F489556
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 440 | 2150 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100063090|Ga0068860_1000630903 |
| Length | 166 |
| Sequence | VRNRCLRCPRFGRGGLLLFETIEEFLAVTRYLHTMIRVTDPDATVRFFNLIGLEEVRRFSNEQGRFTLIFLAAPGQAGVAEVELTYNWDPQEYTGGRNFGHLAYRVDNIYETCQRLVEAGVTINRPPRDGHMAFVRSPDGISVELLQDGHLPPQEPWASMPNTGSW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 132 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 218 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 234 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 250 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 253 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 254 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 255 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 256 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 367 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 368 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 369 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 373 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 376 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 380 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 388 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 389 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 390 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 393 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 394 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 395 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 396 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 397 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 398 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 399 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 400 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 401 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 402 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 403 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 404 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 405 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 406 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 407 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 408 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 409 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 410 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 411 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 412 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 413 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 414 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 415 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 416 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 417 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 418 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 419 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 420 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 421 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 422 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 423 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 424 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 425 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 426 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 427 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 428 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 429 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 430 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 431 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 432 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 433 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 434 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 435 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 436 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 437 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 438 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 439 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 440 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.16 |
| Metatranscriptomes | 0.19 |
| Isolates | 4.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.7 |
| Nodule | 1.49 |
| Rhizoplane | 4.47 |
| Rhizosphere | 73.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100063090 | 3300005843 | Bacteria | 3520 |
| 2 | JGI24736J21556_1015550 | 3300001904 | Bacteria | 1218 |
| 3 | JGI24752J21851_1000019 | 3300001976 | Bacteria | 18205 |
| 4 | JGI24740J21852_10017003 | 3300001979 | Bacteria | 2612 |
| 5 | JGI24740J21852_10075190 | 3300001979 | Bacteria | 895 |
| 6 | JGI24740J21852_10101680 | 3300001979 | Bacteria | 731 |
| 7 | JGI24739J22299_10001252 | 3300001989 | Bacteria | 9526 |
| 8 | JGI24739J22299_10009714 | 3300001989 | Bacteria | 3580 |
| 9 | JGI24739J22299_10054526 | 3300001989 | Bacteria | 1280 |
| 10 | JGI24739J22299_10070483 | 3300001989 | Bacteria | 1088 |
| 11 | JGI24737J22298_10001039 | 3300001990 | Bacteria | 9812 |
| 12 | JGI24737J22298_10010383 | 3300001990 | Bacteria | 3074 |
| 13 | JGI24737J22298_10028225 | 3300001990 | Bacteria | 1765 |
| 14 | JGI24737J22298_10042305 | 3300001990 | Bacteria | 1396 |
| 15 | JGI24737J22298_10129864 | 3300001990 | Bacteria | 744 |
| 16 | JGI24743J22301_10036319 | 3300001991 | Bacteria | 981 |
| 17 | JGI24735J21928_10000626 | 3300002067 | Bacteria | 12446 |
| 18 | JGI24735J21928_10004199 | 3300002067 | Bacteria | 4863 |
| 19 | JGI24735J21928_10016834 | 3300002067 | Bacteria | 2263 |
| 20 | JGI24735J21928_10019673 | 3300002067 | Bacteria | 2074 |
| 21 | JGI24735J21928_10021160 | 3300002067 | Bacteria | 1988 |
| 22 | JGI24735J21928_10027327 | 3300002067 | Bacteria | 1710 |
| 23 | JGI24735J21928_10045723 | 3300002067 | Bacteria | 1271 |
| 24 | JGI24750J21931_1000043 | 3300002070 | Bacteria | 16792 |
| 25 | JGI24748J21848_1000093 | 3300002074 | Bacteria | 24972 |
| 26 | JGI24738J21930_10003215 | 3300002075 | Bacteria | 4170 |
| 27 | JGI24738J21930_10003683 | 3300002075 | Bacteria | 3838 |
| 28 | JGI24738J21930_10006892 | 3300002075 | Bacteria | 2639 |
| 29 | JGI24744J21845_10003354 | 3300002077 | Bacteria | 3290 |
| 30 | JGI24034J26672_10000032 | 3300002239 | Bacteria | 89175 |
| 31 | JGI24034J26672_10000057 | 3300002239 | Bacteria | 42515 |
| 32 | JGI24742J22300_10006451 | 3300002244 | Bacteria | 1939 |
| 33 | JGI24751J29686_10004989 | 3300002459 | Bacteria | 2705 |
| 34 | JGI25156J39149_1005233 | 3300002705 | Bacteria | 3793 |
| 35 | JGI25157J39369_1000597 | 3300002741 | Bacteria | 21268 |
| 36 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 37 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 38 | Ga0055525_1000063 | 3300003759 | Bacteria | 198877 |
| 39 | Ga0055525_1000064 | 3300003759 | Bacteria | 198750 |
| 40 | Ga0055542_1000123 | 3300003762 | Bacteria | 101557 |
| 41 | Ga0055542_1011154 | 3300003762 | Bacteria | 1608 |
| 42 | Ga0055529_1000144 | 3300003763 | Bacteria | 101557 |
| 43 | Ga0055529_1019104 | 3300003763 | Bacteria | 857 |
| 44 | Ga0055534_1015291 | 3300003784 | Bacteria | 1410 |
| 45 | Ga0055530_10000526 | 3300003791 | Bacteria | 33232 |
| 46 | Ga0055531_10000563 | 3300003794 | Bacteria | 32623 |
| 47 | Ga0065165_1004625 | 3300005262 | Bacteria | 8363 |
| 48 | Ga0065714_10511279 | 3300005288 | Bacteria | 518 |
| 49 | Ga0065704_10001466 | 3300005289 | Bacteria | 8454 |
| 50 | Ga0065704_10450884 | 3300005289 | Bacteria | 690 |
| 51 | Ga0065712_10484986 | 3300005290 | Bacteria | 660 |
| 52 | Ga0065715_10187962 | 3300005293 | Bacteria | 1421 |
| 53 | Ga0065707_10294859 | 3300005295 | Bacteria | 1017 |
| 54 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 55 | Ga0070658_10000083 | 3300005327 | Bacteria | 89189 |
| 56 | Ga0070658_10000688 | 3300005327 | Bacteria | 29272 |
| 57 | Ga0070658_10002274 | 3300005327 | Bacteria | 16105 |
| 58 | Ga0070658_10006725 | 3300005327 | Bacteria | 9314 |
| 59 | Ga0070658_10096964 | 3300005327 | Bacteria | 2435 |
| 60 | Ga0070658_10151357 | 3300005327 | Bacteria | 1943 |
| 61 | Ga0070658_10238578 | 3300005327 | Bacteria | 1540 |
| 62 | Ga0070658_10410091 | 3300005327 | Bacteria | 1164 |
| 63 | Ga0070676_10006658 | 3300005328 | Bacteria | 6186 |
| 64 | Ga0070676_10050811 | 3300005328 | Bacteria | 2432 |
| 65 | Ga0070676_10298533 | 3300005328 | Bacteria | 1091 |
| 66 | Ga0070683_100412488 | 3300005329 | Bacteria | 1288 |
| 67 | Ga0070690_100000011 | 3300005330 | Bacteria | 95472 |
| 68 | Ga0070690_100410640 | 3300005330 | Bacteria | 996 |
| 69 | Ga0070690_100595509 | 3300005330 | Bacteria | 839 |
| 70 | Ga0070670_100026386 | 3300005331 | Bacteria | 5000 |
| 71 | Ga0070670_100546775 | 3300005331 | Bacteria | 1033 |
| 72 | Ga0070670_100973530 | 3300005331 | Bacteria | 771 |
| 73 | Ga0070677_10001076 | 3300005333 | Bacteria | 8820 |
| 74 | Ga0068869_100000353 | 3300005334 | Bacteria | 24652 |
| 75 | Ga0068869_100813174 | 3300005334 | Bacteria | 804 |
| 76 | Ga0070666_10000035 | 3300005335 | Bacteria | 121458 |
| 77 | Ga0070666_10105789 | 3300005335 | Bacteria | 1944 |
| 78 | Ga0070666_10235104 | 3300005335 | Bacteria | 1295 |
| 79 | Ga0070666_10541233 | 3300005335 | Bacteria | 846 |
| 80 | Ga0070680_100047705 | 3300005336 | Bacteria | 3488 |
| 81 | Ga0070680_100249735 | 3300005336 | Bacteria | 1500 |
| 82 | Ga0070682_100809718 | 3300005337 | Bacteria | 762 |
| 83 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 84 | Ga0068868_100565163 | 3300005338 | Bacteria | 1004 |
| 85 | Ga0070660_100000122 | 3300005339 | Bacteria | 49000 |
| 86 | Ga0070660_100001677 | 3300005339 | Bacteria | 15200 |
| 87 | Ga0070660_100024829 | 3300005339 | Bacteria | 4451 |
| 88 | Ga0070660_100027823 | 3300005339 | Bacteria | 4223 |
| 89 | Ga0070660_100156120 | 3300005339 | Bacteria | 1837 |
| 90 | Ga0070660_100198027 | 3300005339 | Bacteria | 1629 |
| 91 | Ga0070660_100764720 | 3300005339 | Bacteria | 811 |
| 92 | Ga0070689_100002629 | 3300005340 | Bacteria | 11763 |
| 93 | Ga0070689_100224932 | 3300005340 | Bacteria | 1541 |
| 94 | Ga0070661_100287576 | 3300005344 | Bacteria | 1277 |
| 95 | Ga0070692_10000999 | 3300005345 | Bacteria | 9709 |
| 96 | Ga0070692_10130743 | 3300005345 | Bacteria | 1411 |
| 97 | Ga0070692_10859070 | 3300005345 | Bacteria | 624 |
| 98 | Ga0070668_100018658 | 3300005347 | Bacteria | 5207 |
| 99 | Ga0070668_100047927 | 3300005347 | Bacteria | 3286 |
| 100 | Ga0070668_100059247 | 3300005347 | Bacteria | 2963 |
| 101 | Ga0070668_100387063 | 3300005347 | Bacteria | 1191 |
| 102 | Ga0070668_100479801 | 3300005347 | Bacteria | 1073 |
| 103 | Ga0070668_100548675 | 3300005347 | Bacteria | 1006 |
| 104 | Ga0070668_101121098 | 3300005347 | Bacteria | 711 |
| 105 | Ga0070669_100000489 | 3300005353 | Bacteria | 29993 |
| 106 | Ga0070669_100005417 | 3300005353 | Bacteria | 9202 |
| 107 | Ga0070669_100007896 | 3300005353 | Bacteria | 7604 |
| 108 | Ga0070669_100025696 | 3300005353 | Bacteria | 4230 |
| 109 | Ga0070669_100423423 | 3300005353 | Bacteria | 1093 |
| 110 | Ga0070669_100768723 | 3300005353 | Bacteria | 817 |
| 111 | Ga0070669_101618640 | 3300005353 | Bacteria | 564 |
| 112 | Ga0070675_100005433 | 3300005354 | Bacteria | 9742 |
| 113 | Ga0070675_100013018 | 3300005354 | Bacteria | 6533 |
| 114 | Ga0070671_100000062 | 3300005355 | Bacteria | 73417 |
| 115 | Ga0070671_100002103 | 3300005355 | Bacteria | 15362 |
| 116 | Ga0070671_100019498 | 3300005355 | Bacteria | 5521 |
| 117 | Ga0070671_100029468 | 3300005355 | Bacteria | 4526 |
| 118 | Ga0070671_100146891 | 3300005355 | Bacteria | 1990 |
| 119 | Ga0070671_100152869 | 3300005355 | Bacteria | 1949 |
| 120 | Ga0070671_100191148 | 3300005355 | Bacteria | 1735 |
| 121 | Ga0070671_101422404 | 3300005355 | Bacteria | 613 |
| 122 | Ga0070674_100032397 | 3300005356 | Bacteria | 3471 |
| 123 | Ga0070674_100105593 | 3300005356 | Bacteria | 2060 |
| 124 | Ga0070674_100250861 | 3300005356 | Bacteria | 1390 |
| 125 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 126 | Ga0070673_101796393 | 3300005364 | Bacteria | 581 |
| 127 | Ga0070688_100013357 | 3300005365 | Bacteria | 4627 |
| 128 | Ga0070688_100172275 | 3300005365 | Bacteria | 1495 |
| 129 | Ga0070659_100022977 | 3300005366 | Bacteria | 4768 |
| 130 | Ga0070659_100213271 | 3300005366 | Bacteria | 1591 |
| 131 | Ga0070659_100297325 | 3300005366 | Bacteria | 1345 |
| 132 | Ga0070659_100302867 | 3300005366 | Bacteria | 1333 |
| 133 | Ga0070659_100345858 | 3300005366 | Bacteria | 1247 |
| 134 | Ga0070667_100014076 | 3300005367 | Bacteria | 6610 |
| 135 | Ga0070667_100041273 | 3300005367 | Bacteria | 3871 |
| 136 | Ga0070667_100052266 | 3300005367 | Bacteria | 3447 |
| 137 | Ga0070667_100065840 | 3300005367 | Bacteria | 3077 |
| 138 | Ga0070667_100110830 | 3300005367 | Bacteria | 2380 |
| 139 | Ga0070667_100358264 | 3300005367 | Bacteria | 1322 |
| 140 | Ga0070667_100553263 | 3300005367 | Bacteria | 1058 |
| 141 | Ga0070714_100157342 | 3300005435 | Bacteria | 2052 |
| 142 | Ga0070663_100099017 | 3300005455 | Bacteria | 2173 |
| 143 | Ga0070663_100224772 | 3300005455 | Bacteria | 1475 |
| 144 | Ga0070663_100464919 | 3300005455 | Bacteria | 1045 |
| 145 | Ga0070678_100167540 | 3300005456 | Bacteria | 1786 |
| 146 | Ga0070678_100250631 | 3300005456 | Bacteria | 1485 |
| 147 | Ga0070678_100536467 | 3300005456 | Bacteria | 1037 |
| 148 | Ga0070662_100003750 | 3300005457 | Bacteria | 9511 |
| 149 | Ga0070662_100190951 | 3300005457 | Bacteria | 1620 |
| 150 | Ga0070662_100284947 | 3300005457 | Bacteria | 1338 |
| 151 | Ga0070662_100359418 | 3300005457 | Bacteria | 1194 |
| 152 | Ga0070662_100427135 | 3300005457 | Bacteria | 1097 |
| 153 | Ga0070662_100552669 | 3300005457 | Bacteria | 965 |
| 154 | Ga0070662_100595219 | 3300005457 | Bacteria | 930 |
| 155 | Ga0070662_101997956 | 3300005457 | Bacteria | 501 |
| 156 | Ga0070681_10363840 | 3300005458 | Bacteria | 1357 |
| 157 | Ga0070681_10636137 | 3300005458 | Bacteria | 981 |
| 158 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 159 | Ga0070685_10000168 | 3300005466 | Bacteria | 43369 |
| 160 | Ga0070679_100239051 | 3300005530 | Bacteria | 1774 |
| 161 | Ga0068853_100113724 | 3300005539 | Bacteria | 2407 |
| 162 | Ga0068853_100617010 | 3300005539 | Bacteria | 1031 |
| 163 | Ga0070672_100046111 | 3300005543 | Bacteria | 3376 |
| 164 | Ga0070672_100222284 | 3300005543 | Bacteria | 1584 |
| 165 | Ga0070672_101221027 | 3300005543 | Bacteria | 670 |
| 166 | Ga0070686_100000035 | 3300005544 | Bacteria | 108191 |
| 167 | Ga0070696_100186631 | 3300005546 | Bacteria | 1541 |
| 168 | Ga0070693_100167685 | 3300005547 | Bacteria | 1404 |
| 169 | Ga0070693_101049445 | 3300005547 | Bacteria | 619 |
| 170 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 171 | Ga0070665_100000161 | 3300005548 | Bacteria | 122088 |
| 172 | Ga0070665_100003713 | 3300005548 | Bacteria | 16167 |
| 173 | Ga0070665_100042108 | 3300005548 | Bacteria | 4590 |
| 174 | Ga0070665_100045411 | 3300005548 | Bacteria | 4412 |
| 175 | Ga0070665_100716089 | 3300005548 | Bacteria | 1014 |
| 176 | Ga0070665_100781373 | 3300005548 | Bacteria | 968 |
| 177 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 178 | Ga0068855_100121035 | 3300005563 | Bacteria | 2995 |
| 179 | Ga0068855_100294989 | 3300005563 | Bacteria | 1797 |
| 180 | Ga0068855_100470742 | 3300005563 | Bacteria | 1369 |
| 181 | Ga0068855_100529651 | 3300005563 | Bacteria | 1277 |
| 182 | Ga0068855_101237351 | 3300005563 | Bacteria | 775 |
| 183 | Ga0070664_100232255 | 3300005564 | Bacteria | 1653 |
| 184 | Ga0068857_100056230 | 3300005577 | Bacteria | 3492 |
| 185 | Ga0068857_100155804 | 3300005577 | Bacteria | 2071 |
| 186 | Ga0068857_100278173 | 3300005577 | Bacteria | 1539 |
| 187 | Ga0068857_101015622 | 3300005577 | Bacteria | 799 |
| 188 | Ga0068854_100000751 | 3300005578 | Bacteria | 19185 |
| 189 | Ga0068854_100011157 | 3300005578 | Bacteria | 5837 |
| 190 | Ga0068854_100020920 | 3300005578 | Bacteria | 4433 |
| 191 | Ga0068854_100185355 | 3300005578 | Bacteria | 1628 |
| 192 | Ga0068854_100429597 | 3300005578 | Bacteria | 1099 |
| 193 | Ga0068854_100657243 | 3300005578 | Bacteria | 901 |
| 194 | Ga0068854_101474412 | 3300005578 | Bacteria | 617 |
| 195 | Ga0068856_100018774 | 3300005614 | Bacteria | 6706 |
| 196 | Ga0068856_100213696 | 3300005614 | Bacteria | 1944 |
| 197 | Ga0068856_100818976 | 3300005614 | Bacteria | 950 |
| 198 | Ga0068856_101336026 | 3300005614 | Bacteria | 732 |
| 199 | Ga0070702_100625054 | 3300005615 | Bacteria | 811 |
| 200 | Ga0068852_100001445 | 3300005616 | Bacteria | 16023 |
| 201 | Ga0068852_100091530 | 3300005616 | Bacteria | 2722 |
| 202 | Ga0068852_100236595 | 3300005616 | Bacteria | 1743 |
| 203 | Ga0068852_100253593 | 3300005616 | Bacteria | 1687 |
| 204 | Ga0068859_100006370 | 3300005617 | Bacteria | 11972 |
| 205 | Ga0068859_100041543 | 3300005617 | Bacteria | 4619 |
| 206 | Ga0068859_100059777 | 3300005617 | Bacteria | 3840 |
| 207 | Ga0068864_100022346 | 3300005618 | Bacteria | 5304 |
| 208 | Ga0068864_100035786 | 3300005618 | Bacteria | 4228 |
| 209 | Ga0068861_100000615 | 3300005719 | Bacteria | 21144 |
| 210 | Ga0068851_10030453 | 3300005834 | Bacteria | 2676 |
| 211 | Ga0068851_10416667 | 3300005834 | Bacteria | 793 |
| 212 | Ga0068870_10114066 | 3300005840 | Bacteria | 1547 |
| 213 | Ga0068863_100000060 | 3300005841 | Bacteria | 122123 |
| 214 | Ga0068863_100000106 | 3300005841 | Bacteria | 90344 |
| 215 | Ga0068863_100000617 | 3300005841 | Bacteria | 36076 |
| 216 | Ga0068863_100042301 | 3300005841 | Bacteria | 4329 |
| 217 | Ga0068863_100461697 | 3300005841 | Bacteria | 1247 |
| 218 | Ga0068863_101456917 | 3300005841 | Bacteria | 693 |
| 219 | Ga0068863_102100018 | 3300005841 | Bacteria | 575 |
| 220 | Ga0068863_102613081 | 3300005841 | Bacteria | 514 |
| 221 | Ga0068858_100000157 | 3300005842 | Bacteria | 72055 |
| 222 | Ga0068858_100002890 | 3300005842 | Bacteria | 17268 |
| 223 | Ga0068858_100009717 | 3300005842 | Bacteria | 9160 |
| 224 | Ga0068858_100112840 | 3300005842 | Bacteria | 2538 |
| 225 | Ga0068860_100000126 | 3300005843 | Bacteria | 122923 |
| 226 | Ga0068860_100000168 | 3300005843 | Bacteria | 107408 |
| 227 | Ga0068860_100000680 | 3300005843 | Bacteria | 39339 |
| 228 | Ga0068860_100589292 | 3300005843 | Bacteria | 1116 |
| 229 | Ga0068862_100000146 | 3300005844 | Bacteria | 80138 |
| 230 | Ga0068862_100000193 | 3300005844 | Bacteria | 67697 |
| 231 | Ga0068862_100004291 | 3300005844 | Bacteria | 12061 |
| 232 | Ga0068862_100004770 | 3300005844 | Bacteria | 11410 |
| 233 | Ga0068862_100377737 | 3300005844 | Bacteria | 1321 |
| 234 | Ga0068862_101521236 | 3300005844 | Bacteria | 675 |
| 235 | Ga0081455_10794787 | 3300005937 | Bacteria | 594 |
| 236 | Ga0081540_1105146 | 3300005983 | Bacteria | 1206 |
| 237 | Ga0075365_10119434 | 3300006038 | Bacteria | 1817 |
| 238 | Ga0075368_10000037 | 3300006042 | Bacteria | 31007 |
| 239 | Ga0075368_10002121 | 3300006042 | Bacteria | 6402 |
| 240 | Ga0075368_10011362 | 3300006042 | Bacteria | 3238 |
| 241 | Ga0075363_100008002 | 3300006048 | Bacteria | 4898 |
| 242 | Ga0075363_100059341 | 3300006048 | Bacteria | 2057 |
| 243 | Ga0075364_10077215 | 3300006051 | Bacteria | 2198 |
| 244 | Ga0075364_10088769 | 3300006051 | Bacteria | 2050 |
| 245 | Ga0075364_10136370 | 3300006051 | Bacteria | 1649 |
| 246 | Ga0075364_10532920 | 3300006051 | Bacteria | 803 |
| 247 | Ga0075364_10766835 | 3300006051 | Bacteria | 658 |
| 248 | Ga0075362_10002084 | 3300006177 | Bacteria | 6601 |
| 249 | Ga0075362_10468086 | 3300006177 | Bacteria | 642 |
| 250 | Ga0075367_10001103 | 3300006178 | Bacteria | 11168 |
| 251 | Ga0075367_10095170 | 3300006178 | Bacteria | 1816 |
| 252 | Ga0075369_10037806 | 3300006186 | Bacteria | 2057 |
| 253 | Ga0075366_10018983 | 3300006195 | Bacteria | 3974 |
| 254 | Ga0075366_10019187 | 3300006195 | Bacteria | 3953 |
| 255 | Ga0075366_10029450 | 3300006195 | Bacteria | 3225 |
| 256 | Ga0075366_10127430 | 3300006195 | Bacteria | 1535 |
| 257 | Ga0075366_10174805 | 3300006195 | Bacteria | 1304 |
| 258 | Ga0075366_10307203 | 3300006195 | Bacteria | 971 |
| 259 | Ga0097621_101442686 | 3300006237 | Bacteria | 652 |
| 260 | Ga0075370_10079240 | 3300006353 | Bacteria | 1887 |
| 261 | Ga0075370_10388191 | 3300006353 | Bacteria | 837 |
| 262 | Ga0075370_10473819 | 3300006353 | Bacteria | 754 |
| 263 | Ga0068871_100051306 | 3300006358 | Bacteria | 3340 |
| 264 | Ga0068871_101788012 | 3300006358 | Bacteria | 583 |
| 265 | Ga0068871_101997439 | 3300006358 | Bacteria | 552 |
| 266 | Ga0075430_100007359 | 3300006846 | Bacteria | 9301 |
| 267 | Ga0075430_100071070 | 3300006846 | Bacteria | 2920 |
| 268 | Ga0075430_100119423 | 3300006846 | Bacteria | 2197 |
| 269 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 270 | Ga0097620_100006370 | 3300006931 | Bacteria | 11972 |
| 271 | Ga0097620_100041543 | 3300006931 | Bacteria | 4619 |
| 272 | Ga0097620_100059776 | 3300006931 | Bacteria | 3840 |
| 273 | Ga0079104_1003382 | 3300006946 | Bacteria | 7483 |
| 274 | Ga0079104_1004641 | 3300006946 | Bacteria | 5775 |
| 275 | Ga0079104_1036606 | 3300006946 | Bacteria | 1176 |
| 276 | Ga0105251_10001266 | 3300009011 | Bacteria | 21849 |
| 277 | Ga0105251_10182084 | 3300009011 | Bacteria | 946 |
| 278 | Ga0105240_10004083 | 3300009093 | Bacteria | 22457 |
| 279 | Ga0105240_10333520 | 3300009093 | Bacteria | 1725 |
| 280 | Ga0105240_12750275 | 3300009093 | Bacteria | 507 |
| 281 | Ga0111539_13024116 | 3300009094 | Bacteria | 543 |
| 282 | Ga0105245_10001496 | 3300009098 | Bacteria | 21142 |
| 283 | Ga0105245_10007145 | 3300009098 | Bacteria | 9794 |
| 284 | Ga0105247_10001477 | 3300009101 | Bacteria | 16935 |
| 285 | Ga0105247_10056974 | 3300009101 | Bacteria | 2415 |
| 286 | Ga0105247_10230863 | 3300009101 | Bacteria | 1256 |
| 287 | Ga0105247_10402689 | 3300009101 | Bacteria | 975 |
| 288 | Ga0105247_10601036 | 3300009101 | Bacteria | 816 |
| 289 | Ga0105243_10000054 | 3300009148 | Bacteria | 136517 |
| 290 | Ga0105243_10101399 | 3300009148 | Bacteria | 2390 |
| 291 | Ga0105243_11109481 | 3300009148 | Bacteria | 800 |
| 292 | Ga0105241_10034303 | 3300009174 | Bacteria | 3812 |
| 293 | Ga0105241_10328204 | 3300009174 | Bacteria | 1321 |
| 294 | Ga0105241_10706302 | 3300009174 | Bacteria | 921 |
| 295 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 296 | Ga0105248_10004792 | 3300009177 | Bacteria | 14977 |
| 297 | Ga0105248_10007222 | 3300009177 | Bacteria | 12185 |
| 298 | Ga0105248_10025331 | 3300009177 | Bacteria | 6595 |
| 299 | Ga0105248_10137987 | 3300009177 | Bacteria | 2751 |
| 300 | Ga0105248_10229002 | 3300009177 | Bacteria | 2092 |
| 301 | Ga0105248_10398217 | 3300009177 | Bacteria | 1550 |
| 302 | Ga0105237_10083217 | 3300009545 | Bacteria | 3191 |
| 303 | Ga0105237_10317656 | 3300009545 | Bacteria | 1561 |
| 304 | Ga0105237_10791679 | 3300009545 | Bacteria | 955 |
| 305 | Ga0105237_11125569 | 3300009545 | Bacteria | 792 |
| 306 | Ga0105238_10010681 | 3300009551 | Bacteria | 9221 |
| 307 | Ga0105238_10010889 | 3300009551 | Bacteria | 9140 |
| 308 | Ga0105238_10302286 | 3300009551 | Bacteria | 1584 |
| 309 | Ga0105238_11008023 | 3300009551 | Bacteria | 854 |
| 310 | Ga0105238_12059342 | 3300009551 | Bacteria | 605 |
| 311 | Ga0105238_12255281 | 3300009551 | Bacteria | 579 |
| 312 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 313 | Ga0105249_10000094 | 3300009553 | Bacteria | 122611 |
| 314 | Ga0105249_10013736 | 3300009553 | Bacteria | 7150 |
| 315 | Ga0105249_10172798 | 3300009553 | Bacteria | 2097 |
| 316 | Ga0105239_10000031 | 3300010375 | Bacteria | 226947 |
| 317 | Ga0105239_10829219 | 3300010375 | Bacteria | 1060 |
| 318 | Ga0105239_10851605 | 3300010375 | Bacteria | 1045 |
| 319 | Ga0105239_11390536 | 3300010375 | Bacteria | 810 |
| 320 | Ga0105246_10022917 | 3300011119 | Bacteria | 4035 |
| 321 | Ga0105246_10357559 | 3300011119 | Bacteria | 1199 |
| 322 | Ga0157373_10054363 | 3300013100 | Bacteria | 2845 |
| 323 | Ga0157373_11169411 | 3300013100 | Bacteria | 579 |
| 324 | Ga0157371_10023965 | 3300013102 | Bacteria | 4459 |
| 325 | Ga0157371_10819125 | 3300013102 | Bacteria | 702 |
| 326 | Ga0157371_11117534 | 3300013102 | Bacteria | 605 |
| 327 | Ga0157370_10004235 | 3300013104 | Bacteria | 16599 |
| 328 | Ga0157370_10615244 | 3300013104 | Bacteria | 994 |
| 329 | Ga0157370_11540782 | 3300013104 | Bacteria | 597 |
| 330 | Ga0157370_11687144 | 3300013104 | Bacteria | 569 |
| 331 | Ga0157369_10020716 | 3300013105 | Bacteria | 7352 |
| 332 | Ga0157369_10444132 | 3300013105 | Bacteria | 1343 |
| 333 | Ga0157369_10645368 | 3300013105 | Bacteria | 1092 |
| 334 | Ga0157374_10007279 | 3300013296 | Bacteria | 9430 |
| 335 | Ga0157374_10292932 | 3300013296 | Bacteria | 1609 |
| 336 | Ga0157374_10326710 | 3300013296 | Bacteria | 1521 |
| 337 | Ga0157378_10020119 | 3300013297 | Bacteria | 5869 |
| 338 | Ga0157378_10051802 | 3300013297 | Bacteria | 3652 |
| 339 | Ga0157378_10513758 | 3300013297 | Bacteria | 1198 |
| 340 | Ga0163162_10151250 | 3300013306 | Bacteria | 2439 |
| 341 | Ga0163162_11005798 | 3300013306 | Bacteria | 943 |
| 342 | Ga0157372_10014562 | 3300013307 | Bacteria | 8412 |
| 343 | Ga0157372_10172216 | 3300013307 | Bacteria | 2505 |
| 344 | Ga0157372_10227903 | 3300013307 | Bacteria | 2160 |
| 345 | Ga0157372_10317339 | 3300013307 | Bacteria | 1814 |
| 346 | Ga0157372_10460050 | 3300013307 | Bacteria | 1483 |
| 347 | Ga0157372_10563651 | 3300013307 | Bacteria | 1328 |
| 348 | Ga0157375_10003825 | 3300013308 | Bacteria | 13053 |
| 349 | Ga0157375_10724994 | 3300013308 | Bacteria | 1147 |
| 350 | Ga0163163_10033187 | 3300014325 | Bacteria | 4991 |
| 351 | Ga0163163_10204153 | 3300014325 | Bacteria | 2025 |
| 352 | Ga0163163_11564186 | 3300014325 | Bacteria | 720 |
| 353 | Ga0157380_10000851 | 3300014326 | Bacteria | 19120 |
| 354 | Ga0157380_10037643 | 3300014326 | Bacteria | 3749 |
| 355 | Ga0157380_11039458 | 3300014326 | Bacteria | 855 |
| 356 | Ga0157377_11431264 | 3300014745 | Bacteria | 546 |
| 357 | Ga0157379_10005418 | 3300014968 | Bacteria | 10961 |
| 358 | Ga0157379_10659973 | 3300014968 | Bacteria | 980 |
| 359 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 360 | Ga0163161_10002507 | 3300017792 | Bacteria | 13096 |
| 361 | Ga0163161_10004251 | 3300017792 | Bacteria | 9991 |
| 362 | Ga0163161_10080010 | 3300017792 | Bacteria | 2404 |
| 363 | Ga0214542_1055259 | 3300021321 | Bacteria | 691 |
| 364 | Ga0214543_1000173 | 3300021327 | Bacteria | 93894 |
| 365 | Ga0213875_10038209 | 3300021388 | Bacteria | 2262 |
| 366 | Ga0209563_100066 | 3300025230 | Bacteria | 257382 |
| 367 | Ga0207427_109532 | 3300025231 | Bacteria | 1041 |
| 368 | Ga0209646_1023471 | 3300025246 | Bacteria | 874 |
| 369 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 370 | Ga0209026_1003041 | 3300025250 | Bacteria | 5766 |
| 371 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 372 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 373 | Ga0209148_1002311 | 3300025254 | Bacteria | 6820 |
| 374 | Ga0209759_1000062 | 3300025256 | Bacteria | 197996 |
| 375 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 376 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 377 | Ga0209233_1023172 | 3300025261 | Bacteria | 1576 |
| 378 | Ga0209565_1032271 | 3300025263 | Bacteria | 1014 |
| 379 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 380 | Ga0209455_1000972 | 3300025272 | Bacteria | 14510 |
| 381 | Ga0209455_1017111 | 3300025272 | Bacteria | 1535 |
| 382 | Ga0207673_1064185 | 3300025290 | Bacteria | 523 |
| 383 | Ga0209675_1000137 | 3300025291 | Bacteria | 98902 |
| 384 | Ga0209676_1000883 | 3300025292 | Bacteria | 38382 |
| 385 | Ga0209676_1001128 | 3300025292 | Bacteria | 29355 |
| 386 | Ga0209025_1020063 | 3300025294 | Bacteria | 3678 |
| 387 | Ga0209025_1032667 | 3300025294 | Bacteria | 2426 |
| 388 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 389 | Ga0209050_1000119 | 3300025298 | Bacteria | 200661 |
| 390 | Ga0209050_1000400 | 3300025298 | Bacteria | 81202 |
| 391 | Ga0209050_1001243 | 3300025298 | Bacteria | 29491 |
| 392 | Ga0209257_1000250 | 3300025304 | Bacteria | 124024 |
| 393 | Ga0209257_1000603 | 3300025304 | Bacteria | 59325 |
| 394 | Ga0209257_1002085 | 3300025304 | Bacteria | 21046 |
| 395 | Ga0209257_1022922 | 3300025304 | Bacteria | 2212 |
| 396 | Ga0209257_1033784 | 3300025304 | Bacteria | 1604 |
| 397 | Ga0207697_10085510 | 3300025315 | Bacteria | 1332 |
| 398 | Ga0207697_10549307 | 3300025315 | Bacteria | 508 |
| 399 | Ga0207656_10053455 | 3300025321 | Bacteria | 1753 |
| 400 | Ga0207656_10063181 | 3300025321 | Bacteria | 1629 |
| 401 | Ga0207656_10218080 | 3300025321 | Bacteria | 926 |
| 402 | Ga0207713_1010768 | 3300025735 | Bacteria | 5036 |
| 403 | Ga0207682_10000505 | 3300025893 | Bacteria | 17929 |
| 404 | Ga0207710_10001911 | 3300025900 | Bacteria | 9984 |
| 405 | Ga0207710_10324522 | 3300025900 | Bacteria | 781 |
| 406 | Ga0207688_10039994 | 3300025901 | Bacteria | 2605 |
| 407 | Ga0207688_10516620 | 3300025901 | Bacteria | 749 |
| 408 | Ga0207688_10951548 | 3300025901 | Bacteria | 543 |
| 409 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 410 | Ga0207680_11117599 | 3300025903 | Bacteria | 563 |
| 411 | Ga0207647_10000270 | 3300025904 | Bacteria | 42605 |
| 412 | Ga0207647_10001030 | 3300025904 | Bacteria | 21610 |
| 413 | Ga0207647_10002997 | 3300025904 | Bacteria | 12709 |
| 414 | Ga0207647_10008132 | 3300025904 | Bacteria | 7537 |
| 415 | Ga0207647_10018008 | 3300025904 | Bacteria | 4789 |
| 416 | Ga0207647_10103636 | 3300025904 | Bacteria | 1686 |
| 417 | Ga0207647_10173756 | 3300025904 | Bacteria | 1254 |
| 418 | Ga0207645_10003775 | 3300025907 | Bacteria | 11381 |
| 419 | Ga0207645_10014073 | 3300025907 | Bacteria | 5362 |
| 420 | Ga0207643_10321138 | 3300025908 | Bacteria | 967 |
| 421 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 422 | Ga0207705_10000316 | 3300025909 | Bacteria | 44059 |
| 423 | Ga0207705_10000340 | 3300025909 | Bacteria | 42251 |
| 424 | Ga0207705_10012135 | 3300025909 | Bacteria | 6226 |
| 425 | Ga0207705_10073287 | 3300025909 | Bacteria | 2484 |
| 426 | Ga0207705_10113946 | 3300025909 | Bacteria | 2000 |
| 427 | Ga0207705_10174715 | 3300025909 | Bacteria | 1618 |
| 428 | Ga0207705_11055103 | 3300025909 | Bacteria | 627 |
| 429 | Ga0207654_10008007 | 3300025911 | Bacteria | 5328 |
| 430 | Ga0207707_10445324 | 3300025912 | Bacteria | 1109 |
| 431 | Ga0207707_11354760 | 3300025912 | Bacteria | 569 |
| 432 | Ga0207695_10015209 | 3300025913 | Bacteria | 9074 |
| 433 | Ga0207695_10127995 | 3300025913 | Bacteria | 2499 |
| 434 | Ga0207695_11740006 | 3300025913 | Bacteria | 504 |
| 435 | Ga0207671_10034401 | 3300025914 | Bacteria | 3764 |
| 436 | Ga0207671_10052103 | 3300025914 | Bacteria | 3032 |
| 437 | Ga0207671_11182956 | 3300025914 | Bacteria | 599 |
| 438 | Ga0207657_10000832 | 3300025919 | Bacteria | 32589 |
| 439 | Ga0207657_10007820 | 3300025919 | Bacteria | 10910 |
| 440 | Ga0207657_10018806 | 3300025919 | Bacteria | 6579 |
| 441 | Ga0207657_10021901 | 3300025919 | Bacteria | 6002 |
| 442 | Ga0207657_10022634 | 3300025919 | Bacteria | 5875 |
| 443 | Ga0207657_10086509 | 3300025919 | Bacteria | 2623 |
| 444 | Ga0207657_10093489 | 3300025919 | Bacteria | 2504 |
| 445 | Ga0207657_10178902 | 3300025919 | Bacteria | 1715 |
| 446 | Ga0207649_10207523 | 3300025920 | Bacteria | 1388 |
| 447 | Ga0207649_10214589 | 3300025920 | Bacteria | 1367 |
| 448 | Ga0207649_11336078 | 3300025920 | Bacteria | 567 |
| 449 | Ga0207652_10538495 | 3300025921 | Bacteria | 1050 |
| 450 | Ga0207681_10000053 | 3300025923 | Bacteria | 110626 |
| 451 | Ga0207681_10002314 | 3300025923 | Bacteria | 12113 |
| 452 | Ga0207681_10008412 | 3300025923 | Bacteria | 6306 |
| 453 | Ga0207681_10011479 | 3300025923 | Bacteria | 5444 |
| 454 | Ga0207681_10100199 | 3300025923 | Bacteria | 2088 |
| 455 | Ga0207681_10785634 | 3300025923 | Bacteria | 795 |
| 456 | Ga0207681_11389497 | 3300025923 | Bacteria | 589 |
| 457 | Ga0207694_10016121 | 3300025924 | Bacteria | 5639 |
| 458 | Ga0207694_10176560 | 3300025924 | Bacteria | 1731 |
| 459 | Ga0207694_10326340 | 3300025924 | Bacteria | 1267 |
| 460 | Ga0207694_10440264 | 3300025924 | Bacteria | 1087 |
| 461 | Ga0207694_11204932 | 3300025924 | Bacteria | 641 |
| 462 | Ga0207650_10037516 | 3300025925 | Bacteria | 3532 |
| 463 | Ga0207650_10068113 | 3300025925 | Bacteria | 2672 |
| 464 | Ga0207650_10207795 | 3300025925 | Bacteria | 1571 |
| 465 | Ga0207650_10645301 | 3300025925 | Bacteria | 892 |
| 466 | Ga0207650_10893881 | 3300025925 | Bacteria | 754 |
| 467 | Ga0207659_10004630 | 3300025926 | Bacteria | 8327 |
| 468 | Ga0207659_10024906 | 3300025926 | Bacteria | 4016 |
| 469 | Ga0207687_10001694 | 3300025927 | Bacteria | 15197 |
| 470 | Ga0207687_10005171 | 3300025927 | Bacteria | 8651 |
| 471 | Ga0207664_10110773 | 3300025929 | Bacteria | 2283 |
| 472 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 473 | Ga0207644_10000242 | 3300025931 | Bacteria | 37472 |
| 474 | Ga0207644_10000964 | 3300025931 | Bacteria | 18357 |
| 475 | Ga0207644_10009287 | 3300025931 | Bacteria | 6454 |
| 476 | Ga0207644_10115903 | 3300025931 | Bacteria | 2032 |
| 477 | Ga0207644_10149378 | 3300025931 | Bacteria | 1807 |
| 478 | Ga0207644_10424638 | 3300025931 | Bacteria | 1089 |
| 479 | Ga0207644_11680972 | 3300025931 | Bacteria | 532 |
| 480 | Ga0207690_10006391 | 3300025932 | Bacteria | 6985 |
| 481 | Ga0207690_10110934 | 3300025932 | Bacteria | 1976 |
| 482 | Ga0207690_10328563 | 3300025932 | Bacteria | 1204 |
| 483 | Ga0207690_10453815 | 3300025932 | Bacteria | 1031 |
| 484 | Ga0207690_10543304 | 3300025932 | Bacteria | 944 |
| 485 | Ga0207690_11316159 | 3300025932 | Bacteria | 604 |
| 486 | Ga0207706_10014101 | 3300025933 | Bacteria | 7247 |
| 487 | Ga0207706_10045638 | 3300025933 | Bacteria | 3882 |
| 488 | Ga0207706_10053172 | 3300025933 | Bacteria | 3575 |
| 489 | Ga0207706_10060688 | 3300025933 | Bacteria | 3330 |
| 490 | Ga0207706_10154593 | 3300025933 | Bacteria | 2018 |
| 491 | Ga0207706_10156031 | 3300025933 | Bacteria | 2007 |
| 492 | Ga0207706_10672610 | 3300025933 | Bacteria | 886 |
| 493 | Ga0207706_10674918 | 3300025933 | Bacteria | 884 |
| 494 | Ga0207686_10000598 | 3300025934 | Bacteria | 22543 |
| 495 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 496 | Ga0207709_10122482 | 3300025935 | Bacteria | 1758 |
| 497 | Ga0207670_10009646 | 3300025936 | Bacteria | 5517 |
| 498 | Ga0207670_10193618 | 3300025936 | Bacteria | 1540 |
| 499 | Ga0207669_10009567 | 3300025937 | Bacteria | 4626 |
| 500 | Ga0207669_10169779 | 3300025937 | Bacteria | 1551 |
| 501 | Ga0207669_10224758 | 3300025937 | Bacteria | 1380 |
| 502 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 503 | Ga0207704_11032711 | 3300025938 | Bacteria | 696 |
| 504 | Ga0207691_10331253 | 3300025940 | Bacteria | 1304 |
| 505 | Ga0207691_10477160 | 3300025940 | Bacteria | 1060 |
| 506 | Ga0207691_10533400 | 3300025940 | Bacteria | 996 |
| 507 | Ga0207711_10001087 | 3300025941 | Bacteria | 25938 |
| 508 | Ga0207711_10006515 | 3300025941 | Bacteria | 9832 |
| 509 | Ga0207711_10022035 | 3300025941 | Bacteria | 5324 |
| 510 | Ga0207711_10542889 | 3300025941 | Bacteria | 1084 |
| 511 | Ga0207711_11360092 | 3300025941 | Bacteria | 652 |
| 512 | Ga0207711_11405996 | 3300025941 | Bacteria | 640 |
| 513 | Ga0207689_10001110 | 3300025942 | Bacteria | 25930 |
| 514 | Ga0207689_10181463 | 3300025942 | Bacteria | 1736 |
| 515 | Ga0207689_10867355 | 3300025942 | Bacteria | 762 |
| 516 | Ga0207661_10390443 | 3300025944 | Bacteria | 1261 |
| 517 | Ga0207679_10159802 | 3300025945 | Bacteria | 1844 |
| 518 | Ga0207679_10391622 | 3300025945 | Bacteria | 1220 |
| 519 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 520 | Ga0207667_10031919 | 3300025949 | Bacteria | 5680 |
| 521 | Ga0207667_10351219 | 3300025949 | Bacteria | 1504 |
| 522 | Ga0207667_10512940 | 3300025949 | Bacteria | 1215 |
| 523 | Ga0207667_10565217 | 3300025949 | Bacteria | 1149 |
| 524 | Ga0207667_10884162 | 3300025949 | Bacteria | 886 |
| 525 | Ga0207667_11360958 | 3300025949 | Bacteria | 684 |
| 526 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 527 | Ga0207651_10184309 | 3300025960 | Bacteria | 1659 |
| 528 | Ga0207651_10390156 | 3300025960 | Bacteria | 1182 |
| 529 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 530 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 531 | Ga0207712_10039051 | 3300025961 | Bacteria | 3250 |
| 532 | Ga0207712_10132626 | 3300025961 | Bacteria | 1900 |
| 533 | Ga0207668_10004132 | 3300025972 | Bacteria | 8518 |
| 534 | Ga0207668_10034891 | 3300025972 | Bacteria | 3345 |
| 535 | Ga0207668_10056180 | 3300025972 | Bacteria | 2740 |
| 536 | Ga0207668_10103299 | 3300025972 | Bacteria | 2122 |
| 537 | Ga0207668_10170441 | 3300025972 | Bacteria | 1706 |
| 538 | Ga0207668_10208760 | 3300025972 | Bacteria | 1561 |
| 539 | Ga0207668_10499797 | 3300025972 | Bacteria | 1046 |
| 540 | Ga0207640_10000436 | 3300025981 | Bacteria | 25464 |
| 541 | Ga0207640_10007861 | 3300025981 | Bacteria | 5883 |
| 542 | Ga0207640_10041447 | 3300025981 | Bacteria | 2928 |
| 543 | Ga0207640_10070511 | 3300025981 | Bacteria | 2351 |
| 544 | Ga0207640_10071071 | 3300025981 | Bacteria | 2343 |
| 545 | Ga0207640_10274695 | 3300025981 | Bacteria | 1320 |
| 546 | Ga0207640_10284936 | 3300025981 | Bacteria | 1300 |
| 547 | Ga0207640_10627893 | 3300025981 | Bacteria | 913 |
| 548 | Ga0207658_10000865 | 3300025986 | Bacteria | 25306 |
| 549 | Ga0207658_10007156 | 3300025986 | Bacteria | 7604 |
| 550 | Ga0207658_10016492 | 3300025986 | Bacteria | 5080 |
| 551 | Ga0207658_10183814 | 3300025986 | Bacteria | 1732 |
| 552 | Ga0207677_10001245 | 3300026023 | Bacteria | 13747 |
| 553 | Ga0207677_11538829 | 3300026023 | Bacteria | 615 |
| 554 | Ga0207703_10000095 | 3300026035 | Bacteria | 104227 |
| 555 | Ga0207703_10005905 | 3300026035 | Bacteria | 9813 |
| 556 | Ga0207639_10006866 | 3300026041 | Bacteria | 7754 |
| 557 | Ga0207639_10277737 | 3300026041 | Bacteria | 1472 |
| 558 | Ga0207639_10310222 | 3300026041 | Bacteria | 1397 |
| 559 | Ga0207639_10369132 | 3300026041 | Bacteria | 1286 |
| 560 | Ga0207639_10971264 | 3300026041 | Bacteria | 795 |
| 561 | Ga0207639_11171880 | 3300026041 | Bacteria | 721 |
| 562 | Ga0207639_11669602 | 3300026041 | Bacteria | 597 |
| 563 | Ga0207639_11782712 | 3300026041 | Bacteria | 576 |
| 564 | Ga0207678_10001958 | 3300026067 | Bacteria | 18768 |
| 565 | Ga0207678_10012101 | 3300026067 | Bacteria | 7576 |
| 566 | Ga0207678_10314458 | 3300026067 | Bacteria | 1347 |
| 567 | Ga0207678_10567166 | 3300026067 | Bacteria | 994 |
| 568 | Ga0207702_10005556 | 3300026078 | Bacteria | 11009 |
| 569 | Ga0207702_10011049 | 3300026078 | Bacteria | 7536 |
| 570 | Ga0207702_10118420 | 3300026078 | Bacteria | 2366 |
| 571 | Ga0207641_10000100 | 3300026088 | Bacteria | 122664 |
| 572 | Ga0207641_10000270 | 3300026088 | Bacteria | 65856 |
| 573 | Ga0207641_10000481 | 3300026088 | Bacteria | 45053 |
| 574 | Ga0207641_10067161 | 3300026088 | Bacteria | 3071 |
| 575 | Ga0207641_11828068 | 3300026088 | Bacteria | 609 |
| 576 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 577 | Ga0207648_10373278 | 3300026089 | Bacteria | 1289 |
| 578 | Ga0207648_10730310 | 3300026089 | Bacteria | 919 |
| 579 | Ga0207676_10004649 | 3300026095 | Bacteria | 9720 |
| 580 | Ga0207676_10010123 | 3300026095 | Bacteria | 6710 |
| 581 | Ga0207676_10876043 | 3300026095 | Bacteria | 879 |
| 582 | Ga0207674_10020635 | 3300026116 | Bacteria | 7114 |
| 583 | Ga0207674_10057517 | 3300026116 | Bacteria | 3942 |
| 584 | Ga0207674_10260328 | 3300026116 | Bacteria | 1682 |
| 585 | Ga0207674_10745865 | 3300026116 | Bacteria | 945 |
| 586 | Ga0207674_11603622 | 3300026116 | Bacteria | 619 |
| 587 | Ga0207675_100000739 | 3300026118 | Bacteria | 32427 |
| 588 | Ga0207683_10181595 | 3300026121 | Bacteria | 1908 |
| 589 | Ga0207683_10318272 | 3300026121 | Bacteria | 1425 |
| 590 | Ga0207683_10497744 | 3300026121 | Bacteria | 1125 |
| 591 | Ga0207698_10000858 | 3300026142 | Bacteria | 17656 |
| 592 | Ga0207698_10281237 | 3300026142 | Bacteria | 1539 |
| 593 | Ga0207698_10396540 | 3300026142 | Bacteria | 1317 |
| 594 | Ga0209281_1023255 | 3300027111 | Bacteria | 1177 |
| 595 | Ga0209813_10000030 | 3300027866 | Bacteria | 65385 |
| 596 | Ga0209974_10007025 | 3300027876 | Bacteria | 3897 |
| 597 | Ga0209974_10088425 | 3300027876 | Bacteria | 1072 |
| 598 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 599 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 600 | Ga0268266_10000198 | 3300028379 | Bacteria | 104891 |
| 601 | Ga0268266_10004412 | 3300028379 | Bacteria | 13482 |
| 602 | Ga0268266_10086743 | 3300028379 | Bacteria | 2737 |
| 603 | Ga0268266_10143199 | 3300028379 | Bacteria | 2147 |
| 604 | Ga0268266_10758820 | 3300028379 | Bacteria | 936 |
| 605 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 606 | Ga0268265_10000128 | 3300028380 | Bacteria | 96118 |
| 607 | Ga0268265_10011310 | 3300028380 | Bacteria | 6034 |
| 608 | Ga0268265_10016140 | 3300028380 | Bacteria | 5126 |
| 609 | Ga0268265_10965870 | 3300028380 | Bacteria | 840 |
| 610 | Ga0268265_11564333 | 3300028380 | Bacteria | 664 |
| 611 | Ga0268265_12035442 | 3300028380 | Bacteria | 581 |
| 612 | Ga0268265_12307515 | 3300028380 | Bacteria | 545 |
| 613 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 614 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 615 | Ga0268264_10000304 | 3300028381 | Bacteria | 79130 |
| 616 | Ga0268264_10003482 | 3300028381 | Bacteria | 13572 |
| 617 | Ga0268264_11012582 | 3300028381 | Bacteria | 837 |
| 618 | Ga0307517_10038523 | 3300028786 | Bacteria | 5287 |
| 619 | Ga0307515_10501817 | 3300028794 | Bacteria | 824 |
| 620 | Ga0265327_10041088 | 3300031251 | Bacteria | 2496 |
| 621 | Ga0307513_10126993 | 3300031456 | Bacteria | 2503 |
| 622 | Ga0307513_10241316 | 3300031456 | Bacteria | 1611 |
| 623 | Ga0307408_100053681 | 3300031548 | Bacteria | 2911 |
| 624 | Ga0307508_10000202 | 3300031616 | Bacteria | 71789 |
| 625 | Ga0316579_10016513 | 3300031691 | Bacteria | 3226 |
| 626 | Ga0316579_10585838 | 3300031691 | Bacteria | 540 |
| 627 | Ga0316576_10254501 | 3300031727 | Bacteria | 1318 |
| 628 | Ga0316576_10316253 | 3300031727 | Bacteria | 1165 |
| 629 | Ga0316578_10311354 | 3300031728 | Bacteria | 941 |
| 630 | Ga0316578_10371171 | 3300031728 | Bacteria | 850 |
| 631 | Ga0307405_10036688 | 3300031731 | Bacteria | 2939 |
| 632 | Ga0307405_10086074 | 3300031731 | Bacteria | 2068 |
| 633 | Ga0307405_10334494 | 3300031731 | Bacteria | 1162 |
| 634 | Ga0307413_10027149 | 3300031824 | Bacteria | 3167 |
| 635 | Ga0307413_10063121 | 3300031824 | Bacteria | 2296 |
| 636 | Ga0307413_10093923 | 3300031824 | Bacteria | 1962 |
| 637 | Ga0307413_10162076 | 3300031824 | Bacteria | 1572 |
| 638 | Ga0307413_10206976 | 3300031824 | Bacteria | 1421 |
| 639 | Ga0307413_10762278 | 3300031824 | Bacteria | 810 |
| 640 | Ga0307413_10780878 | 3300031824 | Bacteria | 801 |
| 641 | Ga0307413_12008932 | 3300031824 | Bacteria | 521 |
| 642 | Ga0307410_10037654 | 3300031852 | Bacteria | 3161 |
| 643 | Ga0307410_10112127 | 3300031852 | Bacteria | 1975 |
| 644 | Ga0307406_10429126 | 3300031901 | Bacteria | 1055 |
| 645 | Ga0307406_10465841 | 3300031901 | Bacteria | 1017 |
| 646 | Ga0307406_10956003 | 3300031901 | Bacteria | 732 |
| 647 | Ga0307406_11646359 | 3300031901 | Bacteria | 568 |
| 648 | Ga0307407_10011706 | 3300031903 | Bacteria | 4189 |
| 649 | Ga0307412_10003817 | 3300031911 | Bacteria | 8379 |
| 650 | Ga0307412_10020442 | 3300031911 | Bacteria | 4028 |
| 651 | Ga0307412_10050601 | 3300031911 | Bacteria | 2742 |
| 652 | Ga0307412_10133298 | 3300031911 | Bacteria | 1808 |
| 653 | Ga0307412_10173777 | 3300031911 | Bacteria | 1613 |
| 654 | Ga0307412_10431618 | 3300031911 | Bacteria | 1080 |
| 655 | Ga0307412_10583874 | 3300031911 | Bacteria | 944 |
| 656 | Ga0307409_100033984 | 3300031995 | Bacteria | 3718 |
| 657 | Ga0307409_100130733 | 3300031995 | Bacteria | 2145 |
| 658 | Ga0307409_100518256 | 3300031995 | Bacteria | 1164 |
| 659 | Ga0307409_100865419 | 3300031995 | Bacteria | 915 |
| 660 | Ga0307416_100080945 | 3300032002 | Bacteria | 2744 |
| 661 | Ga0307416_100122699 | 3300032002 | Bacteria | 2320 |
| 662 | Ga0307416_100184641 | 3300032002 | Bacteria | 1959 |
| 663 | Ga0307416_100418141 | 3300032002 | Bacteria | 1384 |
| 664 | Ga0307416_100926409 | 3300032002 | Bacteria | 972 |
| 665 | Ga0307414_10001433 | 3300032004 | Bacteria | 12381 |
| 666 | Ga0307414_10002743 | 3300032004 | Bacteria | 9268 |
| 667 | Ga0307414_10158436 | 3300032004 | Bacteria | 1795 |
| 668 | Ga0307414_10328561 | 3300032004 | Bacteria | 1304 |
| 669 | Ga0307414_10383929 | 3300032004 | Bacteria | 1215 |
| 670 | Ga0307414_10598436 | 3300032004 | Bacteria | 988 |
| 671 | Ga0307414_10660497 | 3300032004 | Bacteria | 943 |
| 672 | Ga0307414_10663567 | 3300032004 | Bacteria | 941 |
| 673 | Ga0307414_10668979 | 3300032004 | Bacteria | 937 |
| 674 | Ga0307411_10000664 | 3300032005 | Bacteria | 12562 |
| 675 | Ga0307411_10076688 | 3300032005 | Bacteria | 2286 |
| 676 | Ga0307411_10082381 | 3300032005 | Bacteria | 2219 |
| 677 | Ga0307411_10246093 | 3300032005 | Bacteria | 1403 |
| 678 | Ga0307411_10249435 | 3300032005 | Bacteria | 1395 |
| 679 | Ga0307411_10321182 | 3300032005 | Bacteria | 1250 |
| 680 | Ga0307411_10592319 | 3300032005 | Bacteria | 952 |
| 681 | Ga0307411_10754935 | 3300032005 | Bacteria | 852 |
| 682 | Ga0307411_10913804 | 3300032005 | Bacteria | 781 |
| 683 | Ga0307411_11213934 | 3300032005 | Bacteria | 684 |
| 684 | Ga0307415_100224771 | 3300032126 | Bacteria | 1508 |
| 685 | Ga0307415_100736632 | 3300032126 | Bacteria | 893 |
| 686 | Ga0316583_10002111 | 3300032133 | Bacteria | 6834 |
| 687 | Ga0373932_0086904 | 3300035112 | Bacteria | 997 |
| 688 | Ga0316582_0004595 | 3300036647 | Bacteria | 6994 |
| 689 | Ga0316584_0089964 | 3300036712 | Bacteria | 2298 |
| 690 | Ga0316584_0250934 | 3300036712 | Bacteria | 1293 |
| 691 | Ga0395899_0001026 | 3300037312 | Bacteria | 25486 |
| 692 | Ga0395899_0023762 | 3300037312 | Bacteria | 4639 |
| 693 | Ga0395900_0014297 | 3300037418 | Bacteria | 8102 |
| 694 | Ga0395900_0106340 | 3300037418 | Bacteria | 2882 |
| 695 | Ga0395900_0175983 | 3300037418 | Bacteria | 2176 |
| 696 | Ga0395900_0195584 | 3300037418 | Bacteria | 2049 |
| 697 | Ga0395900_0310310 | 3300037418 | Bacteria | 1561 |
| 698 | Ga0395900_0332507 | 3300037418 | Bacteria | 1497 |
| 699 | Ga0395898_0311781 | 3300037466 | Bacteria | 1501 |
| 700 | Ga0395905_0012607 | 3300037471 | Bacteria | 8133 |
| 701 | Ga0395905_0096692 | 3300037471 | Bacteria | 2772 |
| 702 | Ga0395905_0163569 | 3300037471 | Bacteria | 2091 |
| 703 | Ga0395905_0639074 | 3300037471 | Bacteria | 966 |
| 704 | Ga0395905_0888072 | 3300037471 | Bacteria | 794 |
| 705 | Ga0316581_0025968 | 3300037588 | Bacteria | 1745 |
| 706 | Ga0436364_0561934 | 3300037853 | Bacteria | 21949 |
| 707 | Ga0436364_1421612 | 3300037853 | Bacteria | 566 |
| 708 | Ga0395901_0000375 | 3300038443 | Bacteria | 53750 |
| 709 | Ga0395901_0058847 | 3300038443 | Bacteria | 3997 |
| 710 | Ga0395901_0144012 | 3300038443 | Bacteria | 2505 |
| 711 | Ga0436365_0195281 | 3300039437 | Bacteria | 1750 |
| 712 | Ga0436361_0290751 | 3300039447 | Bacteria | 1883 |
| 713 | Ga0436361_0936593 | 3300039447 | Bacteria | 36363 |
| 714 | Ga0451791_1642827 | 3300041451 | Bacteria | 521 |
| 715 | Ga0451797_1238947 | 3300041453 | Bacteria | 627 |
| 716 | Ga0451795_0595987 | 3300041456 | Bacteria | 876 |
| 717 | Ga0451800_0216242 | 3300041459 | Bacteria | 659 |
| 718 | Ga0451800_1145456 | 3300041459 | Bacteria | 595 |
| 719 | Ga0451802_1293139 | 3300041460 | Bacteria | 559 |
| 720 | Ga0451833_0320310 | 3300041491 | Bacteria | 562 |
| 721 | Ga0451833_0562953 | 3300041491 | Bacteria | 513 |
| 722 | Ga0451849_1104376 | 3300041505 | Bacteria | 525 |
| 723 | Ga0451853_0443311 | 3300041512 | Bacteria | 872 |
| 724 | Ga0451853_2107157 | 3300041512 | Bacteria | 1012 |
| 725 | Ga0439448_0007619 | 3300042005 | Bacteria | 3144 |
| 726 | Ga0439448_0008821 | 3300042005 | Bacteria | 2958 |
| 727 | Ga0439448_0012720 | 3300042005 | Bacteria | 2523 |
| 728 | Ga0439432_109721 | 3300042006 | Bacteria | 822 |
| 729 | Ga0439455_0001877 | 3300042012 | Bacteria | 3674 |
| 730 | Ga0439455_0026008 | 3300042012 | Bacteria | 1426 |
| 731 | Ga0450914_016694 | 3300042118 | Bacteria | 781 |
| 732 | Ga0439458_0000234 | 3300042157 | Bacteria | 13258 |
| 733 | Ga0466972_0007096 | 3300044658 | Bacteria | 5625 |
| 734 | Ga0466972_0211013 | 3300044658 | Bacteria | 909 |
| 735 | Ga0466961_0145760 | 3300044693 | Bacteria | 1480 |
| 736 | Ga0466961_0754341 | 3300044693 | Bacteria | 582 |
| 737 | Ga0466963_0045146 | 3300044694 | Bacteria | 2902 |
| 738 | Ga0466964_0001667 | 3300044706 | Bacteria | 7688 |
| 739 | Ga0466964_0048332 | 3300044706 | Bacteria | 1739 |
| 740 | Ga0466971_0003839 | 3300044719 | Bacteria | 6438 |
| 741 | Ga0466968_0152135 | 3300044735 | Bacteria | 1064 |
| 742 | Ga0466970_0013581 | 3300044765 | Bacteria | 4177 |
| 743 | Ga0466970_0071665 | 3300044765 | Bacteria | 1864 |
| 744 | Ga0466957_0011181 | 3300044842 | Bacteria | 5170 |
| 745 | Ga0466957_0134065 | 3300044842 | Bacteria | 1590 |
| 746 | Ga0466957_0228127 | 3300044842 | Bacteria | 1232 |
| 747 | Ga0466960_0018280 | 3300044901 | Bacteria | 3069 |
| 748 | Ga0466959_0007287 | 3300045049 | Bacteria | 7751 |
| 749 | Ga0451576_0000393 | 3300045051 | Bacteria | 101814 |
| 750 | Ga0451576_1044552 | 3300045051 | Bacteria | 856 |
| 751 | Ga0466958_0017879 | 3300045836 | Bacteria | 4107 |
| 752 | Ga0466958_0099321 | 3300045836 | Bacteria | 1808 |
| 753 | Ga0466967_0045654 | 3300045976 | Bacteria | 3808 |
| 754 | Ga0466967_0048001 | 3300045976 | Bacteria | 3726 |
| 755 | Ga0495638_0000414 | 3300046460 | Bacteria | 51945 |
| 756 | Ga0495638_0078887 | 3300046460 | Bacteria | 2003 |
| 757 | Ga0495638_0582062 | 3300046460 | Bacteria | 552 |
| 758 | Ga0495650_0000172 | 3300046471 | Bacteria | 142776 |
| 759 | Ga0495650_0039879 | 3300046471 | Bacteria | 2022 |
| 760 | Ga0495650_0205230 | 3300046471 | Bacteria | 683 |
| 761 | Ga0495584_0241587 | 3300046491 | Bacteria | 918 |
| 762 | Ga0495585_0005045 | 3300046492 | Bacteria | 8416 |
| 763 | Ga0495585_0085973 | 3300046492 | Bacteria | 1699 |
| 764 | Ga0495596_0000203 | 3300046500 | Bacteria | 40619 |
| 765 | Ga0495596_0021646 | 3300046500 | Bacteria | 2622 |
| 766 | Ga0495583_0000286 | 3300046506 | Bacteria | 80417 |
| 767 | Ga0495583_0001640 | 3300046506 | Bacteria | 21794 |
| 768 | Ga0495583_0005542 | 3300046506 | Bacteria | 8534 |
| 769 | Ga0495583_0011178 | 3300046506 | Bacteria | 5172 |
| 770 | Ga0495606_0000963 | 3300046507 | Bacteria | 42128 |
| 771 | Ga0495606_0001229 | 3300046507 | Bacteria | 35865 |
| 772 | Ga0495606_0036857 | 3300046507 | Bacteria | 3327 |
| 773 | Ga0495606_0039480 | 3300046507 | Bacteria | 3180 |
| 774 | Ga0495606_0065858 | 3300046507 | Bacteria | 2300 |
| 775 | Ga0495606_0070487 | 3300046507 | Bacteria | 2204 |
| 776 | Ga0495610_0006251 | 3300046512 | Bacteria | 8254 |
| 777 | Ga0495610_0207928 | 3300046512 | Bacteria | 797 |
| 778 | Ga0495616_0144257 | 3300046513 | Bacteria | 1081 |
| 779 | Ga0495631_0027448 | 3300046518 | Bacteria | 2605 |
| 780 | Ga0495637_0218112 | 3300046520 | Bacteria | 695 |
| 781 | Ga0495643_0000786 | 3300046522 | Bacteria | 35198 |
| 782 | Ga0495643_0002044 | 3300046522 | Bacteria | 16765 |
| 783 | Ga0495643_0053480 | 3300046522 | Bacteria | 2164 |
| 784 | Ga0495643_0079391 | 3300046522 | Bacteria | 1711 |
| 785 | Ga0495643_0167446 | 3300046522 | Bacteria | 1077 |
| 786 | Ga0495648_0000782 | 3300046524 | Bacteria | 33902 |
| 787 | Ga0495648_0074519 | 3300046524 | Bacteria | 1955 |
| 788 | Ga0495648_0297664 | 3300046524 | Bacteria | 757 |
| 789 | Ga0495663_0006090 | 3300046525 | Bacteria | 3336 |
| 790 | Ga0495663_0027062 | 3300046525 | Bacteria | 1681 |
| 791 | Ga0495621_0067972 | 3300046539 | Bacteria | 1307 |
| 792 | Ga0495633_0005249 | 3300046558 | Bacteria | 7988 |
| 793 | Ga0495668_0000080 | 3300046616 | Bacteria | 157259 |
| 794 | Ga0495668_0030463 | 3300046616 | Bacteria | 3046 |
| 795 | Ga0495668_0417067 | 3300046616 | Bacteria | 738 |
| 796 | Ga0495611_0024359 | 3300046648 | Bacteria | 2632 |
| 797 | Ga0495625_0000169 | 3300046660 | Bacteria | 102287 |
| 798 | Ga0495625_0000492 | 3300046660 | Bacteria | 59211 |
| 799 | Ga0495625_0000819 | 3300046660 | Bacteria | 42876 |
| 800 | Ga0495625_0093957 | 3300046660 | Bacteria | 2070 |
| 801 | Ga0495625_0311254 | 3300046660 | Bacteria | 1005 |
| 802 | Ga0495625_0666275 | 3300046660 | Bacteria | 618 |
| 803 | Ga0495661_0089686 | 3300046665 | Bacteria | 1752 |
| 804 | Ga0495661_0109316 | 3300046665 | Bacteria | 1543 |
| 805 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 806 | Ga0495670_0000056 | 3300046691 | Bacteria | 55007 |
| 807 | Ga0495670_0014237 | 3300046691 | Bacteria | 3914 |
| 808 | Ga0495649_0021504 | 3300046694 | Bacteria | 3613 |
| 809 | Ga0495600_0051505 | 3300046809 | Bacteria | 2687 |
| 810 | Ga0495660_0108292 | 3300046810 | Bacteria | 1421 |
| 811 | Ga0495660_0115295 | 3300046810 | Bacteria | 1366 |
| 812 | Ga0495683_0006885 | 3300047323 | Bacteria | 6180 |
| 813 | Ga0495687_000684 | 3300047443 | Bacteria | 38434 |
| 814 | Ga0495687_002397 | 3300047443 | Bacteria | 15119 |
| 815 | Ga0495687_106813 | 3300047443 | Bacteria | 1038 |
| 816 | Ga0495673_0005960 | 3300047469 | Bacteria | 7258 |
| 817 | Ga0495673_0007812 | 3300047469 | Bacteria | 6092 |
| 818 | Ga0495681_0018299 | 3300047470 | Bacteria | 3863 |
| 819 | Ga0495681_0026759 | 3300047470 | Bacteria | 2995 |
| 820 | Ga0495681_0141217 | 3300047470 | Bacteria | 1017 |
| 821 | Ga0495686_0000701 | 3300047472 | Bacteria | 45238 |
| 822 | Ga0495686_0003079 | 3300047472 | Bacteria | 14759 |
| 823 | Ga0495686_0003843 | 3300047472 | Bacteria | 12715 |
| 824 | Ga0495686_0194869 | 3300047472 | Bacteria | 1166 |
| 825 | Ga0495686_0375312 | 3300047472 | Bacteria | 768 |
| 826 | Ga0495626_0000995 | 3300048091 | Bacteria | 24359 |
| 827 | Ga0496100_0114388 | 3300048903 | Bacteria | 1879 |
| 828 | Ga0496100_0912233 | 3300048903 | Bacteria | 690 |
| 829 | Ga0496101_0042986 | 3300048904 | Bacteria | 3227 |
| 830 | Ga0496101_0240313 | 3300048904 | Bacteria | 1409 |
| 831 | Ga0496101_0344814 | 3300048904 | Bacteria | 1170 |
| 832 | Ga0496102_0000213 | 3300048905 | Bacteria | 76751 |
| 833 | Ga0496102_0002236 | 3300048905 | Bacteria | 16607 |
| 834 | Ga0496102_0013917 | 3300048905 | Bacteria | 6981 |
| 835 | Ga0496103_0001102 | 3300048906 | Bacteria | 18819 |
| 836 | Ga0496103_0001866 | 3300048906 | Bacteria | 13692 |
| 837 | Ga0496103_0281318 | 3300048906 | Bacteria | 1070 |
| 838 | Ga0496104_0005683 | 3300048907 | Bacteria | 10918 |
| 839 | Ga0496104_0120878 | 3300048907 | Bacteria | 2515 |
| 840 | Ga0496104_0122322 | 3300048907 | Bacteria | 2498 |
| 841 | Ga0496104_1434224 | 3300048907 | Bacteria | 593 |
| 842 | Ga0496105_0000836 | 3300048908 | Bacteria | 20954 |
| 843 | Ga0496105_0013563 | 3300048908 | Bacteria | 6473 |
| 844 | Ga0496105_0032491 | 3300048908 | Bacteria | 4282 |
| 845 | Ga0496105_0076967 | 3300048908 | Bacteria | 2755 |
| 846 | Ga0496105_0253785 | 3300048908 | Bacteria | 1424 |
| 847 | Ga0496106_0010856 | 3300048909 | Bacteria | 6730 |
| 848 | Ga0496106_0073490 | 3300048909 | Bacteria | 2616 |
| 849 | Ga0496107_0280736 | 3300048910 | Bacteria | 1240 |
| 850 | Ga0496107_0593979 | 3300048910 | Bacteria | 818 |
| 851 | Ga0496108_1337030 | 3300048911 | Bacteria | 601 |
| 852 | Ga0496109_0120596 | 3300048912 | Bacteria | 2443 |
| 853 | Ga0496109_0697809 | 3300048912 | Bacteria | 952 |
| 854 | Ga0496109_1211603 | 3300048912 | Bacteria | 691 |
| 855 | Ga0496110_0105763 | 3300048913 | Bacteria | 2525 |
| 856 | Ga0496110_0182521 | 3300048913 | Bacteria | 1905 |
| 857 | Ga0496110_0486634 | 3300048913 | Bacteria | 1124 |
| 858 | Ga0496110_1468262 | 3300048913 | Bacteria | 592 |
| 859 | Ga0496111_0019440 | 3300048914 | Bacteria | 4718 |
| 860 | Ga0496111_0024337 | 3300048914 | Bacteria | 4262 |
| 861 | Ga0496111_0037996 | 3300048914 | Bacteria | 3448 |
| 862 | Ga0496111_0076062 | 3300048914 | Bacteria | 2446 |
| 863 | Ga0496111_0322926 | 3300048914 | Bacteria | 1143 |
| 864 | Ga0496113_0058959 | 3300048916 | Bacteria | 2890 |
| 865 | Ga0496113_0400702 | 3300048916 | Bacteria | 1102 |
| 866 | Ga0496114_0006960 | 3300048917 | Bacteria | 8910 |
| 867 | Ga0496115_0000030 | 3300048918 | Bacteria | 138328 |
| 868 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 869 | Ga0496116_0008331 | 3300048919 | Bacteria | 9009 |
| 870 | Ga0496116_0052539 | 3300048919 | Bacteria | 2699 |
| 871 | Ga0496116_0091919 | 3300048919 | Bacteria | 1842 |
| 872 | Ga0496117_0005182 | 3300048920 | Bacteria | 13881 |
| 873 | Ga0496117_0024164 | 3300048920 | Bacteria | 4815 |
| 874 | Ga0496117_0029255 | 3300048920 | Bacteria | 4250 |
| 875 | Ga0496117_0063227 | 3300048920 | Bacteria | 2531 |
| 876 | Ga0496117_0114148 | 3300048920 | Bacteria | 1675 |
| 877 | Ga0496117_0361003 | 3300048920 | Bacteria | 746 |
| 878 | Ga0496118_0000207 | 3300048921 | Bacteria | 102753 |
| 879 | Ga0496118_0001886 | 3300048921 | Bacteria | 29933 |
| 880 | Ga0496118_0010653 | 3300048921 | Bacteria | 9070 |
| 881 | Ga0496118_0034205 | 3300048921 | Bacteria | 4152 |
| 882 | Ga0496118_0069987 | 3300048921 | Bacteria | 2537 |
| 883 | Ga0496118_0103051 | 3300048921 | Bacteria | 1921 |
| 884 | Ga0496118_0113773 | 3300048921 | Bacteria | 1786 |
| 885 | Ga0496119_0012406 | 3300048922 | Bacteria | 6925 |
| 886 | Ga0496119_0013018 | 3300048922 | Bacteria | 6678 |
| 887 | Ga0496119_0020775 | 3300048922 | Bacteria | 4771 |
| 888 | Ga0496120_0023582 | 3300048923 | Bacteria | 3850 |
| 889 | Ga0496120_0023713 | 3300048923 | Bacteria | 3837 |
| 890 | Ga0496120_0216135 | 3300048923 | Bacteria | 919 |
| 891 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 892 | Ga0496121_0000069 | 3300048924 | Bacteria | 253087 |
| 893 | Ga0496121_0001274 | 3300048924 | Bacteria | 43406 |
| 894 | Ga0496121_0002669 | 3300048924 | Bacteria | 26715 |
| 895 | Ga0496121_0003231 | 3300048924 | Bacteria | 23434 |
| 896 | Ga0496121_0018071 | 3300048924 | Bacteria | 7136 |
| 897 | Ga0496121_0020984 | 3300048924 | Bacteria | 6427 |
| 898 | Ga0496121_0071851 | 3300048924 | Bacteria | 2781 |
| 899 | Ga0496121_0103504 | 3300048924 | Bacteria | 2190 |
| 900 | Ga0496121_0209279 | 3300048924 | Bacteria | 1383 |
| 901 | Ga0496121_0306596 | 3300048924 | Bacteria | 1075 |
| 902 | Ga0496122_0004700 | 3300048925 | Bacteria | 16775 |
| 903 | Ga0496122_0177425 | 3300048925 | Bacteria | 1275 |
| 904 | Ga0496122_0416579 | 3300048925 | Bacteria | 677 |
| 905 | Ga0496123_0001360 | 3300048926 | Bacteria | 34429 |
| 906 | Ga0496123_0043064 | 3300048926 | Bacteria | 3106 |
| 907 | Ga0496123_0043471 | 3300048926 | Bacteria | 3085 |
| 908 | Ga0496123_0196097 | 3300048926 | Bacteria | 1040 |
| 909 | Ga0496123_0253647 | 3300048926 | Bacteria | 866 |
| 910 | Ga0496124_0001058 | 3300048927 | Bacteria | 43458 |
| 911 | Ga0496124_0003665 | 3300048927 | Bacteria | 18569 |
| 912 | Ga0496124_0004157 | 3300048927 | Bacteria | 17085 |
| 913 | Ga0496124_0209931 | 3300048927 | Bacteria | 1474 |
| 914 | Ga0496124_0568101 | 3300048927 | Bacteria | 745 |
| 915 | Ga0496124_0663947 | 3300048927 | Bacteria | 667 |
| 916 | Ga0496125_0001207 | 3300048928 | Bacteria | 38864 |
| 917 | Ga0496125_0004729 | 3300048928 | Bacteria | 15515 |
| 918 | Ga0496125_0032154 | 3300048928 | Bacteria | 4664 |
| 919 | Ga0496125_0078900 | 3300048928 | Bacteria | 2528 |
| 920 | Ga0496125_0079369 | 3300048928 | Bacteria | 2518 |
| 921 | Ga0496125_0086015 | 3300048928 | Bacteria | 2380 |
| 922 | Ga0496125_0490349 | 3300048928 | Bacteria | 694 |
| 923 | Ga0496126_0000124 | 3300048929 | Bacteria | 180422 |
| 924 | Ga0496126_0001895 | 3300048929 | Bacteria | 30168 |
| 925 | Ga0496126_0002142 | 3300048929 | Bacteria | 27515 |
| 926 | Ga0496126_0002534 | 3300048929 | Bacteria | 24446 |
| 927 | Ga0496126_0202877 | 3300048929 | Bacteria | 1674 |
| 928 | Ga0496126_0279213 | 3300048929 | Bacteria | 1384 |
| 929 | Ga0496126_0796577 | 3300048929 | Bacteria | 725 |
| 930 | Ga0495682_0014961 | 3300049460 | Bacteria | 2940 |
| 931 | Ga0501314_000483 | 3300049530 | Bacteria | 2493 |
| 932 | Ga0501031_0209943 | 3300049568 | Bacteria | 1269 |
| 933 | Ga0501032_0066467 | 3300049569 | Bacteria | 2409 |
| 934 | Ga0501033_0037080 | 3300049570 | Bacteria | 3650 |
| 935 | Ga0501034_0001091 | 3300049571 | Bacteria | 38199 |
| 936 | Ga0501034_0035819 | 3300049571 | Bacteria | 5031 |
| 937 | Ga0501034_0197894 | 3300049571 | Bacteria | 1969 |
| 938 | Ga0501034_0285407 | 3300049571 | Bacteria | 1590 |
| 939 | Ga0501034_0432858 | 3300049571 | Bacteria | 1235 |
| 940 | Ga0501036_0110973 | 3300049572 | Bacteria | 2317 |
| 941 | Ga0501037_0052642 | 3300049573 | Bacteria | 2977 |
| 942 | Ga0501038_0018286 | 3300049574 | Bacteria | 6327 |
| 943 | Ga0501038_0100768 | 3300049574 | Bacteria | 2405 |
| 944 | Ga0501043_0116803 | 3300049579 | Bacteria | 2093 |
| 945 | Ga0501046_0365960 | 3300049580 | Bacteria | 1045 |
| 946 | Ga0501047_0122208 | 3300049581 | Bacteria | 2485 |
| 947 | Ga0501069_0010052 | 3300049585 | Bacteria | 5004 |
| 948 | Ga0501070_0153960 | 3300049586 | Bacteria | 1896 |
| 949 | Ga0501071_0147049 | 3300049587 | Bacteria | 1757 |
| 950 | Ga0501076_0328060 | 3300049592 | Bacteria | 1256 |
| 951 | Ga0501223_004174 | 3300049663 | Bacteria | 3113 |
| 952 | Ga0501223_025784 | 3300049663 | Bacteria | 1144 |
| 953 | Ga0501224_000027 | 3300049664 | Bacteria | 53610 |
| 954 | Ga0501233_004186 | 3300049668 | Bacteria | 2630 |
| 955 | Ga0501235_024630 | 3300049669 | Bacteria | 1344 |
| 956 | Ga0501225_0000057 | 3300049705 | Bacteria | 37809 |
| 957 | Ga0501234_002771 | 3300049707 | Bacteria | 2760 |
| 958 | Ga0501080_0912732 | 3300049742 | Bacteria | 765 |
| 959 | Ga0501080_1181356 | 3300049742 | Bacteria | 658 |
| 960 | Ga0501083_0114285 | 3300049744 | Bacteria | 1773 |
| 961 | Ga0501262_004171 | 3300049759 | Bacteria | 1670 |
| 962 | Ga0501035_0024288 | 3300049822 | Bacteria | 5559 |
| 963 | Ga0501035_0495676 | 3300049822 | Bacteria | 1006 |
| 964 | Ga0501044_0013012 | 3300049823 | Bacteria | 9004 |
| 965 | Ga0501044_0052175 | 3300049823 | Bacteria | 4215 |
| 966 | Ga0501044_0475213 | 3300049823 | Bacteria | 1154 |
| 967 | Ga0501044_0526347 | 3300049823 | Bacteria | 1081 |
| 968 | Ga0501044_0599876 | 3300049823 | Bacteria | 994 |
| 969 | Ga0501226_001461 | 3300049853 | Bacteria | 3020 |
| 970 | nmdc:mga03683_162_c1 | 3300050489 | Bacteria | 22492 |
| 971 | nmdc:mga03n38_46774_c1 | 3300050490 | Bacteria | 1912 |
| 972 | nmdc:mga03n38_520064_c1 | 3300050490 | Bacteria | 670 |
| 973 | nmdc:mga00v17_268262_c1 | 3300050491 | Bacteria | 1108 |
| 974 | nmdc:mga00v17_45214_c1 | 3300050491 | Bacteria | 2659 |
| 975 | nmdc:mga00v17_466554_c1 | 3300050491 | Bacteria | 819 |
| 976 | nmdc:mga00v17_676485_c1 | 3300050491 | Bacteria | 663 |
| 977 | nmdc:mga0yw44_89284_c1 | 3300050492 | Bacteria | 1945 |
| 978 | nmdc:mga0k408_145641_c1 | 3300050493 | Bacteria | 1410 |
| 979 | nmdc:mga0k408_765972_c1 | 3300050493 | Bacteria | 563 |
| 980 | nmdc:mga06z11_182_c1 | 3300050494 | Bacteria | 24990 |
| 981 | nmdc:mga06z11_404536_c1 | 3300050494 | Bacteria | 822 |
| 982 | nmdc:mga04h51_252088_c1 | 3300050495 | Bacteria | 708 |
| 983 | nmdc:mga04h51_83_c1 | 3300050495 | Bacteria | 28958 |
| 984 | nmdc:mga07m45_146885_c1 | 3300050496 | Bacteria | 1367 |
| 985 | nmdc:mga07m45_32_c1 | 3300050496 | Bacteria | 78063 |
| 986 | nmdc:mga07m45_450966_c1 | 3300050496 | Bacteria | 746 |
| 987 | nmdc:mga07m45_77392_c1 | 3300050496 | Bacteria | 1897 |
| 988 | nmdc:mga0qj67_293097_c1 | 3300050509 | Bacteria | 1318 |
| 989 | nmdc:mga0qj67_41529_c1 | 3300050509 | Bacteria | 3618 |
| 990 | nmdc:mga0qj67_481221_c1 | 3300050509 | Bacteria | 999 |
| 991 | nmdc:mga0sz30_383076_c1 | 3300050516 | Bacteria | 630 |
| 992 | Ga0500610_0000034 | 3300053079 | Bacteria | 49152 |
| 993 | Ga0500643_000803 | 3300053087 | Bacteria | 20304 |
| 994 | Ga0500643_000972 | 3300053087 | Bacteria | 17780 |
| 995 | Ga0500643_005262 | 3300053087 | Bacteria | 5614 |
| 996 | Ga0500647_0108041 | 3300053091 | Bacteria | 1325 |
| 997 | Ga0500583_0107988 | 3300053092 | Bacteria | 1368 |
| 998 | Ga0500555_000591 | 3300053103 | Bacteria | 14166 |
| 999 | Ga0500562_003139 | 3300053108 | Bacteria | 4127 |
| 1000 | Ga0500592_070547 | 3300053116 | Bacteria | 576 |
| 1001 | Ga0500594_0237994 | 3300053118 | Bacteria | 604 |
| 1002 | Ga0500595_000211 | 3300053119 | Bacteria | 39658 |
| 1003 | Ga0500608_000153 | 3300053122 | Bacteria | 28720 |
| 1004 | Ga0500614_155995 | 3300053123 | Bacteria | 689 |
| 1005 | Ga0500618_000964 | 3300053125 | Bacteria | 14691 |
| 1006 | Ga0500559_0050061 | 3300053136 | Bacteria | 1842 |
| 1007 | Ga0500564_001024 | 3300053138 | Bacteria | 9167 |
| 1008 | Ga0500573_0086993 | 3300053140 | Bacteria | 1770 |
| 1009 | Ga0500573_0461907 | 3300053140 | Bacteria | 584 |
| 1010 | Ga0500577_0147512 | 3300053142 | Bacteria | 996 |
| 1011 | Ga0500590_009905 | 3300053148 | Bacteria | 4802 |
| 1012 | Ga0500604_0000146 | 3300053151 | Bacteria | 21141 |
| 1013 | Ga0500616_0059172 | 3300053153 | Bacteria | 1991 |
| 1014 | Ga0500622_0007706 | 3300053156 | Bacteria | 6082 |
| 1015 | Ga0500624_002499 | 3300053157 | Bacteria | 2489 |
| 1016 | Ga0500636_0010279 | 3300053177 | Bacteria | 5455 |
| 1017 | Ga0500636_0150096 | 3300053177 | Bacteria | 1281 |
| 1018 | Ga0500636_0462549 | 3300053177 | Bacteria | 570 |
| 1019 | Ga0500567_004232 | 3300053723 | Bacteria | 6514 |
| 1020 | Ga0500625_000005 | 3300053729 | Bacteria | 209509 |
| 1021 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 1022 | Ga0500645_017970 | 3300053730 | Bacteria | 2213 |
| 1023 | Ga0500645_072147 | 3300053730 | Bacteria | 990 |
| 1024 | Ga0587085_162448 | 3300059506 | Bacteria | 523 |
| 1025 | Ga0466962_0012254 | 3300061719 | Bacteria | 4121 |
| 1026 | 2509107760 | 2508501122 | Bacteria | 6292184 |
| 1027 | 2509376141 | 2509276019 | Bacteria | 6802256 |
| 1028 | 2511389409 | 2511231027 | Bacteria | 5013807 |
| 1029 | 2512533130 | 2512047086 | Bacteria | 6850303 |
| 1030 | 2524453066 | 2524023207 | Bacteria | 6813453 |
| 1031 | 2558865547 | 2558860100 | Bacteria | 8458965 |
| 1032 | 2558868376 | 2558860100 | Bacteria | 8458965 |
| 1033 | 2643730730 | 2643221541 | Bacteria | 5498788 |
| 1034 | 2644044617 | 2643221606 | Bacteria | 5588032 |
| 1035 | 2644391458 | 2643221671 | Bacteria | 5496681 |
| 1036 | 2738712449 | 2738541275 | Bacteria | 4830863 |
| 1037 | 2738850857 | 2738541301 | Bacteria | 4834102 |
| 1038 | 2738866603 | 2738541304 | Bacteria | 4833665 |
| 1039 | 2739299104 | 2738543022 | Bacteria | 4835059 |
| 1040 | 2739360799 | 2738543033 | Bacteria | 4833336 |
| 1041 | 2739651334 | 2739367664 | Bacteria | 4114334 |
| 1042 | 2740029807 | 2739367865 | Bacteria | 4114482 |
| 1043 | 2753359609 | 2751185800 | Bacteria | 5467370 |
| 1044 | 2757569945 | 2757320392 | Bacteria | 3737298 |
| 1045 | 2758641869 | 2758568016 | Bacteria | 5645291 |
| 1046 | 2765466044 | 2765235802 | Bacteria | 5618596 |
| 1047 | 2776271692 | 2775506902 | Bacteria | 6208009 |
| 1048 | 2776279795 | 2775506904 | Bacteria | 5954060 |
| 1049 | 2819553412 | 2818991438 | Bacteria | 5793701 |
| 1050 | 2839995228 | 2839993093 | Bacteria | 5512535 |
| 1051 | 2840769987 | 2840764183 | Bacteria | 6358399 |
| 1052 | 2842872779 | 2842871566 | Bacteria | 4827117 |
| 1053 | 2850080921 | 2850079185 | Bacteria | 6848280 |
| 1054 | 2852654634 | 2852653556 | Bacteria | 4050083 |
| 1055 | 2876373375 | 2876369609 | Bacteria | 6807521 |
| 1056 | 2881152153 | 2881147464 | Bacteria | 7779814 |
| 1057 | 2881168136 | 2881161766 | Bacteria | 7127907 |
| 1058 | 2882808607 | 2882806704 | Bacteria | 3007728 |
| 1059 | 2889794654 | 2889790730 | Bacteria | 5689708 |
| 1060 | 2889917868 | 2889914905 | Bacteria | 5702301 |
| 1061 | 2894654604 | 2894652903 | Bacteria | 4587256 |
| 1062 | 2894819886 | 2894817345 | Bacteria | 4892941 |
| 1063 | 2896254454 | 2896253425 | Bacteria | 3418029 |
| 1064 | 2904583318 | 2904578770 | Bacteria | 5302906 |
| 1065 | 2915652998 | 2915650412 | Bacteria | 4288180 |
| 1066 | 2919121062 | 2919119836 | Bacteria | 5208557 |
| 1067 | 2921211294 | 2921208531 | Bacteria | 6745326 |
| 1068 | 2928103501 | 2928100450 | Bacteria | 4837635 |
| 1069 | 2928523211 | 2928521798 | Bacteria | 4960112 |
| 1070 | 2928962812 | 2928959182 | Bacteria | 4725774 |
| 1071 | 2954015481 | 2954011201 | Bacteria | 4762601 |
| 1072 | 3002144049 | 3002141150 | Bacteria | 5254435 |
| 1073 | 3003670257 | 3003665799 | Bacteria | 7279786 |
| 1074 | 8001526622 | 8001522603 | Bacteria | 4726425 |
| 1075 | 8045865579 | 8045864390 | Bacteria | 5043873 |
| 1076 | Ga0068860_100063090 | |||
| 1077 | JGI24736J21556_1015550 | |||
| 1078 | JGI24752J21851_1000019 | |||
| 1079 | JGI24740J21852_10017003 | |||
| 1080 | JGI24740J21852_10075190 | |||
| 1081 | JGI24740J21852_10101680 | |||
| 1082 | JGI24739J22299_10001252 | |||
| 1083 | JGI24739J22299_10009714 | |||
| 1084 | JGI24739J22299_10054526 | |||
| 1085 | JGI24739J22299_10070483 | |||
| 1086 | JGI24737J22298_10001039 | |||
| 1087 | JGI24737J22298_10010383 | |||
| 1088 | JGI24737J22298_10028225 | |||
| 1089 | JGI24737J22298_10042305 | |||
| 1090 | JGI24737J22298_10129864 | |||
| 1091 | JGI24743J22301_10036319 | |||
| 1092 | JGI24735J21928_10000626 | |||
| 1093 | JGI24735J21928_10004199 | |||
| 1094 | JGI24735J21928_10016834 | |||
| 1095 | JGI24735J21928_10019673 | |||
| 1096 | JGI24735J21928_10021160 | |||
| 1097 | JGI24735J21928_10027327 | |||
| 1098 | JGI24735J21928_10045723 | |||
| 1099 | JGI24750J21931_1000043 | |||
| 1100 | JGI24748J21848_1000093 | |||
| 1101 | JGI24738J21930_10003215 | |||
| 1102 | JGI24738J21930_10003683 | |||
| 1103 | JGI24738J21930_10006892 | |||
| 1104 | JGI24744J21845_10003354 | |||
| 1105 | JGI24034J26672_10000032 | |||
| 1106 | JGI24034J26672_10000057 | |||
| 1107 | JGI24742J22300_10006451 | |||
| 1108 | JGI24751J29686_10004989 | |||
| 1109 | JGI25156J39149_1005233 | |||
| 1110 | JGI25157J39369_1000597 | |||
| 1111 | JGI25165J46597_1000188 | |||
| 1112 | JGI25153J46596_10000008 | |||
| 1113 | Ga0055525_1000063 | |||
| 1114 | Ga0055525_1000064 | |||
| 1115 | Ga0055542_1000123 | |||
| 1116 | Ga0055542_1011154 | |||
| 1117 | Ga0055529_1000144 | |||
| 1118 | Ga0055529_1019104 | |||
| 1119 | Ga0055534_1015291 | |||
| 1120 | Ga0055530_10000526 | |||
| 1121 | Ga0055531_10000563 | |||
| 1122 | Ga0065165_1004625 | |||
| 1123 | Ga0065714_10511279 | |||
| 1124 | Ga0065704_10001466 | |||
| 1125 | Ga0065704_10450884 | |||
| 1126 | Ga0065712_10484986 | |||
| 1127 | Ga0065715_10187962 | |||
| 1128 | Ga0065707_10294859 | |||
| 1129 | Ga0070658_10000003 | |||
| 1130 | Ga0070658_10000083 | |||
| 1131 | Ga0070658_10000688 | |||
| 1132 | Ga0070658_10002274 | |||
| 1133 | Ga0070658_10006725 | |||
| 1134 | Ga0070658_10096964 | |||
| 1135 | Ga0070658_10151357 | |||
| 1136 | Ga0070658_10238578 | |||
| 1137 | Ga0070658_10410091 | |||
| 1138 | Ga0070676_10006658 | |||
| 1139 | Ga0070676_10050811 | |||
| 1140 | Ga0070676_10298533 | |||
| 1141 | Ga0070683_100412488 | |||
| 1142 | Ga0070690_100000011 | |||
| 1143 | Ga0070690_100410640 | |||
| 1144 | Ga0070690_100595509 | |||
| 1145 | Ga0070670_100026386 | |||
| 1146 | Ga0070670_100546775 | |||
| 1147 | Ga0070670_100973530 | |||
| 1148 | Ga0070677_10001076 | |||
| 1149 | Ga0068869_100000353 | |||
| 1150 | Ga0068869_100813174 | |||
| 1151 | Ga0070666_10000035 | |||
| 1152 | Ga0070666_10105789 | |||
| 1153 | Ga0070666_10235104 | |||
| 1154 | Ga0070666_10541233 | |||
| 1155 | Ga0070680_100047705 | |||
| 1156 | Ga0070680_100249735 | |||
| 1157 | Ga0070682_100809718 | |||
| 1158 | Ga0068868_100000154 | |||
| 1159 | Ga0068868_100565163 | |||
| 1160 | Ga0070660_100000122 | |||
| 1161 | Ga0070660_100001677 | |||
| 1162 | Ga0070660_100024829 | |||
| 1163 | Ga0070660_100027823 | |||
| 1164 | Ga0070660_100156120 | |||
| 1165 | Ga0070660_100198027 | |||
| 1166 | Ga0070660_100764720 | |||
| 1167 | Ga0070689_100002629 | |||
| 1168 | Ga0070689_100224932 | |||
| 1169 | Ga0070661_100287576 | |||
| 1170 | Ga0070692_10000999 | |||
| 1171 | Ga0070692_10130743 | |||
| 1172 | Ga0070692_10859070 | |||
| 1173 | Ga0070668_100018658 | |||
| 1174 | Ga0070668_100047927 | |||
| 1175 | Ga0070668_100059247 | |||
| 1176 | Ga0070668_100387063 | |||
| 1177 | Ga0070668_100479801 | |||
| 1178 | Ga0070668_100548675 | |||
| 1179 | Ga0070668_101121098 | |||
| 1180 | Ga0070669_100000489 | |||
| 1181 | Ga0070669_100005417 | |||
| 1182 | Ga0070669_100007896 | |||
| 1183 | Ga0070669_100025696 | |||
| 1184 | Ga0070669_100423423 | |||
| 1185 | Ga0070669_100768723 | |||
| 1186 | Ga0070669_101618640 | |||
| 1187 | Ga0070675_100005433 | |||
| 1188 | Ga0070675_100013018 | |||
| 1189 | Ga0070671_100000062 | |||
| 1190 | Ga0070671_100002103 | |||
| 1191 | Ga0070671_100019498 | |||
| 1192 | Ga0070671_100029468 | |||
| 1193 | Ga0070671_100146891 | |||
| 1194 | Ga0070671_100152869 | |||
| 1195 | Ga0070671_100191148 | |||
| 1196 | Ga0070671_101422404 | |||
| 1197 | Ga0070674_100032397 | |||
| 1198 | Ga0070674_100105593 | |||
| 1199 | Ga0070674_100250861 | |||
| 1200 | Ga0070673_100000023 | |||
| 1201 | Ga0070673_101796393 | |||
| 1202 | Ga0070688_100013357 | |||
| 1203 | Ga0070688_100172275 | |||
| 1204 | Ga0070659_100022977 | |||
| 1205 | Ga0070659_100213271 | |||
| 1206 | Ga0070659_100297325 | |||
| 1207 | Ga0070659_100302867 | |||
| 1208 | Ga0070659_100345858 | |||
| 1209 | Ga0070667_100014076 | |||
| 1210 | Ga0070667_100041273 | |||
| 1211 | Ga0070667_100052266 | |||
| 1212 | Ga0070667_100065840 | |||
| 1213 | Ga0070667_100110830 | |||
| 1214 | Ga0070667_100358264 | |||
| 1215 | Ga0070667_100553263 | |||
| 1216 | Ga0070714_100157342 | |||
| 1217 | Ga0070663_100099017 | |||
| 1218 | Ga0070663_100224772 | |||
| 1219 | Ga0070663_100464919 | |||
| 1220 | Ga0070678_100167540 | |||
| 1221 | Ga0070678_100250631 | |||
| 1222 | Ga0070678_100536467 | |||
| 1223 | Ga0070662_100003750 | |||
| 1224 | Ga0070662_100190951 | |||
| 1225 | Ga0070662_100284947 | |||
| 1226 | Ga0070662_100359418 | |||
| 1227 | Ga0070662_100427135 | |||
| 1228 | Ga0070662_100552669 | |||
| 1229 | Ga0070662_100595219 | |||
| 1230 | Ga0070662_101997956 | |||
| 1231 | Ga0070681_10363840 | |||
| 1232 | Ga0070681_10636137 | |||
| 1233 | Ga0068867_100000007 | |||
| 1234 | Ga0070685_10000168 | |||
| 1235 | Ga0070679_100239051 | |||
| 1236 | Ga0068853_100113724 | |||
| 1237 | Ga0068853_100617010 | |||
| 1238 | Ga0070672_100046111 | |||
| 1239 | Ga0070672_100222284 | |||
| 1240 | Ga0070672_101221027 | |||
| 1241 | Ga0070686_100000035 | |||
| 1242 | Ga0070696_100186631 | |||
| 1243 | Ga0070693_100167685 | |||
| 1244 | Ga0070693_101049445 | |||
| 1245 | Ga0070665_100000023 | |||
| 1246 | Ga0070665_100000161 | |||
| 1247 | Ga0070665_100003713 | |||
| 1248 | Ga0070665_100042108 | |||
| 1249 | Ga0070665_100045411 | |||
| 1250 | Ga0070665_100716089 | |||
| 1251 | Ga0070665_100781373 | |||
| 1252 | Ga0068855_100000029 | |||
| 1253 | Ga0068855_100121035 | |||
| 1254 | Ga0068855_100294989 | |||
| 1255 | Ga0068855_100470742 | |||
| 1256 | Ga0068855_100529651 | |||
| 1257 | Ga0068855_101237351 | |||
| 1258 | Ga0070664_100232255 | |||
| 1259 | Ga0068857_100056230 | |||
| 1260 | Ga0068857_100155804 | |||
| 1261 | Ga0068857_100278173 | |||
| 1262 | Ga0068857_101015622 | |||
| 1263 | Ga0068854_100000751 | |||
| 1264 | Ga0068854_100011157 | |||
| 1265 | Ga0068854_100020920 | |||
| 1266 | Ga0068854_100185355 | |||
| 1267 | Ga0068854_100429597 | |||
| 1268 | Ga0068854_100657243 | |||
| 1269 | Ga0068854_101474412 | |||
| 1270 | Ga0068856_100018774 | |||
| 1271 | Ga0068856_100213696 | |||
| 1272 | Ga0068856_100818976 | |||
| 1273 | Ga0068856_101336026 | |||
| 1274 | Ga0070702_100625054 | |||
| 1275 | Ga0068852_100001445 | |||
| 1276 | Ga0068852_100091530 | |||
| 1277 | Ga0068852_100236595 | |||
| 1278 | Ga0068852_100253593 | |||
| 1279 | Ga0068859_100006370 | |||
| 1280 | Ga0068859_100041543 | |||
| 1281 | Ga0068859_100059777 | |||
| 1282 | Ga0068864_100022346 | |||
| 1283 | Ga0068864_100035786 | |||
| 1284 | Ga0068861_100000615 | |||
| 1285 | Ga0068851_10030453 | |||
| 1286 | Ga0068851_10416667 | |||
| 1287 | Ga0068870_10114066 | |||
| 1288 | Ga0068863_100000060 | |||
| 1289 | Ga0068863_100000106 | |||
| 1290 | Ga0068863_100000617 | |||
| 1291 | Ga0068863_100042301 | |||
| 1292 | Ga0068863_100461697 | |||
| 1293 | Ga0068863_101456917 | |||
| 1294 | Ga0068863_102100018 | |||
| 1295 | Ga0068863_102613081 | |||
| 1296 | Ga0068858_100000157 | |||
| 1297 | Ga0068858_100002890 | |||
| 1298 | Ga0068858_100009717 | |||
| 1299 | Ga0068858_100112840 | |||
| 1300 | Ga0068860_100000126 | |||
| 1301 | Ga0068860_100000168 | |||
| 1302 | Ga0068860_100000680 | |||
| 1303 | Ga0068860_100589292 | |||
| 1304 | Ga0068862_100000146 | |||
| 1305 | Ga0068862_100000193 | |||
| 1306 | Ga0068862_100004291 | |||
| 1307 | Ga0068862_100004770 | |||
| 1308 | Ga0068862_100377737 | |||
| 1309 | Ga0068862_101521236 | |||
| 1310 | Ga0081455_10794787 | |||
| 1311 | Ga0081540_1105146 | |||
| 1312 | Ga0075365_10119434 | |||
| 1313 | Ga0075368_10000037 | |||
| 1314 | Ga0075368_10002121 | |||
| 1315 | Ga0075368_10011362 | |||
| 1316 | Ga0075363_100008002 | |||
| 1317 | Ga0075363_100059341 | |||
| 1318 | Ga0075364_10077215 | |||
| 1319 | Ga0075364_10088769 | |||
| 1320 | Ga0075364_10136370 | |||
| 1321 | Ga0075364_10532920 | |||
| 1322 | Ga0075364_10766835 | |||
| 1323 | Ga0075362_10002084 | |||
| 1324 | Ga0075362_10468086 | |||
| 1325 | Ga0075367_10001103 | |||
| 1326 | Ga0075367_10095170 | |||
| 1327 | Ga0075369_10037806 | |||
| 1328 | Ga0075366_10018983 | |||
| 1329 | Ga0075366_10019187 | |||
| 1330 | Ga0075366_10029450 | |||
| 1331 | Ga0075366_10127430 | |||
| 1332 | Ga0075366_10174805 | |||
| 1333 | Ga0075366_10307203 | |||
| 1334 | Ga0097621_101442686 | |||
| 1335 | Ga0075370_10079240 | |||
| 1336 | Ga0075370_10388191 | |||
| 1337 | Ga0075370_10473819 | |||
| 1338 | Ga0068871_100051306 | |||
| 1339 | Ga0068871_101788012 | |||
| 1340 | Ga0068871_101997439 | |||
| 1341 | Ga0075430_100007359 | |||
| 1342 | Ga0075430_100071070 | |||
| 1343 | Ga0075430_100119423 | |||
| 1344 | Ga0068865_100000010 | |||
| 1345 | Ga0097620_100006370 | |||
| 1346 | Ga0097620_100041543 | |||
| 1347 | Ga0097620_100059776 | |||
| 1348 | Ga0079104_1003382 | |||
| 1349 | Ga0079104_1004641 | |||
| 1350 | Ga0079104_1036606 | |||
| 1351 | Ga0105251_10001266 | |||
| 1352 | Ga0105251_10182084 | |||
| 1353 | Ga0105240_10004083 | |||
| 1354 | Ga0105240_10333520 | |||
| 1355 | Ga0105240_12750275 | |||
| 1356 | Ga0111539_13024116 | |||
| 1357 | Ga0105245_10001496 | |||
| 1358 | Ga0105245_10007145 | |||
| 1359 | Ga0105247_10001477 | |||
| 1360 | Ga0105247_10056974 | |||
| 1361 | Ga0105247_10230863 | |||
| 1362 | Ga0105247_10402689 | |||
| 1363 | Ga0105247_10601036 | |||
| 1364 | Ga0105243_10000054 | |||
| 1365 | Ga0105243_10101399 | |||
| 1366 | Ga0105243_11109481 | |||
| 1367 | Ga0105241_10034303 | |||
| 1368 | Ga0105241_10328204 | |||
| 1369 | Ga0105241_10706302 | |||
| 1370 | Ga0105242_10000210 | |||
| 1371 | Ga0105248_10004792 | |||
| 1372 | Ga0105248_10007222 | |||
| 1373 | Ga0105248_10025331 | |||
| 1374 | Ga0105248_10137987 | |||
| 1375 | Ga0105248_10229002 | |||
| 1376 | Ga0105248_10398217 | |||
| 1377 | Ga0105237_10083217 | |||
| 1378 | Ga0105237_10317656 | |||
| 1379 | Ga0105237_10791679 | |||
| 1380 | Ga0105237_11125569 | |||
| 1381 | Ga0105238_10010681 | |||
| 1382 | Ga0105238_10010889 | |||
| 1383 | Ga0105238_10302286 | |||
| 1384 | Ga0105238_11008023 | |||
| 1385 | Ga0105238_12059342 | |||
| 1386 | Ga0105238_12255281 | |||
| 1387 | Ga0105249_10000002 | |||
| 1388 | Ga0105249_10000094 | |||
| 1389 | Ga0105249_10013736 | |||
| 1390 | Ga0105249_10172798 | |||
| 1391 | Ga0105239_10000031 | |||
| 1392 | Ga0105239_10829219 | |||
| 1393 | Ga0105239_10851605 | |||
| 1394 | Ga0105239_11390536 | |||
| 1395 | Ga0105246_10022917 | |||
| 1396 | Ga0105246_10357559 | |||
| 1397 | Ga0157373_10054363 | |||
| 1398 | Ga0157373_11169411 | |||
| 1399 | Ga0157371_10023965 | |||
| 1400 | Ga0157371_10819125 | |||
| 1401 | Ga0157371_11117534 | |||
| 1402 | Ga0157370_10004235 | |||
| 1403 | Ga0157370_10615244 | |||
| 1404 | Ga0157370_11540782 | |||
| 1405 | Ga0157370_11687144 | |||
| 1406 | Ga0157369_10020716 | |||
| 1407 | Ga0157369_10444132 | |||
| 1408 | Ga0157369_10645368 | |||
| 1409 | Ga0157374_10007279 | |||
| 1410 | Ga0157374_10292932 | |||
| 1411 | Ga0157374_10326710 | |||
| 1412 | Ga0157378_10020119 | |||
| 1413 | Ga0157378_10051802 | |||
| 1414 | Ga0157378_10513758 | |||
| 1415 | Ga0163162_10151250 | |||
| 1416 | Ga0163162_11005798 | |||
| 1417 | Ga0157372_10014562 | |||
| 1418 | Ga0157372_10172216 | |||
| 1419 | Ga0157372_10227903 | |||
| 1420 | Ga0157372_10317339 | |||
| 1421 | Ga0157372_10460050 | |||
| 1422 | Ga0157372_10563651 | |||
| 1423 | Ga0157375_10003825 | |||
| 1424 | Ga0157375_10724994 | |||
| 1425 | Ga0163163_10033187 | |||
| 1426 | Ga0163163_10204153 | |||
| 1427 | Ga0163163_11564186 | |||
| 1428 | Ga0157380_10000851 | |||
| 1429 | Ga0157380_10037643 | |||
| 1430 | Ga0157380_11039458 | |||
| 1431 | Ga0157377_11431264 | |||
| 1432 | Ga0157379_10005418 | |||
| 1433 | Ga0157379_10659973 | |||
| 1434 | Ga0157376_10000047 | |||
| 1435 | Ga0163161_10002507 | |||
| 1436 | Ga0163161_10004251 | |||
| 1437 | Ga0163161_10080010 | |||
| 1438 | Ga0214542_1055259 | |||
| 1439 | Ga0214543_1000173 | |||
| 1440 | Ga0213875_10038209 | |||
| 1441 | Ga0209563_100066 | |||
| 1442 | Ga0207427_109532 | |||
| 1443 | Ga0209646_1023471 | |||
| 1444 | Ga0209026_1000002 | |||
| 1445 | Ga0209026_1003041 | |||
| 1446 | Ga0209148_1000011 | |||
| 1447 | Ga0209148_1000061 | |||
| 1448 | Ga0209148_1002311 | |||
| 1449 | Ga0209759_1000062 | |||
| 1450 | Ga0209233_1000052 | |||
| 1451 | Ga0209233_1000120 | |||
| 1452 | Ga0209233_1023172 | |||
| 1453 | Ga0209565_1032271 | |||
| 1454 | Ga0209455_1000006 | |||
| 1455 | Ga0209455_1000972 | |||
| 1456 | Ga0209455_1017111 | |||
| 1457 | Ga0207673_1064185 | |||
| 1458 | Ga0209675_1000137 | |||
| 1459 | Ga0209676_1000883 | |||
| 1460 | Ga0209676_1001128 | |||
| 1461 | Ga0209025_1020063 | |||
| 1462 | Ga0209025_1032667 | |||
| 1463 | Ga0209758_1000017 | |||
| 1464 | Ga0209050_1000119 | |||
| 1465 | Ga0209050_1000400 | |||
| 1466 | Ga0209050_1001243 | |||
| 1467 | Ga0209257_1000250 | |||
| 1468 | Ga0209257_1000603 | |||
| 1469 | Ga0209257_1002085 | |||
| 1470 | Ga0209257_1022922 | |||
| 1471 | Ga0209257_1033784 | |||
| 1472 | Ga0207697_10085510 | |||
| 1473 | Ga0207697_10549307 | |||
| 1474 | Ga0207656_10053455 | |||
| 1475 | Ga0207656_10063181 | |||
| 1476 | Ga0207656_10218080 | |||
| 1477 | Ga0207713_1010768 | |||
| 1478 | Ga0207682_10000505 | |||
| 1479 | Ga0207710_10001911 | |||
| 1480 | Ga0207710_10324522 | |||
| 1481 | Ga0207688_10039994 | |||
| 1482 | Ga0207688_10516620 | |||
| 1483 | Ga0207688_10951548 | |||
| 1484 | Ga0207680_10000007 | |||
| 1485 | Ga0207680_11117599 | |||
| 1486 | Ga0207647_10000270 | |||
| 1487 | Ga0207647_10001030 | |||
| 1488 | Ga0207647_10002997 | |||
| 1489 | Ga0207647_10008132 | |||
| 1490 | Ga0207647_10018008 | |||
| 1491 | Ga0207647_10103636 | |||
| 1492 | Ga0207647_10173756 | |||
| 1493 | Ga0207645_10003775 | |||
| 1494 | Ga0207645_10014073 | |||
| 1495 | Ga0207643_10321138 | |||
| 1496 | Ga0207705_10000005 | |||
| 1497 | Ga0207705_10000316 | |||
| 1498 | Ga0207705_10000340 | |||
| 1499 | Ga0207705_10012135 | |||
| 1500 | Ga0207705_10073287 | |||
| 1501 | Ga0207705_10113946 | |||
| 1502 | Ga0207705_10174715 | |||
| 1503 | Ga0207705_11055103 | |||
| 1504 | Ga0207654_10008007 | |||
| 1505 | Ga0207707_10445324 | |||
| 1506 | Ga0207707_11354760 | |||
| 1507 | Ga0207695_10015209 | |||
| 1508 | Ga0207695_10127995 | |||
| 1509 | Ga0207695_11740006 | |||
| 1510 | Ga0207671_10034401 | |||
| 1511 | Ga0207671_10052103 | |||
| 1512 | Ga0207671_11182956 | |||
| 1513 | Ga0207657_10000832 | |||
| 1514 | Ga0207657_10007820 | |||
| 1515 | Ga0207657_10018806 | |||
| 1516 | Ga0207657_10021901 | |||
| 1517 | Ga0207657_10022634 | |||
| 1518 | Ga0207657_10086509 | |||
| 1519 | Ga0207657_10093489 | |||
| 1520 | Ga0207657_10178902 | |||
| 1521 | Ga0207649_10207523 | |||
| 1522 | Ga0207649_10214589 | |||
| 1523 | Ga0207649_11336078 | |||
| 1524 | Ga0207652_10538495 | |||
| 1525 | Ga0207681_10000053 | |||
| 1526 | Ga0207681_10002314 | |||
| 1527 | Ga0207681_10008412 | |||
| 1528 | Ga0207681_10011479 | |||
| 1529 | Ga0207681_10100199 | |||
| 1530 | Ga0207681_10785634 | |||
| 1531 | Ga0207681_11389497 | |||
| 1532 | Ga0207694_10016121 | |||
| 1533 | Ga0207694_10176560 | |||
| 1534 | Ga0207694_10326340 | |||
| 1535 | Ga0207694_10440264 | |||
| 1536 | Ga0207694_11204932 | |||
| 1537 | Ga0207650_10037516 | |||
| 1538 | Ga0207650_10068113 | |||
| 1539 | Ga0207650_10207795 | |||
| 1540 | Ga0207650_10645301 | |||
| 1541 | Ga0207650_10893881 | |||
| 1542 | Ga0207659_10004630 | |||
| 1543 | Ga0207659_10024906 | |||
| 1544 | Ga0207687_10001694 | |||
| 1545 | Ga0207687_10005171 | |||
| 1546 | Ga0207664_10110773 | |||
| 1547 | Ga0207644_10000005 | |||
| 1548 | Ga0207644_10000242 | |||
| 1549 | Ga0207644_10000964 | |||
| 1550 | Ga0207644_10009287 | |||
| 1551 | Ga0207644_10115903 | |||
| 1552 | Ga0207644_10149378 | |||
| 1553 | Ga0207644_10424638 | |||
| 1554 | Ga0207644_11680972 | |||
| 1555 | Ga0207690_10006391 | |||
| 1556 | Ga0207690_10110934 | |||
| 1557 | Ga0207690_10328563 | |||
| 1558 | Ga0207690_10453815 | |||
| 1559 | Ga0207690_10543304 | |||
| 1560 | Ga0207690_11316159 | |||
| 1561 | Ga0207706_10014101 | |||
| 1562 | Ga0207706_10045638 | |||
| 1563 | Ga0207706_10053172 | |||
| 1564 | Ga0207706_10060688 | |||
| 1565 | Ga0207706_10154593 | |||
| 1566 | Ga0207706_10156031 | |||
| 1567 | Ga0207706_10672610 | |||
| 1568 | Ga0207706_10674918 | |||
| 1569 | Ga0207686_10000598 | |||
| 1570 | Ga0207709_10000050 | |||
| 1571 | Ga0207709_10122482 | |||
| 1572 | Ga0207670_10009646 | |||
| 1573 | Ga0207670_10193618 | |||
| 1574 | Ga0207669_10009567 | |||
| 1575 | Ga0207669_10169779 | |||
| 1576 | Ga0207669_10224758 | |||
| 1577 | Ga0207704_10000020 | |||
| 1578 | Ga0207704_11032711 | |||
| 1579 | Ga0207691_10331253 | |||
| 1580 | Ga0207691_10477160 | |||
| 1581 | Ga0207691_10533400 | |||
| 1582 | Ga0207711_10001087 | |||
| 1583 | Ga0207711_10006515 | |||
| 1584 | Ga0207711_10022035 | |||
| 1585 | Ga0207711_10542889 | |||
| 1586 | Ga0207711_11360092 | |||
| 1587 | Ga0207711_11405996 | |||
| 1588 | Ga0207689_10001110 | |||
| 1589 | Ga0207689_10181463 | |||
| 1590 | Ga0207689_10867355 | |||
| 1591 | Ga0207661_10390443 | |||
| 1592 | Ga0207679_10159802 | |||
| 1593 | Ga0207679_10391622 | |||
| 1594 | Ga0207667_10000035 | |||
| 1595 | Ga0207667_10031919 | |||
| 1596 | Ga0207667_10351219 | |||
| 1597 | Ga0207667_10512940 | |||
| 1598 | Ga0207667_10565217 | |||
| 1599 | Ga0207667_10884162 | |||
| 1600 | Ga0207667_11360958 | |||
| 1601 | Ga0207651_10000005 | |||
| 1602 | Ga0207651_10184309 | |||
| 1603 | Ga0207651_10390156 | |||
| 1604 | Ga0207712_10000002 | |||
| 1605 | Ga0207712_10000004 | |||
| 1606 | Ga0207712_10039051 | |||
| 1607 | Ga0207712_10132626 | |||
| 1608 | Ga0207668_10004132 | |||
| 1609 | Ga0207668_10034891 | |||
| 1610 | Ga0207668_10056180 | |||
| 1611 | Ga0207668_10103299 | |||
| 1612 | Ga0207668_10170441 | |||
| 1613 | Ga0207668_10208760 | |||
| 1614 | Ga0207668_10499797 | |||
| 1615 | Ga0207640_10000436 | |||
| 1616 | Ga0207640_10007861 | |||
| 1617 | Ga0207640_10041447 | |||
| 1618 | Ga0207640_10070511 | |||
| 1619 | Ga0207640_10071071 | |||
| 1620 | Ga0207640_10274695 | |||
| 1621 | Ga0207640_10284936 | |||
| 1622 | Ga0207640_10627893 | |||
| 1623 | Ga0207658_10000865 | |||
| 1624 | Ga0207658_10007156 | |||
| 1625 | Ga0207658_10016492 | |||
| 1626 | Ga0207658_10183814 | |||
| 1627 | Ga0207677_10001245 | |||
| 1628 | Ga0207677_11538829 | |||
| 1629 | Ga0207703_10000095 | |||
| 1630 | Ga0207703_10005905 | |||
| 1631 | Ga0207639_10006866 | |||
| 1632 | Ga0207639_10277737 | |||
| 1633 | Ga0207639_10310222 | |||
| 1634 | Ga0207639_10369132 | |||
| 1635 | Ga0207639_10971264 | |||
| 1636 | Ga0207639_11171880 | |||
| 1637 | Ga0207639_11669602 | |||
| 1638 | Ga0207639_11782712 | |||
| 1639 | Ga0207678_10001958 | |||
| 1640 | Ga0207678_10012101 | |||
| 1641 | Ga0207678_10314458 | |||
| 1642 | Ga0207678_10567166 | |||
| 1643 | Ga0207702_10005556 | |||
| 1644 | Ga0207702_10011049 | |||
| 1645 | Ga0207702_10118420 | |||
| 1646 | Ga0207641_10000100 | |||
| 1647 | Ga0207641_10000270 | |||
| 1648 | Ga0207641_10000481 | |||
| 1649 | Ga0207641_10067161 | |||
| 1650 | Ga0207641_11828068 | |||
| 1651 | Ga0207648_10000017 | |||
| 1652 | Ga0207648_10373278 | |||
| 1653 | Ga0207648_10730310 | |||
| 1654 | Ga0207676_10004649 | |||
| 1655 | Ga0207676_10010123 | |||
| 1656 | Ga0207676_10876043 | |||
| 1657 | Ga0207674_10020635 | |||
| 1658 | Ga0207674_10057517 | |||
| 1659 | Ga0207674_10260328 | |||
| 1660 | Ga0207674_10745865 | |||
| 1661 | Ga0207674_11603622 | |||
| 1662 | Ga0207675_100000739 | |||
| 1663 | Ga0207683_10181595 | |||
| 1664 | Ga0207683_10318272 | |||
| 1665 | Ga0207683_10497744 | |||
| 1666 | Ga0207698_10000858 | |||
| 1667 | Ga0207698_10281237 | |||
| 1668 | Ga0207698_10396540 | |||
| 1669 | Ga0209281_1023255 | |||
| 1670 | Ga0209813_10000030 | |||
| 1671 | Ga0209974_10007025 | |||
| 1672 | Ga0209974_10088425 | |||
| 1673 | Ga0268266_10000002 | |||
| 1674 | Ga0268266_10000040 | |||
| 1675 | Ga0268266_10000198 | |||
| 1676 | Ga0268266_10004412 | |||
| 1677 | Ga0268266_10086743 | |||
| 1678 | Ga0268266_10143199 | |||
| 1679 | Ga0268266_10758820 | |||
| 1680 | Ga0268265_10000048 | |||
| 1681 | Ga0268265_10000128 | |||
| 1682 | Ga0268265_10011310 | |||
| 1683 | Ga0268265_10016140 | |||
| 1684 | Ga0268265_10965870 | |||
| 1685 | Ga0268265_11564333 | |||
| 1686 | Ga0268265_12035442 | |||
| 1687 | Ga0268265_12307515 | |||
| 1688 | Ga0268264_10000003 | |||
| 1689 | Ga0268264_10000040 | |||
| 1690 | Ga0268264_10000304 | |||
| 1691 | Ga0268264_10003482 | |||
| 1692 | Ga0268264_11012582 | |||
| 1693 | Ga0307517_10038523 | |||
| 1694 | Ga0307515_10501817 | |||
| 1695 | Ga0265327_10041088 | |||
| 1696 | Ga0307513_10126993 | |||
| 1697 | Ga0307513_10241316 | |||
| 1698 | Ga0307408_100053681 | |||
| 1699 | Ga0307508_10000202 | |||
| 1700 | Ga0316579_10016513 | |||
| 1701 | Ga0316579_10585838 | |||
| 1702 | Ga0316576_10254501 | |||
| 1703 | Ga0316576_10316253 | |||
| 1704 | Ga0316578_10311354 | |||
| 1705 | Ga0316578_10371171 | |||
| 1706 | Ga0307405_10036688 | |||
| 1707 | Ga0307405_10086074 | |||
| 1708 | Ga0307405_10334494 | |||
| 1709 | Ga0307413_10027149 | |||
| 1710 | Ga0307413_10063121 | |||
| 1711 | Ga0307413_10093923 | |||
| 1712 | Ga0307413_10162076 | |||
| 1713 | Ga0307413_10206976 | |||
| 1714 | Ga0307413_10762278 | |||
| 1715 | Ga0307413_10780878 | |||
| 1716 | Ga0307413_12008932 | |||
| 1717 | Ga0307410_10037654 | |||
| 1718 | Ga0307410_10112127 | |||
| 1719 | Ga0307406_10429126 | |||
| 1720 | Ga0307406_10465841 | |||
| 1721 | Ga0307406_10956003 | |||
| 1722 | Ga0307406_11646359 | |||
| 1723 | Ga0307407_10011706 | |||
| 1724 | Ga0307412_10003817 | |||
| 1725 | Ga0307412_10020442 | |||
| 1726 | Ga0307412_10050601 | |||
| 1727 | Ga0307412_10133298 | |||
| 1728 | Ga0307412_10173777 | |||
| 1729 | Ga0307412_10431618 | |||
| 1730 | Ga0307412_10583874 | |||
| 1731 | Ga0307409_100033984 | |||
| 1732 | Ga0307409_100130733 | |||
| 1733 | Ga0307409_100518256 | |||
| 1734 | Ga0307409_100865419 | |||
| 1735 | Ga0307416_100080945 | |||
| 1736 | Ga0307416_100122699 | |||
| 1737 | Ga0307416_100184641 | |||
| 1738 | Ga0307416_100418141 | |||
| 1739 | Ga0307416_100926409 | |||
| 1740 | Ga0307414_10001433 | |||
| 1741 | Ga0307414_10002743 | |||
| 1742 | Ga0307414_10158436 | |||
| 1743 | Ga0307414_10328561 | |||
| 1744 | Ga0307414_10383929 | |||
| 1745 | Ga0307414_10598436 | |||
| 1746 | Ga0307414_10660497 | |||
| 1747 | Ga0307414_10663567 | |||
| 1748 | Ga0307414_10668979 | |||
| 1749 | Ga0307411_10000664 | |||
| 1750 | Ga0307411_10076688 | |||
| 1751 | Ga0307411_10082381 | |||
| 1752 | Ga0307411_10246093 | |||
| 1753 | Ga0307411_10249435 | |||
| 1754 | Ga0307411_10321182 | |||
| 1755 | Ga0307411_10592319 | |||
| 1756 | Ga0307411_10754935 | |||
| 1757 | Ga0307411_10913804 | |||
| 1758 | Ga0307411_11213934 | |||
| 1759 | Ga0307415_100224771 | |||
| 1760 | Ga0307415_100736632 | |||
| 1761 | Ga0316583_10002111 | |||
| 1762 | Ga0373932_0086904 | |||
| 1763 | Ga0316582_0004595 | |||
| 1764 | Ga0316584_0089964 | |||
| 1765 | Ga0316584_0250934 | |||
| 1766 | Ga0395899_0001026 | |||
| 1767 | Ga0395899_0023762 | |||
| 1768 | Ga0395900_0014297 | |||
| 1769 | Ga0395900_0106340 | |||
| 1770 | Ga0395900_0175983 | |||
| 1771 | Ga0395900_0195584 | |||
| 1772 | Ga0395900_0310310 | |||
| 1773 | Ga0395900_0332507 | |||
| 1774 | Ga0395898_0311781 | |||
| 1775 | Ga0395905_0012607 | |||
| 1776 | Ga0395905_0096692 | |||
| 1777 | Ga0395905_0163569 | |||
| 1778 | Ga0395905_0639074 | |||
| 1779 | Ga0395905_0888072 | |||
| 1780 | Ga0316581_0025968 | |||
| 1781 | Ga0436364_0561934 | |||
| 1782 | Ga0436364_1421612 | |||
| 1783 | Ga0395901_0000375 | |||
| 1784 | Ga0395901_0058847 | |||
| 1785 | Ga0395901_0144012 | |||
| 1786 | Ga0436365_0195281 | |||
| 1787 | Ga0436361_0290751 | |||
| 1788 | Ga0436361_0936593 | |||
| 1789 | Ga0451791_1642827 | |||
| 1790 | Ga0451797_1238947 | |||
| 1791 | Ga0451795_0595987 | |||
| 1792 | Ga0451800_0216242 | |||
| 1793 | Ga0451800_1145456 | |||
| 1794 | Ga0451802_1293139 | |||
| 1795 | Ga0451833_0320310 | |||
| 1796 | Ga0451833_0562953 | |||
| 1797 | Ga0451849_1104376 | |||
| 1798 | Ga0451853_0443311 | |||
| 1799 | Ga0451853_2107157 | |||
| 1800 | Ga0439448_0007619 | |||
| 1801 | Ga0439448_0008821 | |||
| 1802 | Ga0439448_0012720 | |||
| 1803 | Ga0439432_109721 | |||
| 1804 | Ga0439455_0001877 | |||
| 1805 | Ga0439455_0026008 | |||
| 1806 | Ga0450914_016694 | |||
| 1807 | Ga0439458_0000234 | |||
| 1808 | Ga0466972_0007096 | |||
| 1809 | Ga0466972_0211013 | |||
| 1810 | Ga0466961_0145760 | |||
| 1811 | Ga0466961_0754341 | |||
| 1812 | Ga0466963_0045146 | |||
| 1813 | Ga0466964_0001667 | |||
| 1814 | Ga0466964_0048332 | |||
| 1815 | Ga0466971_0003839 | |||
| 1816 | Ga0466968_0152135 | |||
| 1817 | Ga0466970_0013581 | |||
| 1818 | Ga0466970_0071665 | |||
| 1819 | Ga0466957_0011181 | |||
| 1820 | Ga0466957_0134065 | |||
| 1821 | Ga0466957_0228127 | |||
| 1822 | Ga0466960_0018280 | |||
| 1823 | Ga0466959_0007287 | |||
| 1824 | Ga0451576_0000393 | |||
| 1825 | Ga0451576_1044552 | |||
| 1826 | Ga0466958_0017879 | |||
| 1827 | Ga0466958_0099321 | |||
| 1828 | Ga0466967_0045654 | |||
| 1829 | Ga0466967_0048001 | |||
| 1830 | Ga0495638_0000414 | |||
| 1831 | Ga0495638_0078887 | |||
| 1832 | Ga0495638_0582062 | |||
| 1833 | Ga0495650_0000172 | |||
| 1834 | Ga0495650_0039879 | |||
| 1835 | Ga0495650_0205230 | |||
| 1836 | Ga0495584_0241587 | |||
| 1837 | Ga0495585_0005045 | |||
| 1838 | Ga0495585_0085973 | |||
| 1839 | Ga0495596_0000203 | |||
| 1840 | Ga0495596_0021646 | |||
| 1841 | Ga0495583_0000286 | |||
| 1842 | Ga0495583_0001640 | |||
| 1843 | Ga0495583_0005542 | |||
| 1844 | Ga0495583_0011178 | |||
| 1845 | Ga0495606_0000963 | |||
| 1846 | Ga0495606_0001229 | |||
| 1847 | Ga0495606_0036857 | |||
| 1848 | Ga0495606_0039480 | |||
| 1849 | Ga0495606_0065858 | |||
| 1850 | Ga0495606_0070487 | |||
| 1851 | Ga0495610_0006251 | |||
| 1852 | Ga0495610_0207928 | |||
| 1853 | Ga0495616_0144257 | |||
| 1854 | Ga0495631_0027448 | |||
| 1855 | Ga0495637_0218112 | |||
| 1856 | Ga0495643_0000786 | |||
| 1857 | Ga0495643_0002044 | |||
| 1858 | Ga0495643_0053480 | |||
| 1859 | Ga0495643_0079391 | |||
| 1860 | Ga0495643_0167446 | |||
| 1861 | Ga0495648_0000782 | |||
| 1862 | Ga0495648_0074519 | |||
| 1863 | Ga0495648_0297664 | |||
| 1864 | Ga0495663_0006090 | |||
| 1865 | Ga0495663_0027062 | |||
| 1866 | Ga0495621_0067972 | |||
| 1867 | Ga0495633_0005249 | |||
| 1868 | Ga0495668_0000080 | |||
| 1869 | Ga0495668_0030463 | |||
| 1870 | Ga0495668_0417067 | |||
| 1871 | Ga0495611_0024359 | |||
| 1872 | Ga0495625_0000169 | |||
| 1873 | Ga0495625_0000492 | |||
| 1874 | Ga0495625_0000819 | |||
| 1875 | Ga0495625_0093957 | |||
| 1876 | Ga0495625_0311254 | |||
| 1877 | Ga0495625_0666275 | |||
| 1878 | Ga0495661_0089686 | |||
| 1879 | Ga0495661_0109316 | |||
| 1880 | Ga0495669_0000011 | |||
| 1881 | Ga0495670_0000056 | |||
| 1882 | Ga0495670_0014237 | |||
| 1883 | Ga0495649_0021504 | |||
| 1884 | Ga0495600_0051505 | |||
| 1885 | Ga0495660_0108292 | |||
| 1886 | Ga0495660_0115295 | |||
| 1887 | Ga0495683_0006885 | |||
| 1888 | Ga0495687_000684 | |||
| 1889 | Ga0495687_002397 | |||
| 1890 | Ga0495687_106813 | |||
| 1891 | Ga0495673_0005960 | |||
| 1892 | Ga0495673_0007812 | |||
| 1893 | Ga0495681_0018299 | |||
| 1894 | Ga0495681_0026759 | |||
| 1895 | Ga0495681_0141217 | |||
| 1896 | Ga0495686_0000701 | |||
| 1897 | Ga0495686_0003079 | |||
| 1898 | Ga0495686_0003843 | |||
| 1899 | Ga0495686_0194869 | |||
| 1900 | Ga0495686_0375312 | |||
| 1901 | Ga0495626_0000995 | |||
| 1902 | Ga0496100_0114388 | |||
| 1903 | Ga0496100_0912233 | |||
| 1904 | Ga0496101_0042986 | |||
| 1905 | Ga0496101_0240313 | |||
| 1906 | Ga0496101_0344814 | |||
| 1907 | Ga0496102_0000213 | |||
| 1908 | Ga0496102_0002236 | |||
| 1909 | Ga0496102_0013917 | |||
| 1910 | Ga0496103_0001102 | |||
| 1911 | Ga0496103_0001866 | |||
| 1912 | Ga0496103_0281318 | |||
| 1913 | Ga0496104_0005683 | |||
| 1914 | Ga0496104_0120878 | |||
| 1915 | Ga0496104_0122322 | |||
| 1916 | Ga0496104_1434224 | |||
| 1917 | Ga0496105_0000836 | |||
| 1918 | Ga0496105_0013563 | |||
| 1919 | Ga0496105_0032491 | |||
| 1920 | Ga0496105_0076967 | |||
| 1921 | Ga0496105_0253785 | |||
| 1922 | Ga0496106_0010856 | |||
| 1923 | Ga0496106_0073490 | |||
| 1924 | Ga0496107_0280736 | |||
| 1925 | Ga0496107_0593979 | |||
| 1926 | Ga0496108_1337030 | |||
| 1927 | Ga0496109_0120596 | |||
| 1928 | Ga0496109_0697809 | |||
| 1929 | Ga0496109_1211603 | |||
| 1930 | Ga0496110_0105763 | |||
| 1931 | Ga0496110_0182521 | |||
| 1932 | Ga0496110_0486634 | |||
| 1933 | Ga0496110_1468262 | |||
| 1934 | Ga0496111_0019440 | |||
| 1935 | Ga0496111_0024337 | |||
| 1936 | Ga0496111_0037996 | |||
| 1937 | Ga0496111_0076062 | |||
| 1938 | Ga0496111_0322926 | |||
| 1939 | Ga0496113_0058959 | |||
| 1940 | Ga0496113_0400702 | |||
| 1941 | Ga0496114_0006960 | |||
| 1942 | Ga0496115_0000030 | |||
| 1943 | Ga0496116_0000028 | |||
| 1944 | Ga0496116_0008331 | |||
| 1945 | Ga0496116_0052539 | |||
| 1946 | Ga0496116_0091919 | |||
| 1947 | Ga0496117_0005182 | |||
| 1948 | Ga0496117_0024164 | |||
| 1949 | Ga0496117_0029255 | |||
| 1950 | Ga0496117_0063227 | |||
| 1951 | Ga0496117_0114148 | |||
| 1952 | Ga0496117_0361003 | |||
| 1953 | Ga0496118_0000207 | |||
| 1954 | Ga0496118_0001886 | |||
| 1955 | Ga0496118_0010653 | |||
| 1956 | Ga0496118_0034205 | |||
| 1957 | Ga0496118_0069987 | |||
| 1958 | Ga0496118_0103051 | |||
| 1959 | Ga0496118_0113773 | |||
| 1960 | Ga0496119_0012406 | |||
| 1961 | Ga0496119_0013018 | |||
| 1962 | Ga0496119_0020775 | |||
| 1963 | Ga0496120_0023582 | |||
| 1964 | Ga0496120_0023713 | |||
| 1965 | Ga0496120_0216135 | |||
| 1966 | Ga0496121_0000017 | |||
| 1967 | Ga0496121_0000069 | |||
| 1968 | Ga0496121_0001274 | |||
| 1969 | Ga0496121_0002669 | |||
| 1970 | Ga0496121_0003231 | |||
| 1971 | Ga0496121_0018071 | |||
| 1972 | Ga0496121_0020984 | |||
| 1973 | Ga0496121_0071851 | |||
| 1974 | Ga0496121_0103504 | |||
| 1975 | Ga0496121_0209279 | |||
| 1976 | Ga0496121_0306596 | |||
| 1977 | Ga0496122_0004700 | |||
| 1978 | Ga0496122_0177425 | |||
| 1979 | Ga0496122_0416579 | |||
| 1980 | Ga0496123_0001360 | |||
| 1981 | Ga0496123_0043064 | |||
| 1982 | Ga0496123_0043471 | |||
| 1983 | Ga0496123_0196097 | |||
| 1984 | Ga0496123_0253647 | |||
| 1985 | Ga0496124_0001058 | |||
| 1986 | Ga0496124_0003665 | |||
| 1987 | Ga0496124_0004157 | |||
| 1988 | Ga0496124_0209931 | |||
| 1989 | Ga0496124_0568101 | |||
| 1990 | Ga0496124_0663947 | |||
| 1991 | Ga0496125_0001207 | |||
| 1992 | Ga0496125_0004729 | |||
| 1993 | Ga0496125_0032154 | |||
| 1994 | Ga0496125_0078900 | |||
| 1995 | Ga0496125_0079369 | |||
| 1996 | Ga0496125_0086015 | |||
| 1997 | Ga0496125_0490349 | |||
| 1998 | Ga0496126_0000124 | |||
| 1999 | Ga0496126_0001895 | |||
| 2000 | Ga0496126_0002142 | |||
| 2001 | Ga0496126_0002534 | |||
| 2002 | Ga0496126_0202877 | |||
| 2003 | Ga0496126_0279213 | |||
| 2004 | Ga0496126_0796577 | |||
| 2005 | Ga0495682_0014961 | |||
| 2006 | Ga0501314_000483 | |||
| 2007 | Ga0501031_0209943 | |||
| 2008 | Ga0501032_0066467 | |||
| 2009 | Ga0501033_0037080 | |||
| 2010 | Ga0501034_0001091 | |||
| 2011 | Ga0501034_0035819 | |||
| 2012 | Ga0501034_0197894 | |||
| 2013 | Ga0501034_0285407 | |||
| 2014 | Ga0501034_0432858 | |||
| 2015 | Ga0501036_0110973 | |||
| 2016 | Ga0501037_0052642 | |||
| 2017 | Ga0501038_0018286 | |||
| 2018 | Ga0501038_0100768 | |||
| 2019 | Ga0501043_0116803 | |||
| 2020 | Ga0501046_0365960 | |||
| 2021 | Ga0501047_0122208 | |||
| 2022 | Ga0501069_0010052 | |||
| 2023 | Ga0501070_0153960 | |||
| 2024 | Ga0501071_0147049 | |||
| 2025 | Ga0501076_0328060 | |||
| 2026 | Ga0501223_004174 | |||
| 2027 | Ga0501223_025784 | |||
| 2028 | Ga0501224_000027 | |||
| 2029 | Ga0501233_004186 | |||
| 2030 | Ga0501235_024630 | |||
| 2031 | Ga0501225_0000057 | |||
| 2032 | Ga0501234_002771 | |||
| 2033 | Ga0501080_0912732 | |||
| 2034 | Ga0501080_1181356 | |||
| 2035 | Ga0501083_0114285 | |||
| 2036 | Ga0501262_004171 | |||
| 2037 | Ga0501035_0024288 | |||
| 2038 | Ga0501035_0495676 | |||
| 2039 | Ga0501044_0013012 | |||
| 2040 | Ga0501044_0052175 | |||
| 2041 | Ga0501044_0475213 | |||
| 2042 | Ga0501044_0526347 | |||
| 2043 | Ga0501044_0599876 | |||
| 2044 | Ga0501226_001461 | |||
| 2045 | nmdc:mga03683_162_c1 | |||
| 2046 | nmdc:mga03n38_46774_c1 | |||
| 2047 | nmdc:mga03n38_520064_c1 | |||
| 2048 | nmdc:mga00v17_268262_c1 | |||
| 2049 | nmdc:mga00v17_45214_c1 | |||
| 2050 | nmdc:mga00v17_466554_c1 | |||
| 2051 | nmdc:mga00v17_676485_c1 | |||
| 2052 | nmdc:mga0yw44_89284_c1 | |||
| 2053 | nmdc:mga0k408_145641_c1 | |||
| 2054 | nmdc:mga0k408_765972_c1 | |||
| 2055 | nmdc:mga06z11_182_c1 | |||
| 2056 | nmdc:mga06z11_404536_c1 | |||
| 2057 | nmdc:mga04h51_252088_c1 | |||
| 2058 | nmdc:mga04h51_83_c1 | |||
| 2059 | nmdc:mga07m45_146885_c1 | |||
| 2060 | nmdc:mga07m45_32_c1 | |||
| 2061 | nmdc:mga07m45_450966_c1 | |||
| 2062 | nmdc:mga07m45_77392_c1 | |||
| 2063 | nmdc:mga0qj67_293097_c1 | |||
| 2064 | nmdc:mga0qj67_41529_c1 | |||
| 2065 | nmdc:mga0qj67_481221_c1 | |||
| 2066 | nmdc:mga0sz30_383076_c1 | |||
| 2067 | Ga0500610_0000034 | |||
| 2068 | Ga0500643_000803 | |||
| 2069 | Ga0500643_000972 | |||
| 2070 | Ga0500643_005262 | |||
| 2071 | Ga0500647_0108041 | |||
| 2072 | Ga0500583_0107988 | |||
| 2073 | Ga0500555_000591 | |||
| 2074 | Ga0500562_003139 | |||
| 2075 | Ga0500592_070547 | |||
| 2076 | Ga0500594_0237994 | |||
| 2077 | Ga0500595_000211 | |||
| 2078 | Ga0500608_000153 | |||
| 2079 | Ga0500614_155995 | |||
| 2080 | Ga0500618_000964 | |||
| 2081 | Ga0500559_0050061 | |||
| 2082 | Ga0500564_001024 | |||
| 2083 | Ga0500573_0086993 | |||
| 2084 | Ga0500573_0461907 | |||
| 2085 | Ga0500577_0147512 | |||
| 2086 | Ga0500590_009905 | |||
| 2087 | Ga0500604_0000146 | |||
| 2088 | Ga0500616_0059172 | |||
| 2089 | Ga0500622_0007706 | |||
| 2090 | Ga0500624_002499 | |||
| 2091 | Ga0500636_0010279 | |||
| 2092 | Ga0500636_0150096 | |||
| 2093 | Ga0500636_0462549 | |||
| 2094 | Ga0500567_004232 | |||
| 2095 | Ga0500625_000005 | |||
| 2096 | Ga0500645_000001 | |||
| 2097 | Ga0500645_017970 | |||
| 2098 | Ga0500645_072147 | |||
| 2099 | Ga0587085_162448 | |||
| 2100 | Ga0466962_0012254 | |||
| 2101 | 2509107760 | |||
| 2102 | 2509376141 | |||
| 2103 | 2511389409 | |||
| 2104 | 2512533130 | |||
| 2105 | 2524453066 | |||
| 2106 | 2558865547 | |||
| 2107 | 2558868376 | |||
| 2108 | 2643730730 | |||
| 2109 | 2644044617 | |||
| 2110 | 2644391458 | |||
| 2111 | 2738712449 | |||
| 2112 | 2738850857 | |||
| 2113 | 2738866603 | |||
| 2114 | 2739299104 | |||
| 2115 | 2739360799 | |||
| 2116 | 2739651334 | |||
| 2117 | 2740029807 | |||
| 2118 | 2753359609 | |||
| 2119 | 2757569945 | |||
| 2120 | 2758641869 | |||
| 2121 | 2765466044 | |||
| 2122 | 2776271692 | |||
| 2123 | 2776279795 | |||
| 2124 | 2819553412 | |||
| 2125 | 2839995228 | |||
| 2126 | 2840769987 | |||
| 2127 | 2842872779 | |||
| 2128 | 2850080921 | |||
| 2129 | 2852654634 | |||
| 2130 | 2876373375 | |||
| 2131 | 2881152153 | |||
| 2132 | 2881168136 | |||
| 2133 | 2882808607 | |||
| 2134 | 2889794654 | |||
| 2135 | 2889917868 | |||
| 2136 | 2894654604 | |||
| 2137 | 2894819886 | |||
| 2138 | 2896254454 | |||
| 2139 | 2904583318 | |||
| 2140 | 2915652998 | |||
| 2141 | 2919121062 | |||
| 2142 | 2921211294 | |||
| 2143 | 2928103501 | |||
| 2144 | 2928523211 | |||
| 2145 | 2928962812 | |||
| 2146 | 2954015481 | |||
| 2147 | 3002144049 | |||
| 2148 | 3003670257 | |||
| 2149 | 8001526622 | |||
| 2150 | 8045865579 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.9021 | 1 | 120 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.8961 | 1 | 120 |
| 4mts-assembly1.cif.gz_B | ni- and zn-bound gloa2 at high resolution | 0.8855 | 1 | 120 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.8782 | 1 | 120 |
| 2c21-assembly3.cif.gz_F | specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme | 0.8737 | 1 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9021 | 1 | 120 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8961 | 1 | 120 | 3.10.180.10 |
| 2c21D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8929 | 1 | 119 | 3.10.180.10 |
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8785 | 1 | 57 | 3.10.180.10 |
| af_A0A0R0LFH0_212_347_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.858 | 4 | 119 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520I3C9-F1-model_v4 | Lactoylglutathione lyase | 0.9987 | 1 | 57 |
GO:0016829
|
| AF-A0A520I3C9-F1-model_v4 | Lactoylglutathione lyase | 0.9815 | 1 | 57 |
GO:0016829
|
| AF-A0A3D2GKL9-F1-model_v4 | Lactoylglutathione lyase | 0.9574 | 69 | 137 |
GO:0016829
|
| AF-A0A654CBS1-F1-model_v4 | Lactoylglutathione lyase (EC 4.4.1.5) | 0.9523 | 1 | 137 |
GO:0004462
|
| AF-A0A3B0RZP6-F1-model_v4 | Lactoylglutathione lyase (EC 4.4.1.5) | 0.9486 | 1 | 137 |
GO:0004462
GO:0046872 |