000069 | 3300003214 | Bacteria | 195460 |
| 13 | JGI25153J46596_10003671 | 3300003215 | Bacteria | 8496 |
| 14 | JGI25153J46596_10004835 | 3300003215 | Bacteria | 7177 |
| 15 | rootH1_10010206 | 3300003316 | Bacteria | 1833 |
| 16 | rootH1_10015203 | 3300003316 | Bacteria | 4095 |
| 17 | rootL2_10000966 | 3300003322 | Bacteria | 57184 |
| 18 | rootH1_10000830 | 3300003323 | Bacteria | 4608 |
| 19 | rootH1_10114267 | 3300003323 | Bacteria | 1418 |
| 20 | Ga0007409J51694_1045597 | 3300003575 | Bacteria | 1557 |
| 21 | Ga0006562J51391_1013325 | 3300003578 | Bacteria | 17825 |
| 22 | Ga0006562J51391_1013332 | 3300003578 | Bacteria | 3530 |
| 23 | Ga0006562J51391_1029542 | 3300003578 | Bacteria | 12747 |
| 24 | Ga0006562J51391_1029546 | 3300003578 | Bacteria | 2420 |
| 25 | Ga0055538_1000034 | 3300003751 | Bacteria | 195460 |
| 26 | Ga0055539_1000044 | 3300003752 | Bacteria | 195460 |
| 27 | Ga0055539_1000763 | 3300003752 | Bacteria | 7795 |
| 28 | Ga0055539_1002964 | 3300003752 | Bacteria | 2454 |
| 29 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 30 | Ga0055533_1000055 | 3300003756 | Bacteria | 195460 |
| 31 | Ga0055525_1000066 | 3300003759 | Bacteria | 195460 |
| 32 | Ga0055525_1001386 | 3300003759 | Bacteria | 4586 |
| 33 | Ga0055535_1000934 | 3300003761 | Bacteria | 19510 |
| 34 | Ga0055535_1002036 | 3300003761 | Bacteria | 8207 |
| 35 | Ga0055542_1000051 | 3300003762 | Bacteria | 175242 |
| 36 | Ga0055529_1000333 | 3300003763 | Bacteria | 52783 |
| 37 | Ga0055526_1000826 | 3300003771 | Bacteria | 23122 |
| 38 | Ga0055526_1001991 | 3300003771 | Bacteria | 14078 |
| 39 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 40 | Ga0055536_1012919 | 3300003781 | Bacteria | 3055 |
| 41 | Ga0055536_1018427 | 3300003781 | Bacteria | 2238 |
| 42 | Ga0055534_1001847 | 3300003784 | Bacteria | 7905 |
| 43 | Ga0055534_1002526 | 3300003784 | Bacteria | 6276 |
| 44 | Ga0055534_1005182 | 3300003784 | Bacteria | 3566 |
| 45 | Ga0055528_1013683 | 3300003790 | Bacteria | 3057 |
| 46 | Ga0055528_1022218 | 3300003790 | Bacteria | 1982 |
| 47 | Ga0055530_10006857 | 3300003791 | Bacteria | 4941 |
| 48 | Ga0055530_10008783 | 3300003791 | Bacteria | 3989 |
| 49 | Ga0055530_10015568 | 3300003791 | Bacteria | 2474 |
| 50 | Ga0055540_1000019 | 3300003792 | Bacteria | 210593 |
| 51 | Ga0055540_1001799 | 3300003792 | Bacteria | 12186 |
| 52 | Ga0055540_1006211 | 3300003792 | Bacteria | 4800 |
| 53 | Ga0055540_1007850 | 3300003792 | Bacteria | 3948 |
| 54 | Ga0055540_1008402 | 3300003792 | Bacteria | 3724 |
| 55 | Ga0055540_1011021 | 3300003792 | Bacteria | 2954 |
| 56 | Ga0055540_1031797 | 3300003792 | Bacteria | 1210 |
| 57 | Ga0055531_10000360 | 3300003794 | Bacteria | 44186 |
| 58 | Ga0055531_10001074 | 3300003794 | Bacteria | 21465 |
| 59 | Ga0055531_10003311 | 3300003794 | Bacteria | 10311 |
| 60 | Ga0055531_10009158 | 3300003794 | Bacteria | 5102 |
| 61 | Ga0055531_10012618 | 3300003794 | Bacteria | 3963 |
| 62 | Ga0055531_10020656 | 3300003794 | Bacteria | 2593 |
| 63 | Ga0055541_1000032 | 3300003841 | Bacteria | 195460 |
| 64 | Ga0055543_1005706 | 3300004625 | Bacteria | 3134 |
| 65 | Ga0065165_1000080 | 3300005262 | Bacteria | 159638 |
| 66 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 67 | Ga0065165_1003865 | 3300005262 | Bacteria | 9941 |
| 68 | Ga0065165_1043062 | 3300005262 | Bacteria | 1328 |
| 69 | Ga0065707_10100423 | 3300005295 | Bacteria | 2930 |
| 70 | Ga0070658_10100789 | 3300005327 | Bacteria | 2387 |
| 71 | Ga0070658_10227236 | 3300005327 | Bacteria | 1580 |
| 72 | Ga0070676_10011159 | 3300005328 | Bacteria | 4881 |
| 73 | Ga0070676_10012151 | 3300005328 | Bacteria | 4695 |
| 74 | Ga0070676_10034778 | 3300005328 | Bacteria | 2894 |
| 75 | Ga0070676_10127828 | 3300005328 | Bacteria | 1603 |
| 76 | Ga0070683_100029368 | 3300005329 | Bacteria | 4977 |
| 77 | Ga0070683_100087729 | 3300005329 | Bacteria | 2919 |
| 78 | Ga0070690_100022459 | 3300005330 | Bacteria | 3859 |
| 79 | Ga0070690_100055811 | 3300005330 | Bacteria | 2530 |
| 80 | Ga0070670_100086045 | 3300005331 | Bacteria | 2701 |
| 81 | Ga0070670_100115775 | 3300005331 | Bacteria | 2311 |
| 82 | Ga0070670_100138057 | 3300005331 | Bacteria | 2107 |
| 83 | Ga0070670_100199404 | 3300005331 | Bacteria | 1739 |
| 84 | Ga0070670_100209046 | 3300005331 | Bacteria | 1697 |
| 85 | Ga0070670_100252130 | 3300005331 | Bacteria | 1538 |
| 86 | Ga0070677_10032005 | 3300005333 | Bacteria | 2014 |
| 87 | Ga0070677_10140655 | 3300005333 | Bacteria | 1113 |
| 88 | Ga0068869_100010879 | 3300005334 | Bacteria | 5951 |
| 89 | Ga0068869_100027914 | 3300005334 | Bacteria | 3939 |
| 90 | Ga0068869_100061795 | 3300005334 | Bacteria | 2748 |
| 91 | Ga0068869_100065097 | 3300005334 | Bacteria | 2683 |
| 92 | Ga0070666_10050920 | 3300005335 | Bacteria | 2787 |
| 93 | Ga0070666_10128748 | 3300005335 | Bacteria | 1758 |
| 94 | Ga0070682_100085166 | 3300005337 | Bacteria | 2056 |
| 95 | Ga0068868_100014027 | 3300005338 | Bacteria | 5896 |
| 96 | Ga0068868_100025884 | 3300005338 | Bacteria | 4467 |
| 97 | Ga0068868_100057346 | 3300005338 | Bacteria | 3077 |
| 98 | Ga0068868_100073336 | 3300005338 | Bacteria | 2733 |
| 99 | Ga0070660_100013524 | 3300005339 | Bacteria | 5856 |
| 100 | Ga0070660_100034480 | 3300005339 | Bacteria | 3825 |
| 101 | Ga0070660_100128252 | 3300005339 | Bacteria | 2028 |
| 102 | Ga0070689_100328387 | 3300005340 | Bacteria | 1279 |
| 103 | Ga0070687_100030101 | 3300005343 | Bacteria | 2651 |
| 104 | Ga0070661_100001817 | 3300005344 | Bacteria | 14798 |
| 105 | Ga0070661_100100058 | 3300005344 | Bacteria | 2155 |
| 106 | Ga0070668_100024251 | 3300005347 | Bacteria | 4594 |
| 107 | Ga0070668_100117189 | 3300005347 | Bacteria | 2125 |
| 108 | Ga0070668_100119935 | 3300005347 | Bacteria | 2101 |
| 109 | Ga0070669_100034251 | 3300005353 | Bacteria | 3677 |
| 110 | Ga0070669_100071168 | 3300005353 | Bacteria | 2572 |
| 111 | Ga0070669_100072824 | 3300005353 | Bacteria | 2544 |
| 112 | Ga0070675_100027434 | 3300005354 | Bacteria | 4574 |
| 113 | Ga0070675_100064813 | 3300005354 | Bacteria | 3020 |
| 114 | Ga0070675_100076311 | 3300005354 | Bacteria | 2787 |
| 115 | Ga0070675_100318094 | 3300005354 | Bacteria | 1374 |
| 116 | Ga0070671_100011406 | 3300005355 | Bacteria | 7146 |
| 117 | Ga0070671_100021838 | 3300005355 | Bacteria | 5228 |
| 118 | Ga0070671_100076886 | 3300005355 | Bacteria | 2789 |
| 119 | Ga0070671_100095343 | 3300005355 | Bacteria | 2494 |
| 120 | Ga0070671_100216587 | 3300005355 | Bacteria | 1624 |
| 121 | Ga0070674_100020660 | 3300005356 | Bacteria | 4213 |
| 122 | Ga0070674_100136341 | 3300005356 | Bacteria | 1836 |
| 123 | Ga0070674_100146065 | 3300005356 | Bacteria | 1780 |
| 124 | Ga0070673_100010575 | 3300005364 | Bacteria | 6251 |
| 125 | Ga0070673_100029046 | 3300005364 | Bacteria | 4120 |
| 126 | Ga0070673_100060598 | 3300005364 | Bacteria | 2999 |
| 127 | Ga0070659_100000579 | 3300005366 | Bacteria | 26725 |
| 128 | Ga0070659_100138085 | 3300005366 | Bacteria | 1983 |
| 129 | Ga0070659_100141084 | 3300005366 | Bacteria | 1962 |
| 130 | Ga0070667_100017022 | 3300005367 | Bacteria | 6019 |
| 131 | Ga0070667_100048321 | 3300005367 | Bacteria | 3581 |
| 132 | Ga0070667_100063689 | 3300005367 | Bacteria | 3125 |
| 133 | Ga0070708_100143642 | 3300005445 | Bacteria | 2215 |
| 134 | Ga0070663_100001569 | 3300005455 | Bacteria | 12571 |
| 135 | Ga0070663_100005909 | 3300005455 | Bacteria | 7323 |
| 136 | Ga0070663_100416172 | 3300005455 | Bacteria | 1102 |
| 137 | Ga0070678_100013580 | 3300005456 | Bacteria | 5113 |
| 138 | Ga0070678_100086673 | 3300005456 | Bacteria | 2389 |
| 139 | Ga0070678_100164593 | 3300005456 | Bacteria | 1800 |
| 140 | Ga0070678_100172516 | 3300005456 | Bacteria | 1763 |
| 141 | Ga0070678_100185324 | 3300005456 | Bacteria | 1707 |
| 142 | Ga0070678_100408253 | 3300005456 | Bacteria | 1181 |
| 143 | Ga0070662_100034033 | 3300005457 | Bacteria | 3591 |
| 144 | Ga0070662_100054096 | 3300005457 | Bacteria | 2908 |
| 145 | Ga0070662_100055624 | 3300005457 | Bacteria | 2871 |
| 146 | Ga0070662_100158535 | 3300005457 | Bacteria | 1768 |
| 147 | Ga0070681_10232499 | 3300005458 | Bacteria | 1758 |
| 148 | Ga0068867_100000072 | 3300005459 | Bacteria | 61663 |
| 149 | Ga0068867_100014337 | 3300005459 | Bacteria | 5614 |
| 150 | Ga0068867_100014505 | 3300005459 | Bacteria | 5585 |
| 151 | Ga0068867_100025831 | 3300005459 | Bacteria | 4213 |
| 152 | Ga0068867_100039511 | 3300005459 | Bacteria | 3440 |
| 153 | Ga0068867_100084146 | 3300005459 | Bacteria | 2402 |
| 154 | Ga0068867_100160344 | 3300005459 | Bacteria | 1773 |
| 155 | Ga0070706_100003148 | 3300005467 | Bacteria | 16310 |
| 156 | Ga0070679_100016827 | 3300005530 | Bacteria | 7067 |
| 157 | Ga0070679_100458852 | 3300005530 | Bacteria | 1219 |
| 158 | Ga0070684_100233184 | 3300005535 | Bacteria | 1681 |
| 159 | Ga0068853_100022735 | 3300005539 | Bacteria | 5240 |
| 160 | Ga0068853_100080199 | 3300005539 | Bacteria | 2855 |
| 161 | Ga0070672_100027758 | 3300005543 | Bacteria | 4225 |
| 162 | Ga0070672_100053209 | 3300005543 | Bacteria | 3164 |
| 163 | Ga0070672_100100519 | 3300005543 | Bacteria | 2345 |
| 164 | Ga0070672_100161318 | 3300005543 | Bacteria | 1860 |
| 165 | Ga0070672_100228763 | 3300005543 | Bacteria | 1562 |
| 166 | Ga0070693_100011646 | 3300005547 | Bacteria | 4432 |
| 167 | Ga0070665_100050202 | 3300005548 | Bacteria | 4186 |
| 168 | Ga0070665_100093595 | 3300005548 | Bacteria | 3010 |
| 169 | Ga0070665_100304456 | 3300005548 | Bacteria | 1597 |
| 170 | Ga0068855_100013525 | 3300005563 | Bacteria | 9840 |
| 171 | Ga0068855_100020802 | 3300005563 | Bacteria | 7867 |
| 172 | Ga0068855_100050047 | 3300005563 | Bacteria | 4925 |
| 173 | Ga0068855_100176827 | 3300005563 | Bacteria | 2415 |
| 174 | Ga0068855_100450372 | 3300005563 | Bacteria | 1405 |
| 175 | Ga0070664_100003888 | 3300005564 | Bacteria | 12054 |
| 176 | Ga0070664_100017203 | 3300005564 | Bacteria | 5936 |
| 177 | Ga0070664_100026915 | 3300005564 | Bacteria | 4776 |
| 178 | Ga0070664_100095364 | 3300005564 | Bacteria | 2580 |
| 179 | Ga0070664_100308447 | 3300005564 | Bacteria | 1432 |
| 180 | Ga0070664_100480371 | 3300005564 | Bacteria | 1143 |
| 181 | Ga0068857_100068892 | 3300005577 | Bacteria | 3149 |
| 182 | Ga0068857_100088867 | 3300005577 | Bacteria | 2764 |
| 183 | Ga0068857_100112626 | 3300005577 | Bacteria | 2446 |
| 184 | Ga0068854_100023360 | 3300005578 | Bacteria | 4222 |
| 185 | Ga0068856_100012944 | 3300005614 | Bacteria | 8076 |
| 186 | Ga0068856_100059328 | 3300005614 | Bacteria | 3780 |
| 187 | Ga0068856_100059918 | 3300005614 | Bacteria | 3760 |
| 188 | Ga0068856_100443477 | 3300005614 | Bacteria | 1319 |
| 189 | Ga0068852_100028494 | 3300005616 | Bacteria | 4572 |
| 190 | Ga0068852_100031065 | 3300005616 | Bacteria | 4402 |
| 191 | Ga0068852_100085784 | 3300005616 | Bacteria | 2805 |
| 192 | Ga0068852_100095692 | 3300005616 | Bacteria | 2667 |
| 193 | Ga0068852_100114168 | 3300005616 | Bacteria | 2461 |
| 194 | Ga0068852_100198506 | 3300005616 | Bacteria | 1897 |
| 195 | Ga0068852_100208459 | 3300005616 | Bacteria | 1853 |
| 196 | Ga0068859_100010805 | 3300005617 | Bacteria | 9191 |
| 197 | Ga0068859_100033863 | 3300005617 | Bacteria | 5129 |
| 198 | Ga0068859_100208397 | 3300005617 | Bacteria | 2041 |
| 199 | Ga0068859_100231075 | 3300005617 | Bacteria | 1938 |
| 200 | Ga0068859_100327980 | 3300005617 | Bacteria | 1625 |
| 201 | Ga0068864_100002362 | 3300005618 | Bacteria | 15612 |
| 202 | Ga0068864_100049681 | 3300005618 | Bacteria | 3609 |
| 203 | Ga0068864_100056292 | 3300005618 | Bacteria | 3397 |
| 204 | Ga0068864_100082398 | 3300005618 | Bacteria | 2822 |
| 205 | Ga0068864_100157482 | 3300005618 | Bacteria | 2062 |
| 206 | Ga0068866_10033347 | 3300005718 | Bacteria | 2497 |
| 207 | Ga0068866_10180079 | 3300005718 | Bacteria | 1248 |
| 208 | Ga0068861_100001649 | 3300005719 | Bacteria | 14258 |
| 209 | Ga0068861_100022805 | 3300005719 | Bacteria | 4513 |
| 210 | Ga0068861_100024567 | 3300005719 | Bacteria | 4359 |
| 211 | Ga0068861_100146023 | 3300005719 | Bacteria | 1936 |
| 212 | Ga0068851_10035063 | 3300005834 | Bacteria | 2507 |
| 213 | Ga0068851_10115492 | 3300005834 | Bacteria | 1438 |
| 214 | Ga0068870_10025942 | 3300005840 | Bacteria | 2915 |
| 215 | Ga0068870_10054833 | 3300005840 | Bacteria | 2122 |
| 216 | Ga0068870_10115178 | 3300005840 | Bacteria | 1541 |
| 217 | Ga0068863_100031768 | 3300005841 | Bacteria | 5037 |
| 218 | Ga0068863_100038412 | 3300005841 | Bacteria | 4554 |
| 219 | Ga0068863_100040765 | 3300005841 | Bacteria | 4415 |
| 220 | Ga0068863_100051637 | 3300005841 | Bacteria | 3896 |
| 221 | Ga0068863_100083801 | 3300005841 | Bacteria | 3021 |
| 222 | Ga0068863_100189569 | 3300005841 | Bacteria | 1976 |
| 223 | Ga0068858_100000947 | 3300005842 | Bacteria | 30015 |
| 224 | Ga0068858_100028870 | 3300005842 | Bacteria | 5151 |
| 225 | Ga0068858_100188292 | 3300005842 | Bacteria | 1950 |
| 226 | Ga0068860_100000590 | 3300005843 | Bacteria | 43453 |
| 227 | Ga0068860_100013253 | 3300005843 | Bacteria | 8089 |
| 228 | Ga0068860_100156493 | 3300005843 | Bacteria | 2196 |
| 229 | Ga0068860_100197279 | 3300005843 | Bacteria | 1950 |
| 230 | Ga0068860_100204213 | 3300005843 | Bacteria | 1916 |
| 231 | Ga0068862_100028602 | 3300005844 | Bacteria | 4695 |
| 232 | Ga0068862_100056931 | 3300005844 | Bacteria | 3351 |
| 233 | Ga0068862_100058125 | 3300005844 | Bacteria | 3317 |
| 234 | Ga0075365_10001679 | 3300006038 | Bacteria | 10232 |
| 235 | Ga0075365_10034744 | 3300006038 | Bacteria | 3257 |
| 236 | Ga0075363_100012906 | 3300006048 | Bacteria | 4034 |
| 237 | Ga0075363_100053453 | 3300006048 | Bacteria | 2158 |
| 238 | Ga0075364_10023395 | 3300006051 | Bacteria | 3912 |
| 239 | Ga0075364_10194821 | 3300006051 | Bacteria | 1373 |
| 240 | Ga0075362_10006614 | 3300006177 | Bacteria | 4327 |
| 241 | Ga0075367_10013667 | 3300006178 | Bacteria | 4372 |
| 242 | Ga0075367_10030265 | 3300006178 | Bacteria | 3102 |
| 243 | Ga0075367_10065816 | 3300006178 | Bacteria | 2171 |
| 244 | Ga0075367_10085205 | 3300006178 | Bacteria | 1917 |
| 245 | Ga0075367_10125705 | 3300006178 | Bacteria | 1582 |
| 246 | Ga0075369_10038509 | 3300006186 | Bacteria | 2040 |
| 247 | Ga0075366_10032419 | 3300006195 | Bacteria | 3075 |
| 248 | Ga0075366_10040155 | 3300006195 | Bacteria | 2767 |
| 249 | Ga0075366_10051496 | 3300006195 | Bacteria | 2446 |
| 250 | Ga0075366_10075317 | 3300006195 | Bacteria | 2013 |
| 251 | Ga0075366_10103866 | 3300006195 | Bacteria | 1707 |
| 252 | Ga0097621_100064293 | 3300006237 | Bacteria | 3017 |
| 253 | Ga0097621_100081669 | 3300006237 | Bacteria | 2690 |
| 254 | Ga0097621_100159403 | 3300006237 | Bacteria | 1939 |
| 255 | Ga0075370_10000547 | 3300006353 | Bacteria | 14418 |
| 256 | Ga0075370_10002604 | 3300006353 | Bacteria | 8412 |
| 257 | Ga0075370_10007775 | 3300006353 | Bacteria | 5477 |
| 258 | Ga0075370_10011725 | 3300006353 | Bacteria | 4614 |
| 259 | Ga0075370_10021986 | 3300006353 | Bacteria | 3497 |
| 260 | Ga0075370_10037246 | 3300006353 | Bacteria | 2734 |
| 261 | Ga0075370_10040108 | 3300006353 | Bacteria | 2640 |
| 262 | Ga0075370_10075281 | 3300006353 | Bacteria | 1935 |
| 263 | Ga0068871_100074554 | 3300006358 | Bacteria | 2799 |
| 264 | Ga0068871_100093767 | 3300006358 | Bacteria | 2505 |
| 265 | Ga0068871_100130241 | 3300006358 | Bacteria | 2132 |
| 266 | Ga0075430_100078142 | 3300006846 | Bacteria | 2774 |
| 267 | Ga0075429_100000199 | 3300006880 | Bacteria | 39995 |
| 268 | Ga0068865_100079132 | 3300006881 | Bacteria | 2353 |
| 269 | Ga0068865_100145558 | 3300006881 | Bacteria | 1792 |
| 270 | Ga0097620_100010805 | 3300006931 | Bacteria | 9191 |
| 271 | Ga0097620_100033861 | 3300006931 | Bacteria | 5129 |
| 272 | Ga0097620_100208406 | 3300006931 | Bacteria | 2041 |
| 273 | Ga0097620_100231087 | 3300006931 | Bacteria | 1938 |
| 274 | Ga0097620_100327959 | 3300006931 | Bacteria | 1625 |
| 275 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 276 | Ga0079104_1017870 | 3300006946 | Bacteria | 2026 |
| 277 | Ga0099826_10041983 | 3300006948 | Bacteria | 3167 |
| 278 | Ga0099826_10085707 | 3300006948 | Bacteria | 1944 |
| 279 | Ga0105244_10007138 | 3300009036 | Bacteria | 7139 |
| 280 | Ga0105240_10024611 | 3300009093 | Bacteria | 7930 |
| 281 | Ga0105240_10062071 | 3300009093 | Bacteria | 4654 |
| 282 | Ga0105245_10102204 | 3300009098 | Bacteria | 2654 |
| 283 | Ga0105245_10442779 | 3300009098 | Bacteria | 1306 |
| 284 | Ga0114129_10149580 | 3300009147 | Bacteria | 3196 |
| 285 | Ga0105243_10001108 | 3300009148 | Bacteria | 24452 |
| 286 | Ga0105243_10010327 | 3300009148 | Bacteria | 7091 |
| 287 | Ga0105243_10019712 | 3300009148 | Bacteria | 5114 |
| 288 | Ga0105242_10018229 | 3300009176 | Bacteria | 5486 |
| 289 | Ga0105242_10079059 | 3300009176 | Bacteria | 2746 |
| 290 | Ga0105242_10615719 | 3300009176 | Bacteria | 1051 |
| 291 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 292 | Ga0105248_10123485 | 3300009177 | Bacteria | 2921 |
| 293 | Ga0105248_10154142 | 3300009177 | Bacteria | 2592 |
| 294 | Ga0105248_10333990 | 3300009177 | Bacteria | 1707 |
| 295 | Ga0105237_10367620 | 3300009545 | Bacteria | 1443 |
| 296 | Ga0105238_10020663 | 3300009551 | Bacteria | 6707 |
| 297 | Ga0105238_10081997 | 3300009551 | Bacteria | 3215 |
| 298 | Ga0105238_10227899 | 3300009551 | Bacteria | 1840 |
| 299 | Ga0105249_10010561 | 3300009553 | Bacteria | 8116 |
| 300 | Ga0105249_10022308 | 3300009553 | Bacteria | 5671 |
| 301 | Ga0105239_10072072 | 3300010375 | Bacteria | 3797 |
| 302 | Ga0105239_10166314 | 3300010375 | Bacteria | 2466 |
| 303 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 304 | Ga0157373_10022910 | 3300013100 | Bacteria | 4530 |
| 305 | Ga0157373_10037740 | 3300013100 | Bacteria | 3462 |
| 306 | Ga0157373_10178132 | 3300013100 | Bacteria | 1497 |
| 307 | Ga0157371_10102629 | 3300013102 | Bacteria | 2029 |
| 308 | Ga0157370_10117019 | 3300013104 | Bacteria | 2490 |
| 309 | Ga0157369_10013318 | 3300013105 | Bacteria | 9299 |
| 310 | Ga0157369_10059000 | 3300013105 | Bacteria | 4139 |
| 311 | Ga0157374_10097347 | 3300013296 | Bacteria | 2815 |
| 312 | Ga0157374_10170314 | 3300013296 | Bacteria | 2124 |
| 313 | Ga0157378_10008627 | 3300013297 | Bacteria | 8870 |
| 314 | Ga0163162_10002118 | 3300013306 | Bacteria | 18641 |
| 315 | Ga0163162_10007695 | 3300013306 | Bacteria | 10495 |
| 316 | Ga0163162_10026342 | 3300013306 | Bacteria | 5747 |
| 317 | Ga0157372_10051925 | 3300013307 | Bacteria | 4564 |
| 318 | Ga0157375_10046187 | 3300013308 | Bacteria | 4244 |
| 319 | Ga0157375_10064111 | 3300013308 | Bacteria | 3657 |
| 320 | Ga0157375_10095187 | 3300013308 | Bacteria | 3048 |
| 321 | Ga0157375_10099385 | 3300013308 | Bacteria | 2989 |
| 322 | Ga0157375_10112718 | 3300013308 | Bacteria | 2820 |
| 323 | Ga0157375_10130614 | 3300013308 | Bacteria | 2631 |
| 324 | Ga0157375_10318209 | 3300013308 | Bacteria | 1721 |
| 325 | Ga0163163_10007361 | 3300014325 | Bacteria | 9711 |
| 326 | Ga0163163_10165401 | 3300014325 | Bacteria | 2258 |
| 327 | Ga0163163_10251023 | 3300014325 | Bacteria | 1820 |
| 328 | Ga0163163_10580674 | 3300014325 | Bacteria | 1184 |
| 329 | Ga0157380_10015463 | 3300014326 | Bacteria | 5610 |
| 330 | Ga0157380_10056674 | 3300014326 | Bacteria | 3118 |
| 331 | Ga0157380_10102260 | 3300014326 | Bacteria | 2389 |
| 332 | Ga0157380_10112388 | 3300014326 | Bacteria | 2292 |
| 333 | Ga0157380_10281039 | 3300014326 | Bacteria | 1523 |
| 334 | Ga0157380_10548396 | 3300014326 | Bacteria | 1134 |
| 335 | Ga0182008_10001156 | 3300014497 | Bacteria | 18204 |
| 336 | Ga0182008_10004095 | 3300014497 | Bacteria | 8593 |
| 337 | Ga0182008_10008484 | 3300014497 | Bacteria | 5610 |
| 338 | Ga0182008_10116007 | 3300014497 | Bacteria | 1328 |
| 339 | Ga0157377_10000075 | 3300014745 | Bacteria | 76405 |
| 340 | Ga0157377_10023652 | 3300014745 | Bacteria | 3259 |
| 341 | Ga0157379_10025992 | 3300014968 | Bacteria | 5207 |
| 342 | Ga0157379_10030374 | 3300014968 | Bacteria | 4809 |
| 343 | Ga0157379_10034913 | 3300014968 | Bacteria | 4483 |
| 344 | Ga0157379_10061361 | 3300014968 | Bacteria | 3362 |
| 345 | Ga0157379_10069401 | 3300014968 | Bacteria | 3152 |
| 346 | Ga0157379_10093358 | 3300014968 | Bacteria | 2700 |
| 347 | Ga0157379_10097801 | 3300014968 | Bacteria | 2635 |
| 348 | Ga0157379_10122709 | 3300014968 | Bacteria | 2338 |
| 349 | Ga0157379_10266193 | 3300014968 | Bacteria | 1558 |
| 350 | Ga0157376_10017920 | 3300014969 | Bacteria | 5415 |
| 351 | Ga0157376_10142978 | 3300014969 | Bacteria | 2149 |
| 352 | Ga0157376_10206022 | 3300014969 | Bacteria | 1813 |
| 353 | Ga0157376_10227786 | 3300014969 | Bacteria | 1730 |
| 354 | Ga0182006_1003275 | 3300015261 | Bacteria | 8372 |
| 355 | Ga0182007_10002915 | 3300015262 | Bacteria | 8314 |
| 356 | Ga0182007_10031538 | 3300015262 | Bacteria | 1804 |
| 357 | Ga0182005_1000283 | 3300015265 | Bacteria | 31970 |
| 358 | Ga0182005_1017831 | 3300015265 | Bacteria | 1964 |
| 359 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 360 | Ga0163161_10039684 | 3300017792 | Bacteria | 3381 |
| 361 | Ga0163161_10053752 | 3300017792 | Bacteria | 2921 |
| 362 | Ga0163161_10090355 | 3300017792 | Bacteria | 2266 |
| 363 | Ga0213872_10000382 | 3300021361 | Bacteria | 37031 |
| 364 | Ga0209435_101147 | 3300025206 | Bacteria | 3652 |
| 365 | Ga0209784_100049 | 3300025224 | Bacteria | 195512 |
| 366 | Ga0209566_100061 | 3300025225 | Bacteria | 195512 |
| 367 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 368 | Ga0209674_100069 | 3300025226 | Bacteria | 243948 |
| 369 | Ga0209672_100538 | 3300025228 | Bacteria | 20576 |
| 370 | Ga0209672_102207 | 3300025228 | Bacteria | 5083 |
| 371 | Ga0209147_102676 | 3300025229 | Bacteria | 4127 |
| 372 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 373 | Ga0209563_100083 | 3300025230 | Bacteria | 195512 |
| 374 | Ga0207427_100345 | 3300025231 | Bacteria | 30030 |
| 375 | Ga0207427_100646 | 3300025231 | Bacteria | 16896 |
| 376 | Ga0209437_100091 | 3300025233 | Bacteria | 243344 |
| 377 | Ga0209258_100132 | 3300025242 | Bacteria | 175292 |
| 378 | Ga0209258_100344 | 3300025242 | Bacteria | 68131 |
| 379 | Ga0209258_100785 | 3300025242 | Bacteria | 19212 |
| 380 | Ga0207425_1000226 | 3300025245 | Bacteria | 44291 |
| 381 | Ga0207425_1007249 | 3300025245 | Bacteria | 2948 |
| 382 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 383 | Ga0209646_1002496 | 3300025246 | Bacteria | 4043 |
| 384 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 385 | Ga0209677_100039 | 3300025253 | Bacteria | 243974 |
| 386 | Ga0209677_100096 | 3300025253 | Bacteria | 99089 |
| 387 | Ga0209677_101194 | 3300025253 | Bacteria | 11889 |
| 388 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 389 | Ga0209148_1008882 | 3300025254 | Bacteria | 1993 |
| 390 | Ga0209759_1000075 | 3300025256 | Bacteria | 176235 |
| 391 | Ga0209759_1001215 | 3300025256 | Bacteria | 15837 |
| 392 | Ga0209759_1001295 | 3300025256 | Bacteria | 14863 |
| 393 | Ga0209759_1003631 | 3300025256 | Bacteria | 6070 |
| 394 | Ga0209759_1012969 | 3300025256 | Bacteria | 2279 |
| 395 | Ga0209759_1014554 | 3300025256 | Bacteria | 2074 |
| 396 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 397 | Ga0209129_1000084 | 3300025258 | Bacteria | 182554 |
| 398 | Ga0209233_1000115 | 3300025261 | Bacteria | 243344 |
| 399 | Ga0209565_1000169 | 3300025263 | Bacteria | 84839 |
| 400 | Ga0209565_1000364 | 3300025263 | Bacteria | 38944 |
| 401 | Ga0209565_1015528 | 3300025263 | Bacteria | 1715 |
| 402 | Ga0209455_1000242 | 3300025272 | Bacteria | 68131 |
| 403 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 404 | Ga0209673_1000916 | 3300025273 | Bacteria | 37512 |
| 405 | Ga0209673_1001117 | 3300025273 | Bacteria | 29869 |
| 406 | Ga0209673_1009349 | 3300025273 | Bacteria | 4258 |
| 407 | Ga0209673_1018628 | 3300025273 | Bacteria | 2517 |
| 408 | Ga0209673_1019820 | 3300025273 | Bacteria | 2403 |
| 409 | Ga0209673_1023627 | 3300025273 | Bacteria | 2088 |
| 410 | Ga0209673_1032796 | 3300025273 | Bacteria | 1595 |
| 411 | Ga0209130_1000571 | 3300025284 | Bacteria | 36074 |
| 412 | Ga0209130_1004615 | 3300025284 | Bacteria | 5136 |
| 413 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 414 | Ga0209675_1006399 | 3300025291 | Bacteria | 4731 |
| 415 | Ga0209676_1000817 | 3300025292 | Bacteria | 40674 |
| 416 | Ga0209676_1003376 | 3300025292 | Bacteria | 9919 |
| 417 | Ga0209676_1006433 | 3300025292 | Bacteria | 5803 |
| 418 | Ga0209676_1006821 | 3300025292 | Bacteria | 5537 |
| 419 | Ga0209025_1000719 | 3300025294 | Bacteria | 56292 |
| 420 | Ga0209025_1000861 | 3300025294 | Bacteria | 47942 |
| 421 | Ga0209025_1018573 | 3300025294 | Bacteria | 3927 |
| 422 | Ga0209025_1045276 | 3300025294 | Bacteria | 1826 |
| 423 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 424 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 425 | Ga0209564_1000414 | 3300025295 | Bacteria | 75224 |
| 426 | Ga0209564_1000613 | 3300025295 | Bacteria | 55031 |
| 427 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 428 | Ga0209758_1002249 | 3300025297 | Bacteria | 20036 |
| 429 | Ga0209050_1000052 | 3300025298 | Bacteria | 351785 |
| 430 | Ga0209050_1001635 | 3300025298 | Bacteria | 22939 |
| 431 | Ga0209050_1001761 | 3300025298 | Bacteria | 21453 |
| 432 | Ga0209050_1001765 | 3300025298 | Bacteria | 21356 |
| 433 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 434 | Ga0209256_1000206 | 3300025299 | Bacteria | 111425 |
| 435 | Ga0209256_1000239 | 3300025299 | Bacteria | 97580 |
| 436 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 437 | Ga0207426_1000086 | 3300025302 | Bacteria | 292089 |
| 438 | Ga0207426_1000346 | 3300025302 | Bacteria | 85832 |
| 439 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 440 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 441 | Ga0209051_1000071 | 3300025303 | Bacteria | 210843 |
| 442 | Ga0209051_1000420 | 3300025303 | Bacteria | 58383 |
| 443 | Ga0209051_1000492 | 3300025303 | Bacteria | 51006 |
| 444 | Ga0209051_1001081 | 3300025303 | Bacteria | 25280 |
| 445 | Ga0209051_1001503 | 3300025303 | Bacteria | 19479 |
| 446 | Ga0209051_1002112 | 3300025303 | Bacteria | 14864 |
| 447 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 448 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 449 | Ga0209257_1000367 | 3300025304 | Bacteria | 91077 |
| 450 | Ga0209257_1003430 | 3300025304 | Bacteria | 13611 |
| 451 | Ga0209257_1005624 | 3300025304 | Bacteria | 8678 |
| 452 | Ga0207656_10042172 | 3300025321 | Bacteria | 1941 |
| 453 | Ga0207656_10062157 | 3300025321 | Bacteria | 1641 |
| 454 | Ga0207656_10080253 | 3300025321 | Bacteria | 1465 |
| 455 | Ga0207655_1000477 | 3300025728 | Bacteria | 51677 |
| 456 | Ga0207682_10040791 | 3300025893 | Bacteria | 1892 |
| 457 | Ga0207682_10042315 | 3300025893 | Bacteria | 1861 |
| 458 | Ga0207642_10010253 | 3300025899 | Bacteria | 3294 |
| 459 | Ga0207642_10182304 | 3300025899 | Bacteria | 1145 |
| 460 | Ga0207680_10143169 | 3300025903 | Bacteria | 1586 |
| 461 | Ga0207680_10145423 | 3300025903 | Bacteria | 1575 |
| 462 | Ga0207680_10168886 | 3300025903 | Bacteria | 1472 |
| 463 | Ga0207680_10224614 | 3300025903 | Bacteria | 1289 |
| 464 | Ga0207647_10089114 | 3300025904 | Bacteria | 1842 |
| 465 | Ga0207645_10008088 | 3300025907 | Bacteria | 7379 |
| 466 | Ga0207645_10037909 | 3300025907 | Bacteria | 3093 |
| 467 | Ga0207645_10064845 | 3300025907 | Bacteria | 2334 |
| 468 | Ga0207645_10102595 | 3300025907 | Bacteria | 1846 |
| 469 | Ga0207643_10029897 | 3300025908 | Bacteria | 3031 |
| 470 | Ga0207643_10067632 | 3300025908 | Bacteria | 2051 |
| 471 | Ga0207705_10017381 | 3300025909 | Bacteria | 5151 |
| 472 | Ga0207705_10061682 | 3300025909 | Bacteria | 2708 |
| 473 | Ga0207705_10121110 | 3300025909 | Bacteria | 1942 |
| 474 | Ga0207695_10019040 | 3300025913 | Bacteria | 7918 |
| 475 | Ga0207695_10092973 | 3300025913 | Bacteria | 3026 |
| 476 | Ga0207695_10108240 | 3300025913 | Bacteria | 2764 |
| 477 | Ga0207695_10116955 | 3300025913 | Bacteria | 2640 |
| 478 | Ga0207662_10029185 | 3300025918 | Bacteria | 3194 |
| 479 | Ga0207657_10021426 | 3300025919 | Bacteria | 6082 |
| 480 | Ga0207657_10065236 | 3300025919 | Bacteria | 3105 |
| 481 | Ga0207657_10081075 | 3300025919 | Bacteria | 2726 |
| 482 | Ga0207657_10113479 | 3300025919 | Bacteria | 2236 |
| 483 | Ga0207657_10156024 | 3300025919 | Bacteria | 1856 |
| 484 | Ga0207649_10001310 | 3300025920 | Bacteria | 14847 |
| 485 | Ga0207649_10022011 | 3300025920 | Bacteria | 3679 |
| 486 | Ga0207649_10176533 | 3300025920 | Bacteria | 1492 |
| 487 | Ga0207652_10018335 | 3300025921 | Bacteria | 5739 |
| 488 | Ga0207652_10130236 | 3300025921 | Bacteria | 2243 |
| 489 | Ga0207652_10194118 | 3300025921 | Bacteria | 1826 |
| 490 | Ga0207681_10000593 | 3300025923 | Bacteria | 24630 |
| 491 | Ga0207681_10016551 | 3300025923 | Bacteria | 4615 |
| 492 | Ga0207681_10052469 | 3300025923 | Bacteria | 2765 |
| 493 | Ga0207681_10112309 | 3300025923 | Bacteria | 1984 |
| 494 | Ga0207694_10036617 | 3300025924 | Bacteria | 3766 |
| 495 | Ga0207694_10056930 | 3300025924 | Bacteria | 3038 |
| 496 | Ga0207650_10001668 | 3300025925 | Bacteria | 15808 |
| 497 | Ga0207650_10007368 | 3300025925 | Bacteria | 7487 |
| 498 | Ga0207650_10008263 | 3300025925 | Bacteria | 7106 |
| 499 | Ga0207650_10077646 | 3300025925 | Bacteria | 2511 |
| 500 | Ga0207650_10343548 | 3300025925 | Bacteria | 1226 |
| 501 | Ga0207659_10002674 | 3300025926 | Bacteria | 10616 |
| 502 | Ga0207659_10016256 | 3300025926 | Bacteria | 4839 |
| 503 | Ga0207659_10021228 | 3300025926 | Bacteria | 4307 |
| 504 | Ga0207659_10025527 | 3300025926 | Bacteria | 3972 |
| 505 | Ga0207659_10105397 | 3300025926 | Bacteria | 2133 |
| 506 | Ga0207687_10014488 | 3300025927 | Bacteria | 5159 |
| 507 | Ga0207644_10001504 | 3300025931 | Bacteria | 15026 |
| 508 | Ga0207644_10001724 | 3300025931 | Bacteria | 14137 |
| 509 | Ga0207644_10022871 | 3300025931 | Bacteria | 4274 |
| 510 | Ga0207690_10012412 | 3300025932 | Bacteria | 5094 |
| 511 | Ga0207690_10117694 | 3300025932 | Bacteria | 1924 |
| 512 | Ga0207690_10150421 | 3300025932 | Bacteria | 1725 |
| 513 | Ga0207706_10001677 | 3300025933 | Bacteria | 21872 |
| 514 | Ga0207706_10011352 | 3300025933 | Bacteria | 8118 |
| 515 | Ga0207706_10095958 | 3300025933 | Bacteria | 2608 |
| 516 | Ga0207686_10010318 | 3300025934 | Bacteria | 5083 |
| 517 | Ga0207686_10038467 | 3300025934 | Bacteria | 2895 |
| 518 | Ga0207709_10000625 | 3300025935 | Bacteria | 29011 |
| 519 | Ga0207709_10008688 | 3300025935 | Bacteria | 5605 |
| 520 | Ga0207709_10085744 | 3300025935 | Bacteria | 2043 |
| 521 | Ga0207670_10062873 | 3300025936 | Bacteria | 2538 |
| 522 | Ga0207669_10022100 | 3300025937 | Bacteria | 3373 |
| 523 | Ga0207669_10093576 | 3300025937 | Bacteria | 1964 |
| 524 | Ga0207704_10001522 | 3300025938 | Bacteria | 10396 |
| 525 | Ga0207704_10190598 | 3300025938 | Bacteria | 1491 |
| 526 | Ga0207691_10002901 | 3300025940 | Bacteria | 16713 |
| 527 | Ga0207691_10012766 | 3300025940 | Bacteria | 8042 |
| 528 | Ga0207691_10016738 | 3300025940 | Bacteria | 6961 |
| 529 | Ga0207691_10043548 | 3300025940 | Bacteria | 4136 |
| 530 | Ga0207691_10080536 | 3300025940 | Bacteria | 2929 |
| 531 | Ga0207691_10093842 | 3300025940 | Bacteria | 2686 |
| 532 | Ga0207691_10239744 | 3300025940 | Bacteria | 1568 |
| 533 | Ga0207711_10007584 | 3300025941 | Bacteria | 9078 |
| 534 | Ga0207711_10041907 | 3300025941 | Bacteria | 3899 |
| 535 | Ga0207711_10076292 | 3300025941 | Bacteria | 2919 |
| 536 | Ga0207711_10146699 | 3300025941 | Bacteria | 2126 |
| 537 | Ga0207711_10256121 | 3300025941 | Bacteria | 1608 |
| 538 | Ga0207689_10009850 | 3300025942 | Bacteria | 8237 |
| 539 | Ga0207689_10022702 | 3300025942 | Bacteria | 5271 |
| 540 | Ga0207689_10034031 | 3300025942 | Bacteria | 4232 |
| 541 | Ga0207689_10061308 | 3300025942 | Bacteria | 3093 |
| 542 | Ga0207689_10063571 | 3300025942 | Bacteria | 3036 |
| 543 | Ga0207689_10118101 | 3300025942 | Bacteria | 2181 |
| 544 | Ga0207689_10277214 | 3300025942 | Bacteria | 1388 |
| 545 | Ga0207661_10135339 | 3300025944 | Bacteria | 2115 |
| 546 | Ga0207661_10142760 | 3300025944 | Bacteria | 2062 |
| 547 | Ga0207679_10000730 | 3300025945 | Bacteria | 21864 |
| 548 | Ga0207679_10010415 | 3300025945 | Bacteria | 5985 |
| 549 | Ga0207679_10011896 | 3300025945 | Bacteria | 5656 |
| 550 | Ga0207679_10131331 | 3300025945 | Bacteria | 2010 |
| 551 | Ga0207679_10205195 | 3300025945 | Bacteria | 1649 |
| 552 | Ga0207667_10024656 | 3300025949 | Bacteria | 6599 |
| 553 | Ga0207667_10026800 | 3300025949 | Bacteria | 6289 |
| 554 | Ga0207667_10030273 | 3300025949 | Bacteria | 5858 |
| 555 | Ga0207667_10087544 | 3300025949 | Bacteria | 3222 |
| 556 | Ga0207667_10154567 | 3300025949 | Bacteria | 2361 |
| 557 | Ga0207651_10003471 | 3300025960 | Bacteria | 7745 |
| 558 | Ga0207651_10028358 | 3300025960 | Bacteria | 3530 |
| 559 | Ga0207651_10069685 | 3300025960 | Bacteria | 2484 |
| 560 | Ga0207651_10252192 | 3300025960 | Bacteria | 1444 |
| 561 | Ga0207712_10067108 | 3300025961 | Bacteria | 2566 |
| 562 | Ga0207668_10004390 | 3300025972 | Bacteria | 8286 |
| 563 | Ga0207668_10053015 | 3300025972 | Bacteria | 2809 |
| 564 | Ga0207640_10023034 | 3300025981 | Bacteria | 3738 |
| 565 | Ga0207640_10082383 | 3300025981 | Bacteria | 2203 |
| 566 | Ga0207658_10005270 | 3300025986 | Bacteria | 8895 |
| 567 | Ga0207658_10007685 | 3300025986 | Bacteria | 7342 |
| 568 | Ga0207658_10015971 | 3300025986 | Bacteria | 5157 |
| 569 | Ga0207658_10021533 | 3300025986 | Bacteria | 4478 |
| 570 | Ga0207658_10021561 | 3300025986 | Bacteria | 4476 |
| 571 | Ga0207658_10167556 | 3300025986 | Bacteria | 1806 |
| 572 | Ga0207677_10002324 | 3300026023 | Bacteria | 9980 |
| 573 | Ga0207677_10023530 | 3300026023 | Bacteria | 3808 |
| 574 | Ga0207677_10043382 | 3300026023 | Bacteria | 2989 |
| 575 | Ga0207703_10003131 | 3300026035 | Bacteria | 13968 |
| 576 | Ga0207703_10005198 | 3300026035 | Bacteria | 10519 |
| 577 | Ga0207703_10033516 | 3300026035 | Bacteria | 4072 |
| 578 | Ga0207703_10163573 | 3300026035 | Bacteria | 1951 |
| 579 | Ga0207639_10010457 | 3300026041 | Bacteria | 6429 |
| 580 | Ga0207639_10035863 | 3300026041 | Bacteria | 3672 |
| 581 | Ga0207639_10106409 | 3300026041 | Bacteria | 2277 |
| 582 | Ga0207639_10122505 | 3300026041 | Bacteria | 2139 |
| 583 | Ga0207639_10227734 | 3300026041 | Bacteria | 1614 |
| 584 | Ga0207639_10279091 | 3300026041 | Bacteria | 1469 |
| 585 | Ga0207678_10002200 | 3300026067 | Bacteria | 17609 |
| 586 | Ga0207678_10053222 | 3300026067 | Bacteria | 3489 |
| 587 | Ga0207678_10147260 | 3300026067 | Bacteria | 2010 |
| 588 | Ga0207708_10044032 | 3300026075 | Bacteria | 3401 |
| 589 | Ga0207702_10000305 | 3300026078 | Bacteria | 56491 |
| 590 | Ga0207702_10032304 | 3300026078 | Bacteria | 4368 |
| 591 | Ga0207702_10058880 | 3300026078 | Bacteria | 3270 |
| 592 | Ga0207641_10006528 | 3300026088 | Bacteria | 9811 |
| 593 | Ga0207641_10012012 | 3300026088 | Bacteria | 7106 |
| 594 | Ga0207641_10124207 | 3300026088 | Bacteria | 2308 |
| 595 | Ga0207641_10322836 | 3300026088 | Bacteria | 1464 |
| 596 | Ga0207648_10000286 | 3300026089 | Bacteria | 54985 |
| 597 | Ga0207648_10000878 | 3300026089 | Bacteria | 33868 |
| 598 | Ga0207648_10008332 | 3300026089 | Bacteria | 10058 |
| 599 | Ga0207648_10024038 | 3300026089 | Bacteria | 5446 |
| 600 | Ga0207648_10042896 | 3300026089 | Bacteria | 3972 |
| 601 | Ga0207648_10066867 | 3300026089 | Bacteria | 3134 |
| 602 | Ga0207648_10105019 | 3300026089 | Bacteria | 2478 |
| 603 | Ga0207676_10001457 | 3300026095 | Bacteria | 17601 |
| 604 | Ga0207676_10021802 | 3300026095 | Bacteria | 4704 |
| 605 | Ga0207676_10036150 | 3300026095 | Bacteria | 3755 |
| 606 | Ga0207676_10114179 | 3300026095 | Bacteria | 2265 |
| 607 | Ga0207676_10218332 | 3300026095 | Bacteria | 1696 |
| 608 | Ga0207676_10258686 | 3300026095 | Bacteria | 1570 |
| 609 | Ga0207674_10067815 | 3300026116 | Bacteria | 3591 |
| 610 | Ga0207674_10091078 | 3300026116 | Bacteria | 3040 |
| 611 | Ga0207674_10102936 | 3300026116 | Bacteria | 2835 |
| 612 | Ga0207675_100001900 | 3300026118 | Bacteria | 20834 |
| 613 | Ga0207675_100008217 | 3300026118 | Bacteria | 9835 |
| 614 | Ga0207675_100037604 | 3300026118 | Bacteria | 4514 |
| 615 | Ga0207683_10016577 | 3300026121 | Bacteria | 6273 |
| 616 | Ga0207683_10028752 | 3300026121 | Bacteria | 4808 |
| 617 | Ga0207683_10092116 | 3300026121 | Bacteria | 2701 |
| 618 | Ga0207683_10116820 | 3300026121 | Bacteria | 2392 |
| 619 | Ga0207683_10164423 | 3300026121 | Bacteria | 2007 |
| 620 | Ga0207698_10004685 | 3300026142 | Bacteria | 8360 |
| 621 | Ga0207698_10009520 | 3300026142 | Bacteria | 6200 |
| 622 | Ga0207698_10045582 | 3300026142 | Bacteria | 3305 |
| 623 | Ga0207698_10055995 | 3300026142 | Bacteria | 3042 |
| 624 | Ga0207698_10059137 | 3300026142 | Bacteria | 2974 |
| 625 | Ga0207698_10062309 | 3300026142 | Bacteria | 2912 |
| 626 | Ga0207698_10086423 | 3300026142 | Bacteria | 2550 |
| 627 | Ga0207698_10118010 | 3300026142 | Bacteria | 2240 |
| 628 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 629 | Ga0209968_1000129 | 3300027526 | Bacteria | 13402 |
| 630 | Ga0209999_1002190 | 3300027543 | Bacteria | 3420 |
| 631 | Ga0209282_1001433 | 3300027666 | Bacteria | 13109 |
| 632 | Ga0209966_1000035 | 3300027695 | Bacteria | 56067 |
| 633 | Ga0207428_10035993 | 3300027907 | Bacteria | 4041 |
| 634 | Ga0268266_10117070 | 3300028379 | Bacteria | 2368 |
| 635 | Ga0268266_10559763 | 3300028379 | Bacteria | 1096 |
| 636 | Ga0268265_10114311 | 3300028380 | Bacteria | 2210 |
| 637 | Ga0268264_10000991 | 3300028381 | Bacteria | 28937 |
| 638 | Ga0268264_10062766 | 3300028381 | Bacteria | 3121 |
| 639 | Ga0268264_10112149 | 3300028381 | Bacteria | 2390 |
| 640 | Ga0268264_10115229 | 3300028381 | Bacteria | 2361 |
| 641 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 642 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 643 | Ga0307517_10069239 | 3300028786 | Bacteria | 3201 |
| 644 | Ga0307517_10155715 | 3300028786 | Bacteria | 1551 |
| 645 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 646 | Ga0307515_10000278 | 3300028794 | Bacteria | 125493 |
| 647 | Ga0307515_10006352 | 3300028794 | Bacteria | 23656 |
| 648 | Ga0307515_10009653 | 3300028794 | Bacteria | 18622 |
| 649 | Ga0307515_10028588 | 3300028794 | Bacteria | 9473 |
| 650 | Ga0307515_10035182 | 3300028794 | Bacteria | 8160 |
| 651 | Ga0307515_10037795 | 3300028794 | Bacteria | 7745 |
| 652 | Ga0307515_10040145 | 3300028794 | Bacteria | 7410 |
| 653 | Ga0307515_10066582 | 3300028794 | Bacteria | 4987 |
| 654 | Ga0307515_10089622 | 3300028794 | Bacteria | 3870 |
| 655 | Ga0307515_10120653 | 3300028794 | Bacteria | 2972 |
| 656 | Ga0307515_10165132 | 3300028794 | Bacteria | 2236 |
| 657 | Ga0265324_10000193 | 3300029957 | Bacteria | 46981 |
| 658 | Ga0265324_10007057 | 3300029957 | Bacteria | 4607 |
| 659 | Ga0316177_1175648 | 3300030731 | Bacteria | 4726 |
| 660 | Ga0316176_1195019 | 3300030732 | Bacteria | 2474 |
| 661 | Ga0314311_1020317 | 3300030733 | Bacteria | 3252 |
| 662 | Ga0316179_1040040 | 3300030734 | Bacteria | 2406 |
| 663 | Ga0316178_1025743 | 3300030735 | Bacteria | 6114 |
| 664 | Ga0316180_1050502 | 3300030736 | Bacteria | 4264 |
| 665 | Ga0316183_1188254 | 3300030742 | Bacteria | 3217 |
| 666 | Ga0316183_1202539 | 3300030742 | Bacteria | 1790 |
| 667 | Ga0316181_1041597 | 3300030744 | Bacteria | 3900 |
| 668 | Ga0316182_1104984 | 3300030745 | Bacteria | 4450 |
| 669 | Ga0316182_1417019 | 3300030745 | Bacteria | 3598 |
| 670 | Ga0265330_10000453 | 3300031235 | Bacteria | 27395 |
| 671 | Ga0265332_10000012 | 3300031238 | Bacteria | 272641 |
| 672 | Ga0265325_10017431 | 3300031241 | Bacteria | 3990 |
| 673 | Ga0265327_10001807 | 3300031251 | Bacteria | 25067 |
| 674 | Ga0307513_10043473 | 3300031456 | Bacteria | 4933 |
| 675 | Ga0307513_10051134 | 3300031456 | Bacteria | 4461 |
| 676 | Ga0307513_10069012 | 3300031456 | Bacteria | 3700 |
| 677 | Ga0307513_10155369 | 3300031456 | Bacteria | 2189 |
| 678 | Ga0307509_10000871 | 3300031507 | Bacteria | 52060 |
| 679 | Ga0307509_10009460 | 3300031507 | Bacteria | 12180 |
| 680 | Ga0307509_10062290 | 3300031507 | Bacteria | 3934 |
| 681 | Ga0307509_10071281 | 3300031507 | Bacteria | 3625 |
| 682 | Ga0307509_10072259 | 3300031507 | Bacteria | 3595 |
| 683 | Ga0307509_10086638 | 3300031507 | Bacteria | 3220 |
| 684 | Ga0307509_10158271 | 3300031507 | Bacteria | 2167 |
| 685 | Ga0307509_10271113 | 3300031507 | Bacteria | 1465 |
| 686 | Ga0307408_100000274 | 3300031548 | Bacteria | 51724 |
| 687 | Ga0307408_100104590 | 3300031548 | Bacteria | 2163 |
| 688 | Ga0307408_100106258 | 3300031548 | Bacteria | 2147 |
| 689 | Ga0307508_10000123 | 3300031616 | Bacteria | 92439 |
| 690 | Ga0307508_10000349 | 3300031616 | Bacteria | 56002 |
| 691 | Ga0307508_10046060 | 3300031616 | Bacteria | 3894 |
| 692 | Ga0307508_10061411 | 3300031616 | Bacteria | 3321 |
| 693 | Ga0307508_10189187 | 3300031616 | Bacteria | 1660 |
| 694 | Ga0307508_10245087 | 3300031616 | Bacteria | 1389 |
| 695 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 696 | Ga0307514_10001708 | 3300031649 | Bacteria | 25207 |
| 697 | Ga0307514_10010918 | 3300031649 | Bacteria | 7584 |
| 698 | Ga0307514_10024565 | 3300031649 | Bacteria | 4876 |
| 699 | Ga0307514_10057518 | 3300031649 | Bacteria | 2978 |
| 700 | Ga0265314_10000029 | 3300031711 | Bacteria | 272506 |
| 701 | Ga0307516_10001568 | 3300031730 | Bacteria | 31474 |
| 702 | Ga0307516_10001850 | 3300031730 | Bacteria | 29022 |
| 703 | Ga0307516_10004605 | 3300031730 | Bacteria | 16911 |
| 704 | Ga0307516_10044066 | 3300031730 | Bacteria | 4417 |
| 705 | Ga0307516_10146531 | 3300031730 | Bacteria | 2126 |
| 706 | Ga0307405_10014665 | 3300031731 | Bacteria | 4222 |
| 707 | Ga0307405_10014975 | 3300031731 | Bacteria | 4186 |
| 708 | Ga0307405_10369473 | 3300031731 | Bacteria | 1113 |
| 709 | Ga0307413_10026524 | 3300031824 | Bacteria | 3194 |
| 710 | Ga0307410_10185676 | 3300031852 | Bacteria | 1578 |
| 711 | Ga0307406_10001131 | 3300031901 | Bacteria | 14904 |
| 712 | Ga0307406_10001699 | 3300031901 | Bacteria | 12095 |
| 713 | Ga0307406_10027882 | 3300031901 | Bacteria | 3407 |
| 714 | Ga0307406_10042058 | 3300031901 | Bacteria | 2851 |
| 715 | Ga0307412_10054471 | 3300031911 | Bacteria | 2656 |
| 716 | Ga0307412_10097082 | 3300031911 | Bacteria | 2075 |
| 717 | Ga0307412_10117802 | 3300031911 | Bacteria | 1907 |
| 718 | Ga0307412_10125216 | 3300031911 | Bacteria | 1857 |
| 719 | Ga0307412_10353632 | 3300031911 | Bacteria | 1180 |
| 720 | Ga0307409_100000926 | 3300031995 | Bacteria | 13646 |
| 721 | Ga0307416_100003028 | 3300032002 | Bacteria | 9820 |
| 722 | Ga0307416_100168892 | 3300032002 | Bacteria | 2033 |
| 723 | Ga0307416_100179728 | 3300032002 | Bacteria | 1981 |
| 724 | Ga0307416_100502519 | 3300032002 | Bacteria | 1277 |
| 725 | Ga0307414_10026215 | 3300032004 | Bacteria | 3748 |
| 726 | Ga0307414_10064209 | 3300032004 | Bacteria | 2613 |
| 727 | Ga0307414_10159590 | 3300032004 | Bacteria | 1789 |
| 728 | Ga0307411_10041081 | 3300032005 | Bacteria | 2940 |
| 729 | Ga0307415_100003743 | 3300032126 | Bacteria | 7793 |
| 730 | Ga0307510_10008226 | 3300033180 | Bacteria | 12423 |
| 731 | Ga0307510_10069826 | 3300033180 | Bacteria | 3514 |
| 732 | Ga0307510_10201778 | 3300033180 | Bacteria | 1522 |
| 733 | Ga0373959_0006082 | 3300034820 | Bacteria | 1994 |
| 734 | Ga0373955_0184150 | 3300035172 | Bacteria | 1240 |
| 735 | Ga0373962_0011061 | 3300035242 | Bacteria | 2257 |
| 736 | Ga0373931_0058186 | 3300035691 | Bacteria | 2075 |
| 737 | Ga0373931_0122546 | 3300035691 | Bacteria | 1487 |
| 738 | Ga0373947_0070940 | 3300035725 | Bacteria | 2136 |
| 739 | Ga0373925_0435975 | 3300037068 | Bacteria | 1072 |
| 740 | Ga0395899_0000586 | 3300037312 | Bacteria | 38344 |
| 741 | Ga0395899_0001071 | 3300037312 | Bacteria | 24692 |
| 742 | Ga0395899_0074231 | 3300037312 | Bacteria | 2485 |
| 743 | Ga0395900_0000058 | 3300037418 | Bacteria | 206785 |
| 744 | Ga0395900_0005380 | 3300037418 | Bacteria | 13414 |
| 745 | Ga0395900_0039728 | 3300037418 | Bacteria | 4847 |
| 746 | Ga0395900_0054509 | 3300037418 | Bacteria | 4117 |
| 747 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 748 | Ga0395898_0004069 | 3300037466 | Bacteria | 16053 |
| 749 | Ga0395898_0006225 | 3300037466 | Bacteria | 12784 |
| 750 | Ga0395905_0000474 | 3300037471 | Bacteria | 55503 |
| 751 | Ga0395905_0006877 | 3300037471 | Bacteria | 11371 |
| 752 | Ga0395905_0013432 | 3300037471 | Bacteria | 7846 |
| 753 | Ga0395905_0022875 | 3300037471 | Bacteria | 5908 |
| 754 | Ga0395905_0023384 | 3300037471 | Bacteria | 5840 |
| 755 | Ga0395905_0023805 | 3300037471 | Bacteria | 5782 |
| 756 | Ga0395905_0060047 | 3300037471 | Bacteria | 3555 |
| 757 | Ga0395905_0070264 | 3300037471 | Bacteria | 3280 |
| 758 | Ga0395905_0113331 | 3300037471 | Bacteria | 2547 |
| 759 | Ga0395905_0232081 | 3300037471 | Bacteria | 1725 |
| 760 | Ga0395905_0373377 | 3300037471 | Bacteria | 1319 |
| 761 | Ga0395901_0001676 | 3300038443 | Bacteria | 22857 |
| 762 | Ga0395901_0002111 | 3300038443 | Bacteria | 20385 |
| 763 | Ga0395901_0010431 | 3300038443 | Bacteria | 9413 |
| 764 | Ga0395901_0130823 | 3300038443 | Bacteria | 2637 |
| 765 | Ga0436365_0730477 | 3300039437 | Bacteria | 2085 |
| 766 | Ga0436361_0566522 | 3300039447 | Bacteria | 37173 |
| 767 | Ga0436361_0591904 | 3300039447 | Bacteria | 6639 |
| 768 | Ga0436361_0627254 | 3300039447 | Bacteria | 2153 |
| 769 | Ga0436361_1134487 | 3300039447 | Bacteria | 5287 |
| 770 | Ga0439436_0002079 | 3300041404 | Bacteria | 5974 |
| 771 | Ga0439439_0017596 | 3300041406 | Bacteria | 1759 |
| 772 | Ga0439465_0001094 | 3300041413 | Bacteria | 8687 |
| 773 | Ga0451795_0816552 | 3300041456 | Bacteria | 1931 |
| 774 | Ga0451802_0878914 | 3300041460 | Bacteria | 1396 |
| 775 | Ga0451839_1446416 | 3300041496 | Bacteria | 2231 |
| 776 | Ga0451853_2222586 | 3300041512 | Bacteria | 1257 |
| 777 | Ga0439431_0011396 | 3300041997 | Bacteria | 2031 |
| 778 | Ga0439432_006841 | 3300042006 | Bacteria | 4061 |
| 779 | Ga0439432_013501 | 3300042006 | Bacteria | 2777 |
| 780 | Ga0439449_0000840 | 3300042007 | Bacteria | 11913 |
| 781 | Ga0439449_0004494 | 3300042007 | Bacteria | 5388 |
| 782 | Ga0439449_0016763 | 3300042007 | Bacteria | 2752 |
| 783 | Ga0439449_0053043 | 3300042007 | Bacteria | 1499 |
| 784 | Ga0439452_013992 | 3300042010 | Bacteria | 2239 |
| 785 | Ga0439457_020415 | 3300042014 | Bacteria | 1470 |
| 786 | Ga0439462_0013086 | 3300042015 | Bacteria | 2125 |
| 787 | Ga0439462_0015525 | 3300042015 | Bacteria | 1963 |
| 788 | Ga0450911_001146 | 3300042115 | Bacteria | 6532 |
| 789 | Ga0450919_000198 | 3300042121 | Bacteria | 6591 |
| 790 | Ga0450920_012224 | 3300042122 | Bacteria | 1608 |
| 791 | Ga0450890_006419 | 3300042127 | Bacteria | 1504 |
| 792 | Ga0450897_001948 | 3300042128 | Bacteria | 1484 |
| 793 | Ga0439446_0012002 | 3300042156 | Bacteria | 2362 |
| 794 | Ga0450908_011281 | 3300042184 | Bacteria | 1637 |
| 795 | Ga0439434_0004081 | 3300042435 | Bacteria | 4264 |
| 796 | Ga0439434_0043675 | 3300042435 | Bacteria | 1380 |
| 797 | Ga0439459_0006802 | 3300042438 | Bacteria | 1916 |
| 798 | Ga0450918_000047 | 3300042531 | Bacteria | 24725 |
| 799 | Ga0450918_000609 | 3300042531 | Bacteria | 7669 |
| 800 | Ga0451577_0010228 | 3300042876 | Bacteria | 8985 |
| 801 | Ga0451577_0013180 | 3300042876 | Bacteria | 7747 |
| 802 | Ga0451577_0019182 | 3300042876 | Bacteria | 6290 |
| 803 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 804 | Ga0466969_0001902 | 3300044656 | Bacteria | 11167 |
| 805 | Ga0466969_0038002 | 3300044656 | Bacteria | 2425 |
| 806 | Ga0466969_0098117 | 3300044656 | Bacteria | 1381 |
| 807 | Ga0466972_0074601 | 3300044658 | Bacteria | 1616 |
| 808 | Ga0466972_0078819 | 3300044658 | Bacteria | 1569 |
| 809 | Ga0466965_0072665 | 3300044683 | Bacteria | 1731 |
| 810 | Ga0466966_0007367 | 3300044684 | Bacteria | 7299 |
| 811 | Ga0466966_0009518 | 3300044684 | Bacteria | 6435 |
| 812 | Ga0466966_0019848 | 3300044684 | Bacteria | 4420 |
| 813 | Ga0466966_0063907 | 3300044684 | Bacteria | 2318 |
| 814 | Ga0466963_0006190 | 3300044694 | Bacteria | 7066 |
| 815 | Ga0466964_0023321 | 3300044706 | Bacteria | 2406 |
| 816 | Ga0466964_0049836 | 3300044706 | Bacteria | 1715 |
| 817 | Ga0453684_0027299 | 3300044712 | Bacteria | 8193 |
| 818 | Ga0466971_0003284 | 3300044719 | Bacteria | 6900 |
| 819 | Ga0466970_0041588 | 3300044765 | Bacteria | 2442 |
| 820 | Ga0466957_0028042 | 3300044842 | Bacteria | 3350 |
| 821 | Ga0466957_0068411 | 3300044842 | Bacteria | 2192 |
| 822 | Ga0466959_0012078 | 3300045049 | Bacteria | 6231 |
| 823 | Ga0466959_0086352 | 3300045049 | Bacteria | 2257 |
| 824 | Ga0466958_0007549 | 3300045836 | Bacteria | 5986 |
| 825 | Ga0466967_0159737 | 3300045976 | Bacteria | 2114 |
| 826 | Ga0495627_008213 | 3300046453 | Bacteria | 3928 |
| 827 | Ga0495627_019457 | 3300046453 | Bacteria | 2276 |
| 828 | Ga0495592_0000394 | 3300046454 | Bacteria | 33973 |
| 829 | Ga0495592_0125944 | 3300046454 | Bacteria | 1797 |
| 830 | Ga0495590_0005173 | 3300046457 | Bacteria | 5190 |
| 831 | Ga0495638_0139249 | 3300046460 | Bacteria | 1418 |
| 832 | Ga0495651_0019143 | 3300046462 | Bacteria | 5304 |
| 833 | Ga0495651_0025317 | 3300046462 | Bacteria | 4618 |
| 834 | Ga0495651_0040232 | 3300046462 | Bacteria | 3636 |
| 835 | Ga0495653_0047008 | 3300046463 | Bacteria | 3339 |
| 836 | Ga0495650_0019463 | 3300046471 | Bacteria | 3340 |
| 837 | Ga0495583_0000081 | 3300046506 | Bacteria | 168304 |
| 838 | Ga0495606_0001086 | 3300046507 | Bacteria | 38950 |
| 839 | Ga0495608_0013966 | 3300046511 | Bacteria | 5571 |
| 840 | Ga0495608_0056440 | 3300046511 | Bacteria | 2593 |
| 841 | Ga0495610_0025702 | 3300046512 | Bacteria | 3155 |
| 842 | Ga0495610_0056162 | 3300046512 | Bacteria | 1894 |
| 843 | Ga0495610_0061924 | 3300046512 | Bacteria | 1776 |
| 844 | Ga0495616_0011779 | 3300046513 | Bacteria | 4993 |
| 845 | Ga0495618_0154218 | 3300046514 | Bacteria | 1466 |
| 846 | Ga0495628_0001687 | 3300046516 | Bacteria | 20156 |
| 847 | Ga0495628_0013853 | 3300046516 | Bacteria | 6773 |
| 848 | Ga0495628_0322765 | 3300046516 | Bacteria | 1139 |
| 849 | Ga0495630_0154828 | 3300046517 | Bacteria | 1745 |
| 850 | Ga0495631_0001417 | 3300046518 | Bacteria | 14572 |
| 851 | Ga0495632_0010162 | 3300046519 | Bacteria | 5598 |
| 852 | Ga0495637_0008174 | 3300046520 | Bacteria | 5150 |
| 853 | Ga0495643_0067736 | 3300046522 | Bacteria | 1880 |
| 854 | Ga0495643_0149048 | 3300046522 | Bacteria | 1160 |
| 855 | Ga0495652_0008424 | 3300046529 | Bacteria | 9412 |
| 856 | Ga0495586_0054921 | 3300046535 | Bacteria | 2159 |
| 857 | Ga0495621_0018955 | 3300046539 | Bacteria | 2241 |
| 858 | Ga0495621_0024847 | 3300046539 | Bacteria | 2006 |
| 859 | Ga0495645_0062491 | 3300046543 | Bacteria | 2697 |
| 860 | Ga0495656_0000093 | 3300046615 | Bacteria | 38558 |
| 861 | Ga0495656_0019941 | 3300046615 | Bacteria | 2594 |
| 862 | Ga0495656_0093610 | 3300046615 | Bacteria | 1378 |
| 863 | Ga0495668_0046750 | 3300046616 | Bacteria | 2404 |
| 864 | Ga0495611_0087562 | 3300046648 | Bacteria | 1437 |
| 865 | Ga0495625_0001179 | 3300046660 | Bacteria | 33575 |
| 866 | Ga0495625_0006045 | 3300046660 | Bacteria | 10869 |
| 867 | Ga0495625_0034941 | 3300046660 | Bacteria | 3707 |
| 868 | Ga0495635_0064709 | 3300046663 | Bacteria | 2510 |
| 869 | Ga0495588_0049426 | 3300046674 | Bacteria | 2162 |
| 870 | Ga0495657_0064886 | 3300046675 | Bacteria | 2403 |
| 871 | Ga0495623_0006819 | 3300046679 | Bacteria | 7430 |
| 872 | Ga0495646_0002576 | 3300046680 | Bacteria | 11150 |
| 873 | Ga0495646_0031501 | 3300046680 | Bacteria | 3304 |
| 874 | Ga0495646_0141327 | 3300046680 | Bacteria | 1346 |
| 875 | Ga0495658_0035262 | 3300046683 | Bacteria | 2751 |
| 876 | Ga0495658_0037493 | 3300046683 | Bacteria | 2680 |
| 877 | Ga0495658_0046686 | 3300046683 | Bacteria | 2436 |
| 878 | Ga0495658_0214289 | 3300046683 | Bacteria | 1204 |
| 879 | Ga0495669_0012571 | 3300046684 | Bacteria | 3605 |
| 880 | Ga0495613_0165418 | 3300046689 | Bacteria | 1572 |
| 881 | Ga0495624_0062388 | 3300046690 | Bacteria | 2332 |
| 882 | Ga0495670_0034634 | 3300046691 | Bacteria | 2516 |
| 883 | Ga0495671_0021694 | 3300046692 | Bacteria | 3370 |
| 884 | Ga0495649_0000287 | 3300046694 | Bacteria | 44649 |
| 885 | Ga0495649_0015647 | 3300046694 | Bacteria | 4313 |
| 886 | Ga0495589_0008991 | 3300046794 | Bacteria | 5197 |
| 887 | Ga0495604_0044585 | 3300047317 | Bacteria | 3463 |
| 888 | Ga0495604_0096919 | 3300047317 | Bacteria | 2176 |
| 889 | Ga0495676_0107019 | 3300047321 | Bacteria | 2059 |
| 890 | Ga0495687_000582 | 3300047443 | Bacteria | 42863 |
| 891 | Ga0495687_003988 | 3300047443 | Bacteria | 10280 |
| 892 | Ga0495684_0157686 | 3300047471 | Bacteria | 1695 |
| 893 | Ga0495686_0012435 | 3300047472 | Bacteria | 5953 |
| 894 | Ga0495686_0075315 | 3300047472 | Bacteria | 2069 |
| 895 | Ga0495593_0101135 | 3300047673 | Bacteria | 1478 |
| 896 | Ga0495602_0019713 | 3300048088 | Bacteria | 6684 |
| 897 | Ga0495602_0089757 | 3300048088 | Bacteria | 2555 |
| 898 | Ga0495602_0135349 | 3300048088 | Bacteria | 1958 |
| 899 | Ga0495615_0007340 | 3300048090 | Bacteria | 2088 |
| 900 | Ga0496100_0043054 | 3300048903 | Bacteria | 2886 |
| 901 | Ga0496100_0092730 | 3300048903 | Bacteria | 2065 |
| 902 | Ga0496101_0034545 | 3300048904 | Bacteria | 3571 |
| 903 | Ga0496101_0342128 | 3300048904 | Bacteria | 1175 |
| 904 | Ga0496102_0025715 | 3300048905 | Bacteria | 5243 |
| 905 | Ga0496103_0050295 | 3300048906 | Bacteria | 2578 |
| 906 | Ga0496104_0008511 | 3300048907 | Bacteria | 9120 |
| 907 | Ga0496105_0024726 | 3300048908 | Bacteria | 4882 |
| 908 | Ga0496105_0078475 | 3300048908 | Bacteria | 2726 |
| 909 | Ga0496106_0022941 | 3300048909 | Bacteria | 4635 |
| 910 | Ga0496106_0048622 | 3300048909 | Bacteria | 3194 |
| 911 | Ga0496106_0053548 | 3300048909 | Bacteria | 3048 |
| 912 | Ga0496107_0006316 | 3300048910 | Bacteria | 8145 |
| 913 | Ga0496108_0236330 | 3300048911 | Bacteria | 1589 |
| 914 | Ga0496109_0073499 | 3300048912 | Bacteria | 3142 |
| 915 | Ga0496110_0079805 | 3300048913 | Bacteria | 2914 |
| 916 | Ga0496110_0358531 | 3300048913 | Bacteria | 1329 |
| 917 | Ga0496111_0067545 | 3300048914 | Bacteria | 2597 |
| 918 | Ga0496111_0078010 | 3300048914 | Bacteria | 2415 |
| 919 | Ga0496112_0011308 | 3300048915 | Bacteria | 8144 |
| 920 | Ga0496112_0460602 | 3300048915 | Bacteria | 1209 |
| 921 | Ga0496114_0003046 | 3300048917 | Bacteria | 12833 |
| 922 | Ga0496114_0056306 | 3300048917 | Bacteria | 3281 |
| 923 | Ga0496114_0124210 | 3300048917 | Bacteria | 2223 |
| 924 | Ga0496114_0159508 | 3300048917 | Bacteria | 1960 |
| 925 | Ga0496115_0067578 | 3300048918 | Bacteria | 2891 |
| 926 | Ga0496117_0044192 | 3300048920 | Bacteria | 3229 |
| 927 | Ga0496117_0081894 | 3300048920 | Bacteria | 2116 |
| 928 | Ga0496118_0007613 | 3300048921 | Bacteria | 11409 |
| 929 | Ga0496121_0035310 | 3300048924 | Bacteria | 4482 |
| 930 | Ga0496121_0061186 | 3300048924 | Bacteria | 3091 |
| 931 | Ga0496121_0065545 | 3300048924 | Bacteria | 2954 |
| 932 | Ga0496121_0083876 | 3300048924 | Bacteria | 2514 |
| 933 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 934 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 935 | Ga0496124_0002378 | 3300048927 | Bacteria | 24780 |
| 936 | Ga0496124_0016354 | 3300048927 | Bacteria | 7058 |
| 937 | Ga0496124_0097272 | 3300048927 | Bacteria | 2390 |
| 938 | Ga0496125_0000785 | 3300048928 | Bacteria | 51744 |
| 939 | Ga0496125_0013437 | 3300048928 | Bacteria | 8046 |
| 940 | Ga0496125_0049441 | 3300048928 | Bacteria | 3494 |
| 941 | Ga0496125_0070483 | 3300048928 | Bacteria | 2736 |
| 942 | Ga0501034_0239499 | 3300049571 | Bacteria | 1761 |
| 943 | Ga0501038_0058954 | 3300049574 | Bacteria | 3290 |
| 944 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 945 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 946 | Ga0501046_0063108 | 3300049580 | Bacteria | 2893 |
| 947 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 948 | Ga0501048_0006915 | 3300049582 | Bacteria | 8623 |
| 949 | Ga0501252_001618 | 3300049682 | Bacteria | 2115 |
| 950 | Ga0501225_0007622 | 3300049705 | Bacteria | 3135 |
| 951 | Ga0501262_001452 | 3300049759 | Bacteria | 2660 |
| 952 | Ga0501035_0238000 | 3300049822 | Bacteria | 1549 |
| 953 | Ga0501045_0020284 | 3300049824 | Bacteria | 4747 |
| 954 | nmdc:mga03683_26256_c1 | 3300050489 | Bacteria | 2296 |
| 955 | nmdc:mga03683_32284_c1 | 3300050489 | Bacteria | 2106 |
| 956 | nmdc:mga03683_52391_c1 | 3300050489 | Bacteria | 1706 |
| 957 | nmdc:mga03n38_21542_c1 | 3300050490 | Bacteria | 2596 |
| 958 | nmdc:mga0yw44_14380_c1 | 3300050492 | Bacteria | 4202 |
| 959 | nmdc:mga0yw44_38057_c1 | 3300050492 | Bacteria | 2844 |
| 960 | nmdc:mga0k408_14868_c1 | 3300050493 | Bacteria | 4297 |
| 961 | nmdc:mga0k408_28083_c1 | 3300050493 | Bacteria | 3198 |
| 962 | nmdc:mga0k408_47081_c1 | 3300050493 | Bacteria | 2492 |
| 963 | nmdc:mga0k408_51063_c1 | 3300050493 | Bacteria | 2395 |
| 964 | nmdc:mga0k408_55984_c1 | 3300050493 | Bacteria | 2287 |
| 965 | nmdc:mga0k408_8358_c1 | 3300050493 | Bacteria | 5553 |
| 966 | nmdc:mga0k408_86717_c1 | 3300050493 | Bacteria | 1838 |
| 967 | nmdc:mga06z11_115211_c1 | 3300050494 | Bacteria | 1493 |
| 968 | nmdc:mga06z11_190863_c1 | 3300050494 | Bacteria | 1186 |
| 969 | nmdc:mga06z11_42479_c1 | 3300050494 | Bacteria | 2281 |
| 970 | nmdc:mga06z11_52833_c1 | 3300050494 | Bacteria | 2087 |
| 971 | nmdc:mga07m45_12201_c1 | 3300050496 | Bacteria | 4535 |
| 972 | nmdc:mga07m45_221111_c1 | 3300050496 | Bacteria | 1102 |
| 973 | nmdc:mga07m45_29688_c1 | 3300050496 | Bacteria | 3026 |
| 974 | nmdc:mga07m45_36397_c1 | 3300050496 | Bacteria | 2741 |
| 975 | nmdc:mga07m45_43867_c1 | 3300050496 | Bacteria | 2508 |
| 976 | nmdc:mga07m45_81_c1 | 3300050496 | Bacteria | 35778 |
| 977 | nmdc:mga09592_14596_c1 | 3300050508 | Bacteria | 6411 |
| 978 | nmdc:mga0qj67_69170_c1 | 3300050509 | Bacteria | 2815 |
| 979 | nmdc:mga0sz30_21551_c1 | 3300050516 | Bacteria | 2609 |
| 980 | Ga0495601_0044290 | 3300053077 | Bacteria | 2797 |
| 981 | Ga0500578_0000652 | 3300053086 | Bacteria | 41736 |
| 982 | Ga0500643_018305 | 3300053087 | Bacteria | 2328 |
| 983 | Ga0500646_0020168 | 3300053090 | Bacteria | 1769 |
| 984 | Ga0500651_0000067 | 3300053093 | Bacteria | 67673 |
| 985 | Ga0500651_0008514 | 3300053093 | Bacteria | 6043 |
| 986 | Ga0500562_016498 | 3300053108 | Bacteria | 1900 |
| 987 | Ga0500571_000952 | 3300053110 | Bacteria | 12727 |
| 988 | Ga0500572_065181 | 3300053111 | Bacteria | 1115 |
| 989 | Ga0500593_001535 | 3300053117 | Bacteria | 8290 |
| 990 | Ga0500593_005315 | 3300053117 | Bacteria | 5060 |
| 991 | Ga0500594_0005643 | 3300053118 | Bacteria | 2778 |
| 992 | Ga0500595_013753 | 3300053119 | Bacteria | 3094 |
| 993 | Ga0500628_002238 | 3300053129 | Bacteria | 3228 |
| 994 | Ga0500652_005856 | 3300053131 | Bacteria | 3910 |
| 995 | Ga0500652_089169 | 3300053131 | Bacteria | 1287 |
| 996 | Ga0500658_0019270 | 3300053134 | Bacteria | 2566 |
| 997 | Ga0500658_0022824 | 3300053134 | Bacteria | 2383 |
| 998 | Ga0500658_0106674 | 3300053134 | Bacteria | 1228 |
| 999 | Ga0500559_0000446 | 3300053136 | Bacteria | 29360 |
| 1000 | Ga0500559_0009437 | 3300053136 | Bacteria | 4222 |
| 1001 | Ga0500559_0022035 | 3300053136 | Bacteria | 2702 |
| 1002 | Ga0500568_0009510 | 3300053139 | Bacteria | 4608 |
| 1003 | Ga0500568_0033306 | 3300053139 | Bacteria | 2115 |
| 1004 | Ga0500574_000749 | 3300053141 | Bacteria | 4334 |
| 1005 | Ga0500590_002813 | 3300053148 | Bacteria | 7859 |
| 1006 | Ga0500616_0012717 | 3300053153 | Bacteria | 4918 |
| 1007 | Ga0500619_000568 | 3300053154 | Bacteria | 6293 |
| 1008 | Ga0500619_004153 | 3300053154 | Bacteria | 3075 |
| 1009 | Ga0500622_0000124 | 3300053156 | Bacteria | 81245 |
| 1010 | Ga0500622_0004516 | 3300053156 | Bacteria | 8701 |
| 1011 | Ga0500622_0009123 | 3300053156 | Bacteria | 5505 |
| 1012 | Ga0500627_0012737 | 3300053158 | Bacteria | 3163 |
| 1013 | Ga0500587_000477 | 3300053739 | Bacteria | 4798 |
| 1014 | Ga0590075_010416 | 3300059424 | Bacteria | 2237 |
| 1015 | Ga0466962_0003944 | 3300061719 | Bacteria | 7100 |
| 1016 | Ga0466962_0049703 | 3300061719 | Bacteria | 2004 |
| 1017 | Ga0466962_0098610 | 3300061719 | Bacteria | 1402 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053111 | Ga0500572_065181 | Ga0500572_065181_10_912 | 292 |
| 2 | 3300025913 | Ga0207695_10092973 | Ga0207695_100929733 | 294 |
| 3 | 3300053131 | Ga0500652_089169 | Ga0500652_089169_131_1042 | 302 |
| 4 | iso_pu_bacteria | 2842733646 | 2842737619 | 305 |
| 5 | 3300005339 | Ga0070660_100034480 | Ga0070660_1000344804 | 306 |
| 6 | 3300025921 | Ga0207652_10130236 | Ga0207652_101302362 | 306 |
| 7 | 3300009176 | Ga0105242_10018229 | Ga0105242_100182295 | 308 |
| 8 | 3300046689 | Ga0495613_0165418 | Ga0495613_0165418_609_1544 | 308 |
| 9 | 3300044656 | Ga0466969_0001902 | Ga0466969_0001902_7897_8919 | 311 |
| 10 | 3300044706 | Ga0466964_0023321 | Ga0466964_0023321_1192_2214 | 311 |
| 11 | 3300044719 | Ga0466971_0003284 | Ga0466971_0003284_883_1905 | 311 |
| 12 | 3300044842 | Ga0466957_0028042 | Ga0466957_0028042_536_1558 | 311 |
| 13 | 3300045049 | Ga0466959_0012078 | Ga0466959_0012078_4778_5800 | 311 |
| 14 | 3300061719 | Ga0466962_0003944 | Ga0466962_0003944_987_2009 | 311 |
| 15 | 3300010375 | Ga0105239_10072072 | Ga0105239_100720723 | 312 |
| 16 | 3300028794 | Ga0307515_10066582 | Ga0307515_100665824 | 313 |
| 17 | 3300053108 | Ga0500562_016498 | Ga0500562_016498_75_1043 | 313 |
| 18 | 3300005339 | Ga0070660_100013524 | Ga0070660_1000135245 | 314 |
| 19 | 3300005563 | Ga0068855_100450372 | Ga0068855_1004503721 | 314 |
| 20 | 3300025949 | Ga0207667_10154567 | Ga0207667_101545672 | 314 |
| 21 | 3300027526 | Ga0209968_1000129 | Ga0209968_100012912 | 314 |
| 22 | 3300027543 | Ga0209999_1002190 | Ga0209999_10021903 | 314 |
| 23 | 3300027695 | Ga0209966_1000035 | Ga0209966_100003512 | 314 |
| 24 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011247 | 314 |
| 25 | 3300048924 | Ga0496121_0065545 | Ga0496121_0065545_1176_2186 | 314 |
| 26 | iso_pu_bacteria | 2643221660 | 2644340825 | 314 |
| 27 | iso_pu_bacteria | 2831864461 | 2831869140 | 314 |
| 28 | iso_pu_bacteria | 2881101125 | 2881103523 | 314 |
| 29 | 3300005331 | Ga0070670_100209046 | Ga0070670_1002090462 | 315 |
| 30 | 3300005459 | Ga0068867_100084146 | Ga0068867_1000841463 | 315 |
| 31 | 3300025942 | Ga0207689_10118101 | Ga0207689_101181012 | 315 |
| 32 | 3300026089 | Ga0207648_10066867 | Ga0207648_100668672 | 315 |
| 33 | 3300038443 | Ga0395901_0001676 | Ga0395901_0001676_13884_14858 | 315 |
| 34 | 3300046462 | Ga0495651_0040232 | Ga0495651_0040232_1971_2945 | 315 |
| 35 | 3300046535 | Ga0495586_0054921 | Ga0495586_0054921_601_1626 | 315 |
| 36 | 3300046615 | Ga0495656_0093610 | Ga0495656_0093610_410_1360 | 315 |
| 37 | 3300046680 | Ga0495646_0031501 | Ga0495646_0031501_1178_2152 | 315 |
| 38 | 3300046691 | Ga0495670_0034634 | Ga0495670_0034634_652_1611 | 315 |
| 39 | 3300047317 | Ga0495604_0096919 | Ga0495604_0096919_193_1152 | 315 |
| 40 | 3300048088 | Ga0495602_0135349 | Ga0495602_0135349_419_1393 | 315 |
| 41 | iso_pu_bacteria | 2643221644 | 2644243366 | 315 |
| 42 | iso_pu_bacteria | 2818991436 | 2819543489 | 315 |
| 43 | iso_pu_bacteria | 2885192300 | 2885196698 | 315 |
| 44 | 3300005614 | Ga0068856_100059328 | Ga0068856_1000593284 | 316 |
| 45 | 3300014968 | Ga0157379_10030374 | Ga0157379_100303744 | 316 |
| 46 | 3300021361 | Ga0213872_10000382 | Ga0213872_1000038212 | 316 |
| 47 | 3300026041 | Ga0207639_10279091 | Ga0207639_102790912 | 316 |
| 48 | 3300026078 | Ga0207702_10032304 | Ga0207702_100323043 | 316 |
| 49 | 3300028794 | Ga0307515_10028588 | Ga0307515_100285888 | 316 |
| 50 | 3300031507 | Ga0307509_10062290 | Ga0307509_100622902 | 316 |
| 51 | 3300039447 | Ga0436361_0566522 | Ga0436361_0566522_22755_23741 | 316 |
| 52 | 3300044712 | Ga0453684_0027299 | Ga0453684_0027299_1532_2485 | 316 |
| 53 | 3300047472 | Ga0495686_0012435 | Ga0495686_0012435_1288_2241 | 316 |
| 54 | 3300050493 | nmdc:mga0k408_8358_c1 | nmdc:mga0k408_8358_c1_1045_1998 | 316 |
| 55 | 3300003316 | rootH1_10015203 | rootH1_100152035 | 317 |
| 56 | 3300003322 | rootL2_10000966 | rootL2_100009663 | 317 |
| 57 | 3300003323 | rootH1_10000830 | rootH1_100008305 | 317 |
| 58 | 3300003771 | Ga0055526_1001991 | Ga0055526_10019915 | 317 |
| 59 | 3300003794 | Ga0055531_10009158 | Ga0055531_100091583 | 317 |
| 60 | 3300005262 | Ga0065165_1000101 | Ga0065165_1000101108 | 317 |
| 61 | 3300005262 | Ga0065165_1043062 | Ga0065165_10430622 | 317 |
| 62 | 3300005338 | Ga0068868_100025884 | Ga0068868_1000258842 | 317 |
| 63 | 3300005347 | Ga0070668_100117189 | Ga0070668_1001171892 | 317 |
| 64 | 3300005353 | Ga0070669_100071168 | Ga0070669_1000711683 | 317 |
| 65 | 3300005354 | Ga0070675_100076311 | Ga0070675_1000763113 | 317 |
| 66 | 3300005355 | Ga0070671_100021838 | Ga0070671_1000218382 | 317 |
| 67 | 3300005456 | Ga0070678_100086673 | Ga0070678_1000866733 | 317 |
| 68 | 3300005618 | Ga0068864_100157482 | Ga0068864_1001574823 | 317 |
| 69 | 3300005840 | Ga0068870_10054833 | Ga0068870_100548332 | 317 |
| 70 | 3300006178 | Ga0075367_10013667 | Ga0075367_100136673 | 317 |
| 71 | 3300009147 | Ga0114129_10149580 | Ga0114129_101495802 | 317 |
| 72 | 3300009177 | Ga0105248_10000507 | Ga0105248_1000050718 | 317 |
| 73 | 3300012497 | Ga0157319_1000008 | Ga0157319_1000008100 | 317 |
| 74 | 3300014969 | Ga0157376_10017920 | Ga0157376_100179203 | 317 |
| 75 | 3300025273 | Ga0209673_1023627 | Ga0209673_10236272 | 317 |
| 76 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008635 | 317 |
| 77 | 3300025304 | Ga0209257_1005624 | Ga0209257_10056245 | 317 |
| 78 | 3300025893 | Ga0207682_10042315 | Ga0207682_100423152 | 317 |
| 79 | 3300025903 | Ga0207680_10224614 | Ga0207680_102246142 | 317 |
| 80 | 3300025908 | Ga0207643_10067632 | Ga0207643_100676322 | 317 |
| 81 | 3300025923 | Ga0207681_10016551 | Ga0207681_100165513 | 317 |
| 82 | 3300025926 | Ga0207659_10021228 | Ga0207659_100212282 | 317 |
| 83 | 3300025927 | Ga0207687_10014488 | Ga0207687_100144882 | 317 |
| 84 | 3300025937 | Ga0207669_10022100 | Ga0207669_100221002 | 317 |
| 85 | 3300025940 | Ga0207691_10016738 | Ga0207691_100167386 | 317 |
| 86 | 3300025941 | Ga0207711_10146699 | Ga0207711_101466992 | 317 |
| 87 | 3300026095 | Ga0207676_10258686 | Ga0207676_102586862 | 317 |
| 88 | 3300026121 | Ga0207683_10116820 | Ga0207683_101168202 | 317 |
| 89 | 3300028794 | Ga0307515_10165132 | Ga0307515_101651323 | 317 |
| 90 | 3300031456 | Ga0307513_10069012 | Ga0307513_100690122 | 317 |
| 91 | 3300037312 | Ga0395899_0000586 | Ga0395899_0000586_9987_10967 | 317 |
| 92 | 3300037312 | Ga0395899_0074231 | Ga0395899_0074231_1109_2077 | 317 |
| 93 | 3300037418 | Ga0395900_0039728 | Ga0395900_0039728_2651_3619 | 317 |
| 94 | 3300037418 | Ga0395900_0054509 | Ga0395900_0054509_3031_4011 | 317 |
| 95 | 3300037466 | Ga0395898_0006225 | Ga0395898_0006225_4866_5834 | 317 |
| 96 | 3300037471 | Ga0395905_0013432 | Ga0395905_0013432_5835_6815 | 317 |
| 97 | 3300037471 | Ga0395905_0023384 | Ga0395905_0023384_576_1544 | 317 |
| 98 | 3300037471 | Ga0395905_0232081 | Ga0395905_0232081_597_1562 | 317 |
| 99 | 3300038443 | Ga0395901_0010431 | Ga0395901_0010431_5043_6011 | 317 |
| 100 | 3300038443 | Ga0395901_0130823 | Ga0395901_0130823_1296_2276 | 317 |
| 101 | 3300039447 | Ga0436361_0627254 | Ga0436361_0627254_481_1461 | 317 |
| 102 | 3300042127 | Ga0450890_006419 | Ga0450890_006419_363_1370 | 317 |
| 103 | 3300042438 | Ga0439459_0006802 | Ga0439459_0006802_298_1305 | 317 |
| 104 | 3300042876 | Ga0451577_0013180 | Ga0451577_0013180_4185_5156 | 317 |
| 105 | 3300044658 | Ga0466972_0074601 | Ga0466972_0074601_234_1214 | 317 |
| 106 | 3300044684 | Ga0466966_0063907 | Ga0466966_0063907_1143_2123 | 317 |
| 107 | 3300046539 | Ga0495621_0024847 | Ga0495621_0024847_864_1823 | 317 |
| 108 | 3300048915 | Ga0496112_0011308 | Ga0496112_0011308_6787_7746 | 317 |
| 109 | 3300048928 | Ga0496125_0000785 | Ga0496125_0000785_45996_46985 | 317 |
| 110 | 3300049571 | Ga0501034_0239499 | Ga0501034_0239499_365_1345 | 317 |
| 111 | 3300050489 | nmdc:mga03683_26256_c1 | nmdc:mga03683_26256_c1_594_1547 | 317 |
| 112 | 3300050492 | nmdc:mga0yw44_38057_c1 | nmdc:mga0yw44_38057_c1_289_1254 | 317 |
| 113 | 3300050494 | nmdc:mga06z11_42479_c1 | nmdc:mga06z11_42479_c1_981_1946 | 317 |
| 114 | 3300053148 | Ga0500590_002813 | Ga0500590_002813_5852_6817 | 317 |
| 115 | 3300053156 | Ga0500622_0004516 | Ga0500622_0004516_4401_5468 | 317 |
| 116 | 3300059424 | Ga0590075_010416 | Ga0590075_010416_567_1523 | 317 |
| 117 | 3300061719 | Ga0466962_0098610 | Ga0466962_0098610_66_1046 | 317 |
| 118 | iso_pu_bacteria | 2585428062 | 2587759369 | 317 |
| 119 | 3300002705 | JGI25156J39149_1007524 | JGI25156J39149_10075242 | 318 |
| 120 | 3300002737 | JGI25162J39368_1000063 | JGI25162J39368_100006364 | 318 |
| 121 | 3300002738 | JGI25154J39366_1004037 | JGI25154J39366_10040372 | 318 |
| 122 | 3300002771 | JGI25163J39215_1001308 | JGI25163J39215_10013084 | 318 |
| 123 | 3300002772 | JGI25164J39214_1004328 | JGI25164J39214_10043282 | 318 |
| 124 | 3300003214 | JGI25165J46597_1000069 | JGI25165J46597_100006964 | 318 |
| 125 | 3300003575 | Ga0007409J51694_1045597 | Ga0007409J51694_10455972 | 318 |
| 126 | 3300003751 | Ga0055538_1000034 | Ga0055538_100003463 | 318 |
| 127 | 3300003752 | Ga0055539_1000044 | Ga0055539_100004463 | 318 |
| 128 | 3300003756 | Ga0055533_1000055 | Ga0055533_100005563 | 318 |
| 129 | 3300003759 | Ga0055525_1000066 | Ga0055525_1000066119 | 318 |
| 130 | 3300003775 | Ga0055524_1000052 | Ga0055524_100005293 | 318 |
| 131 | 3300003791 | Ga0055530_10006857 | Ga0055530_100068572 | 318 |
| 132 | 3300003792 | Ga0055540_1000019 | Ga0055540_100001917 | 318 |
| 133 | 3300003794 | Ga0055531_10001074 | Ga0055531_100010745 | 318 |
| 134 | 3300003841 | Ga0055541_1000032 | Ga0055541_1000032120 | 318 |
| 135 | 3300005344 | Ga0070661_100001817 | Ga0070661_1000018173 | 318 |
| 136 | 3300005366 | Ga0070659_100000579 | Ga0070659_1000005794 | 318 |
| 137 | 3300005366 | Ga0070659_100141084 | Ga0070659_1001410842 | 318 |
| 138 | 3300005564 | Ga0070664_100003888 | Ga0070664_10000388810 | 318 |
| 139 | 3300006237 | Ga0097621_100159403 | Ga0097621_1001594032 | 318 |
| 140 | 3300006946 | Ga0079104_1000206 | Ga0079104_100020636 | 318 |
| 141 | 3300009093 | Ga0105240_10024611 | Ga0105240_100246116 | 318 |
| 142 | 3300015262 | Ga0182007_10031538 | Ga0182007_100315382 | 318 |
| 143 | 3300015265 | Ga0182005_1000283 | Ga0182005_100028311 | 318 |
| 144 | 3300015265 | Ga0182005_1017831 | Ga0182005_10178311 | 318 |
| 145 | 3300025206 | Ga0209435_101147 | Ga0209435_1011472 | 318 |
| 146 | 3300025224 | Ga0209784_100049 | Ga0209784_100049119 | 318 |
| 147 | 3300025225 | Ga0209566_100061 | Ga0209566_100061119 | 318 |
| 148 | 3300025226 | Ga0209674_100069 | Ga0209674_100069168 | 318 |
| 149 | 3300025230 | Ga0209563_100083 | Ga0209563_100083119 | 318 |
| 150 | 3300025231 | Ga0207427_100345 | Ga0207427_1003454 | 318 |
| 151 | 3300025233 | Ga0209437_100091 | Ga0209437_100091167 | 318 |
| 152 | 3300025246 | Ga0209646_1002496 | Ga0209646_10024963 | 318 |
| 153 | 3300025253 | Ga0209677_100039 | Ga0209677_100039168 | 318 |
| 154 | 3300025256 | Ga0209759_1001215 | Ga0209759_100121511 | 318 |
| 155 | 3300025261 | Ga0209233_1000115 | Ga0209233_1000115167 | 318 |
| 156 | 3300025263 | Ga0209565_1015528 | Ga0209565_10155281 | 318 |
| 157 | 3300025298 | Ga0209050_1001761 | Ga0209050_100176117 | 318 |
| 158 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036223 | 318 |
| 159 | 3300025303 | Ga0209051_1000071 | Ga0209051_1000071164 | 318 |
| 160 | 3300025304 | Ga0209257_1000367 | Ga0209257_100036717 | 318 |
| 161 | 3300025913 | Ga0207695_10019040 | Ga0207695_100190402 | 318 |
| 162 | 3300025919 | Ga0207657_10081075 | Ga0207657_100810753 | 318 |
| 163 | 3300025920 | Ga0207649_10001310 | Ga0207649_100013104 | 318 |
| 164 | 3300025932 | Ga0207690_10012412 | Ga0207690_100124122 | 318 |
| 165 | 3300025945 | Ga0207679_10000730 | Ga0207679_100007305 | 318 |
| 166 | 3300025945 | Ga0207679_10010415 | Ga0207679_100104152 | 318 |
| 167 | 3300027111 | Ga0209281_1000259 | Ga0209281_100025935 | 318 |
| 168 | 3300028794 | Ga0307515_10035182 | Ga0307515_100351826 | 318 |
| 169 | 3300031456 | Ga0307513_10155369 | Ga0307513_101553692 | 318 |
| 170 | 3300032004 | Ga0307414_10064209 | Ga0307414_100642093 | 318 |
| 171 | 3300037312 | Ga0395899_0001071 | Ga0395899_0001071_4984_5967 | 318 |
| 172 | 3300037418 | Ga0395900_0005380 | Ga0395900_0005380_3125_4114 | 318 |
| 173 | 3300037471 | Ga0395905_0022875 | Ga0395905_0022875_639_1607 | 318 |
| 174 | 3300037471 | Ga0395905_0113331 | Ga0395905_0113331_49_1008 | 318 |
| 175 | 3300042121 | Ga0450919_000198 | Ga0450919_000198_3185_4150 | 318 |
| 176 | 3300042122 | Ga0450920_012224 | Ga0450920_012224_30_995 | 318 |
| 177 | 3300042531 | Ga0450918_000047 | Ga0450918_000047_751_1716 | 318 |
| 178 | 3300044656 | Ga0466969_0038002 | Ga0466969_0038002_290_1288 | 318 |
| 179 | 3300044656 | Ga0466969_0098117 | Ga0466969_0098117_289_1254 | 318 |
| 180 | 3300044684 | Ga0466966_0007367 | Ga0466966_0007367_1936_2901 | 318 |
| 181 | 3300044684 | Ga0466966_0009518 | Ga0466966_0009518_2840_3838 | 318 |
| 182 | 3300044694 | Ga0466963_0006190 | Ga0466963_0006190_1689_2654 | 318 |
| 183 | 3300044706 | Ga0466964_0049836 | Ga0466964_0049836_412_1377 | 318 |
| 184 | 3300044765 | Ga0466970_0041588 | Ga0466970_0041588_1037_2002 | 318 |
| 185 | 3300044842 | Ga0466957_0068411 | Ga0466957_0068411_520_1518 | 318 |
| 186 | 3300045976 | Ga0466967_0159737 | Ga0466967_0159737_1126_2091 | 318 |
| 187 | 3300046454 | Ga0495592_0125944 | Ga0495592_0125944_652_1638 | 318 |
| 188 | 3300046462 | Ga0495651_0019143 | Ga0495651_0019143_3181_4167 | 318 |
| 189 | 3300046462 | Ga0495651_0025317 | Ga0495651_0025317_1593_2579 | 318 |
| 190 | 3300046463 | Ga0495653_0047008 | Ga0495653_0047008_160_1146 | 318 |
| 191 | 3300046511 | Ga0495608_0013966 | Ga0495608_0013966_1350_2336 | 318 |
| 192 | 3300046511 | Ga0495608_0056440 | Ga0495608_0056440_414_1400 | 318 |
| 193 | 3300046514 | Ga0495618_0154218 | Ga0495618_0154218_340_1326 | 318 |
| 194 | 3300046516 | Ga0495628_0001687 | Ga0495628_0001687_2931_3917 | 318 |
| 195 | 3300046516 | Ga0495628_0013853 | Ga0495628_0013853_1525_2511 | 318 |
| 196 | 3300046516 | Ga0495628_0322765 | Ga0495628_0322765_99_1085 | 318 |
| 197 | 3300046529 | Ga0495652_0008424 | Ga0495652_0008424_5697_6683 | 318 |
| 198 | 3300046663 | Ga0495635_0064709 | Ga0495635_0064709_455_1441 | 318 |
| 199 | 3300046675 | Ga0495657_0064886 | Ga0495657_0064886_732_1718 | 318 |
| 200 | 3300046679 | Ga0495623_0006819 | Ga0495623_0006819_531_1517 | 318 |
| 201 | 3300046680 | Ga0495646_0002576 | Ga0495646_0002576_6721_7731 | 318 |
| 202 | 3300046683 | Ga0495658_0035262 | Ga0495658_0035262_866_1852 | 318 |
| 203 | 3300047317 | Ga0495604_0044585 | Ga0495604_0044585_1144_2130 | 318 |
| 204 | 3300048088 | Ga0495602_0019713 | Ga0495602_0019713_5591_6577 | 318 |
| 205 | 3300048904 | Ga0496101_0342128 | Ga0496101_0342128_170_1156 | 318 |
| 206 | 3300048905 | Ga0496102_0025715 | Ga0496102_0025715_1273_2235 | 318 |
| 207 | 3300048908 | Ga0496105_0078475 | Ga0496105_0078475_658_1668 | 318 |
| 208 | 3300048909 | Ga0496106_0048622 | Ga0496106_0048622_2025_2987 | 318 |
| 209 | 3300048917 | Ga0496114_0003046 | Ga0496114_0003046_1721_2686 | 318 |
| 210 | 3300048924 | Ga0496121_0061186 | Ga0496121_0061186_526_1488 | 318 |
| 211 | 3300048924 | Ga0496121_0083876 | Ga0496121_0083876_1227_2210 | 318 |
| 212 | 3300049574 | Ga0501038_0058954 | Ga0501038_0058954_1216_2190 | 318 |
| 213 | 3300049580 | Ga0501046_0063108 | Ga0501046_0063108_1262_2236 | 318 |
| 214 | 3300049682 | Ga0501252_001618 | Ga0501252_001618_331_1296 | 318 |
| 215 | 3300053077 | Ga0495601_0044290 | Ga0495601_0044290_1799_2785 | 318 |
| 216 | 3300053117 | Ga0500593_001535 | Ga0500593_001535_1351_2328 | 318 |
| 217 | 3300053119 | Ga0500595_013753 | Ga0500595_013753_1012_1998 | 318 |
| 218 | 3300053141 | Ga0500574_000749 | Ga0500574_000749_1875_2861 | 318 |
| 219 | 3300053154 | Ga0500619_004153 | Ga0500619_004153_1013_1999 | 318 |
| 220 | iso_pu_bacteria | 2643221592 | 2643971301 | 318 |
| 221 | iso_pu_bacteria | 2643221625 | 2644142057 | 318 |
| 222 | iso_pu_bacteria | 2643221648 | 2644275464 | 318 |
| 223 | iso_pu_bacteria | 2643221654 | 2644303038 | 318 |
| 224 | iso_pu_bacteria | 2643221672 | 2644400761 | 318 |
| 225 | iso_pu_bacteria | 2842747753 | 2842749718 | 318 |
| 226 | 3300004625 | Ga0055543_1005706 | Ga0055543_10057062 | 319 |
| 227 | 3300005262 | Ga0065165_1000080 | Ga0065165_1000080132 | 319 |
| 228 | 3300005295 | Ga0065707_10100423 | Ga0065707_101004233 | 319 |
| 229 | 3300005356 | Ga0070674_100136341 | Ga0070674_1001363412 | 319 |
| 230 | 3300005455 | Ga0070663_100001569 | Ga0070663_1000015697 | 319 |
| 231 | 3300005459 | Ga0068867_100000072 | Ga0068867_10000007246 | 319 |
| 232 | 3300006178 | Ga0075367_10030265 | Ga0075367_100302653 | 319 |
| 233 | 3300006178 | Ga0075367_10085205 | Ga0075367_100852052 | 319 |
| 234 | 3300006353 | Ga0075370_10002604 | Ga0075370_100026045 | 319 |
| 235 | 3300006353 | Ga0075370_10011725 | Ga0075370_100117253 | 319 |
| 236 | 3300006353 | Ga0075370_10037246 | Ga0075370_100372462 | 319 |
| 237 | 3300006846 | Ga0075430_100078142 | Ga0075430_1000781422 | 319 |
| 238 | 3300006880 | Ga0075429_100000199 | Ga0075429_10000019927 | 319 |
| 239 | 3300009148 | Ga0105243_10001108 | Ga0105243_1000110816 | 319 |
| 240 | 3300014745 | Ga0157377_10000075 | Ga0157377_1000007550 | 319 |
| 241 | 3300025321 | Ga0207656_10080253 | Ga0207656_100802532 | 319 |
| 242 | 3300025935 | Ga0207709_10000625 | Ga0207709_1000062518 | 319 |
| 243 | 3300025942 | Ga0207689_10063571 | Ga0207689_100635713 | 319 |
| 244 | 3300026067 | Ga0207678_10002200 | Ga0207678_1000220010 | 319 |
| 245 | 3300026089 | Ga0207648_10000286 | Ga0207648_1000028620 | 319 |
| 246 | 3300028381 | Ga0268264_10115229 | Ga0268264_101152292 | 319 |
| 247 | 3300028794 | Ga0307515_10000278 | Ga0307515_1000027867 | 319 |
| 248 | 3300031456 | Ga0307513_10051134 | Ga0307513_100511342 | 319 |
| 249 | 3300032002 | Ga0307416_100168892 | Ga0307416_1001688922 | 319 |
| 250 | 3300032002 | Ga0307416_100179728 | Ga0307416_1001797282 | 319 |
| 251 | 3300041404 | Ga0439436_0002079 | Ga0439436_0002079_1273_2232 | 319 |
| 252 | 3300041406 | Ga0439439_0017596 | Ga0439439_0017596_410_1369 | 319 |
| 253 | 3300041413 | Ga0439465_0001094 | Ga0439465_0001094_6480_7439 | 319 |
| 254 | 3300041997 | Ga0439431_0011396 | Ga0439431_0011396_37_996 | 319 |
| 255 | 3300042006 | Ga0439432_006841 | Ga0439432_006841_684_1643 | 319 |
| 256 | 3300042006 | Ga0439432_013501 | Ga0439432_013501_1102_2061 | 319 |
| 257 | 3300042007 | Ga0439449_0004494 | Ga0439449_0004494_2036_2995 | 319 |
| 258 | 3300042007 | Ga0439449_0016763 | Ga0439449_0016763_816_1775 | 319 |
| 259 | 3300042010 | Ga0439452_013992 | Ga0439452_013992_1262_2221 | 319 |
| 260 | 3300042014 | Ga0439457_020415 | Ga0439457_020415_321_1280 | 319 |
| 261 | 3300042015 | Ga0439462_0015525 | Ga0439462_0015525_888_1847 | 319 |
| 262 | 3300042156 | Ga0439446_0012002 | Ga0439446_0012002_901_1860 | 319 |
| 263 | 3300042435 | Ga0439434_0004081 | Ga0439434_0004081_3295_4254 | 319 |
| 264 | 3300044656 | Ga0466969_0000013 | Ga0466969_0000013_30461_31432 | 319 |
| 265 | 3300044684 | Ga0466966_0019848 | Ga0466966_0019848_124_1092 | 319 |
| 266 | 3300046522 | Ga0495643_0149048 | Ga0495643_0149048_13_975 | 319 |
| 267 | 3300046683 | Ga0495658_0046686 | Ga0495658_0046686_61_1101 | 319 |
| 268 | 3300046694 | Ga0495649_0015647 | Ga0495649_0015647_682_1644 | 319 |
| 269 | 3300047443 | Ga0495687_000582 | Ga0495687_000582_35959_36921 | 319 |
| 270 | 3300047443 | Ga0495687_003988 | Ga0495687_003988_6824_7786 | 319 |
| 271 | 3300048913 | Ga0496110_0358531 | Ga0496110_0358531_289_1299 | 319 |
| 272 | 3300048927 | Ga0496124_0002378 | Ga0496124_0002378_22170_23135 | 319 |
| 273 | 3300048928 | Ga0496125_0049441 | Ga0496125_0049441_952_1917 | 319 |
| 274 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_46059_47024 | 319 |
| 275 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_46048_47013 | 319 |
| 276 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_46106_47071 | 319 |
| 277 | 3300049582 | Ga0501048_0006915 | Ga0501048_0006915_1099_2064 | 319 |
| 278 | 3300049824 | Ga0501045_0020284 | Ga0501045_0020284_1017_1982 | 319 |
| 279 | 3300050493 | nmdc:mga0k408_51063_c1 | nmdc:mga0k408_51063_c1_964_1923 | 319 |
| 280 | 3300050496 | nmdc:mga07m45_12201_c1 | nmdc:mga07m45_12201_c1_1498_2460 | 319 |
| 281 | 3300050496 | nmdc:mga07m45_29688_c1 | nmdc:mga07m45_29688_c1_233_1192 | 319 |
| 282 | 3300050496 | nmdc:mga07m45_36397_c1 | nmdc:mga07m45_36397_c1_177_1139 | 319 |
| 283 | 3300050508 | nmdc:mga09592_14596_c1 | nmdc:mga09592_14596_c1_4064_5026 | 319 |
| 284 | 3300050509 | nmdc:mga0qj67_69170_c1 | nmdc:mga0qj67_69170_c1_965_1927 | 319 |
| 285 | 3300053134 | Ga0500658_0019270 | Ga0500658_0019270_528_1490 | 319 |
| 286 | 3300053139 | Ga0500568_0033306 | Ga0500568_0033306_450_1436 | 319 |
| 287 | 3300053154 | Ga0500619_000568 | Ga0500619_000568_2623_3588 | 319 |
| 288 | iso_pu_bacteria | 2513020051 | 2513228784 | 319 |
| 289 | iso_pu_bacteria | 2599185214 | 2599620875 | 319 |
| 290 | iso_pu_bacteria | 2599185226 | 2599674319 | 319 |
| 291 | iso_pu_bacteria | 2599185227 | 2599678509 | 319 |
| 292 | iso_pu_bacteria | 2599185229 | 2599690386 | 319 |
| 293 | iso_pu_bacteria | 2643221628 | 2644161338 | 319 |
| 294 | iso_pu_bacteria | 2643221658 | 2644324055 | 319 |
| 295 | iso_pu_bacteria | 2643221683 | 2644466000 | 319 |
| 296 | iso_pu_bacteria | 2738541277 | 2738720723 | 319 |
| 297 | iso_pu_bacteria | 2738541307 | 2738882323 | 319 |
| 298 | iso_pu_bacteria | 2738543013 | 2739251909 | 319 |
| 299 | iso_pu_bacteria | 2738543019 | 2739279922 | 319 |
| 300 | iso_pu_bacteria | 2818991446 | 2819601998 | 319 |
| 301 | iso_pu_bacteria | 2831265667 | 2831269827 | 319 |
| 302 | iso_pu_bacteria | 2838054893 | 2838055155 | 319 |
| 303 | iso_pu_bacteria | 2842677519 | 2842680911 | 319 |
| 304 | iso_pu_bacteria | 2885198086 | 2885201848 | 319 |
| 305 | iso_pu_bacteria | 2885211737 | 2885215442 | 319 |
| 306 | iso_pu_bacteria | 2899924645 | 2899927245 | 319 |
| 307 | iso_pu_bacteria | 2904449895 | 2904453999 | 319 |
| 308 | iso_pu_bacteria | 2904456579 | 2904459463 | 319 |
| 309 | iso_pu_bacteria | 2904479285 | 2904479540 | 319 |
| 310 | iso_pu_bacteria | 2904541872 | 2904546117 | 319 |
| 311 | iso_pu_bacteria | 2919462493 | 2919465421 | 319 |
| 312 | iso_pu_bacteria | 2928037797 | 2928042840 | 319 |
| 313 | iso_pu_bacteria | 2928044640 | 2928048733 | 319 |
| 314 | iso_pu_bacteria | 2928051484 | 2928055065 | 319 |
| 315 | iso_pu_bacteria | 2928064002 | 2928068491 | 319 |
| 316 | iso_pu_bacteria | 2928070936 | 2928073603 | 319 |
| 317 | iso_pu_bacteria | 2928084124 | 2928089694 | 319 |
| 318 | iso_pu_bacteria | 2929160207 | 2929161314 | 319 |
| 319 | iso_pu_bacteria | 2929520902 | 2929521577 | 319 |
| 320 | iso_pu_bacteria | 2945945610 | 2945949787 | 319 |
| 321 | iso_pu_bacteria | 2945972063 | 2945973810 | 319 |
| 322 | 3300002705 | JGI25156J39149_1001782 | JGI25156J39149_10017823 | 320 |
| 323 | 3300002738 | JGI25154J39366_1001302 | JGI25154J39366_10013026 | 320 |
| 324 | 3300002741 | JGI25157J39369_1000148 | JGI25157J39369_100014839 | 320 |
| 325 | 3300003323 | rootH1_10114267 | rootH1_101142672 | 320 |
| 326 | 3300003752 | Ga0055539_1000763 | Ga0055539_10007632 | 320 |
| 327 | 3300003752 | Ga0055539_1002964 | Ga0055539_10029642 | 320 |
| 328 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016198 | 320 |
| 329 | 3300003759 | Ga0055525_1001386 | Ga0055525_10013863 | 320 |
| 330 | 3300003761 | Ga0055535_1002036 | Ga0055535_10020363 | 320 |
| 331 | 3300003763 | Ga0055529_1000333 | Ga0055529_100033331 | 320 |
| 332 | 3300003792 | Ga0055540_1011021 | Ga0055540_10110212 | 320 |
| 333 | 3300005327 | Ga0070658_10100789 | Ga0070658_101007892 | 320 |
| 334 | 3300005328 | Ga0070676_10034778 | Ga0070676_100347783 | 320 |
| 335 | 3300005330 | Ga0070690_100055811 | Ga0070690_1000558113 | 320 |
| 336 | 3300005331 | Ga0070670_100199404 | Ga0070670_1001994041 | 320 |
| 337 | 3300005334 | Ga0068869_100010879 | Ga0068869_1000108795 | 320 |
| 338 | 3300005334 | Ga0068869_100065097 | Ga0068869_1000650973 | 320 |
| 339 | 3300005355 | Ga0070671_100095343 | Ga0070671_1000953433 | 320 |
| 340 | 3300005364 | Ga0070673_100029046 | Ga0070673_1000290463 | 320 |
| 341 | 3300005459 | Ga0068867_100039511 | Ga0068867_1000395113 | 320 |
| 342 | 3300005530 | Ga0070679_100016827 | Ga0070679_1000168272 | 320 |
| 343 | 3300005543 | Ga0070672_100027758 | Ga0070672_1000277583 | 320 |
| 344 | 3300005548 | Ga0070665_100050202 | Ga0070665_1000502024 | 320 |
| 345 | 3300005577 | Ga0068857_100112626 | Ga0068857_1001126262 | 320 |
| 346 | 3300005578 | Ga0068854_100023360 | Ga0068854_1000233603 | 320 |
| 347 | 3300005614 | Ga0068856_100012944 | Ga0068856_1000129442 | 320 |
| 348 | 3300005614 | Ga0068856_100443477 | Ga0068856_1004434772 | 320 |
| 349 | 3300005719 | Ga0068861_100146023 | Ga0068861_1001460232 | 320 |
| 350 | 3300006178 | Ga0075367_10125705 | Ga0075367_101257052 | 320 |
| 351 | 3300006195 | Ga0075366_10075317 | Ga0075366_100753172 | 320 |
| 352 | 3300006195 | Ga0075366_10103866 | Ga0075366_101038662 | 320 |
| 353 | 3300009098 | Ga0105245_10442779 | Ga0105245_104427792 | 320 |
| 354 | 3300009545 | Ga0105237_10367620 | Ga0105237_103676202 | 320 |
| 355 | 3300009551 | Ga0105238_10081997 | Ga0105238_100819972 | 320 |
| 356 | 3300010375 | Ga0105239_10166314 | Ga0105239_101663142 | 320 |
| 357 | 3300013105 | Ga0157369_10059000 | Ga0157369_100590002 | 320 |
| 358 | 3300014968 | Ga0157379_10266193 | Ga0157379_102661932 | 320 |
| 359 | 3300025226 | Ga0209674_100041 | Ga0209674_100041187 | 320 |
| 360 | 3300025228 | Ga0209672_102207 | Ga0209672_1022071 | 320 |
| 361 | 3300025230 | Ga0209563_100043 | Ga0209563_100043187 | 320 |
| 362 | 3300025231 | Ga0207427_100646 | Ga0207427_1006465 | 320 |
| 363 | 3300025242 | Ga0209258_100344 | Ga0209258_10034427 | 320 |
| 364 | 3300025242 | Ga0209258_100785 | Ga0209258_1007853 | 320 |
| 365 | 3300025246 | Ga0209646_1000069 | Ga0209646_1000069105 | 320 |
| 366 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006200 | 320 |
| 367 | 3300025253 | Ga0209677_100096 | Ga0209677_10009680 | 320 |
| 368 | 3300025253 | Ga0209677_101194 | Ga0209677_10119410 | 320 |
| 369 | 3300025254 | Ga0209148_1008882 | Ga0209148_10088822 | 320 |
| 370 | 3300025256 | Ga0209759_1000075 | Ga0209759_1000075105 | 320 |
| 371 | 3300025256 | Ga0209759_1001295 | Ga0209759_10012953 | 320 |
| 372 | 3300025256 | Ga0209759_1003631 | Ga0209759_10036313 | 320 |
| 373 | 3300025256 | Ga0209759_1012969 | Ga0209759_10129692 | 320 |
| 374 | 3300025256 | Ga0209759_1014554 | Ga0209759_10145542 | 320 |
| 375 | 3300025272 | Ga0209455_1000242 | Ga0209455_100024232 | 320 |
| 376 | 3300025303 | Ga0209051_1001503 | Ga0209051_100150319 | 320 |
| 377 | 3300025907 | Ga0207645_10037909 | Ga0207645_100379092 | 320 |
| 378 | 3300025909 | Ga0207705_10017381 | Ga0207705_100173814 | 320 |
| 379 | 3300025909 | Ga0207705_10061682 | Ga0207705_100616823 | 320 |
| 380 | 3300025913 | Ga0207695_10108240 | Ga0207695_101082402 | 320 |
| 381 | 3300025913 | Ga0207695_10116955 | Ga0207695_101169551 | 320 |
| 382 | 3300025919 | Ga0207657_10156024 | Ga0207657_101560242 | 320 |
| 383 | 3300025921 | Ga0207652_10018335 | Ga0207652_100183354 | 320 |
| 384 | 3300025925 | Ga0207650_10077646 | Ga0207650_100776463 | 320 |
| 385 | 3300025940 | Ga0207691_10043548 | Ga0207691_100435483 | 320 |
| 386 | 3300025942 | Ga0207689_10061308 | Ga0207689_100613083 | 320 |
| 387 | 3300025942 | Ga0207689_10277214 | Ga0207689_102772142 | 320 |
| 388 | 3300025949 | Ga0207667_10024656 | Ga0207667_100246564 | 320 |
| 389 | 3300025981 | Ga0207640_10023034 | Ga0207640_100230343 | 320 |
| 390 | 3300026078 | Ga0207702_10000305 | Ga0207702_1000030515 | 320 |
| 391 | 3300026089 | Ga0207648_10000878 | Ga0207648_1000087830 | 320 |
| 392 | 3300026116 | Ga0207674_10102936 | Ga0207674_101029362 | 320 |
| 393 | 3300026118 | Ga0207675_100008217 | Ga0207675_1000082177 | 320 |
| 394 | 3300026142 | Ga0207698_10062309 | Ga0207698_100623092 | 320 |
| 395 | 3300028666 | Ga0265336_10000013 | Ga0265336_10000013178 | 320 |
| 396 | 3300028794 | Ga0307515_10009653 | Ga0307515_1000965312 | 320 |
| 397 | 3300028794 | Ga0307515_10037795 | Ga0307515_100377958 | 320 |
| 398 | 3300028794 | Ga0307515_10040145 | Ga0307515_100401457 | 320 |
| 399 | 3300029957 | Ga0265324_10000193 | Ga0265324_1000019335 | 320 |
| 400 | 3300031456 | Ga0307513_10043473 | Ga0307513_100434734 | 320 |
| 401 | 3300031507 | Ga0307509_10072259 | Ga0307509_100722593 | 320 |
| 402 | 3300031507 | Ga0307509_10271113 | Ga0307509_102711132 | 320 |
| 403 | 3300031616 | Ga0307508_10000123 | Ga0307508_100001233 | 320 |
| 404 | 3300031616 | Ga0307508_10189187 | Ga0307508_101891871 | 320 |
| 405 | 3300031616 | Ga0307508_10245087 | Ga0307508_102450872 | 320 |
| 406 | 3300031649 | Ga0307514_10000355 | Ga0307514_1000035554 | 320 |
| 407 | 3300031649 | Ga0307514_10010918 | Ga0307514_100109187 | 320 |
| 408 | 3300031730 | Ga0307516_10001850 | Ga0307516_1000185012 | 320 |
| 409 | 3300031730 | Ga0307516_10044066 | Ga0307516_100440664 | 320 |
| 410 | 3300034820 | Ga0373959_0006082 | Ga0373959_0006082_762_1778 | 320 |
| 411 | 3300035691 | Ga0373931_0122546 | Ga0373931_0122546_409_1431 | 320 |
| 412 | 3300037466 | Ga0395898_0004069 | Ga0395898_0004069_1090_2106 | 320 |
| 413 | 3300037471 | Ga0395905_0000474 | Ga0395905_0000474_27229_28206 | 320 |
| 414 | 3300037471 | Ga0395905_0023805 | Ga0395905_0023805_4397_5380 | 320 |
| 415 | 3300037471 | Ga0395905_0060047 | Ga0395905_0060047_208_1188 | 320 |
| 416 | 3300038443 | Ga0395901_0002111 | Ga0395901_0002111_3296_4312 | 320 |
| 417 | 3300039447 | Ga0436361_0591904 | Ga0436361_0591904_996_2018 | 320 |
| 418 | 3300039447 | Ga0436361_1134487 | Ga0436361_1134487_1758_2780 | 320 |
| 419 | 3300041496 | Ga0451839_1446416 | Ga0451839_1446416_43_1011 | 320 |
| 420 | 3300042007 | Ga0439449_0000840 | Ga0439449_0000840_2893_3870 | 320 |
| 421 | 3300042007 | Ga0439449_0053043 | Ga0439449_0053043_500_1474 | 320 |
| 422 | 3300042015 | Ga0439462_0013086 | Ga0439462_0013086_1094_2071 | 320 |
| 423 | 3300042128 | Ga0450897_001948 | Ga0450897_001948_58_1032 | 320 |
| 424 | 3300042435 | Ga0439434_0043675 | Ga0439434_0043675_378_1358 | 320 |
| 425 | 3300045836 | Ga0466958_0007549 | Ga0466958_0007549_35_1057 | 320 |
| 426 | 3300046457 | Ga0495590_0005173 | Ga0495590_0005173_4064_5047 | 320 |
| 427 | 3300046506 | Ga0495583_0000081 | Ga0495583_0000081_49044_50057 | 320 |
| 428 | 3300046507 | Ga0495606_0001086 | Ga0495606_0001086_2776_3789 | 320 |
| 429 | 3300046512 | Ga0495610_0025702 | Ga0495610_0025702_1242_2210 | 320 |
| 430 | 3300046616 | Ga0495668_0046750 | Ga0495668_0046750_30_1043 | 320 |
| 431 | 3300046660 | Ga0495625_0006045 | Ga0495625_0006045_6846_7814 | 320 |
| 432 | 3300046660 | Ga0495625_0034941 | Ga0495625_0034941_2624_3637 | 320 |
| 433 | 3300046684 | Ga0495669_0012571 | Ga0495669_0012571_2012_3025 | 320 |
| 434 | 3300046694 | Ga0495649_0000287 | Ga0495649_0000287_1066_2079 | 320 |
| 435 | 3300046794 | Ga0495589_0008991 | Ga0495589_0008991_4054_5067 | 320 |
| 436 | 3300047472 | Ga0495686_0075315 | Ga0495686_0075315_72_1088 | 320 |
| 437 | 3300048903 | Ga0496100_0092730 | Ga0496100_0092730_507_1523 | 320 |
| 438 | 3300048912 | Ga0496109_0073499 | Ga0496109_0073499_2015_3031 | 320 |
| 439 | 3300050493 | nmdc:mga0k408_86717_c1 | nmdc:mga0k408_86717_c1_18_986 | 320 |
| 440 | 3300050494 | nmdc:mga06z11_190863_c1 | nmdc:mga06z11_190863_c1_94_1062 | 320 |
| 441 | 3300053136 | Ga0500559_0022035 | Ga0500559_0022035_1541_2563 | 320 |
| 442 | 3300053739 | Ga0500587_000477 | Ga0500587_000477_2726_3694 | 320 |
| 443 | iso_pu_bacteria | 2547132374 | 2548499213 | 320 |
| 444 | iso_pu_bacteria | 2643221570 | 2643866047 | 320 |
| 445 | iso_pu_bacteria | 2643221596 | 2643994044 | 320 |
| 446 | iso_pu_bacteria | 2643221652 | 2644292858 | 320 |
| 447 | iso_pu_bacteria | 2643221717 | 2644647876 | 320 |
| 448 | iso_pu_bacteria | 2954767861 | 2954770597 | 320 |
| 449 | iso_pu_bacteria | 2990710928 | 2990714101 | 320 |
| 450 | 3300003316 | rootH1_10010206 | rootH1_100102062 | 321 |
| 451 | 3300003784 | Ga0055534_1001847 | Ga0055534_10018475 | 321 |
| 452 | 3300003791 | Ga0055530_10015568 | Ga0055530_100155682 | 321 |
| 453 | 3300003792 | Ga0055540_1006211 | Ga0055540_10062113 | 321 |
| 454 | 3300003794 | Ga0055531_10000360 | Ga0055531_100003603 | 321 |
| 455 | 3300003794 | Ga0055531_10003311 | Ga0055531_100033115 | 321 |
| 456 | 3300005262 | Ga0065165_1003865 | Ga0065165_10038655 | 321 |
| 457 | 3300005327 | Ga0070658_10227236 | Ga0070658_102272362 | 321 |
| 458 | 3300005328 | Ga0070676_10012151 | Ga0070676_100121512 | 321 |
| 459 | 3300005329 | Ga0070683_100087729 | Ga0070683_1000877292 | 321 |
| 460 | 3300005330 | Ga0070690_100022459 | Ga0070690_1000224592 | 321 |
| 461 | 3300005331 | Ga0070670_100086045 | Ga0070670_1000860453 | 321 |
| 462 | 3300005331 | Ga0070670_100138057 | Ga0070670_1001380572 | 321 |
| 463 | 3300005333 | Ga0070677_10032005 | Ga0070677_100320052 | 321 |
| 464 | 3300005333 | Ga0070677_10140655 | Ga0070677_101406551 | 321 |
| 465 | 3300005334 | Ga0068869_100061795 | Ga0068869_1000617953 | 321 |
| 466 | 3300005343 | Ga0070687_100030101 | Ga0070687_1000301012 | 321 |
| 467 | 3300005347 | Ga0070668_100024251 | Ga0070668_1000242513 | 321 |
| 468 | 3300005354 | Ga0070675_100318094 | Ga0070675_1003180942 | 321 |
| 469 | 3300005355 | Ga0070671_100216587 | Ga0070671_1002165872 | 321 |
| 470 | 3300005356 | Ga0070674_100146065 | Ga0070674_1001460652 | 321 |
| 471 | 3300005367 | Ga0070667_100017022 | Ga0070667_1000170223 | 321 |
| 472 | 3300005367 | Ga0070667_100063689 | Ga0070667_1000636892 | 321 |
| 473 | 3300005445 | Ga0070708_100143642 | Ga0070708_1001436422 | 321 |
| 474 | 3300005455 | Ga0070663_100416172 | Ga0070663_1004161721 | 321 |
| 475 | 3300005456 | Ga0070678_100164593 | Ga0070678_1001645932 | 321 |
| 476 | 3300005456 | Ga0070678_100408253 | Ga0070678_1004082532 | 321 |
| 477 | 3300005457 | Ga0070662_100034033 | Ga0070662_1000340333 | 321 |
| 478 | 3300005459 | Ga0068867_100014505 | Ga0068867_1000145053 | 321 |
| 479 | 3300005467 | Ga0070706_100003148 | Ga0070706_10000314813 | 321 |
| 480 | 3300005530 | Ga0070679_100458852 | Ga0070679_1004588522 | 321 |
| 481 | 3300005535 | Ga0070684_100233184 | Ga0070684_1002331842 | 321 |
| 482 | 3300005543 | Ga0070672_100053209 | Ga0070672_1000532092 | 321 |
| 483 | 3300005548 | Ga0070665_100093595 | Ga0070665_1000935952 | 321 |
| 484 | 3300005563 | Ga0068855_100013525 | Ga0068855_1000135255 | 321 |
| 485 | 3300005564 | Ga0070664_100095364 | Ga0070664_1000953642 | 321 |
| 486 | 3300005564 | Ga0070664_100308447 | Ga0070664_1003084472 | 321 |
| 487 | 3300005564 | Ga0070664_100480371 | Ga0070664_1004803711 | 321 |
| 488 | 3300005616 | Ga0068852_100028494 | Ga0068852_1000284944 | 321 |
| 489 | 3300005616 | Ga0068852_100085784 | Ga0068852_1000857843 | 321 |
| 490 | 3300005616 | Ga0068852_100198506 | Ga0068852_1001985062 | 321 |
| 491 | 3300005617 | Ga0068859_100231075 | Ga0068859_1002310752 | 321 |
| 492 | 3300005617 | Ga0068859_100327980 | Ga0068859_1003279802 | 321 |
| 493 | 3300005618 | Ga0068864_100082398 | Ga0068864_1000823982 | 321 |
| 494 | 3300005718 | Ga0068866_10033347 | Ga0068866_100333473 | 321 |
| 495 | 3300005719 | Ga0068861_100001649 | Ga0068861_10000164911 | 321 |
| 496 | 3300005834 | Ga0068851_10115492 | Ga0068851_101154922 | 321 |
| 497 | 3300005841 | Ga0068863_100083801 | Ga0068863_1000838013 | 321 |
| 498 | 3300005841 | Ga0068863_100189569 | Ga0068863_1001895692 | 321 |
| 499 | 3300005842 | Ga0068858_100028870 | Ga0068858_1000288703 | 321 |
| 500 | 3300005842 | Ga0068858_100188292 | Ga0068858_1001882922 | 321 |
| 501 | 3300005843 | Ga0068860_100013253 | Ga0068860_1000132536 | 321 |
| 502 | 3300005843 | Ga0068860_100156493 | Ga0068860_1001564932 | 321 |
| 503 | 3300005844 | Ga0068862_100028602 | Ga0068862_1000286022 | 321 |
| 504 | 3300006038 | Ga0075365_10034744 | Ga0075365_100347443 | 321 |
| 505 | 3300006048 | Ga0075363_100053453 | Ga0075363_1000534532 | 321 |
| 506 | 3300006051 | Ga0075364_10194821 | Ga0075364_101948212 | 321 |
| 507 | 3300006195 | Ga0075366_10040155 | Ga0075366_100401552 | 321 |
| 508 | 3300006353 | Ga0075370_10000547 | Ga0075370_1000054711 | 321 |
| 509 | 3300006353 | Ga0075370_10040108 | Ga0075370_100401083 | 321 |
| 510 | 3300006353 | Ga0075370_10075281 | Ga0075370_100752812 | 321 |
| 511 | 3300006358 | Ga0068871_100130241 | Ga0068871_1001302413 | 321 |
| 512 | 3300006931 | Ga0097620_100231087 | Ga0097620_1002310872 | 321 |
| 513 | 3300006931 | Ga0097620_100327959 | Ga0097620_1003279592 | 321 |
| 514 | 3300009093 | Ga0105240_10062071 | Ga0105240_100620713 | 321 |
| 515 | 3300009176 | Ga0105242_10615719 | Ga0105242_106157191 | 321 |
| 516 | 3300009551 | Ga0105238_10020663 | Ga0105238_100206634 | 321 |
| 517 | 3300009553 | Ga0105249_10022308 | Ga0105249_100223085 | 321 |
| 518 | 3300013306 | Ga0163162_10026342 | Ga0163162_100263423 | 321 |
| 519 | 3300013308 | Ga0157375_10046187 | Ga0157375_100461875 | 321 |
| 520 | 3300013308 | Ga0157375_10095187 | Ga0157375_100951873 | 321 |
| 521 | 3300013308 | Ga0157375_10112718 | Ga0157375_101127182 | 321 |
| 522 | 3300014325 | Ga0163163_10165401 | Ga0163163_101654012 | 321 |
| 523 | 3300014325 | Ga0163163_10580674 | Ga0163163_105806741 | 321 |
| 524 | 3300014326 | Ga0157380_10015463 | Ga0157380_100154635 | 321 |
| 525 | 3300014326 | Ga0157380_10102260 | Ga0157380_101022602 | 321 |
| 526 | 3300014968 | Ga0157379_10034913 | Ga0157379_100349134 | 321 |
| 527 | 3300014968 | Ga0157379_10061361 | Ga0157379_100613613 | 321 |
| 528 | 3300014968 | Ga0157379_10093358 | Ga0157379_100933582 | 321 |
| 529 | 3300014969 | Ga0157376_10142978 | Ga0157376_101429783 | 321 |
| 530 | 3300025273 | Ga0209673_1018628 | Ga0209673_10186282 | 321 |
| 531 | 3300025273 | Ga0209673_1032796 | Ga0209673_10327962 | 321 |
| 532 | 3300025291 | Ga0209675_1006399 | Ga0209675_10063994 | 321 |
| 533 | 3300025292 | Ga0209676_1006433 | Ga0209676_10064334 | 321 |
| 534 | 3300025298 | Ga0209050_1001765 | Ga0209050_100176517 | 321 |
| 535 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025287 | 321 |
| 536 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039321 | 321 |
| 537 | 3300025899 | Ga0207642_10010253 | Ga0207642_100102534 | 321 |
| 538 | 3300025903 | Ga0207680_10168886 | Ga0207680_101688862 | 321 |
| 539 | 3300025907 | Ga0207645_10008088 | Ga0207645_100080886 | 321 |
| 540 | 3300025907 | Ga0207645_10102595 | Ga0207645_101025952 | 321 |
| 541 | 3300025918 | Ga0207662_10029185 | Ga0207662_100291852 | 321 |
| 542 | 3300025919 | Ga0207657_10021426 | Ga0207657_100214265 | 321 |
| 543 | 3300025920 | Ga0207649_10176533 | Ga0207649_101765332 | 321 |
| 544 | 3300025921 | Ga0207652_10194118 | Ga0207652_101941182 | 321 |
| 545 | 3300025923 | Ga0207681_10000593 | Ga0207681_100005933 | 321 |
| 546 | 3300025925 | Ga0207650_10001668 | Ga0207650_1000166810 | 321 |
| 547 | 3300025925 | Ga0207650_10008263 | Ga0207650_100082632 | 321 |
| 548 | 3300025926 | Ga0207659_10105397 | Ga0207659_101053972 | 321 |
| 549 | 3300025940 | Ga0207691_10080536 | Ga0207691_100805363 | 321 |
| 550 | 3300025942 | Ga0207689_10022702 | Ga0207689_100227024 | 321 |
| 551 | 3300025944 | Ga0207661_10142760 | Ga0207661_101427602 | 321 |
| 552 | 3300025945 | Ga0207679_10131331 | Ga0207679_101313312 | 321 |
| 553 | 3300025949 | Ga0207667_10026800 | Ga0207667_100268002 | 321 |
| 554 | 3300025960 | Ga0207651_10028358 | Ga0207651_100283582 | 321 |
| 555 | 3300025960 | Ga0207651_10252192 | Ga0207651_102521922 | 321 |
| 556 | 3300025961 | Ga0207712_10067108 | Ga0207712_100671082 | 321 |
| 557 | 3300025972 | Ga0207668_10004390 | Ga0207668_100043905 | 321 |
| 558 | 3300025986 | Ga0207658_10005270 | Ga0207658_100052704 | 321 |
| 559 | 3300025986 | Ga0207658_10007685 | Ga0207658_100076852 | 321 |
| 560 | 3300025986 | Ga0207658_10021561 | Ga0207658_100215614 | 321 |
| 561 | 3300026035 | Ga0207703_10005198 | Ga0207703_100051983 | 321 |
| 562 | 3300026035 | Ga0207703_10033516 | Ga0207703_100335163 | 321 |
| 563 | 3300026035 | Ga0207703_10163573 | Ga0207703_101635732 | 321 |
| 564 | 3300026041 | Ga0207639_10227734 | Ga0207639_102277342 | 321 |
| 565 | 3300026067 | Ga0207678_10147260 | Ga0207678_101472601 | 321 |
| 566 | 3300026075 | Ga0207708_10044032 | Ga0207708_100440322 | 321 |
| 567 | 3300026088 | Ga0207641_10006528 | Ga0207641_100065283 | 321 |
| 568 | 3300026088 | Ga0207641_10322836 | Ga0207641_103228362 | 321 |
| 569 | 3300026089 | Ga0207648_10024038 | Ga0207648_100240383 | 321 |
| 570 | 3300026089 | Ga0207648_10105019 | Ga0207648_101050193 | 321 |
| 571 | 3300026095 | Ga0207676_10021802 | Ga0207676_100218024 | 321 |
| 572 | 3300026118 | Ga0207675_100037604 | Ga0207675_1000376045 | 321 |
| 573 | 3300026142 | Ga0207698_10004685 | Ga0207698_100046855 | 321 |
| 574 | 3300026142 | Ga0207698_10059137 | Ga0207698_100591373 | 321 |
| 575 | 3300028379 | Ga0268266_10559763 | Ga0268266_105597631 | 321 |
| 576 | 3300028381 | Ga0268264_10062766 | Ga0268264_100627663 | 321 |
| 577 | 3300028381 | Ga0268264_10112149 | Ga0268264_101121492 | 321 |
| 578 | 3300028786 | Ga0307517_10000131 | Ga0307517_1000013126 | 321 |
| 579 | 3300028786 | Ga0307517_10069239 | Ga0307517_100692393 | 321 |
| 580 | 3300028786 | Ga0307517_10155715 | Ga0307517_101557152 | 321 |
| 581 | 3300028794 | Ga0307515_10089622 | Ga0307515_100896222 | 321 |
| 582 | 3300028794 | Ga0307515_10120653 | Ga0307515_101206533 | 321 |
| 583 | 3300031507 | Ga0307509_10000871 | Ga0307509_1000087140 | 321 |
| 584 | 3300031507 | Ga0307509_10009460 | Ga0307509_100094602 | 321 |
| 585 | 3300031507 | Ga0307509_10071281 | Ga0307509_100712813 | 321 |
| 586 | 3300031507 | Ga0307509_10086638 | Ga0307509_100866383 | 321 |
| 587 | 3300031507 | Ga0307509_10158271 | Ga0307509_101582712 | 321 |
| 588 | 3300031616 | Ga0307508_10000349 | Ga0307508_1000034929 | 321 |
| 589 | 3300031616 | Ga0307508_10046060 | Ga0307508_100460602 | 321 |
| 590 | 3300031616 | Ga0307508_10061411 | Ga0307508_100614113 | 321 |
| 591 | 3300031649 | Ga0307514_10001708 | Ga0307514_100017085 | 321 |
| 592 | 3300031649 | Ga0307514_10057518 | Ga0307514_100575182 | 321 |
| 593 | 3300031730 | Ga0307516_10004605 | Ga0307516_1000460511 | 321 |
| 594 | 3300031730 | Ga0307516_10146531 | Ga0307516_101465312 | 321 |
| 595 | 3300031731 | Ga0307405_10014665 | Ga0307405_100146654 | 321 |
| 596 | 3300031901 | Ga0307406_10042058 | Ga0307406_100420582 | 321 |
| 597 | 3300031911 | Ga0307412_10054471 | Ga0307412_100544712 | 321 |
| 598 | 3300031995 | Ga0307409_100000926 | Ga0307409_1000009266 | 321 |
| 599 | 3300032002 | Ga0307416_100003028 | Ga0307416_1000030282 | 321 |
| 600 | 3300032002 | Ga0307416_100502519 | Ga0307416_1005025192 | 321 |
| 601 | 3300032005 | Ga0307411_10041081 | Ga0307411_100410812 | 321 |
| 602 | 3300032126 | Ga0307415_100003743 | Ga0307415_1000037436 | 321 |
| 603 | 3300033180 | Ga0307510_10008226 | Ga0307510_100082266 | 321 |
| 604 | 3300033180 | Ga0307510_10069826 | Ga0307510_100698263 | 321 |
| 605 | 3300033180 | Ga0307510_10201778 | Ga0307510_102017782 | 321 |
| 606 | 3300035725 | Ga0373947_0070940 | Ga0373947_0070940_682_1662 | 321 |
| 607 | 3300037068 | Ga0373925_0435975 | Ga0373925_0435975_27_998 | 321 |
| 608 | 3300037418 | Ga0395900_0000058 | Ga0395900_0000058_141661_142635 | 321 |
| 609 | 3300037466 | Ga0395898_0000283 | Ga0395898_0000283_90210_91184 | 321 |
| 610 | 3300037471 | Ga0395905_0070264 | Ga0395905_0070264_1505_2497 | 321 |
| 611 | 3300041456 | Ga0451795_0816552 | Ga0451795_0816552_720_1706 | 321 |
| 612 | 3300041460 | Ga0451802_0878914 | Ga0451802_0878914_12_989 | 321 |
| 613 | 3300041512 | Ga0451853_2222586 | Ga0451853_2222586_131_1111 | 321 |
| 614 | 3300042115 | Ga0450911_001146 | Ga0450911_001146_2595_3569 | 321 |
| 615 | 3300042876 | Ga0451577_0010228 | Ga0451577_0010228_7672_8658 | 321 |
| 616 | 3300044658 | Ga0466972_0078819 | Ga0466972_0078819_369_1343 | 321 |
| 617 | 3300044683 | Ga0466965_0072665 | Ga0466965_0072665_435_1406 | 321 |
| 618 | 3300045049 | Ga0466959_0086352 | Ga0466959_0086352_1138_2148 | 321 |
| 619 | 3300046454 | Ga0495592_0000394 | Ga0495592_0000394_32775_33746 | 321 |
| 620 | 3300046460 | Ga0495638_0139249 | Ga0495638_0139249_166_1152 | 321 |
| 621 | 3300046471 | Ga0495650_0019463 | Ga0495650_0019463_1275_2249 | 321 |
| 622 | 3300046512 | Ga0495610_0061924 | Ga0495610_0061924_591_1562 | 321 |
| 623 | 3300046517 | Ga0495630_0154828 | Ga0495630_0154828_427_1398 | 321 |
| 624 | 3300046519 | Ga0495632_0010162 | Ga0495632_0010162_1443_2429 | 321 |
| 625 | 3300046522 | Ga0495643_0067736 | Ga0495643_0067736_611_1579 | 321 |
| 626 | 3300046543 | Ga0495645_0062491 | Ga0495645_0062491_368_1348 | 321 |
| 627 | 3300046648 | Ga0495611_0087562 | Ga0495611_0087562_125_1141 | 321 |
| 628 | 3300046680 | Ga0495646_0141327 | Ga0495646_0141327_43_1014 | 321 |
| 629 | 3300046683 | Ga0495658_0037493 | Ga0495658_0037493_985_1965 | 321 |
| 630 | 3300046690 | Ga0495624_0062388 | Ga0495624_0062388_44_1015 | 321 |
| 631 | 3300047471 | Ga0495684_0157686 | Ga0495684_0157686_608_1588 | 321 |
| 632 | 3300047673 | Ga0495593_0101135 | Ga0495593_0101135_487_1458 | 321 |
| 633 | 3300048911 | Ga0496108_0236330 | Ga0496108_0236330_211_1197 | 321 |
| 634 | 3300048924 | Ga0496121_0035310 | Ga0496121_0035310_772_1746 | 321 |
| 635 | 3300048927 | Ga0496124_0097272 | Ga0496124_0097272_968_1942 | 321 |
| 636 | 3300048928 | Ga0496125_0013437 | Ga0496125_0013437_2835_3818 | 321 |
| 637 | 3300048928 | Ga0496125_0070483 | Ga0496125_0070483_802_1776 | 321 |
| 638 | 3300049822 | Ga0501035_0238000 | Ga0501035_0238000_244_1239 | 321 |
| 639 | 3300050489 | nmdc:mga03683_32284_c1 | nmdc:mga03683_32284_c1_219_1190 | 321 |
| 640 | 3300050493 | nmdc:mga0k408_14868_c1 | nmdc:mga0k408_14868_c1_3031_4002 | 321 |
| 641 | 3300050493 | nmdc:mga0k408_28083_c1 | nmdc:mga0k408_28083_c1_1057_2043 | 321 |
| 642 | 3300050494 | nmdc:mga06z11_115211_c1 | nmdc:mga06z11_115211_c1_105_1079 | 321 |
| 643 | 3300050494 | nmdc:mga06z11_52833_c1 | nmdc:mga06z11_52833_c1_979_1950 | 321 |
| 644 | 3300050496 | nmdc:mga07m45_221111_c1 | nmdc:mga07m45_221111_c1_83_1051 | 321 |
| 645 | 3300050496 | nmdc:mga07m45_81_c1 | nmdc:mga07m45_81_c1_14365_15336 | 321 |
| 646 | 3300050516 | nmdc:mga0sz30_21551_c1 | nmdc:mga0sz30_21551_c1_1062_2033 | 321 |
| 647 | 3300053086 | Ga0500578_0000652 | Ga0500578_0000652_13006_13980 | 321 |
| 648 | 3300053090 | Ga0500646_0020168 | Ga0500646_0020168_574_1560 | 321 |
| 649 | 3300053093 | Ga0500651_0008514 | Ga0500651_0008514_449_1435 | 321 |
| 650 | 3300053118 | Ga0500594_0005643 | Ga0500594_0005643_1232_2203 | 321 |
| 651 | 3300053129 | Ga0500628_002238 | Ga0500628_002238_1146_2132 | 321 |
| 652 | 3300053131 | Ga0500652_005856 | Ga0500652_005856_1602_2588 | 321 |
| 653 | 3300053136 | Ga0500559_0000446 | Ga0500559_0000446_2671_3642 | 321 |
| 654 | 3300053156 | Ga0500622_0000124 | Ga0500622_0000124_12418_13404 | 321 |
| 655 | 3300053156 | Ga0500622_0009123 | Ga0500622_0009123_611_1582 | 321 |
| 656 | iso_pu_bacteria | 2585428057 | 2587728306 | 321 |
| 657 | iso_pu_bacteria | 2585428058 | 2587734486 | 321 |
| 658 | iso_pu_bacteria | 2588253510 | 2588295024 | 321 |
| 659 | iso_pu_bacteria | 2928115317 | 2928117250 | 321 |
| 660 | 3300003792 | Ga0055540_1007850 | Ga0055540_10078503 | 322 |
| 661 | 3300003794 | Ga0055531_10012618 | Ga0055531_100126183 | 322 |
| 662 | 3300005328 | Ga0070676_10011159 | Ga0070676_100111592 | 322 |
| 663 | 3300005329 | Ga0070683_100029368 | Ga0070683_1000293682 | 322 |
| 664 | 3300005331 | Ga0070670_100115775 | Ga0070670_1001157752 | 322 |
| 665 | 3300005331 | Ga0070670_100252130 | Ga0070670_1002521302 | 322 |
| 666 | 3300005334 | Ga0068869_100027914 | Ga0068869_1000279142 | 322 |
| 667 | 3300005335 | Ga0070666_10050920 | Ga0070666_100509202 | 322 |
| 668 | 3300005337 | Ga0070682_100085166 | Ga0070682_1000851662 | 322 |
| 669 | 3300005338 | Ga0068868_100057346 | Ga0068868_1000573463 | 322 |
| 670 | 3300005338 | Ga0068868_100073336 | Ga0068868_1000733363 | 322 |
| 671 | 3300005339 | Ga0070660_100128252 | Ga0070660_1001282522 | 322 |
| 672 | 3300005344 | Ga0070661_100100058 | Ga0070661_1001000582 | 322 |
| 673 | 3300005347 | Ga0070668_100119935 | Ga0070668_1001199352 | 322 |
| 674 | 3300005353 | Ga0070669_100034251 | Ga0070669_1000342512 | 322 |
| 675 | 3300005353 | Ga0070669_100072824 | Ga0070669_1000728242 | 322 |
| 676 | 3300005354 | Ga0070675_100064813 | Ga0070675_1000648132 | 322 |
| 677 | 3300005355 | Ga0070671_100076886 | Ga0070671_1000768862 | 322 |
| 678 | 3300005364 | Ga0070673_100060598 | Ga0070673_1000605982 | 322 |
| 679 | 3300005366 | Ga0070659_100138085 | Ga0070659_1001380852 | 322 |
| 680 | 3300005455 | Ga0070663_100005909 | Ga0070663_1000059096 | 322 |
| 681 | 3300005456 | Ga0070678_100013580 | Ga0070678_1000135802 | 322 |
| 682 | 3300005456 | Ga0070678_100185324 | Ga0070678_1001853241 | 322 |
| 683 | 3300005457 | Ga0070662_100054096 | Ga0070662_1000540963 | 322 |
| 684 | 3300005457 | Ga0070662_100055624 | Ga0070662_1000556242 | 322 |
| 685 | 3300005458 | Ga0070681_10232499 | Ga0070681_102324992 | 322 |
| 686 | 3300005543 | Ga0070672_100161318 | Ga0070672_1001613182 | 322 |
| 687 | 3300005543 | Ga0070672_100228763 | Ga0070672_1002287631 | 322 |
| 688 | 3300005547 | Ga0070693_100011646 | Ga0070693_1000116462 | 322 |
| 689 | 3300005563 | Ga0068855_100050047 | Ga0068855_1000500472 | 322 |
| 690 | 3300005563 | Ga0068855_100176827 | Ga0068855_1001768272 | 322 |
| 691 | 3300005564 | Ga0070664_100017203 | Ga0070664_1000172032 | 322 |
| 692 | 3300005577 | Ga0068857_100068892 | Ga0068857_1000688923 | 322 |
| 693 | 3300005614 | Ga0068856_100059918 | Ga0068856_1000599182 | 322 |
| 694 | 3300005616 | Ga0068852_100095692 | Ga0068852_1000956922 | 322 |
| 695 | 3300005616 | Ga0068852_100114168 | Ga0068852_1001141682 | 322 |
| 696 | 3300005616 | Ga0068852_100208459 | Ga0068852_1002084592 | 322 |
| 697 | 3300005617 | Ga0068859_100033863 | Ga0068859_1000338633 | 322 |
| 698 | 3300005618 | Ga0068864_100049681 | Ga0068864_1000496812 | 322 |
| 699 | 3300005618 | Ga0068864_100056292 | Ga0068864_1000562923 | 322 |
| 700 | 3300005719 | Ga0068861_100024567 | Ga0068861_1000245673 | 322 |
| 701 | 3300005840 | Ga0068870_10115178 | Ga0068870_101151782 | 322 |
| 702 | 3300005841 | Ga0068863_100031768 | Ga0068863_1000317684 | 322 |
| 703 | 3300005841 | Ga0068863_100038412 | Ga0068863_1000384122 | 322 |
| 704 | 3300005841 | Ga0068863_100051637 | Ga0068863_1000516372 | 322 |
| 705 | 3300005843 | Ga0068860_100197279 | Ga0068860_1001972792 | 322 |
| 706 | 3300005843 | Ga0068860_100204213 | Ga0068860_1002042132 | 322 |
| 707 | 3300005844 | Ga0068862_100058125 | Ga0068862_1000581253 | 322 |
| 708 | 3300006186 | Ga0075369_10038509 | Ga0075369_100385092 | 322 |
| 709 | 3300006237 | Ga0097621_100081669 | Ga0097621_1000816693 | 322 |
| 710 | 3300006358 | Ga0068871_100093767 | Ga0068871_1000937673 | 322 |
| 711 | 3300006881 | Ga0068865_100079132 | Ga0068865_1000791322 | 322 |
| 712 | 3300006931 | Ga0097620_100033861 | Ga0097620_1000338613 | 322 |
| 713 | 3300009098 | Ga0105245_10102204 | Ga0105245_101022042 | 322 |
| 714 | 3300009176 | Ga0105242_10079059 | Ga0105242_100790593 | 322 |
| 715 | 3300009177 | Ga0105248_10123485 | Ga0105248_101234853 | 322 |
| 716 | 3300009177 | Ga0105248_10154142 | Ga0105248_101541422 | 322 |
| 717 | 3300009551 | Ga0105238_10227899 | Ga0105238_102278992 | 322 |
| 718 | 3300009553 | Ga0105249_10010561 | Ga0105249_100105617 | 322 |
| 719 | 3300013100 | Ga0157373_10037740 | Ga0157373_100377403 | 322 |
| 720 | 3300013296 | Ga0157374_10097347 | Ga0157374_100973473 | 322 |
| 721 | 3300013296 | Ga0157374_10170314 | Ga0157374_101703142 | 322 |
| 722 | 3300013306 | Ga0163162_10007695 | Ga0163162_1000769511 | 322 |
| 723 | 3300013307 | Ga0157372_10051925 | Ga0157372_100519253 | 322 |
| 724 | 3300013308 | Ga0157375_10099385 | Ga0157375_100993852 | 322 |
| 725 | 3300013308 | Ga0157375_10130614 | Ga0157375_101306142 | 322 |
| 726 | 3300014325 | Ga0163163_10251023 | Ga0163163_102510232 | 322 |
| 727 | 3300014326 | Ga0157380_10112388 | Ga0157380_101123882 | 322 |
| 728 | 3300014326 | Ga0157380_10281039 | Ga0157380_102810392 | 322 |
| 729 | 3300014326 | Ga0157380_10548396 | Ga0157380_105483961 | 322 |
| 730 | 3300014497 | Ga0182008_10001156 | Ga0182008_1000115615 | 322 |
| 731 | 3300014497 | Ga0182008_10004095 | Ga0182008_100040955 | 322 |
| 732 | 3300014745 | Ga0157377_10023652 | Ga0157377_100236523 | 322 |
| 733 | 3300014968 | Ga0157379_10122709 | Ga0157379_101227093 | 322 |
| 734 | 3300014969 | Ga0157376_10206022 | Ga0157376_102060222 | 322 |
| 735 | 3300014969 | Ga0157376_10227786 | Ga0157376_102277862 | 322 |
| 736 | 3300015683 | Ga0183362_10003 | Ga0183362_10003879 | 322 |
| 737 | 3300017792 | Ga0163161_10090355 | Ga0163161_100903552 | 322 |
| 738 | 3300025292 | Ga0209676_1006821 | Ga0209676_10068214 | 322 |
| 739 | 3300025298 | Ga0209050_1001635 | Ga0209050_100163516 | 322 |
| 740 | 3300025303 | Ga0209051_1001081 | Ga0209051_100108118 | 322 |
| 741 | 3300025304 | Ga0209257_1003430 | Ga0209257_100343011 | 322 |
| 742 | 3300025321 | Ga0207656_10062157 | Ga0207656_100621572 | 322 |
| 743 | 3300025893 | Ga0207682_10040791 | Ga0207682_100407912 | 322 |
| 744 | 3300025899 | Ga0207642_10182304 | Ga0207642_101823041 | 322 |
| 745 | 3300025903 | Ga0207680_10145423 | Ga0207680_101454232 | 322 |
| 746 | 3300025907 | Ga0207645_10064845 | Ga0207645_100648452 | 322 |
| 747 | 3300025909 | Ga0207705_10121110 | Ga0207705_101211102 | 322 |
| 748 | 3300025919 | Ga0207657_10065236 | Ga0207657_100652363 | 322 |
| 749 | 3300025919 | Ga0207657_10113479 | Ga0207657_101134792 | 322 |
| 750 | 3300025920 | Ga0207649_10022011 | Ga0207649_100220112 | 322 |
| 751 | 3300025923 | Ga0207681_10112309 | Ga0207681_101123092 | 322 |
| 752 | 3300025924 | Ga0207694_10036617 | Ga0207694_100366172 | 322 |
| 753 | 3300025925 | Ga0207650_10343548 | Ga0207650_103435481 | 322 |
| 754 | 3300025926 | Ga0207659_10025527 | Ga0207659_100255272 | 322 |
| 755 | 3300025931 | Ga0207644_10001504 | Ga0207644_100015046 | 322 |
| 756 | 3300025932 | Ga0207690_10117694 | Ga0207690_101176942 | 322 |
| 757 | 3300025932 | Ga0207690_10150421 | Ga0207690_101504212 | 322 |
| 758 | 3300025933 | Ga0207706_10001677 | Ga0207706_100016772 | 322 |
| 759 | 3300025933 | Ga0207706_10011352 | Ga0207706_100113523 | 322 |
| 760 | 3300025934 | Ga0207686_10038467 | Ga0207686_100384672 | 322 |
| 761 | 3300025938 | Ga0207704_10190598 | Ga0207704_101905982 | 322 |
| 762 | 3300025940 | Ga0207691_10093842 | Ga0207691_100938423 | 322 |
| 763 | 3300025940 | Ga0207691_10239744 | Ga0207691_102397441 | 322 |
| 764 | 3300025941 | Ga0207711_10007584 | Ga0207711_100075846 | 322 |
| 765 | 3300025941 | Ga0207711_10041907 | Ga0207711_100419072 | 322 |
| 766 | 3300025941 | Ga0207711_10076292 | Ga0207711_100762923 | 322 |
| 767 | 3300025942 | Ga0207689_10009850 | Ga0207689_100098506 | 322 |
| 768 | 3300025944 | Ga0207661_10135339 | Ga0207661_101353392 | 322 |
| 769 | 3300025945 | Ga0207679_10011896 | Ga0207679_100118962 | 322 |
| 770 | 3300025949 | Ga0207667_10030273 | Ga0207667_100302735 | 322 |
| 771 | 3300025949 | Ga0207667_10087544 | Ga0207667_100875443 | 322 |
| 772 | 3300025960 | Ga0207651_10069685 | Ga0207651_100696852 | 322 |
| 773 | 3300025981 | Ga0207640_10082383 | Ga0207640_100823832 | 322 |
| 774 | 3300025986 | Ga0207658_10021533 | Ga0207658_100215332 | 322 |
| 775 | 3300026023 | Ga0207677_10023530 | Ga0207677_100235304 | 322 |
| 776 | 3300026023 | Ga0207677_10043382 | Ga0207677_100433823 | 322 |
| 777 | 3300026041 | Ga0207639_10035863 | Ga0207639_100358633 | 322 |
| 778 | 3300026041 | Ga0207639_10122505 | Ga0207639_101225052 | 322 |
| 779 | 3300026067 | Ga0207678_10053222 | Ga0207678_100532222 | 322 |
| 780 | 3300026078 | Ga0207702_10058880 | Ga0207702_100588803 | 322 |
| 781 | 3300026088 | Ga0207641_10124207 | Ga0207641_101242072 | 322 |
| 782 | 3300026095 | Ga0207676_10036150 | Ga0207676_100361502 | 322 |
| 783 | 3300026095 | Ga0207676_10114179 | Ga0207676_101141793 | 322 |
| 784 | 3300026095 | Ga0207676_10218332 | Ga0207676_102183322 | 322 |
| 785 | 3300026116 | Ga0207674_10067815 | Ga0207674_100678153 | 322 |
| 786 | 3300026121 | Ga0207683_10016577 | Ga0207683_100165774 | 322 |
| 787 | 3300026121 | Ga0207683_10164423 | Ga0207683_101644233 | 322 |
| 788 | 3300026142 | Ga0207698_10045582 | Ga0207698_100455823 | 322 |
| 789 | 3300026142 | Ga0207698_10086423 | Ga0207698_100864232 | 322 |
| 790 | 3300026142 | Ga0207698_10118010 | Ga0207698_101180102 | 322 |
| 791 | 3300028380 | Ga0268265_10114311 | Ga0268265_101143112 | 322 |
| 792 | 3300028794 | Ga0307515_10006352 | Ga0307515_100063529 | 322 |
| 793 | 3300029957 | Ga0265324_10007057 | Ga0265324_100070572 | 322 |
| 794 | 3300031251 | Ga0265327_10001807 | Ga0265327_100018075 | 322 |
| 795 | 3300031730 | Ga0307516_10001568 | Ga0307516_1000156813 | 322 |
| 796 | 3300031731 | Ga0307405_10369473 | Ga0307405_103694731 | 322 |
| 797 | 3300031852 | Ga0307410_10185676 | Ga0307410_101856762 | 322 |
| 798 | 3300035242 | Ga0373962_0011061 | Ga0373962_0011061_583_1575 | 322 |
| 799 | 3300035691 | Ga0373931_0058186 | Ga0373931_0058186_10_1002 | 322 |
| 800 | 3300037471 | Ga0395905_0006877 | Ga0395905_0006877_4499_5473 | 322 |
| 801 | 3300037471 | Ga0395905_0373377 | Ga0395905_0373377_173_1156 | 322 |
| 802 | 3300039437 | Ga0436365_0730477 | Ga0436365_0730477_693_1685 | 322 |
| 803 | 3300042184 | Ga0450908_011281 | Ga0450908_011281_174_1142 | 322 |
| 804 | 3300042876 | Ga0451577_0019182 | Ga0451577_0019182_2549_3526 | 322 |
| 805 | 3300046615 | Ga0495656_0000093 | Ga0495656_0000093_27410_28393 | 322 |
| 806 | 3300046615 | Ga0495656_0019941 | Ga0495656_0019941_1227_2237 | 322 |
| 807 | 3300048090 | Ga0495615_0007340 | Ga0495615_0007340_434_1441 | 322 |
| 808 | 3300048903 | Ga0496100_0043054 | Ga0496100_0043054_1276_2259 | 322 |
| 809 | 3300048904 | Ga0496101_0034545 | Ga0496101_0034545_1083_2066 | 322 |
| 810 | 3300048906 | Ga0496103_0050295 | Ga0496103_0050295_1122_2105 | 322 |
| 811 | 3300048907 | Ga0496104_0008511 | Ga0496104_0008511_6920_7903 | 322 |
| 812 | 3300048908 | Ga0496105_0024726 | Ga0496105_0024726_1151_2134 | 322 |
| 813 | 3300048909 | Ga0496106_0022941 | Ga0496106_0022941_2116_3108 | 322 |
| 814 | 3300048909 | Ga0496106_0053548 | Ga0496106_0053548_933_1916 | 322 |
| 815 | 3300048910 | Ga0496107_0006316 | Ga0496107_0006316_1590_2582 | 322 |
| 816 | 3300048913 | Ga0496110_0079805 | Ga0496110_0079805_301_1293 | 322 |
| 817 | 3300048914 | Ga0496111_0067545 | Ga0496111_0067545_1332_2324 | 322 |
| 818 | 3300048914 | Ga0496111_0078010 | Ga0496111_0078010_986_1969 | 322 |
| 819 | 3300048915 | Ga0496112_0460602 | Ga0496112_0460602_87_1079 | 322 |
| 820 | 3300048917 | Ga0496114_0124210 | Ga0496114_0124210_899_1891 | 322 |
| 821 | 3300048917 | Ga0496114_0159508 | Ga0496114_0159508_318_1301 | 322 |
| 822 | 3300048918 | Ga0496115_0067578 | Ga0496115_0067578_1552_2544 | 322 |
| 823 | 3300048925 | Ga0496122_0000383 | Ga0496122_0000383_1432_2400 | 322 |
| 824 | 3300048926 | Ga0496123_0000249 | Ga0496123_0000249_92312_93280 | 322 |
| 825 | 3300050493 | nmdc:mga0k408_55984_c1 | nmdc:mga0k408_55984_c1_474_1442 | 322 |
| 826 | 3300053136 | Ga0500559_0009437 | Ga0500559_0009437_1252_2220 | 322 |
| 827 | 3300061719 | Ga0466962_0049703 | Ga0466962_0049703_222_1208 | 322 |
| 828 | 3300001979 | JGI24740J21852_10002227 | JGI24740J21852_100022273 | 323 |
| 829 | 3300002773 | JGI25152J39213_1010277 | JGI25152J39213_10102773 | 323 |
| 830 | 3300002774 | JGI25150J39212_1006072 | JGI25150J39212_10060722 | 323 |
| 831 | 3300003215 | JGI25153J46596_10003671 | JGI25153J46596_100036716 | 323 |
| 832 | 3300003215 | JGI25153J46596_10004835 | JGI25153J46596_100048353 | 323 |
| 833 | 3300003578 | Ga0006562J51391_1013325 | Ga0006562J51391_101332511 | 323 |
| 834 | 3300003578 | Ga0006562J51391_1013332 | Ga0006562J51391_10133323 | 323 |
| 835 | 3300003578 | Ga0006562J51391_1029542 | Ga0006562J51391_10295428 | 323 |
| 836 | 3300003578 | Ga0006562J51391_1029546 | Ga0006562J51391_10295463 | 323 |
| 837 | 3300003761 | Ga0055535_1000934 | Ga0055535_100093410 | 323 |
| 838 | 3300003762 | Ga0055542_1000051 | Ga0055542_100005199 | 323 |
| 839 | 3300003771 | Ga0055526_1000826 | Ga0055526_100082617 | 323 |
| 840 | 3300003781 | Ga0055536_1012919 | Ga0055536_10129192 | 323 |
| 841 | 3300003781 | Ga0055536_1018427 | Ga0055536_10184272 | 323 |
| 842 | 3300003784 | Ga0055534_1002526 | Ga0055534_10025265 | 323 |
| 843 | 3300003784 | Ga0055534_1005182 | Ga0055534_10051823 | 323 |
| 844 | 3300003790 | Ga0055528_1013683 | Ga0055528_10136832 | 323 |
| 845 | 3300003790 | Ga0055528_1022218 | Ga0055528_10222182 | 323 |
| 846 | 3300003791 | Ga0055530_10008783 | Ga0055530_100087833 | 323 |
| 847 | 3300003792 | Ga0055540_1001799 | Ga0055540_10017993 | 323 |
| 848 | 3300003792 | Ga0055540_1008402 | Ga0055540_10084023 | 323 |
| 849 | 3300003792 | Ga0055540_1031797 | Ga0055540_10317971 | 323 |
| 850 | 3300003794 | Ga0055531_10020656 | Ga0055531_100206562 | 323 |
| 851 | 3300005328 | Ga0070676_10127828 | Ga0070676_101278281 | 323 |
| 852 | 3300005335 | Ga0070666_10128748 | Ga0070666_101287481 | 323 |
| 853 | 3300005338 | Ga0068868_100014027 | Ga0068868_1000140273 | 323 |
| 854 | 3300005340 | Ga0070689_100328387 | Ga0070689_1003283871 | 323 |
| 855 | 3300005354 | Ga0070675_100027434 | Ga0070675_1000274343 | 323 |
| 856 | 3300005355 | Ga0070671_100011406 | Ga0070671_1000114063 | 323 |
| 857 | 3300005356 | Ga0070674_100020660 | Ga0070674_1000206602 | 323 |
| 858 | 3300005364 | Ga0070673_100010575 | Ga0070673_1000105755 | 323 |
| 859 | 3300005367 | Ga0070667_100048321 | Ga0070667_1000483213 | 323 |
| 860 | 3300005456 | Ga0070678_100172516 | Ga0070678_1001725162 | 323 |
| 861 | 3300005457 | Ga0070662_100158535 | Ga0070662_1001585352 | 323 |
| 862 | 3300005459 | Ga0068867_100014337 | Ga0068867_1000143373 | 323 |
| 863 | 3300005459 | Ga0068867_100025831 | Ga0068867_1000258313 | 323 |
| 864 | 3300005459 | Ga0068867_100160344 | Ga0068867_1001603442 | 323 |
| 865 | 3300005539 | Ga0068853_100022735 | Ga0068853_1000227354 | 323 |
| 866 | 3300005539 | Ga0068853_100080199 | Ga0068853_1000801992 | 323 |
| 867 | 3300005543 | Ga0070672_100100519 | Ga0070672_1001005192 | 323 |
| 868 | 3300005548 | Ga0070665_100304456 | Ga0070665_1003044562 | 323 |
| 869 | 3300005563 | Ga0068855_100020802 | Ga0068855_1000208028 | 323 |
| 870 | 3300005564 | Ga0070664_100026915 | Ga0070664_1000269152 | 323 |
| 871 | 3300005577 | Ga0068857_100088867 | Ga0068857_1000888673 | 323 |
| 872 | 3300005616 | Ga0068852_100031065 | Ga0068852_1000310653 | 323 |
| 873 | 3300005617 | Ga0068859_100010805 | Ga0068859_1000108052 | 323 |
| 874 | 3300005617 | Ga0068859_100208397 | Ga0068859_1002083972 | 323 |
| 875 | 3300005618 | Ga0068864_100002362 | Ga0068864_1000023624 | 323 |
| 876 | 3300005718 | Ga0068866_10180079 | Ga0068866_101800792 | 323 |
| 877 | 3300005719 | Ga0068861_100022805 | Ga0068861_1000228052 | 323 |
| 878 | 3300005834 | Ga0068851_10035063 | Ga0068851_100350632 | 323 |
| 879 | 3300005840 | Ga0068870_10025942 | Ga0068870_100259422 | 323 |
| 880 | 3300005841 | Ga0068863_100040765 | Ga0068863_1000407655 | 323 |
| 881 | 3300005842 | Ga0068858_100000947 | Ga0068858_10000094713 | 323 |
| 882 | 3300005843 | Ga0068860_100000590 | Ga0068860_10000059013 | 323 |
| 883 | 3300005844 | Ga0068862_100056931 | Ga0068862_1000569312 | 323 |
| 884 | 3300006038 | Ga0075365_10001679 | Ga0075365_1000167911 | 323 |
| 885 | 3300006048 | Ga0075363_100012906 | Ga0075363_1000129063 | 323 |
| 886 | 3300006051 | Ga0075364_10023395 | Ga0075364_100233952 | 323 |
| 887 | 3300006177 | Ga0075362_10006614 | Ga0075362_100066144 | 323 |
| 888 | 3300006178 | Ga0075367_10065816 | Ga0075367_100658162 | 323 |
| 889 | 3300006195 | Ga0075366_10032419 | Ga0075366_100324192 | 323 |
| 890 | 3300006195 | Ga0075366_10051496 | Ga0075366_100514963 | 323 |
| 891 | 3300006237 | Ga0097621_100064293 | Ga0097621_1000642932 | 323 |
| 892 | 3300006353 | Ga0075370_10007775 | Ga0075370_100077754 | 323 |
| 893 | 3300006353 | Ga0075370_10021986 | Ga0075370_100219862 | 323 |
| 894 | 3300006358 | Ga0068871_100074554 | Ga0068871_1000745542 | 323 |
| 895 | 3300006881 | Ga0068865_100145558 | Ga0068865_1001455582 | 323 |
| 896 | 3300006931 | Ga0097620_100010805 | Ga0097620_1000108052 | 323 |
| 897 | 3300006931 | Ga0097620_100208406 | Ga0097620_1002084062 | 323 |
| 898 | 3300006946 | Ga0079104_1017870 | Ga0079104_10178702 | 323 |
| 899 | 3300006948 | Ga0099826_10041983 | Ga0099826_100419833 | 323 |
| 900 | 3300006948 | Ga0099826_10085707 | Ga0099826_100857073 | 323 |
| 901 | 3300009036 | Ga0105244_10007138 | Ga0105244_100071385 | 323 |
| 902 | 3300009148 | Ga0105243_10010327 | Ga0105243_100103274 | 323 |
| 903 | 3300009148 | Ga0105243_10019712 | Ga0105243_100197123 | 323 |
| 904 | 3300009177 | Ga0105248_10333990 | Ga0105248_103339902 | 323 |
| 905 | 3300013100 | Ga0157373_10022910 | Ga0157373_100229104 | 323 |
| 906 | 3300013100 | Ga0157373_10178132 | Ga0157373_101781322 | 323 |
| 907 | 3300013102 | Ga0157371_10102629 | Ga0157371_101026292 | 323 |
| 908 | 3300013104 | Ga0157370_10117019 | Ga0157370_101170192 | 323 |
| 909 | 3300013105 | Ga0157369_10013318 | Ga0157369_100133182 | 323 |
| 910 | 3300013297 | Ga0157378_10008627 | Ga0157378_100086277 | 323 |
| 911 | 3300013306 | Ga0163162_10002118 | Ga0163162_1000211810 | 323 |
| 912 | 3300013308 | Ga0157375_10064111 | Ga0157375_100641113 | 323 |
| 913 | 3300013308 | Ga0157375_10318209 | Ga0157375_103182092 | 323 |
| 914 | 3300014325 | Ga0163163_10007361 | Ga0163163_100073616 | 323 |
| 915 | 3300014326 | Ga0157380_10056674 | Ga0157380_100566742 | 323 |
| 916 | 3300014497 | Ga0182008_10008484 | Ga0182008_100084844 | 323 |
| 917 | 3300014497 | Ga0182008_10116007 | Ga0182008_101160072 | 323 |
| 918 | 3300014968 | Ga0157379_10025992 | Ga0157379_100259924 | 323 |
| 919 | 3300014968 | Ga0157379_10069401 | Ga0157379_100694012 | 323 |
| 920 | 3300014968 | Ga0157379_10097801 | Ga0157379_100978012 | 323 |
| 921 | 3300015261 | Ga0182006_1003275 | Ga0182006_10032755 | 323 |
| 922 | 3300015262 | Ga0182007_10002915 | Ga0182007_100029155 | 323 |
| 923 | 3300017792 | Ga0163161_10039684 | Ga0163161_100396843 | 323 |
| 924 | 3300017792 | Ga0163161_10053752 | Ga0163161_100537523 | 323 |
| 925 | 3300025228 | Ga0209672_100538 | Ga0209672_1005385 | 323 |
| 926 | 3300025229 | Ga0209147_102676 | Ga0209147_1026762 | 323 |
| 927 | 3300025242 | Ga0209258_100132 | Ga0209258_10013298 | 323 |
| 928 | 3300025245 | Ga0207425_1000226 | Ga0207425_10002266 | 323 |
| 929 | 3300025245 | Ga0207425_1007249 | Ga0207425_10072493 | 323 |
| 930 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071247 | 323 |
| 931 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012366 | 323 |
| 932 | 3300025258 | Ga0209129_1000084 | Ga0209129_100008434 | 323 |
| 933 | 3300025263 | Ga0209565_1000169 | Ga0209565_100016932 | 323 |
| 934 | 3300025263 | Ga0209565_1000364 | Ga0209565_100036434 | 323 |
| 935 | 3300025273 | Ga0209673_1000114 | Ga0209673_100011432 | 323 |
| 936 | 3300025273 | Ga0209673_1000916 | Ga0209673_10009163 | 323 |
| 937 | 3300025273 | Ga0209673_1001117 | Ga0209673_10011174 | 323 |
| 938 | 3300025273 | Ga0209673_1009349 | Ga0209673_10093493 | 323 |
| 939 | 3300025273 | Ga0209673_1019820 | Ga0209673_10198203 | 323 |
| 940 | 3300025284 | Ga0209130_1000571 | Ga0209130_100057112 | 323 |
| 941 | 3300025284 | Ga0209130_1004615 | Ga0209130_10046154 | 323 |
| 942 | 3300025291 | Ga0209675_1000062 | Ga0209675_100006232 | 323 |
| 943 | 3300025292 | Ga0209676_1000817 | Ga0209676_10008173 | 323 |
| 944 | 3300025292 | Ga0209676_1003376 | Ga0209676_10033765 | 323 |
| 945 | 3300025294 | Ga0209025_1000719 | Ga0209025_100071946 | 323 |
| 946 | 3300025294 | Ga0209025_1000861 | Ga0209025_100086137 | 323 |
| 947 | 3300025294 | Ga0209025_1018573 | Ga0209025_10185733 | 323 |
| 948 | 3300025294 | Ga0209025_1045276 | Ga0209025_10452762 | 323 |
| 949 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022148 | 323 |
| 950 | 3300025295 | Ga0209564_1000414 | Ga0209564_10004143 | 323 |
| 951 | 3300025295 | Ga0209564_1000613 | Ga0209564_10006133 | 323 |
| 952 | 3300025297 | Ga0209758_1000099 | Ga0209758_1000099101 | 323 |
| 953 | 3300025297 | Ga0209758_1002249 | Ga0209758_10022494 | 323 |
| 954 | 3300025298 | Ga0209050_1000052 | Ga0209050_100005236 | 323 |
| 955 | 3300025299 | Ga0209256_1000206 | Ga0209256_100020613 | 323 |
| 956 | 3300025299 | Ga0209256_1000239 | Ga0209256_100023934 | 323 |
| 957 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049149 | 323 |
| 958 | 3300025302 | Ga0207426_1000086 | Ga0207426_100008635 | 323 |
| 959 | 3300025302 | Ga0207426_1000346 | Ga0207426_100034634 | 323 |
| 960 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015482 | 323 |
| 961 | 3300025303 | Ga0209051_1000420 | Ga0209051_100042018 | 323 |
| 962 | 3300025303 | Ga0209051_1000492 | Ga0209051_100049229 | 323 |
| 963 | 3300025303 | Ga0209051_1002112 | Ga0209051_10021123 | 323 |
| 964 | 3300025304 | Ga0209257_1000037 | Ga0209257_1000037263 | 323 |
| 965 | 3300025321 | Ga0207656_10042172 | Ga0207656_100421722 | 323 |
| 966 | 3300025728 | Ga0207655_1000477 | Ga0207655_100047742 | 323 |
| 967 | 3300025903 | Ga0207680_10143169 | Ga0207680_101431692 | 323 |
| 968 | 3300025904 | Ga0207647_10089114 | Ga0207647_100891142 | 323 |
| 969 | 3300025908 | Ga0207643_10029897 | Ga0207643_100298972 | 323 |
| 970 | 3300025923 | Ga0207681_10052469 | Ga0207681_100524693 | 323 |
| 971 | 3300025924 | Ga0207694_10056930 | Ga0207694_100569303 | 323 |
| 972 | 3300025925 | Ga0207650_10007368 | Ga0207650_100073685 | 323 |
| 973 | 3300025926 | Ga0207659_10002674 | Ga0207659_100026747 | 323 |
| 974 | 3300025926 | Ga0207659_10016256 | Ga0207659_100162563 | 323 |
| 975 | 3300025931 | Ga0207644_10001724 | Ga0207644_100017243 | 323 |
| 976 | 3300025931 | Ga0207644_10022871 | Ga0207644_100228713 | 323 |
| 977 | 3300025933 | Ga0207706_10095958 | Ga0207706_100959583 | 323 |
| 978 | 3300025934 | Ga0207686_10010318 | Ga0207686_100103183 | 323 |
| 979 | 3300025935 | Ga0207709_10008688 | Ga0207709_100086883 | 323 |
| 980 | 3300025935 | Ga0207709_10085744 | Ga0207709_100857442 | 323 |
| 981 | 3300025936 | Ga0207670_10062873 | Ga0207670_100628732 | 323 |
| 982 | 3300025937 | Ga0207669_10093576 | Ga0207669_100935762 | 323 |
| 983 | 3300025938 | Ga0207704_10001522 | Ga0207704_100015224 | 323 |
| 984 | 3300025940 | Ga0207691_10002901 | Ga0207691_100029013 | 323 |
| 985 | 3300025940 | Ga0207691_10012766 | Ga0207691_100127667 | 323 |
| 986 | 3300025941 | Ga0207711_10256121 | Ga0207711_102561212 | 323 |
| 987 | 3300025942 | Ga0207689_10034031 | Ga0207689_100340314 | 323 |
| 988 | 3300025945 | Ga0207679_10205195 | Ga0207679_102051952 | 323 |
| 989 | 3300025960 | Ga0207651_10003471 | Ga0207651_100034713 | 323 |
| 990 | 3300025972 | Ga0207668_10053015 | Ga0207668_100530153 | 323 |
| 991 | 3300025986 | Ga0207658_10015971 | Ga0207658_100159714 | 323 |
| 992 | 3300025986 | Ga0207658_10167556 | Ga0207658_101675562 | 323 |
| 993 | 3300026023 | Ga0207677_10002324 | Ga0207677_100023244 | 323 |
| 994 | 3300026035 | Ga0207703_10003131 | Ga0207703_100031317 | 323 |
| 995 | 3300026041 | Ga0207639_10010457 | Ga0207639_100104573 | 323 |
| 996 | 3300026041 | Ga0207639_10106409 | Ga0207639_101064092 | 323 |
| 997 | 3300026088 | Ga0207641_10012012 | Ga0207641_100120126 | 323 |
| 998 | 3300026089 | Ga0207648_10008332 | Ga0207648_100083328 | 323 |
| 999 | 3300026089 | Ga0207648_10042896 | Ga0207648_100428963 | 323 |
| 1000 | 3300026095 | Ga0207676_10001457 | Ga0207676_1000145718 | 323 |
| 1001 | 3300026116 | Ga0207674_10091078 | Ga0207674_100910783 | 323 |
| 1002 | 3300026118 | Ga0207675_100001900 | Ga0207675_10000190019 | 323 |
| 1003 | 3300026121 | Ga0207683_10028752 | Ga0207683_100287524 | 323 |
| 1004 | 3300026121 | Ga0207683_10092116 | Ga0207683_100921163 | 323 |
| 1005 | 3300026142 | Ga0207698_10009520 | Ga0207698_100095201 | 323 |
| 1006 | 3300026142 | Ga0207698_10055995 | Ga0207698_100559952 | 323 |
| 1007 | 3300027666 | Ga0209282_1001433 | Ga0209282_10014333 | 323 |
| 1008 | 3300027907 | Ga0207428_10035993 | Ga0207428_100359935 | 323 |
| 1009 | 3300028379 | Ga0268266_10117070 | Ga0268266_101170702 | 323 |
| 1010 | 3300028381 | Ga0268264_10000991 | Ga0268264_1000099110 | 323 |
| 1011 | 3300030731 | Ga0316177_1175648 | Ga0316177_11756482 | 323 |
| 1012 | 3300030732 | Ga0316176_1195019 | Ga0316176_11950192 | 323 |
| 1013 | 3300030733 | Ga0314311_1020317 | Ga0314311_10203173 | 323 |
| 1014 | 3300030734 | Ga0316179_1040040 | Ga0316179_10400402 | 323 |
| 1015 | 3300030735 | Ga0316178_1025743 | Ga0316178_10257433 | 323 |
| 1016 | 3300030736 | Ga0316180_1050502 | Ga0316180_10505023 | 323 |
| 1017 | 3300030742 | Ga0316183_1188254 | Ga0316183_11882542 | 323 |
| 1018 | 3300030742 | Ga0316183_1202539 | Ga0316183_12025392 | 323 |
| 1019 | 3300030744 | Ga0316181_1041597 | Ga0316181_10415972 | 323 |
| 1020 | 3300030745 | Ga0316182_1104984 | Ga0316182_11049842 | 323 |
| 1021 | 3300030745 | Ga0316182_1417019 | Ga0316182_14170193 | 323 |
| 1022 | 3300031235 | Ga0265330_10000453 | Ga0265330_100004537 | 323 |
| 1023 | 3300031238 | Ga0265332_10000012 | Ga0265332_10000012250 | 323 |
| 1024 | 3300031241 | Ga0265325_10017431 | Ga0265325_100174312 | 323 |
| 1025 | 3300031548 | Ga0307408_100000274 | Ga0307408_10000027436 | 323 |
| 1026 | 3300031548 | Ga0307408_100104590 | Ga0307408_1001045903 | 323 |
| 1027 | 3300031548 | Ga0307408_100106258 | Ga0307408_1001062582 | 323 |
| 1028 | 3300031649 | Ga0307514_10024565 | Ga0307514_100245654 | 323 |
| 1029 | 3300031711 | Ga0265314_10000029 | Ga0265314_100000297 | 323 |
| 1030 | 3300031731 | Ga0307405_10014975 | Ga0307405_100149752 | 323 |
| 1031 | 3300031824 | Ga0307413_10026524 | Ga0307413_100265242 | 323 |
| 1032 | 3300031901 | Ga0307406_10001131 | Ga0307406_1000113111 | 323 |
| 1033 | 3300031901 | Ga0307406_10001699 | Ga0307406_100016995 | 323 |
| 1034 | 3300031901 | Ga0307406_10027882 | Ga0307406_100278823 | 323 |
| 1035 | 3300031911 | Ga0307412_10097082 | Ga0307412_100970822 | 323 |
| 1036 | 3300031911 | Ga0307412_10117802 | Ga0307412_101178022 | 323 |
| 1037 | 3300031911 | Ga0307412_10125216 | Ga0307412_101252162 | 323 |
| 1038 | 3300031911 | Ga0307412_10353632 | Ga0307412_103536322 | 323 |
| 1039 | 3300032004 | Ga0307414_10026215 | Ga0307414_100262152 | 323 |
| 1040 | 3300032004 | Ga0307414_10159590 | Ga0307414_101595902 | 323 |
| 1041 | 3300035172 | Ga0373955_0184150 | Ga0373955_0184150_129_1124 | 323 |
| 1042 | 3300042531 | Ga0450918_000609 | Ga0450918_000609_6384_7355 | 323 |
| 1043 | 3300046453 | Ga0495627_008213 | Ga0495627_008213_1807_2778 | 323 |
| 1044 | 3300046453 | Ga0495627_019457 | Ga0495627_019457_369_1340 | 323 |
| 1045 | 3300046512 | Ga0495610_0056162 | Ga0495610_0056162_371_1342 | 323 |
| 1046 | 3300046513 | Ga0495616_0011779 | Ga0495616_0011779_2846_3817 | 323 |
| 1047 | 3300046518 | Ga0495631_0001417 | Ga0495631_0001417_11055_12026 | 323 |
| 1048 | 3300046520 | Ga0495637_0008174 | Ga0495637_0008174_1076_2047 | 323 |
| 1049 | 3300046539 | Ga0495621_0018955 | Ga0495621_0018955_987_1958 | 323 |
| 1050 | 3300046660 | Ga0495625_0001179 | Ga0495625_0001179_12651_13622 | 323 |
| 1051 | 3300046674 | Ga0495588_0049426 | Ga0495588_0049426_297_1268 | 323 |
| 1052 | 3300046683 | Ga0495658_0214289 | Ga0495658_0214289_41_1036 | 323 |
| 1053 | 3300046692 | Ga0495671_0021694 | Ga0495671_0021694_1125_2096 | 323 |
| 1054 | 3300047321 | Ga0495676_0107019 | Ga0495676_0107019_617_1588 | 323 |
| 1055 | 3300048088 | Ga0495602_0089757 | Ga0495602_0089757_68_1039 | 323 |
| 1056 | 3300048917 | Ga0496114_0056306 | Ga0496114_0056306_864_1859 | 323 |
| 1057 | 3300048920 | Ga0496117_0044192 | Ga0496117_0044192_1119_2090 | 323 |
| 1058 | 3300048920 | Ga0496117_0081894 | Ga0496117_0081894_630_1601 | 323 |
| 1059 | 3300048921 | Ga0496118_0007613 | Ga0496118_0007613_1190_2161 | 323 |
| 1060 | 3300048927 | Ga0496124_0016354 | Ga0496124_0016354_1645_2616 | 323 |
| 1061 | 3300049705 | Ga0501225_0007622 | Ga0501225_0007622_1174_2145 | 323 |
| 1062 | 3300049759 | Ga0501262_001452 | Ga0501262_001452_1330_2301 | 323 |
| 1063 | 3300050489 | nmdc:mga03683_52391_c1 | nmdc:mga03683_52391_c1_504_1475 | 323 |
| 1064 | 3300050490 | nmdc:mga03n38_21542_c1 | nmdc:mga03n38_21542_c1_1038_2009 | 323 |
| 1065 | 3300050492 | nmdc:mga0yw44_14380_c1 | nmdc:mga0yw44_14380_c1_559_1530 | 323 |
| 1066 | 3300050493 | nmdc:mga0k408_47081_c1 | nmdc:mga0k408_47081_c1_963_1934 | 323 |
| 1067 | 3300050496 | nmdc:mga07m45_43867_c1 | nmdc:mga07m45_43867_c1_1125_2096 | 323 |
| 1068 | 3300053087 | Ga0500643_018305 | Ga0500643_018305_1052_2023 | 323 |
| 1069 | 3300053093 | Ga0500651_0000067 | Ga0500651_0000067_22877_23848 | 323 |
| 1070 | 3300053110 | Ga0500571_000952 | Ga0500571_000952_10629_11600 | 323 |
| 1071 | 3300053117 | Ga0500593_005315 | Ga0500593_005315_1022_1993 | 323 |
| 1072 | 3300053134 | Ga0500658_0022824 | Ga0500658_0022824_1194_2165 | 323 |
| 1073 | 3300053134 | Ga0500658_0106674 | Ga0500658_0106674_205_1176 | 323 |
| 1074 | 3300053139 | Ga0500568_0009510 | Ga0500568_0009510_3123_4094 | 323 |
| 1075 | 3300053153 | Ga0500616_0012717 | Ga0500616_0012717_1141_2112 | 323 |
| 1076 | 3300053158 | Ga0500627_0012737 | Ga0500627_0012737_952_1923 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4egj-assembly5.cif.gz_A | crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans | 0.9574 | 5 | 311 |
| 4zqi-assembly2.cif.gz_C | crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis | 0.9535 | 11 | 314 |
| 5d8d-assembly3.cif.gz_D | crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii | 0.9534 | 6 | 311 |
| 5dmx-assembly2.cif.gz_D | crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121 | 0.9525 | 9 | 314 |
| 4zqi-assembly1.cif.gz_B | crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis | 0.9524 | 11 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4egjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9933 | 5 | 90 | 3.40.50.20 |
| 4egjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.96 | 5 | 90 | 3.40.50.20 |
| 3q1kB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9491 | 91 | 312 | 3.30.470.20 |
| 5d8dD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9441 | 91 | 311 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9429 | 91 | 312 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520H4J1-F1-model_v4 | D-alanine--D-alanine ligase | 0.9919 | 5 | 119 |
GO:0005829
GO:0008716 GO:0009252 |
| AF-A0A7X8SRQ2-F1-model_v4 | D-alanine--D-alanine ligase (EC 6.3.2.4) | 0.9802 | 11 | 99 |
GO:0005829
GO:0008716 GO:0009252 |
| AF-A0A258MF12-F1-model_v4 | D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) | 0.9765 | 5 | 311 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |
| AF-A0A059WVN9-F1-model_v4 | D-ala D-ala ligase C-terminus | 0.9765 | 147 | 320 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 |
| AF-A0A6L4B9S6-F1-model_v4 | D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) | 0.975 | 16 | 316 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar