F489556

General Info

Members Datasets Scaffolds Average Seq Length
1075 440 2150 141

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100063090|Ga0068860_1000630903
Length 166
Sequence VRNRCLRCPRFGRGGLLLFETIEEFLAVTRYLHTMIRVTDPDATVRFFNLIGLEEVRRFSNEQGRFTLIFLAAPGQAGVAEVELTYNWDPQEYTGGRNFGHLAYRVDNIYETCQRLVEAGVTINRPPRDGHMAFVRSPDGISVELLQDGHLPPQEPWASMPNTGSW

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
247 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
248 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
249 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
250 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
254 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
255 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
256 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
344 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
345 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
346 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
347 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
348 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
366 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
367 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
368 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
369 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
370 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
371 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
372 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
373 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
374 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
375 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
376 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
377 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
378 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
379 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
387 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
388 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
393 2509276019 Ensifer aridi TW10 Isolate Nodule
394 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
395 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
396 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
397 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
398 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
399 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
400 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
401 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
402 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
403 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
404 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
405 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
406 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
407 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
408 2751185800 Brucella pituitosa AA2 Isolate Unclassified
409 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
410 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
411 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
412 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
413 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
414 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
415 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
416 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
417 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
418 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
419 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
420 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
421 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
422 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
423 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
424 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
425 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
426 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
427 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
428 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
429 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
430 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
431 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
432 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
433 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
434 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
435 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
436 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
437 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
438 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
439 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
440 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0.19
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 1.49
Rhizoplane 4.47
Rhizosphere 73.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100063090 3300005843 Bacteria 3520
2 JGI24736J21556_1015550 3300001904 Bacteria 1218
3 JGI24752J21851_1000019 3300001976 Bacteria 18205
4 JGI24740J21852_10017003 3300001979 Bacteria 2612
5 JGI24740J21852_10075190 3300001979 Bacteria 895
6 JGI24740J21852_10101680 3300001979 Bacteria 731
7 JGI24739J22299_10001252 3300001989 Bacteria 9526
8 JGI24739J22299_10009714 3300001989 Bacteria 3580
9 JGI24739J22299_10054526 3300001989 Bacteria 1280
10 JGI24739J22299_10070483 3300001989 Bacteria 1088
11 JGI24737J22298_10001039 3300001990 Bacteria 9812
12 JGI24737J22298_10010383 3300001990 Bacteria 3074
13 JGI24737J22298_10028225 3300001990 Bacteria 1765
14 JGI24737J22298_10042305 3300001990 Bacteria 1396
15 JGI24737J22298_10129864 3300001990 Bacteria 744
16 JGI24743J22301_10036319 3300001991 Bacteria 981
17 JGI24735J21928_10000626 3300002067 Bacteria 12446
18 JGI24735J21928_10004199 3300002067 Bacteria 4863
19 JGI24735J21928_10016834 3300002067 Bacteria 2263
20 JGI24735J21928_10019673 3300002067 Bacteria 2074
21 JGI24735J21928_10021160 3300002067 Bacteria 1988
22 JGI24735J21928_10027327 3300002067 Bacteria 1710
23 JGI24735J21928_10045723 3300002067 Bacteria 1271
24 JGI24750J21931_1000043 3300002070 Bacteria 16792
25 JGI24748J21848_1000093 3300002074 Bacteria 24972
26 JGI24738J21930_10003215 3300002075 Bacteria 4170
27 JGI24738J21930_10003683 3300002075 Bacteria 3838
28 JGI24738J21930_10006892 3300002075 Bacteria 2639
29 JGI24744J21845_10003354 3300002077 Bacteria 3290
30 JGI24034J26672_10000032 3300002239 Bacteria 89175
31 JGI24034J26672_10000057 3300002239 Bacteria 42515
32 JGI24742J22300_10006451 3300002244 Bacteria 1939
33 JGI24751J29686_10004989 3300002459 Bacteria 2705
34 JGI25156J39149_1005233 3300002705 Bacteria 3793
35 JGI25157J39369_1000597 3300002741 Bacteria 21268
36 JGI25165J46597_1000188 3300003214 Bacteria 92329
37 JGI25153J46596_10000008 3300003215 Bacteria 376808
38 Ga0055525_1000063 3300003759 Bacteria 198877
39 Ga0055525_1000064 3300003759 Bacteria 198750
40 Ga0055542_1000123 3300003762 Bacteria 101557
41 Ga0055542_1011154 3300003762 Bacteria 1608
42 Ga0055529_1000144 3300003763 Bacteria 101557
43 Ga0055529_1019104 3300003763 Bacteria 857
44 Ga0055534_1015291 3300003784 Bacteria 1410
45 Ga0055530_10000526 3300003791 Bacteria 33232
46 Ga0055531_10000563 3300003794 Bacteria 32623
47 Ga0065165_1004625 3300005262 Bacteria 8363
48 Ga0065714_10511279 3300005288 Bacteria 518
49 Ga0065704_10001466 3300005289 Bacteria 8454
50 Ga0065704_10450884 3300005289 Bacteria 690
51 Ga0065712_10484986 3300005290 Bacteria 660
52 Ga0065715_10187962 3300005293 Bacteria 1421
53 Ga0065707_10294859 3300005295 Bacteria 1017
54 Ga0070658_10000003 3300005327 Bacteria 465963
55 Ga0070658_10000083 3300005327 Bacteria 89189
56 Ga0070658_10000688 3300005327 Bacteria 29272
57 Ga0070658_10002274 3300005327 Bacteria 16105
58 Ga0070658_10006725 3300005327 Bacteria 9314
59 Ga0070658_10096964 3300005327 Bacteria 2435
60 Ga0070658_10151357 3300005327 Bacteria 1943
61 Ga0070658_10238578 3300005327 Bacteria 1540
62 Ga0070658_10410091 3300005327 Bacteria 1164
63 Ga0070676_10006658 3300005328 Bacteria 6186
64 Ga0070676_10050811 3300005328 Bacteria 2432
65 Ga0070676_10298533 3300005328 Bacteria 1091
66 Ga0070683_100412488 3300005329 Bacteria 1288
67 Ga0070690_100000011 3300005330 Bacteria 95472
68 Ga0070690_100410640 3300005330 Bacteria 996
69 Ga0070690_100595509 3300005330 Bacteria 839
70 Ga0070670_100026386 3300005331 Bacteria 5000
71 Ga0070670_100546775 3300005331 Bacteria 1033
72 Ga0070670_100973530 3300005331 Bacteria 771
73 Ga0070677_10001076 3300005333 Bacteria 8820
74 Ga0068869_100000353 3300005334 Bacteria 24652
75 Ga0068869_100813174 3300005334 Bacteria 804
76 Ga0070666_10000035 3300005335 Bacteria 121458
77 Ga0070666_10105789 3300005335 Bacteria 1944
78 Ga0070666_10235104 3300005335 Bacteria 1295
79 Ga0070666_10541233 3300005335 Bacteria 846
80 Ga0070680_100047705 3300005336 Bacteria 3488
81 Ga0070680_100249735 3300005336 Bacteria 1500
82 Ga0070682_100809718 3300005337 Bacteria 762
83 Ga0068868_100000154 3300005338 Bacteria 44616
84 Ga0068868_100565163 3300005338 Bacteria 1004
85 Ga0070660_100000122 3300005339 Bacteria 49000
86 Ga0070660_100001677 3300005339 Bacteria 15200
87 Ga0070660_100024829 3300005339 Bacteria 4451
88 Ga0070660_100027823 3300005339 Bacteria 4223
89 Ga0070660_100156120 3300005339 Bacteria 1837
90 Ga0070660_100198027 3300005339 Bacteria 1629
91 Ga0070660_100764720 3300005339 Bacteria 811
92 Ga0070689_100002629 3300005340 Bacteria 11763
93 Ga0070689_100224932 3300005340 Bacteria 1541
94 Ga0070661_100287576 3300005344 Bacteria 1277
95 Ga0070692_10000999 3300005345 Bacteria 9709
96 Ga0070692_10130743 3300005345 Bacteria 1411
97 Ga0070692_10859070 3300005345 Bacteria 624
98 Ga0070668_100018658 3300005347 Bacteria 5207
99 Ga0070668_100047927 3300005347 Bacteria 3286
100 Ga0070668_100059247 3300005347 Bacteria 2963
101 Ga0070668_100387063 3300005347 Bacteria 1191
102 Ga0070668_100479801 3300005347 Bacteria 1073
103 Ga0070668_100548675 3300005347 Bacteria 1006
104 Ga0070668_101121098 3300005347 Bacteria 711
105 Ga0070669_100000489 3300005353 Bacteria 29993
106 Ga0070669_100005417 3300005353 Bacteria 9202
107 Ga0070669_100007896 3300005353 Bacteria 7604
108 Ga0070669_100025696 3300005353 Bacteria 4230
109 Ga0070669_100423423 3300005353 Bacteria 1093
110 Ga0070669_100768723 3300005353 Bacteria 817
111 Ga0070669_101618640 3300005353 Bacteria 564
112 Ga0070675_100005433 3300005354 Bacteria 9742
113 Ga0070675_100013018 3300005354 Bacteria 6533
114 Ga0070671_100000062 3300005355 Bacteria 73417
115 Ga0070671_100002103 3300005355 Bacteria 15362
116 Ga0070671_100019498 3300005355 Bacteria 5521
117 Ga0070671_100029468 3300005355 Bacteria 4526
118 Ga0070671_100146891 3300005355 Bacteria 1990
119 Ga0070671_100152869 3300005355 Bacteria 1949
120 Ga0070671_100191148 3300005355 Bacteria 1735
121 Ga0070671_101422404 3300005355 Bacteria 613
122 Ga0070674_100032397 3300005356 Bacteria 3471
123 Ga0070674_100105593 3300005356 Bacteria 2060
124 Ga0070674_100250861 3300005356 Bacteria 1390
125 Ga0070673_100000023 3300005364 Bacteria 91936
126 Ga0070673_101796393 3300005364 Bacteria 581
127 Ga0070688_100013357 3300005365 Bacteria 4627
128 Ga0070688_100172275 3300005365 Bacteria 1495
129 Ga0070659_100022977 3300005366 Bacteria 4768
130 Ga0070659_100213271 3300005366 Bacteria 1591
131 Ga0070659_100297325 3300005366 Bacteria 1345
132 Ga0070659_100302867 3300005366 Bacteria 1333
133 Ga0070659_100345858 3300005366 Bacteria 1247
134 Ga0070667_100014076 3300005367 Bacteria 6610
135 Ga0070667_100041273 3300005367 Bacteria 3871
136 Ga0070667_100052266 3300005367 Bacteria 3447
137 Ga0070667_100065840 3300005367 Bacteria 3077
138 Ga0070667_100110830 3300005367 Bacteria 2380
139 Ga0070667_100358264 3300005367 Bacteria 1322
140 Ga0070667_100553263 3300005367 Bacteria 1058
141 Ga0070714_100157342 3300005435 Bacteria 2052
142 Ga0070663_100099017 3300005455 Bacteria 2173
143 Ga0070663_100224772 3300005455 Bacteria 1475
144 Ga0070663_100464919 3300005455 Bacteria 1045
145 Ga0070678_100167540 3300005456 Bacteria 1786
146 Ga0070678_100250631 3300005456 Bacteria 1485
147 Ga0070678_100536467 3300005456 Bacteria 1037
148 Ga0070662_100003750 3300005457 Bacteria 9511
149 Ga0070662_100190951 3300005457 Bacteria 1620
150 Ga0070662_100284947 3300005457 Bacteria 1338
151 Ga0070662_100359418 3300005457 Bacteria 1194
152 Ga0070662_100427135 3300005457 Bacteria 1097
153 Ga0070662_100552669 3300005457 Bacteria 965
154 Ga0070662_100595219 3300005457 Bacteria 930
155 Ga0070662_101997956 3300005457 Bacteria 501
156 Ga0070681_10363840 3300005458 Bacteria 1357
157 Ga0070681_10636137 3300005458 Bacteria 981
158 Ga0068867_100000007 3300005459 Bacteria 148726
159 Ga0070685_10000168 3300005466 Bacteria 43369
160 Ga0070679_100239051 3300005530 Bacteria 1774
161 Ga0068853_100113724 3300005539 Bacteria 2407
162 Ga0068853_100617010 3300005539 Bacteria 1031
163 Ga0070672_100046111 3300005543 Bacteria 3376
164 Ga0070672_100222284 3300005543 Bacteria 1584
165 Ga0070672_101221027 3300005543 Bacteria 670
166 Ga0070686_100000035 3300005544 Bacteria 108191
167 Ga0070696_100186631 3300005546 Bacteria 1541
168 Ga0070693_100167685 3300005547 Bacteria 1404
169 Ga0070693_101049445 3300005547 Bacteria 619
170 Ga0070665_100000023 3300005548 Bacteria 375278
171 Ga0070665_100000161 3300005548 Bacteria 122088
172 Ga0070665_100003713 3300005548 Bacteria 16167
173 Ga0070665_100042108 3300005548 Bacteria 4590
174 Ga0070665_100045411 3300005548 Bacteria 4412
175 Ga0070665_100716089 3300005548 Bacteria 1014
176 Ga0070665_100781373 3300005548 Bacteria 968
177 Ga0068855_100000029 3300005563 Bacteria 171278
178 Ga0068855_100121035 3300005563 Bacteria 2995
179 Ga0068855_100294989 3300005563 Bacteria 1797
180 Ga0068855_100470742 3300005563 Bacteria 1369
181 Ga0068855_100529651 3300005563 Bacteria 1277
182 Ga0068855_101237351 3300005563 Bacteria 775
183 Ga0070664_100232255 3300005564 Bacteria 1653
184 Ga0068857_100056230 3300005577 Bacteria 3492
185 Ga0068857_100155804 3300005577 Bacteria 2071
186 Ga0068857_100278173 3300005577 Bacteria 1539
187 Ga0068857_101015622 3300005577 Bacteria 799
188 Ga0068854_100000751 3300005578 Bacteria 19185
189 Ga0068854_100011157 3300005578 Bacteria 5837
190 Ga0068854_100020920 3300005578 Bacteria 4433
191 Ga0068854_100185355 3300005578 Bacteria 1628
192 Ga0068854_100429597 3300005578 Bacteria 1099
193 Ga0068854_100657243 3300005578 Bacteria 901
194 Ga0068854_101474412 3300005578 Bacteria 617
195 Ga0068856_100018774 3300005614 Bacteria 6706
196 Ga0068856_100213696 3300005614 Bacteria 1944
197 Ga0068856_100818976 3300005614 Bacteria 950
198 Ga0068856_101336026 3300005614 Bacteria 732
199 Ga0070702_100625054 3300005615 Bacteria 811
200 Ga0068852_100001445 3300005616 Bacteria 16023
201 Ga0068852_100091530 3300005616 Bacteria 2722
202 Ga0068852_100236595 3300005616 Bacteria 1743
203 Ga0068852_100253593 3300005616 Bacteria 1687
204 Ga0068859_100006370 3300005617 Bacteria 11972
205 Ga0068859_100041543 3300005617 Bacteria 4619
206 Ga0068859_100059777 3300005617 Bacteria 3840
207 Ga0068864_100022346 3300005618 Bacteria 5304
208 Ga0068864_100035786 3300005618 Bacteria 4228
209 Ga0068861_100000615 3300005719 Bacteria 21144
210 Ga0068851_10030453 3300005834 Bacteria 2676
211 Ga0068851_10416667 3300005834 Bacteria 793
212 Ga0068870_10114066 3300005840 Bacteria 1547
213 Ga0068863_100000060 3300005841 Bacteria 122123
214 Ga0068863_100000106 3300005841 Bacteria 90344
215 Ga0068863_100000617 3300005841 Bacteria 36076
216 Ga0068863_100042301 3300005841 Bacteria 4329
217 Ga0068863_100461697 3300005841 Bacteria 1247
218 Ga0068863_101456917 3300005841 Bacteria 693
219 Ga0068863_102100018 3300005841 Bacteria 575
220 Ga0068863_102613081 3300005841 Bacteria 514
221 Ga0068858_100000157 3300005842 Bacteria 72055
222 Ga0068858_100002890 3300005842 Bacteria 17268
223 Ga0068858_100009717 3300005842 Bacteria 9160
224 Ga0068858_100112840 3300005842 Bacteria 2538
225 Ga0068860_100000126 3300005843 Bacteria 122923
226 Ga0068860_100000168 3300005843 Bacteria 107408
227 Ga0068860_100000680 3300005843 Bacteria 39339
228 Ga0068860_100589292 3300005843 Bacteria 1116
229 Ga0068862_100000146 3300005844 Bacteria 80138
230 Ga0068862_100000193 3300005844 Bacteria 67697
231 Ga0068862_100004291 3300005844 Bacteria 12061
232 Ga0068862_100004770 3300005844 Bacteria 11410
233 Ga0068862_100377737 3300005844 Bacteria 1321
234 Ga0068862_101521236 3300005844 Bacteria 675
235 Ga0081455_10794787 3300005937 Bacteria 594
236 Ga0081540_1105146 3300005983 Bacteria 1206
237 Ga0075365_10119434 3300006038 Bacteria 1817
238 Ga0075368_10000037 3300006042 Bacteria 31007
239 Ga0075368_10002121 3300006042 Bacteria 6402
240 Ga0075368_10011362 3300006042 Bacteria 3238
241 Ga0075363_100008002 3300006048 Bacteria 4898
242 Ga0075363_100059341 3300006048 Bacteria 2057
243 Ga0075364_10077215 3300006051 Bacteria 2198
244 Ga0075364_10088769 3300006051 Bacteria 2050
245 Ga0075364_10136370 3300006051 Bacteria 1649
246 Ga0075364_10532920 3300006051 Bacteria 803
247 Ga0075364_10766835 3300006051 Bacteria 658
248 Ga0075362_10002084 3300006177 Bacteria 6601
249 Ga0075362_10468086 3300006177 Bacteria 642
250 Ga0075367_10001103 3300006178 Bacteria 11168
251 Ga0075367_10095170 3300006178 Bacteria 1816
252 Ga0075369_10037806 3300006186 Bacteria 2057
253 Ga0075366_10018983 3300006195 Bacteria 3974
254 Ga0075366_10019187 3300006195 Bacteria 3953
255 Ga0075366_10029450 3300006195 Bacteria 3225
256 Ga0075366_10127430 3300006195 Bacteria 1535
257 Ga0075366_10174805 3300006195 Bacteria 1304
258 Ga0075366_10307203 3300006195 Bacteria 971
259 Ga0097621_101442686 3300006237 Bacteria 652
260 Ga0075370_10079240 3300006353 Bacteria 1887
261 Ga0075370_10388191 3300006353 Bacteria 837
262 Ga0075370_10473819 3300006353 Bacteria 754
263 Ga0068871_100051306 3300006358 Bacteria 3340
264 Ga0068871_101788012 3300006358 Bacteria 583
265 Ga0068871_101997439 3300006358 Bacteria 552
266 Ga0075430_100007359 3300006846 Bacteria 9301
267 Ga0075430_100071070 3300006846 Bacteria 2920
268 Ga0075430_100119423 3300006846 Bacteria 2197
269 Ga0068865_100000010 3300006881 Bacteria 159548
270 Ga0097620_100006370 3300006931 Bacteria 11972
271 Ga0097620_100041543 3300006931 Bacteria 4619
272 Ga0097620_100059776 3300006931 Bacteria 3840
273 Ga0079104_1003382 3300006946 Bacteria 7483
274 Ga0079104_1004641 3300006946 Bacteria 5775
275 Ga0079104_1036606 3300006946 Bacteria 1176
276 Ga0105251_10001266 3300009011 Bacteria 21849
277 Ga0105251_10182084 3300009011 Bacteria 946
278 Ga0105240_10004083 3300009093 Bacteria 22457
279 Ga0105240_10333520 3300009093 Bacteria 1725
280 Ga0105240_12750275 3300009093 Bacteria 507
281 Ga0111539_13024116 3300009094 Bacteria 543
282 Ga0105245_10001496 3300009098 Bacteria 21142
283 Ga0105245_10007145 3300009098 Bacteria 9794
284 Ga0105247_10001477 3300009101 Bacteria 16935
285 Ga0105247_10056974 3300009101 Bacteria 2415
286 Ga0105247_10230863 3300009101 Bacteria 1256
287 Ga0105247_10402689 3300009101 Bacteria 975
288 Ga0105247_10601036 3300009101 Bacteria 816
289 Ga0105243_10000054 3300009148 Bacteria 136517
290 Ga0105243_10101399 3300009148 Bacteria 2390
291 Ga0105243_11109481 3300009148 Bacteria 800
292 Ga0105241_10034303 3300009174 Bacteria 3812
293 Ga0105241_10328204 3300009174 Bacteria 1321
294 Ga0105241_10706302 3300009174 Bacteria 921
295 Ga0105242_10000210 3300009176 Bacteria 45627
296 Ga0105248_10004792 3300009177 Bacteria 14977
297 Ga0105248_10007222 3300009177 Bacteria 12185
298 Ga0105248_10025331 3300009177 Bacteria 6595
299 Ga0105248_10137987 3300009177 Bacteria 2751
300 Ga0105248_10229002 3300009177 Bacteria 2092
301 Ga0105248_10398217 3300009177 Bacteria 1550
302 Ga0105237_10083217 3300009545 Bacteria 3191
303 Ga0105237_10317656 3300009545 Bacteria 1561
304 Ga0105237_10791679 3300009545 Bacteria 955
305 Ga0105237_11125569 3300009545 Bacteria 792
306 Ga0105238_10010681 3300009551 Bacteria 9221
307 Ga0105238_10010889 3300009551 Bacteria 9140
308 Ga0105238_10302286 3300009551 Bacteria 1584
309 Ga0105238_11008023 3300009551 Bacteria 854
310 Ga0105238_12059342 3300009551 Bacteria 605
311 Ga0105238_12255281 3300009551 Bacteria 579
312 Ga0105249_10000002 3300009553 Bacteria 376207
313 Ga0105249_10000094 3300009553 Bacteria 122611
314 Ga0105249_10013736 3300009553 Bacteria 7150
315 Ga0105249_10172798 3300009553 Bacteria 2097
316 Ga0105239_10000031 3300010375 Bacteria 226947
317 Ga0105239_10829219 3300010375 Bacteria 1060
318 Ga0105239_10851605 3300010375 Bacteria 1045
319 Ga0105239_11390536 3300010375 Bacteria 810
320 Ga0105246_10022917 3300011119 Bacteria 4035
321 Ga0105246_10357559 3300011119 Bacteria 1199
322 Ga0157373_10054363 3300013100 Bacteria 2845
323 Ga0157373_11169411 3300013100 Bacteria 579
324 Ga0157371_10023965 3300013102 Bacteria 4459
325 Ga0157371_10819125 3300013102 Bacteria 702
326 Ga0157371_11117534 3300013102 Bacteria 605
327 Ga0157370_10004235 3300013104 Bacteria 16599
328 Ga0157370_10615244 3300013104 Bacteria 994
329 Ga0157370_11540782 3300013104 Bacteria 597
330 Ga0157370_11687144 3300013104 Bacteria 569
331 Ga0157369_10020716 3300013105 Bacteria 7352
332 Ga0157369_10444132 3300013105 Bacteria 1343
333 Ga0157369_10645368 3300013105 Bacteria 1092
334 Ga0157374_10007279 3300013296 Bacteria 9430
335 Ga0157374_10292932 3300013296 Bacteria 1609
336 Ga0157374_10326710 3300013296 Bacteria 1521
337 Ga0157378_10020119 3300013297 Bacteria 5869
338 Ga0157378_10051802 3300013297 Bacteria 3652
339 Ga0157378_10513758 3300013297 Bacteria 1198
340 Ga0163162_10151250 3300013306 Bacteria 2439
341 Ga0163162_11005798 3300013306 Bacteria 943
342 Ga0157372_10014562 3300013307 Bacteria 8412
343 Ga0157372_10172216 3300013307 Bacteria 2505
344 Ga0157372_10227903 3300013307 Bacteria 2160
345 Ga0157372_10317339 3300013307 Bacteria 1814
346 Ga0157372_10460050 3300013307 Bacteria 1483
347 Ga0157372_10563651 3300013307 Bacteria 1328
348 Ga0157375_10003825 3300013308 Bacteria 13053
349 Ga0157375_10724994 3300013308 Bacteria 1147
350 Ga0163163_10033187 3300014325 Bacteria 4991
351 Ga0163163_10204153 3300014325 Bacteria 2025
352 Ga0163163_11564186 3300014325 Bacteria 720
353 Ga0157380_10000851 3300014326 Bacteria 19120
354 Ga0157380_10037643 3300014326 Bacteria 3749
355 Ga0157380_11039458 3300014326 Bacteria 855
356 Ga0157377_11431264 3300014745 Bacteria 546
357 Ga0157379_10005418 3300014968 Bacteria 10961
358 Ga0157379_10659973 3300014968 Bacteria 980
359 Ga0157376_10000047 3300014969 Bacteria 107974
360 Ga0163161_10002507 3300017792 Bacteria 13096
361 Ga0163161_10004251 3300017792 Bacteria 9991
362 Ga0163161_10080010 3300017792 Bacteria 2404
363 Ga0214542_1055259 3300021321 Bacteria 691
364 Ga0214543_1000173 3300021327 Bacteria 93894
365 Ga0213875_10038209 3300021388 Bacteria 2262
366 Ga0209563_100066 3300025230 Bacteria 257382
367 Ga0207427_109532 3300025231 Bacteria 1041
368 Ga0209646_1023471 3300025246 Bacteria 874
369 Ga0209026_1000002 3300025250 Bacteria 1136158
370 Ga0209026_1003041 3300025250 Bacteria 5766
371 Ga0209148_1000011 3300025254 Bacteria 1196503
372 Ga0209148_1000061 3300025254 Bacteria 349575
373 Ga0209148_1002311 3300025254 Bacteria 6820
374 Ga0209759_1000062 3300025256 Bacteria 197996
375 Ga0209233_1000052 3300025261 Bacteria 445813
376 Ga0209233_1000120 3300025261 Bacteria 233311
377 Ga0209233_1023172 3300025261 Bacteria 1576
378 Ga0209565_1032271 3300025263 Bacteria 1014
379 Ga0209455_1000006 3300025272 Bacteria 1196503
380 Ga0209455_1000972 3300025272 Bacteria 14510
381 Ga0209455_1017111 3300025272 Bacteria 1535
382 Ga0207673_1064185 3300025290 Bacteria 523
383 Ga0209675_1000137 3300025291 Bacteria 98902
384 Ga0209676_1000883 3300025292 Bacteria 38382
385 Ga0209676_1001128 3300025292 Bacteria 29355
386 Ga0209025_1020063 3300025294 Bacteria 3678
387 Ga0209025_1032667 3300025294 Bacteria 2426
388 Ga0209758_1000017 3300025297 Bacteria 754393
389 Ga0209050_1000119 3300025298 Bacteria 200661
390 Ga0209050_1000400 3300025298 Bacteria 81202
391 Ga0209050_1001243 3300025298 Bacteria 29491
392 Ga0209257_1000250 3300025304 Bacteria 124024
393 Ga0209257_1000603 3300025304 Bacteria 59325
394 Ga0209257_1002085 3300025304 Bacteria 21046
395 Ga0209257_1022922 3300025304 Bacteria 2212
396 Ga0209257_1033784 3300025304 Bacteria 1604
397 Ga0207697_10085510 3300025315 Bacteria 1332
398 Ga0207697_10549307 3300025315 Bacteria 508
399 Ga0207656_10053455 3300025321 Bacteria 1753
400 Ga0207656_10063181 3300025321 Bacteria 1629
401 Ga0207656_10218080 3300025321 Bacteria 926
402 Ga0207713_1010768 3300025735 Bacteria 5036
403 Ga0207682_10000505 3300025893 Bacteria 17929
404 Ga0207710_10001911 3300025900 Bacteria 9984
405 Ga0207710_10324522 3300025900 Bacteria 781
406 Ga0207688_10039994 3300025901 Bacteria 2605
407 Ga0207688_10516620 3300025901 Bacteria 749
408 Ga0207688_10951548 3300025901 Bacteria 543
409 Ga0207680_10000007 3300025903 Bacteria 623574
410 Ga0207680_11117599 3300025903 Bacteria 563
411 Ga0207647_10000270 3300025904 Bacteria 42605
412 Ga0207647_10001030 3300025904 Bacteria 21610
413 Ga0207647_10002997 3300025904 Bacteria 12709
414 Ga0207647_10008132 3300025904 Bacteria 7537
415 Ga0207647_10018008 3300025904 Bacteria 4789
416 Ga0207647_10103636 3300025904 Bacteria 1686
417 Ga0207647_10173756 3300025904 Bacteria 1254
418 Ga0207645_10003775 3300025907 Bacteria 11381
419 Ga0207645_10014073 3300025907 Bacteria 5362
420 Ga0207643_10321138 3300025908 Bacteria 967
421 Ga0207705_10000005 3300025909 Bacteria 673478
422 Ga0207705_10000316 3300025909 Bacteria 44059
423 Ga0207705_10000340 3300025909 Bacteria 42251
424 Ga0207705_10012135 3300025909 Bacteria 6226
425 Ga0207705_10073287 3300025909 Bacteria 2484
426 Ga0207705_10113946 3300025909 Bacteria 2000
427 Ga0207705_10174715 3300025909 Bacteria 1618
428 Ga0207705_11055103 3300025909 Bacteria 627
429 Ga0207654_10008007 3300025911 Bacteria 5328
430 Ga0207707_10445324 3300025912 Bacteria 1109
431 Ga0207707_11354760 3300025912 Bacteria 569
432 Ga0207695_10015209 3300025913 Bacteria 9074
433 Ga0207695_10127995 3300025913 Bacteria 2499
434 Ga0207695_11740006 3300025913 Bacteria 504
435 Ga0207671_10034401 3300025914 Bacteria 3764
436 Ga0207671_10052103 3300025914 Bacteria 3032
437 Ga0207671_11182956 3300025914 Bacteria 599
438 Ga0207657_10000832 3300025919 Bacteria 32589
439 Ga0207657_10007820 3300025919 Bacteria 10910
440 Ga0207657_10018806 3300025919 Bacteria 6579
441 Ga0207657_10021901 3300025919 Bacteria 6002
442 Ga0207657_10022634 3300025919 Bacteria 5875
443 Ga0207657_10086509 3300025919 Bacteria 2623
444 Ga0207657_10093489 3300025919 Bacteria 2504
445 Ga0207657_10178902 3300025919 Bacteria 1715
446 Ga0207649_10207523 3300025920 Bacteria 1388
447 Ga0207649_10214589 3300025920 Bacteria 1367
448 Ga0207649_11336078 3300025920 Bacteria 567
449 Ga0207652_10538495 3300025921 Bacteria 1050
450 Ga0207681_10000053 3300025923 Bacteria 110626
451 Ga0207681_10002314 3300025923 Bacteria 12113
452 Ga0207681_10008412 3300025923 Bacteria 6306
453 Ga0207681_10011479 3300025923 Bacteria 5444
454 Ga0207681_10100199 3300025923 Bacteria 2088
455 Ga0207681_10785634 3300025923 Bacteria 795
456 Ga0207681_11389497 3300025923 Bacteria 589
457 Ga0207694_10016121 3300025924 Bacteria 5639
458 Ga0207694_10176560 3300025924 Bacteria 1731
459 Ga0207694_10326340 3300025924 Bacteria 1267
460 Ga0207694_10440264 3300025924 Bacteria 1087
461 Ga0207694_11204932 3300025924 Bacteria 641
462 Ga0207650_10037516 3300025925 Bacteria 3532
463 Ga0207650_10068113 3300025925 Bacteria 2672
464 Ga0207650_10207795 3300025925 Bacteria 1571
465 Ga0207650_10645301 3300025925 Bacteria 892
466 Ga0207650_10893881 3300025925 Bacteria 754
467 Ga0207659_10004630 3300025926 Bacteria 8327
468 Ga0207659_10024906 3300025926 Bacteria 4016
469 Ga0207687_10001694 3300025927 Bacteria 15197
470 Ga0207687_10005171 3300025927 Bacteria 8651
471 Ga0207664_10110773 3300025929 Bacteria 2283
472 Ga0207644_10000005 3300025931 Bacteria 441948
473 Ga0207644_10000242 3300025931 Bacteria 37472
474 Ga0207644_10000964 3300025931 Bacteria 18357
475 Ga0207644_10009287 3300025931 Bacteria 6454
476 Ga0207644_10115903 3300025931 Bacteria 2032
477 Ga0207644_10149378 3300025931 Bacteria 1807
478 Ga0207644_10424638 3300025931 Bacteria 1089
479 Ga0207644_11680972 3300025931 Bacteria 532
480 Ga0207690_10006391 3300025932 Bacteria 6985
481 Ga0207690_10110934 3300025932 Bacteria 1976
482 Ga0207690_10328563 3300025932 Bacteria 1204
483 Ga0207690_10453815 3300025932 Bacteria 1031
484 Ga0207690_10543304 3300025932 Bacteria 944
485 Ga0207690_11316159 3300025932 Bacteria 604
486 Ga0207706_10014101 3300025933 Bacteria 7247
487 Ga0207706_10045638 3300025933 Bacteria 3882
488 Ga0207706_10053172 3300025933 Bacteria 3575
489 Ga0207706_10060688 3300025933 Bacteria 3330
490 Ga0207706_10154593 3300025933 Bacteria 2018
491 Ga0207706_10156031 3300025933 Bacteria 2007
492 Ga0207706_10672610 3300025933 Bacteria 886
493 Ga0207706_10674918 3300025933 Bacteria 884
494 Ga0207686_10000598 3300025934 Bacteria 22543
495 Ga0207709_10000050 3300025935 Bacteria 234391
496 Ga0207709_10122482 3300025935 Bacteria 1758
497 Ga0207670_10009646 3300025936 Bacteria 5517
498 Ga0207670_10193618 3300025936 Bacteria 1540
499 Ga0207669_10009567 3300025937 Bacteria 4626
500 Ga0207669_10169779 3300025937 Bacteria 1551
501 Ga0207669_10224758 3300025937 Bacteria 1380
502 Ga0207704_10000020 3300025938 Bacteria 148847
503 Ga0207704_11032711 3300025938 Bacteria 696
504 Ga0207691_10331253 3300025940 Bacteria 1304
505 Ga0207691_10477160 3300025940 Bacteria 1060
506 Ga0207691_10533400 3300025940 Bacteria 996
507 Ga0207711_10001087 3300025941 Bacteria 25938
508 Ga0207711_10006515 3300025941 Bacteria 9832
509 Ga0207711_10022035 3300025941 Bacteria 5324
510 Ga0207711_10542889 3300025941 Bacteria 1084
511 Ga0207711_11360092 3300025941 Bacteria 652
512 Ga0207711_11405996 3300025941 Bacteria 640
513 Ga0207689_10001110 3300025942 Bacteria 25930
514 Ga0207689_10181463 3300025942 Bacteria 1736
515 Ga0207689_10867355 3300025942 Bacteria 762
516 Ga0207661_10390443 3300025944 Bacteria 1261
517 Ga0207679_10159802 3300025945 Bacteria 1844
518 Ga0207679_10391622 3300025945 Bacteria 1220
519 Ga0207667_10000035 3300025949 Bacteria 301056
520 Ga0207667_10031919 3300025949 Bacteria 5680
521 Ga0207667_10351219 3300025949 Bacteria 1504
522 Ga0207667_10512940 3300025949 Bacteria 1215
523 Ga0207667_10565217 3300025949 Bacteria 1149
524 Ga0207667_10884162 3300025949 Bacteria 886
525 Ga0207667_11360958 3300025949 Bacteria 684
526 Ga0207651_10000005 3300025960 Bacteria 246132
527 Ga0207651_10184309 3300025960 Bacteria 1659
528 Ga0207651_10390156 3300025960 Bacteria 1182
529 Ga0207712_10000002 3300025961 Bacteria 706628
530 Ga0207712_10000004 3300025961 Bacteria 614655
531 Ga0207712_10039051 3300025961 Bacteria 3250
532 Ga0207712_10132626 3300025961 Bacteria 1900
533 Ga0207668_10004132 3300025972 Bacteria 8518
534 Ga0207668_10034891 3300025972 Bacteria 3345
535 Ga0207668_10056180 3300025972 Bacteria 2740
536 Ga0207668_10103299 3300025972 Bacteria 2122
537 Ga0207668_10170441 3300025972 Bacteria 1706
538 Ga0207668_10208760 3300025972 Bacteria 1561
539 Ga0207668_10499797 3300025972 Bacteria 1046
540 Ga0207640_10000436 3300025981 Bacteria 25464
541 Ga0207640_10007861 3300025981 Bacteria 5883
542 Ga0207640_10041447 3300025981 Bacteria 2928
543 Ga0207640_10070511 3300025981 Bacteria 2351
544 Ga0207640_10071071 3300025981 Bacteria 2343
545 Ga0207640_10274695 3300025981 Bacteria 1320
546 Ga0207640_10284936 3300025981 Bacteria 1300
547 Ga0207640_10627893 3300025981 Bacteria 913
548 Ga0207658_10000865 3300025986 Bacteria 25306
549 Ga0207658_10007156 3300025986 Bacteria 7604
550 Ga0207658_10016492 3300025986 Bacteria 5080
551 Ga0207658_10183814 3300025986 Bacteria 1732
552 Ga0207677_10001245 3300026023 Bacteria 13747
553 Ga0207677_11538829 3300026023 Bacteria 615
554 Ga0207703_10000095 3300026035 Bacteria 104227
555 Ga0207703_10005905 3300026035 Bacteria 9813
556 Ga0207639_10006866 3300026041 Bacteria 7754
557 Ga0207639_10277737 3300026041 Bacteria 1472
558 Ga0207639_10310222 3300026041 Bacteria 1397
559 Ga0207639_10369132 3300026041 Bacteria 1286
560 Ga0207639_10971264 3300026041 Bacteria 795
561 Ga0207639_11171880 3300026041 Bacteria 721
562 Ga0207639_11669602 3300026041 Bacteria 597
563 Ga0207639_11782712 3300026041 Bacteria 576
564 Ga0207678_10001958 3300026067 Bacteria 18768
565 Ga0207678_10012101 3300026067 Bacteria 7576
566 Ga0207678_10314458 3300026067 Bacteria 1347
567 Ga0207678_10567166 3300026067 Bacteria 994
568 Ga0207702_10005556 3300026078 Bacteria 11009
569 Ga0207702_10011049 3300026078 Bacteria 7536
570 Ga0207702_10118420 3300026078 Bacteria 2366
571 Ga0207641_10000100 3300026088 Bacteria 122664
572 Ga0207641_10000270 3300026088 Bacteria 65856
573 Ga0207641_10000481 3300026088 Bacteria 45053
574 Ga0207641_10067161 3300026088 Bacteria 3071
575 Ga0207641_11828068 3300026088 Bacteria 609
576 Ga0207648_10000017 3300026089 Bacteria 148699
577 Ga0207648_10373278 3300026089 Bacteria 1289
578 Ga0207648_10730310 3300026089 Bacteria 919
579 Ga0207676_10004649 3300026095 Bacteria 9720
580 Ga0207676_10010123 3300026095 Bacteria 6710
581 Ga0207676_10876043 3300026095 Bacteria 879
582 Ga0207674_10020635 3300026116 Bacteria 7114
583 Ga0207674_10057517 3300026116 Bacteria 3942
584 Ga0207674_10260328 3300026116 Bacteria 1682
585 Ga0207674_10745865 3300026116 Bacteria 945
586 Ga0207674_11603622 3300026116 Bacteria 619
587 Ga0207675_100000739 3300026118 Bacteria 32427
588 Ga0207683_10181595 3300026121 Bacteria 1908
589 Ga0207683_10318272 3300026121 Bacteria 1425
590 Ga0207683_10497744 3300026121 Bacteria 1125
591 Ga0207698_10000858 3300026142 Bacteria 17656
592 Ga0207698_10281237 3300026142 Bacteria 1539
593 Ga0207698_10396540 3300026142 Bacteria 1317
594 Ga0209281_1023255 3300027111 Bacteria 1177
595 Ga0209813_10000030 3300027866 Bacteria 65385
596 Ga0209974_10007025 3300027876 Bacteria 3897
597 Ga0209974_10088425 3300027876 Bacteria 1072
598 Ga0268266_10000002 3300028379 Bacteria 3059047
599 Ga0268266_10000040 3300028379 Bacteria 323843
600 Ga0268266_10000198 3300028379 Bacteria 104891
601 Ga0268266_10004412 3300028379 Bacteria 13482
602 Ga0268266_10086743 3300028379 Bacteria 2737
603 Ga0268266_10143199 3300028379 Bacteria 2147
604 Ga0268266_10758820 3300028379 Bacteria 936
605 Ga0268265_10000048 3300028380 Bacteria 178523
606 Ga0268265_10000128 3300028380 Bacteria 96118
607 Ga0268265_10011310 3300028380 Bacteria 6034
608 Ga0268265_10016140 3300028380 Bacteria 5126
609 Ga0268265_10965870 3300028380 Bacteria 840
610 Ga0268265_11564333 3300028380 Bacteria 664
611 Ga0268265_12035442 3300028380 Bacteria 581
612 Ga0268265_12307515 3300028380 Bacteria 545
613 Ga0268264_10000003 3300028381 Bacteria 1141976
614 Ga0268264_10000040 3300028381 Bacteria 373714
615 Ga0268264_10000304 3300028381 Bacteria 79130
616 Ga0268264_10003482 3300028381 Bacteria 13572
617 Ga0268264_11012582 3300028381 Bacteria 837
618 Ga0307517_10038523 3300028786 Bacteria 5287
619 Ga0307515_10501817 3300028794 Bacteria 824
620 Ga0265327_10041088 3300031251 Bacteria 2496
621 Ga0307513_10126993 3300031456 Bacteria 2503
622 Ga0307513_10241316 3300031456 Bacteria 1611
623 Ga0307408_100053681 3300031548 Bacteria 2911
624 Ga0307508_10000202 3300031616 Bacteria 71789
625 Ga0316579_10016513 3300031691 Bacteria 3226
626 Ga0316579_10585838 3300031691 Bacteria 540
627 Ga0316576_10254501 3300031727 Bacteria 1318
628 Ga0316576_10316253 3300031727 Bacteria 1165
629 Ga0316578_10311354 3300031728 Bacteria 941
630 Ga0316578_10371171 3300031728 Bacteria 850
631 Ga0307405_10036688 3300031731 Bacteria 2939
632 Ga0307405_10086074 3300031731 Bacteria 2068
633 Ga0307405_10334494 3300031731 Bacteria 1162
634 Ga0307413_10027149 3300031824 Bacteria 3167
635 Ga0307413_10063121 3300031824 Bacteria 2296
636 Ga0307413_10093923 3300031824 Bacteria 1962
637 Ga0307413_10162076 3300031824 Bacteria 1572
638 Ga0307413_10206976 3300031824 Bacteria 1421
639 Ga0307413_10762278 3300031824 Bacteria 810
640 Ga0307413_10780878 3300031824 Bacteria 801
641 Ga0307413_12008932 3300031824 Bacteria 521
642 Ga0307410_10037654 3300031852 Bacteria 3161
643 Ga0307410_10112127 3300031852 Bacteria 1975
644 Ga0307406_10429126 3300031901 Bacteria 1055
645 Ga0307406_10465841 3300031901 Bacteria 1017
646 Ga0307406_10956003 3300031901 Bacteria 732
647 Ga0307406_11646359 3300031901 Bacteria 568
648 Ga0307407_10011706 3300031903 Bacteria 4189
649 Ga0307412_10003817 3300031911 Bacteria 8379
650 Ga0307412_10020442 3300031911 Bacteria 4028
651 Ga0307412_10050601 3300031911 Bacteria 2742
652 Ga0307412_10133298 3300031911 Bacteria 1808
653 Ga0307412_10173777 3300031911 Bacteria 1613
654 Ga0307412_10431618 3300031911 Bacteria 1080
655 Ga0307412_10583874 3300031911 Bacteria 944
656 Ga0307409_100033984 3300031995 Bacteria 3718
657 Ga0307409_100130733 3300031995 Bacteria 2145
658 Ga0307409_100518256 3300031995 Bacteria 1164
659 Ga0307409_100865419 3300031995 Bacteria 915
660 Ga0307416_100080945 3300032002 Bacteria 2744
661 Ga0307416_100122699 3300032002 Bacteria 2320
662 Ga0307416_100184641 3300032002 Bacteria 1959
663 Ga0307416_100418141 3300032002 Bacteria 1384
664 Ga0307416_100926409 3300032002 Bacteria 972
665 Ga0307414_10001433 3300032004 Bacteria 12381
666 Ga0307414_10002743 3300032004 Bacteria 9268
667 Ga0307414_10158436 3300032004 Bacteria 1795
668 Ga0307414_10328561 3300032004 Bacteria 1304
669 Ga0307414_10383929 3300032004 Bacteria 1215
670 Ga0307414_10598436 3300032004 Bacteria 988
671 Ga0307414_10660497 3300032004 Bacteria 943
672 Ga0307414_10663567 3300032004 Bacteria 941
673 Ga0307414_10668979 3300032004 Bacteria 937
674 Ga0307411_10000664 3300032005 Bacteria 12562
675 Ga0307411_10076688 3300032005 Bacteria 2286
676 Ga0307411_10082381 3300032005 Bacteria 2219
677 Ga0307411_10246093 3300032005 Bacteria 1403
678 Ga0307411_10249435 3300032005 Bacteria 1395
679 Ga0307411_10321182 3300032005 Bacteria 1250
680 Ga0307411_10592319 3300032005 Bacteria 952
681 Ga0307411_10754935 3300032005 Bacteria 852
682 Ga0307411_10913804 3300032005 Bacteria 781
683 Ga0307411_11213934 3300032005 Bacteria 684
684 Ga0307415_100224771 3300032126 Bacteria 1508
685 Ga0307415_100736632 3300032126 Bacteria 893
686 Ga0316583_10002111 3300032133 Bacteria 6834
687 Ga0373932_0086904 3300035112 Bacteria 997
688 Ga0316582_0004595 3300036647 Bacteria 6994
689 Ga0316584_0089964 3300036712 Bacteria 2298
690 Ga0316584_0250934 3300036712 Bacteria 1293
691 Ga0395899_0001026 3300037312 Bacteria 25486
692 Ga0395899_0023762 3300037312 Bacteria 4639
693 Ga0395900_0014297 3300037418 Bacteria 8102
694 Ga0395900_0106340 3300037418 Bacteria 2882
695 Ga0395900_0175983 3300037418 Bacteria 2176
696 Ga0395900_0195584 3300037418 Bacteria 2049
697 Ga0395900_0310310 3300037418 Bacteria 1561
698 Ga0395900_0332507 3300037418 Bacteria 1497
699 Ga0395898_0311781 3300037466 Bacteria 1501
700 Ga0395905_0012607 3300037471 Bacteria 8133
701 Ga0395905_0096692 3300037471 Bacteria 2772
702 Ga0395905_0163569 3300037471 Bacteria 2091
703 Ga0395905_0639074 3300037471 Bacteria 966
704 Ga0395905_0888072 3300037471 Bacteria 794
705 Ga0316581_0025968 3300037588 Bacteria 1745
706 Ga0436364_0561934 3300037853 Bacteria 21949
707 Ga0436364_1421612 3300037853 Bacteria 566
708 Ga0395901_0000375 3300038443 Bacteria 53750
709 Ga0395901_0058847 3300038443 Bacteria 3997
710 Ga0395901_0144012 3300038443 Bacteria 2505
711 Ga0436365_0195281 3300039437 Bacteria 1750
712 Ga0436361_0290751 3300039447 Bacteria 1883
713 Ga0436361_0936593 3300039447 Bacteria 36363
714 Ga0451791_1642827 3300041451 Bacteria 521
715 Ga0451797_1238947 3300041453 Bacteria 627
716 Ga0451795_0595987 3300041456 Bacteria 876
717 Ga0451800_0216242 3300041459 Bacteria 659
718 Ga0451800_1145456 3300041459 Bacteria 595
719 Ga0451802_1293139 3300041460 Bacteria 559
720 Ga0451833_0320310 3300041491 Bacteria 562
721 Ga0451833_0562953 3300041491 Bacteria 513
722 Ga0451849_1104376 3300041505 Bacteria 525
723 Ga0451853_0443311 3300041512 Bacteria 872
724 Ga0451853_2107157 3300041512 Bacteria 1012
725 Ga0439448_0007619 3300042005 Bacteria 3144
726 Ga0439448_0008821 3300042005 Bacteria 2958
727 Ga0439448_0012720 3300042005 Bacteria 2523
728 Ga0439432_109721 3300042006 Bacteria 822
729 Ga0439455_0001877 3300042012 Bacteria 3674
730 Ga0439455_0026008 3300042012 Bacteria 1426
731 Ga0450914_016694 3300042118 Bacteria 781
732 Ga0439458_0000234 3300042157 Bacteria 13258
733 Ga0466972_0007096 3300044658 Bacteria 5625
734 Ga0466972_0211013 3300044658 Bacteria 909
735 Ga0466961_0145760 3300044693 Bacteria 1480
736 Ga0466961_0754341 3300044693 Bacteria 582
737 Ga0466963_0045146 3300044694 Bacteria 2902
738 Ga0466964_0001667 3300044706 Bacteria 7688
739 Ga0466964_0048332 3300044706 Bacteria 1739
740 Ga0466971_0003839 3300044719 Bacteria 6438
741 Ga0466968_0152135 3300044735 Bacteria 1064
742 Ga0466970_0013581 3300044765 Bacteria 4177
743 Ga0466970_0071665 3300044765 Bacteria 1864
744 Ga0466957_0011181 3300044842 Bacteria 5170
745 Ga0466957_0134065 3300044842 Bacteria 1590
746 Ga0466957_0228127 3300044842 Bacteria 1232
747 Ga0466960_0018280 3300044901 Bacteria 3069
748 Ga0466959_0007287 3300045049 Bacteria 7751
749 Ga0451576_0000393 3300045051 Bacteria 101814
750 Ga0451576_1044552 3300045051 Bacteria 856
751 Ga0466958_0017879 3300045836 Bacteria 4107
752 Ga0466958_0099321 3300045836 Bacteria 1808
753 Ga0466967_0045654 3300045976 Bacteria 3808
754 Ga0466967_0048001 3300045976 Bacteria 3726
755 Ga0495638_0000414 3300046460 Bacteria 51945
756 Ga0495638_0078887 3300046460 Bacteria 2003
757 Ga0495638_0582062 3300046460 Bacteria 552
758 Ga0495650_0000172 3300046471 Bacteria 142776
759 Ga0495650_0039879 3300046471 Bacteria 2022
760 Ga0495650_0205230 3300046471 Bacteria 683
761 Ga0495584_0241587 3300046491 Bacteria 918
762 Ga0495585_0005045 3300046492 Bacteria 8416
763 Ga0495585_0085973 3300046492 Bacteria 1699
764 Ga0495596_0000203 3300046500 Bacteria 40619
765 Ga0495596_0021646 3300046500 Bacteria 2622
766 Ga0495583_0000286 3300046506 Bacteria 80417
767 Ga0495583_0001640 3300046506 Bacteria 21794
768 Ga0495583_0005542 3300046506 Bacteria 8534
769 Ga0495583_0011178 3300046506 Bacteria 5172
770 Ga0495606_0000963 3300046507 Bacteria 42128
771 Ga0495606_0001229 3300046507 Bacteria 35865
772 Ga0495606_0036857 3300046507 Bacteria 3327
773 Ga0495606_0039480 3300046507 Bacteria 3180
774 Ga0495606_0065858 3300046507 Bacteria 2300
775 Ga0495606_0070487 3300046507 Bacteria 2204
776 Ga0495610_0006251 3300046512 Bacteria 8254
777 Ga0495610_0207928 3300046512 Bacteria 797
778 Ga0495616_0144257 3300046513 Bacteria 1081
779 Ga0495631_0027448 3300046518 Bacteria 2605
780 Ga0495637_0218112 3300046520 Bacteria 695
781 Ga0495643_0000786 3300046522 Bacteria 35198
782 Ga0495643_0002044 3300046522 Bacteria 16765
783 Ga0495643_0053480 3300046522 Bacteria 2164
784 Ga0495643_0079391 3300046522 Bacteria 1711
785 Ga0495643_0167446 3300046522 Bacteria 1077
786 Ga0495648_0000782 3300046524 Bacteria 33902
787 Ga0495648_0074519 3300046524 Bacteria 1955
788 Ga0495648_0297664 3300046524 Bacteria 757
789 Ga0495663_0006090 3300046525 Bacteria 3336
790 Ga0495663_0027062 3300046525 Bacteria 1681
791 Ga0495621_0067972 3300046539 Bacteria 1307
792 Ga0495633_0005249 3300046558 Bacteria 7988
793 Ga0495668_0000080 3300046616 Bacteria 157259
794 Ga0495668_0030463 3300046616 Bacteria 3046
795 Ga0495668_0417067 3300046616 Bacteria 738
796 Ga0495611_0024359 3300046648 Bacteria 2632
797 Ga0495625_0000169 3300046660 Bacteria 102287
798 Ga0495625_0000492 3300046660 Bacteria 59211
799 Ga0495625_0000819 3300046660 Bacteria 42876
800 Ga0495625_0093957 3300046660 Bacteria 2070
801 Ga0495625_0311254 3300046660 Bacteria 1005
802 Ga0495625_0666275 3300046660 Bacteria 618
803 Ga0495661_0089686 3300046665 Bacteria 1752
804 Ga0495661_0109316 3300046665 Bacteria 1543
805 Ga0495669_0000011 3300046684 Bacteria 158720
806 Ga0495670_0000056 3300046691 Bacteria 55007
807 Ga0495670_0014237 3300046691 Bacteria 3914
808 Ga0495649_0021504 3300046694 Bacteria 3613
809 Ga0495600_0051505 3300046809 Bacteria 2687
810 Ga0495660_0108292 3300046810 Bacteria 1421
811 Ga0495660_0115295 3300046810 Bacteria 1366
812 Ga0495683_0006885 3300047323 Bacteria 6180
813 Ga0495687_000684 3300047443 Bacteria 38434
814 Ga0495687_002397 3300047443 Bacteria 15119
815 Ga0495687_106813 3300047443 Bacteria 1038
816 Ga0495673_0005960 3300047469 Bacteria 7258
817 Ga0495673_0007812 3300047469 Bacteria 6092
818 Ga0495681_0018299 3300047470 Bacteria 3863
819 Ga0495681_0026759 3300047470 Bacteria 2995
820 Ga0495681_0141217 3300047470 Bacteria 1017
821 Ga0495686_0000701 3300047472 Bacteria 45238
822 Ga0495686_0003079 3300047472 Bacteria 14759
823 Ga0495686_0003843 3300047472 Bacteria 12715
824 Ga0495686_0194869 3300047472 Bacteria 1166
825 Ga0495686_0375312 3300047472 Bacteria 768
826 Ga0495626_0000995 3300048091 Bacteria 24359
827 Ga0496100_0114388 3300048903 Bacteria 1879
828 Ga0496100_0912233 3300048903 Bacteria 690
829 Ga0496101_0042986 3300048904 Bacteria 3227
830 Ga0496101_0240313 3300048904 Bacteria 1409
831 Ga0496101_0344814 3300048904 Bacteria 1170
832 Ga0496102_0000213 3300048905 Bacteria 76751
833 Ga0496102_0002236 3300048905 Bacteria 16607
834 Ga0496102_0013917 3300048905 Bacteria 6981
835 Ga0496103_0001102 3300048906 Bacteria 18819
836 Ga0496103_0001866 3300048906 Bacteria 13692
837 Ga0496103_0281318 3300048906 Bacteria 1070
838 Ga0496104_0005683 3300048907 Bacteria 10918
839 Ga0496104_0120878 3300048907 Bacteria 2515
840 Ga0496104_0122322 3300048907 Bacteria 2498
841 Ga0496104_1434224 3300048907 Bacteria 593
842 Ga0496105_0000836 3300048908 Bacteria 20954
843 Ga0496105_0013563 3300048908 Bacteria 6473
844 Ga0496105_0032491 3300048908 Bacteria 4282
845 Ga0496105_0076967 3300048908 Bacteria 2755
846 Ga0496105_0253785 3300048908 Bacteria 1424
847 Ga0496106_0010856 3300048909 Bacteria 6730
848 Ga0496106_0073490 3300048909 Bacteria 2616
849 Ga0496107_0280736 3300048910 Bacteria 1240
850 Ga0496107_0593979 3300048910 Bacteria 818
851 Ga0496108_1337030 3300048911 Bacteria 601
852 Ga0496109_0120596 3300048912 Bacteria 2443
853 Ga0496109_0697809 3300048912 Bacteria 952
854 Ga0496109_1211603 3300048912 Bacteria 691
855 Ga0496110_0105763 3300048913 Bacteria 2525
856 Ga0496110_0182521 3300048913 Bacteria 1905
857 Ga0496110_0486634 3300048913 Bacteria 1124
858 Ga0496110_1468262 3300048913 Bacteria 592
859 Ga0496111_0019440 3300048914 Bacteria 4718
860 Ga0496111_0024337 3300048914 Bacteria 4262
861 Ga0496111_0037996 3300048914 Bacteria 3448
862 Ga0496111_0076062 3300048914 Bacteria 2446
863 Ga0496111_0322926 3300048914 Bacteria 1143
864 Ga0496113_0058959 3300048916 Bacteria 2890
865 Ga0496113_0400702 3300048916 Bacteria 1102
866 Ga0496114_0006960 3300048917 Bacteria 8910
867 Ga0496115_0000030 3300048918 Bacteria 138328
868 Ga0496116_0000028 3300048919 Bacteria 424086
869 Ga0496116_0008331 3300048919 Bacteria 9009
870 Ga0496116_0052539 3300048919 Bacteria 2699
871 Ga0496116_0091919 3300048919 Bacteria 1842
872 Ga0496117_0005182 3300048920 Bacteria 13881
873 Ga0496117_0024164 3300048920 Bacteria 4815
874 Ga0496117_0029255 3300048920 Bacteria 4250
875 Ga0496117_0063227 3300048920 Bacteria 2531
876 Ga0496117_0114148 3300048920 Bacteria 1675
877 Ga0496117_0361003 3300048920 Bacteria 746
878 Ga0496118_0000207 3300048921 Bacteria 102753
879 Ga0496118_0001886 3300048921 Bacteria 29933
880 Ga0496118_0010653 3300048921 Bacteria 9070
881 Ga0496118_0034205 3300048921 Bacteria 4152
882 Ga0496118_0069987 3300048921 Bacteria 2537
883 Ga0496118_0103051 3300048921 Bacteria 1921
884 Ga0496118_0113773 3300048921 Bacteria 1786
885 Ga0496119_0012406 3300048922 Bacteria 6925
886 Ga0496119_0013018 3300048922 Bacteria 6678
887 Ga0496119_0020775 3300048922 Bacteria 4771
888 Ga0496120_0023582 3300048923 Bacteria 3850
889 Ga0496120_0023713 3300048923 Bacteria 3837
890 Ga0496120_0216135 3300048923 Bacteria 919
891 Ga0496121_0000017 3300048924 Bacteria 546415
892 Ga0496121_0000069 3300048924 Bacteria 253087
893 Ga0496121_0001274 3300048924 Bacteria 43406
894 Ga0496121_0002669 3300048924 Bacteria 26715
895 Ga0496121_0003231 3300048924 Bacteria 23434
896 Ga0496121_0018071 3300048924 Bacteria 7136
897 Ga0496121_0020984 3300048924 Bacteria 6427
898 Ga0496121_0071851 3300048924 Bacteria 2781
899 Ga0496121_0103504 3300048924 Bacteria 2190
900 Ga0496121_0209279 3300048924 Bacteria 1383
901 Ga0496121_0306596 3300048924 Bacteria 1075
902 Ga0496122_0004700 3300048925 Bacteria 16775
903 Ga0496122_0177425 3300048925 Bacteria 1275
904 Ga0496122_0416579 3300048925 Bacteria 677
905 Ga0496123_0001360 3300048926 Bacteria 34429
906 Ga0496123_0043064 3300048926 Bacteria 3106
907 Ga0496123_0043471 3300048926 Bacteria 3085
908 Ga0496123_0196097 3300048926 Bacteria 1040
909 Ga0496123_0253647 3300048926 Bacteria 866
910 Ga0496124_0001058 3300048927 Bacteria 43458
911 Ga0496124_0003665 3300048927 Bacteria 18569
912 Ga0496124_0004157 3300048927 Bacteria 17085
913 Ga0496124_0209931 3300048927 Bacteria 1474
914 Ga0496124_0568101 3300048927 Bacteria 745
915 Ga0496124_0663947 3300048927 Bacteria 667
916 Ga0496125_0001207 3300048928 Bacteria 38864
917 Ga0496125_0004729 3300048928 Bacteria 15515
918 Ga0496125_0032154 3300048928 Bacteria 4664
919 Ga0496125_0078900 3300048928 Bacteria 2528
920 Ga0496125_0079369 3300048928 Bacteria 2518
921 Ga0496125_0086015 3300048928 Bacteria 2380
922 Ga0496125_0490349 3300048928 Bacteria 694
923 Ga0496126_0000124 3300048929 Bacteria 180422
924 Ga0496126_0001895 3300048929 Bacteria 30168
925 Ga0496126_0002142 3300048929 Bacteria 27515
926 Ga0496126_0002534 3300048929 Bacteria 24446
927 Ga0496126_0202877 3300048929 Bacteria 1674
928 Ga0496126_0279213 3300048929 Bacteria 1384
929 Ga0496126_0796577 3300048929 Bacteria 725
930 Ga0495682_0014961 3300049460 Bacteria 2940
931 Ga0501314_000483 3300049530 Bacteria 2493
932 Ga0501031_0209943 3300049568 Bacteria 1269
933 Ga0501032_0066467 3300049569 Bacteria 2409
934 Ga0501033_0037080 3300049570 Bacteria 3650
935 Ga0501034_0001091 3300049571 Bacteria 38199
936 Ga0501034_0035819 3300049571 Bacteria 5031
937 Ga0501034_0197894 3300049571 Bacteria 1969
938 Ga0501034_0285407 3300049571 Bacteria 1590
939 Ga0501034_0432858 3300049571 Bacteria 1235
940 Ga0501036_0110973 3300049572 Bacteria 2317
941 Ga0501037_0052642 3300049573 Bacteria 2977
942 Ga0501038_0018286 3300049574 Bacteria 6327
943 Ga0501038_0100768 3300049574 Bacteria 2405
944 Ga0501043_0116803 3300049579 Bacteria 2093
945 Ga0501046_0365960 3300049580 Bacteria 1045
946 Ga0501047_0122208 3300049581 Bacteria 2485
947 Ga0501069_0010052 3300049585 Bacteria 5004
948 Ga0501070_0153960 3300049586 Bacteria 1896
949 Ga0501071_0147049 3300049587 Bacteria 1757
950 Ga0501076_0328060 3300049592 Bacteria 1256
951 Ga0501223_004174 3300049663 Bacteria 3113
952 Ga0501223_025784 3300049663 Bacteria 1144
953 Ga0501224_000027 3300049664 Bacteria 53610
954 Ga0501233_004186 3300049668 Bacteria 2630
955 Ga0501235_024630 3300049669 Bacteria 1344
956 Ga0501225_0000057 3300049705 Bacteria 37809
957 Ga0501234_002771 3300049707 Bacteria 2760
958 Ga0501080_0912732 3300049742 Bacteria 765
959 Ga0501080_1181356 3300049742 Bacteria 658
960 Ga0501083_0114285 3300049744 Bacteria 1773
961 Ga0501262_004171 3300049759 Bacteria 1670
962 Ga0501035_0024288 3300049822 Bacteria 5559
963 Ga0501035_0495676 3300049822 Bacteria 1006
964 Ga0501044_0013012 3300049823 Bacteria 9004
965 Ga0501044_0052175 3300049823 Bacteria 4215
966 Ga0501044_0475213 3300049823 Bacteria 1154
967 Ga0501044_0526347 3300049823 Bacteria 1081
968 Ga0501044_0599876 3300049823 Bacteria 994
969 Ga0501226_001461 3300049853 Bacteria 3020
970 nmdc:mga03683_162_c1 3300050489 Bacteria 22492
971 nmdc:mga03n38_46774_c1 3300050490 Bacteria 1912
972 nmdc:mga03n38_520064_c1 3300050490 Bacteria 670
973 nmdc:mga00v17_268262_c1 3300050491 Bacteria 1108
974 nmdc:mga00v17_45214_c1 3300050491 Bacteria 2659
975 nmdc:mga00v17_466554_c1 3300050491 Bacteria 819
976 nmdc:mga00v17_676485_c1 3300050491 Bacteria 663
977 nmdc:mga0yw44_89284_c1 3300050492 Bacteria 1945
978 nmdc:mga0k408_145641_c1 3300050493 Bacteria 1410
979 nmdc:mga0k408_765972_c1 3300050493 Bacteria 563
980 nmdc:mga06z11_182_c1 3300050494 Bacteria 24990
981 nmdc:mga06z11_404536_c1 3300050494 Bacteria 822
982 nmdc:mga04h51_252088_c1 3300050495 Bacteria 708
983 nmdc:mga04h51_83_c1 3300050495 Bacteria 28958
984 nmdc:mga07m45_146885_c1 3300050496 Bacteria 1367
985 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
986 nmdc:mga07m45_450966_c1 3300050496 Bacteria 746
987 nmdc:mga07m45_77392_c1 3300050496 Bacteria 1897
988 nmdc:mga0qj67_293097_c1 3300050509 Bacteria 1318
989 nmdc:mga0qj67_41529_c1 3300050509 Bacteria 3618
990 nmdc:mga0qj67_481221_c1 3300050509 Bacteria 999
991 nmdc:mga0sz30_383076_c1 3300050516 Bacteria 630
992 Ga0500610_0000034 3300053079 Bacteria 49152
993 Ga0500643_000803 3300053087 Bacteria 20304
994 Ga0500643_000972 3300053087 Bacteria 17780
995 Ga0500643_005262 3300053087 Bacteria 5614
996 Ga0500647_0108041 3300053091 Bacteria 1325
997 Ga0500583_0107988 3300053092 Bacteria 1368
998 Ga0500555_000591 3300053103 Bacteria 14166
999 Ga0500562_003139 3300053108 Bacteria 4127
1000 Ga0500592_070547 3300053116 Bacteria 576
1001 Ga0500594_0237994 3300053118 Bacteria 604
1002 Ga0500595_000211 3300053119 Bacteria 39658
1003 Ga0500608_000153 3300053122 Bacteria 28720
1004 Ga0500614_155995 3300053123 Bacteria 689
1005 Ga0500618_000964 3300053125 Bacteria 14691
1006 Ga0500559_0050061 3300053136 Bacteria 1842
1007 Ga0500564_001024 3300053138 Bacteria 9167
1008 Ga0500573_0086993 3300053140 Bacteria 1770
1009 Ga0500573_0461907 3300053140 Bacteria 584
1010 Ga0500577_0147512 3300053142 Bacteria 996
1011 Ga0500590_009905 3300053148 Bacteria 4802
1012 Ga0500604_0000146 3300053151 Bacteria 21141
1013 Ga0500616_0059172 3300053153 Bacteria 1991
1014 Ga0500622_0007706 3300053156 Bacteria 6082
1015 Ga0500624_002499 3300053157 Bacteria 2489
1016 Ga0500636_0010279 3300053177 Bacteria 5455
1017 Ga0500636_0150096 3300053177 Bacteria 1281
1018 Ga0500636_0462549 3300053177 Bacteria 570
1019 Ga0500567_004232 3300053723 Bacteria 6514
1020 Ga0500625_000005 3300053729 Bacteria 209509
1021 Ga0500645_000001 3300053730 Bacteria 455558
1022 Ga0500645_017970 3300053730 Bacteria 2213
1023 Ga0500645_072147 3300053730 Bacteria 990
1024 Ga0587085_162448 3300059506 Bacteria 523
1025 Ga0466962_0012254 3300061719 Bacteria 4121
1026 2509107760 2508501122 Bacteria 6292184
1027 2509376141 2509276019 Bacteria 6802256
1028 2511389409 2511231027 Bacteria 5013807
1029 2512533130 2512047086 Bacteria 6850303
1030 2524453066 2524023207 Bacteria 6813453
1031 2558865547 2558860100 Bacteria 8458965
1032 2558868376 2558860100 Bacteria 8458965
1033 2643730730 2643221541 Bacteria 5498788
1034 2644044617 2643221606 Bacteria 5588032
1035 2644391458 2643221671 Bacteria 5496681
1036 2738712449 2738541275 Bacteria 4830863
1037 2738850857 2738541301 Bacteria 4834102
1038 2738866603 2738541304 Bacteria 4833665
1039 2739299104 2738543022 Bacteria 4835059
1040 2739360799 2738543033 Bacteria 4833336
1041 2739651334 2739367664 Bacteria 4114334
1042 2740029807 2739367865 Bacteria 4114482
1043 2753359609 2751185800 Bacteria 5467370
1044 2757569945 2757320392 Bacteria 3737298
1045 2758641869 2758568016 Bacteria 5645291
1046 2765466044 2765235802 Bacteria 5618596
1047 2776271692 2775506902 Bacteria 6208009
1048 2776279795 2775506904 Bacteria 5954060
1049 2819553412 2818991438 Bacteria 5793701
1050 2839995228 2839993093 Bacteria 5512535
1051 2840769987 2840764183 Bacteria 6358399
1052 2842872779 2842871566 Bacteria 4827117
1053 2850080921 2850079185 Bacteria 6848280
1054 2852654634 2852653556 Bacteria 4050083
1055 2876373375 2876369609 Bacteria 6807521
1056 2881152153 2881147464 Bacteria 7779814
1057 2881168136 2881161766 Bacteria 7127907
1058 2882808607 2882806704 Bacteria 3007728
1059 2889794654 2889790730 Bacteria 5689708
1060 2889917868 2889914905 Bacteria 5702301
1061 2894654604 2894652903 Bacteria 4587256
1062 2894819886 2894817345 Bacteria 4892941
1063 2896254454 2896253425 Bacteria 3418029
1064 2904583318 2904578770 Bacteria 5302906
1065 2915652998 2915650412 Bacteria 4288180
1066 2919121062 2919119836 Bacteria 5208557
1067 2921211294 2921208531 Bacteria 6745326
1068 2928103501 2928100450 Bacteria 4837635
1069 2928523211 2928521798 Bacteria 4960112
1070 2928962812 2928959182 Bacteria 4725774
1071 2954015481 2954011201 Bacteria 4762601
1072 3002144049 3002141150 Bacteria 5254435
1073 3003670257 3003665799 Bacteria 7279786
1074 8001526622 8001522603 Bacteria 4726425
1075 8045865579 8045864390 Bacteria 5043873
1076 Ga0068860_100063090
1077 JGI24736J21556_1015550
1078 JGI24752J21851_1000019
1079 JGI24740J21852_10017003
1080 JGI24740J21852_10075190
1081 JGI24740J21852_10101680
1082 JGI24739J22299_10001252
1083 JGI24739J22299_10009714
1084 JGI24739J22299_10054526
1085 JGI24739J22299_10070483
1086 JGI24737J22298_10001039
1087 JGI24737J22298_10010383
1088 JGI24737J22298_10028225
1089 JGI24737J22298_10042305
1090 JGI24737J22298_10129864
1091 JGI24743J22301_10036319
1092 JGI24735J21928_10000626
1093 JGI24735J21928_10004199
1094 JGI24735J21928_10016834
1095 JGI24735J21928_10019673
1096 JGI24735J21928_10021160
1097 JGI24735J21928_10027327
1098 JGI24735J21928_10045723
1099 JGI24750J21931_1000043
1100 JGI24748J21848_1000093
1101 JGI24738J21930_10003215
1102 JGI24738J21930_10003683
1103 JGI24738J21930_10006892
1104 JGI24744J21845_10003354
1105 JGI24034J26672_10000032
1106 JGI24034J26672_10000057
1107 JGI24742J22300_10006451
1108 JGI24751J29686_10004989
1109 JGI25156J39149_1005233
1110 JGI25157J39369_1000597
1111 JGI25165J46597_1000188
1112 JGI25153J46596_10000008
1113 Ga0055525_1000063
1114 Ga0055525_1000064
1115 Ga0055542_1000123
1116 Ga0055542_1011154
1117 Ga0055529_1000144
1118 Ga0055529_1019104
1119 Ga0055534_1015291
1120 Ga0055530_10000526
1121 Ga0055531_10000563
1122 Ga0065165_1004625
1123 Ga0065714_10511279
1124 Ga0065704_10001466
1125 Ga0065704_10450884
1126 Ga0065712_10484986
1127 Ga0065715_10187962
1128 Ga0065707_10294859
1129 Ga0070658_10000003
1130 Ga0070658_10000083
1131 Ga0070658_10000688
1132 Ga0070658_10002274
1133 Ga0070658_10006725
1134 Ga0070658_10096964
1135 Ga0070658_10151357
1136 Ga0070658_10238578
1137 Ga0070658_10410091
1138 Ga0070676_10006658
1139 Ga0070676_10050811
1140 Ga0070676_10298533
1141 Ga0070683_100412488
1142 Ga0070690_100000011
1143 Ga0070690_100410640
1144 Ga0070690_100595509
1145 Ga0070670_100026386
1146 Ga0070670_100546775
1147 Ga0070670_100973530
1148 Ga0070677_10001076
1149 Ga0068869_100000353
1150 Ga0068869_100813174
1151 Ga0070666_10000035
1152 Ga0070666_10105789
1153 Ga0070666_10235104
1154 Ga0070666_10541233
1155 Ga0070680_100047705
1156 Ga0070680_100249735
1157 Ga0070682_100809718
1158 Ga0068868_100000154
1159 Ga0068868_100565163
1160 Ga0070660_100000122
1161 Ga0070660_100001677
1162 Ga0070660_100024829
1163 Ga0070660_100027823
1164 Ga0070660_100156120
1165 Ga0070660_100198027
1166 Ga0070660_100764720
1167 Ga0070689_100002629
1168 Ga0070689_100224932
1169 Ga0070661_100287576
1170 Ga0070692_10000999
1171 Ga0070692_10130743
1172 Ga0070692_10859070
1173 Ga0070668_100018658
1174 Ga0070668_100047927
1175 Ga0070668_100059247
1176 Ga0070668_100387063
1177 Ga0070668_100479801
1178 Ga0070668_100548675
1179 Ga0070668_101121098
1180 Ga0070669_100000489
1181 Ga0070669_100005417
1182 Ga0070669_100007896
1183 Ga0070669_100025696
1184 Ga0070669_100423423
1185 Ga0070669_100768723
1186 Ga0070669_101618640
1187 Ga0070675_100005433
1188 Ga0070675_100013018
1189 Ga0070671_100000062
1190 Ga0070671_100002103
1191 Ga0070671_100019498
1192 Ga0070671_100029468
1193 Ga0070671_100146891
1194 Ga0070671_100152869
1195 Ga0070671_100191148
1196 Ga0070671_101422404
1197 Ga0070674_100032397
1198 Ga0070674_100105593
1199 Ga0070674_100250861
1200 Ga0070673_100000023
1201 Ga0070673_101796393
1202 Ga0070688_100013357
1203 Ga0070688_100172275
1204 Ga0070659_100022977
1205 Ga0070659_100213271
1206 Ga0070659_100297325
1207 Ga0070659_100302867
1208 Ga0070659_100345858
1209 Ga0070667_100014076
1210 Ga0070667_100041273
1211 Ga0070667_100052266
1212 Ga0070667_100065840
1213 Ga0070667_100110830
1214 Ga0070667_100358264
1215 Ga0070667_100553263
1216 Ga0070714_100157342
1217 Ga0070663_100099017
1218 Ga0070663_100224772
1219 Ga0070663_100464919
1220 Ga0070678_100167540
1221 Ga0070678_100250631
1222 Ga0070678_100536467
1223 Ga0070662_100003750
1224 Ga0070662_100190951
1225 Ga0070662_100284947
1226 Ga0070662_100359418
1227 Ga0070662_100427135
1228 Ga0070662_100552669
1229 Ga0070662_100595219
1230 Ga0070662_101997956
1231 Ga0070681_10363840
1232 Ga0070681_10636137
1233 Ga0068867_100000007
1234 Ga0070685_10000168
1235 Ga0070679_100239051
1236 Ga0068853_100113724
1237 Ga0068853_100617010
1238 Ga0070672_100046111
1239 Ga0070672_100222284
1240 Ga0070672_101221027
1241 Ga0070686_100000035
1242 Ga0070696_100186631
1243 Ga0070693_100167685
1244 Ga0070693_101049445
1245 Ga0070665_100000023
1246 Ga0070665_100000161
1247 Ga0070665_100003713
1248 Ga0070665_100042108
1249 Ga0070665_100045411
1250 Ga0070665_100716089
1251 Ga0070665_100781373
1252 Ga0068855_100000029
1253 Ga0068855_100121035
1254 Ga0068855_100294989
1255 Ga0068855_100470742
1256 Ga0068855_100529651
1257 Ga0068855_101237351
1258 Ga0070664_100232255
1259 Ga0068857_100056230
1260 Ga0068857_100155804
1261 Ga0068857_100278173
1262 Ga0068857_101015622
1263 Ga0068854_100000751
1264 Ga0068854_100011157
1265 Ga0068854_100020920
1266 Ga0068854_100185355
1267 Ga0068854_100429597
1268 Ga0068854_100657243
1269 Ga0068854_101474412
1270 Ga0068856_100018774
1271 Ga0068856_100213696
1272 Ga0068856_100818976
1273 Ga0068856_101336026
1274 Ga0070702_100625054
1275 Ga0068852_100001445
1276 Ga0068852_100091530
1277 Ga0068852_100236595
1278 Ga0068852_100253593
1279 Ga0068859_100006370
1280 Ga0068859_100041543
1281 Ga0068859_100059777
1282 Ga0068864_100022346
1283 Ga0068864_100035786
1284 Ga0068861_100000615
1285 Ga0068851_10030453
1286 Ga0068851_10416667
1287 Ga0068870_10114066
1288 Ga0068863_100000060
1289 Ga0068863_100000106
1290 Ga0068863_100000617
1291 Ga0068863_100042301
1292 Ga0068863_100461697
1293 Ga0068863_101456917
1294 Ga0068863_102100018
1295 Ga0068863_102613081
1296 Ga0068858_100000157
1297 Ga0068858_100002890
1298 Ga0068858_100009717
1299 Ga0068858_100112840
1300 Ga0068860_100000126
1301 Ga0068860_100000168
1302 Ga0068860_100000680
1303 Ga0068860_100589292
1304 Ga0068862_100000146
1305 Ga0068862_100000193
1306 Ga0068862_100004291
1307 Ga0068862_100004770
1308 Ga0068862_100377737
1309 Ga0068862_101521236
1310 Ga0081455_10794787
1311 Ga0081540_1105146
1312 Ga0075365_10119434
1313 Ga0075368_10000037
1314 Ga0075368_10002121
1315 Ga0075368_10011362
1316 Ga0075363_100008002
1317 Ga0075363_100059341
1318 Ga0075364_10077215
1319 Ga0075364_10088769
1320 Ga0075364_10136370
1321 Ga0075364_10532920
1322 Ga0075364_10766835
1323 Ga0075362_10002084
1324 Ga0075362_10468086
1325 Ga0075367_10001103
1326 Ga0075367_10095170
1327 Ga0075369_10037806
1328 Ga0075366_10018983
1329 Ga0075366_10019187
1330 Ga0075366_10029450
1331 Ga0075366_10127430
1332 Ga0075366_10174805
1333 Ga0075366_10307203
1334 Ga0097621_101442686
1335 Ga0075370_10079240
1336 Ga0075370_10388191
1337 Ga0075370_10473819
1338 Ga0068871_100051306
1339 Ga0068871_101788012
1340 Ga0068871_101997439
1341 Ga0075430_100007359
1342 Ga0075430_100071070
1343 Ga0075430_100119423
1344 Ga0068865_100000010
1345 Ga0097620_100006370
1346 Ga0097620_100041543
1347 Ga0097620_100059776
1348 Ga0079104_1003382
1349 Ga0079104_1004641
1350 Ga0079104_1036606
1351 Ga0105251_10001266
1352 Ga0105251_10182084
1353 Ga0105240_10004083
1354 Ga0105240_10333520
1355 Ga0105240_12750275
1356 Ga0111539_13024116
1357 Ga0105245_10001496
1358 Ga0105245_10007145
1359 Ga0105247_10001477
1360 Ga0105247_10056974
1361 Ga0105247_10230863
1362 Ga0105247_10402689
1363 Ga0105247_10601036
1364 Ga0105243_10000054
1365 Ga0105243_10101399
1366 Ga0105243_11109481
1367 Ga0105241_10034303
1368 Ga0105241_10328204
1369 Ga0105241_10706302
1370 Ga0105242_10000210
1371 Ga0105248_10004792
1372 Ga0105248_10007222
1373 Ga0105248_10025331
1374 Ga0105248_10137987
1375 Ga0105248_10229002
1376 Ga0105248_10398217
1377 Ga0105237_10083217
1378 Ga0105237_10317656
1379 Ga0105237_10791679
1380 Ga0105237_11125569
1381 Ga0105238_10010681
1382 Ga0105238_10010889
1383 Ga0105238_10302286
1384 Ga0105238_11008023
1385 Ga0105238_12059342
1386 Ga0105238_12255281
1387 Ga0105249_10000002
1388 Ga0105249_10000094
1389 Ga0105249_10013736
1390 Ga0105249_10172798
1391 Ga0105239_10000031
1392 Ga0105239_10829219
1393 Ga0105239_10851605
1394 Ga0105239_11390536
1395 Ga0105246_10022917
1396 Ga0105246_10357559
1397 Ga0157373_10054363
1398 Ga0157373_11169411
1399 Ga0157371_10023965
1400 Ga0157371_10819125
1401 Ga0157371_11117534
1402 Ga0157370_10004235
1403 Ga0157370_10615244
1404 Ga0157370_11540782
1405 Ga0157370_11687144
1406 Ga0157369_10020716
1407 Ga0157369_10444132
1408 Ga0157369_10645368
1409 Ga0157374_10007279
1410 Ga0157374_10292932
1411 Ga0157374_10326710
1412 Ga0157378_10020119
1413 Ga0157378_10051802
1414 Ga0157378_10513758
1415 Ga0163162_10151250
1416 Ga0163162_11005798
1417 Ga0157372_10014562
1418 Ga0157372_10172216
1419 Ga0157372_10227903
1420 Ga0157372_10317339
1421 Ga0157372_10460050
1422 Ga0157372_10563651
1423 Ga0157375_10003825
1424 Ga0157375_10724994
1425 Ga0163163_10033187
1426 Ga0163163_10204153
1427 Ga0163163_11564186
1428 Ga0157380_10000851
1429 Ga0157380_10037643
1430 Ga0157380_11039458
1431 Ga0157377_11431264
1432 Ga0157379_10005418
1433 Ga0157379_10659973
1434 Ga0157376_10000047
1435 Ga0163161_10002507
1436 Ga0163161_10004251
1437 Ga0163161_10080010
1438 Ga0214542_1055259
1439 Ga0214543_1000173
1440 Ga0213875_10038209
1441 Ga0209563_100066
1442 Ga0207427_109532
1443 Ga0209646_1023471
1444 Ga0209026_1000002
1445 Ga0209026_1003041
1446 Ga0209148_1000011
1447 Ga0209148_1000061
1448 Ga0209148_1002311
1449 Ga0209759_1000062
1450 Ga0209233_1000052
1451 Ga0209233_1000120
1452 Ga0209233_1023172
1453 Ga0209565_1032271
1454 Ga0209455_1000006
1455 Ga0209455_1000972
1456 Ga0209455_1017111
1457 Ga0207673_1064185
1458 Ga0209675_1000137
1459 Ga0209676_1000883
1460 Ga0209676_1001128
1461 Ga0209025_1020063
1462 Ga0209025_1032667
1463 Ga0209758_1000017
1464 Ga0209050_1000119
1465 Ga0209050_1000400
1466 Ga0209050_1001243
1467 Ga0209257_1000250
1468 Ga0209257_1000603
1469 Ga0209257_1002085
1470 Ga0209257_1022922
1471 Ga0209257_1033784
1472 Ga0207697_10085510
1473 Ga0207697_10549307
1474 Ga0207656_10053455
1475 Ga0207656_10063181
1476 Ga0207656_10218080
1477 Ga0207713_1010768
1478 Ga0207682_10000505
1479 Ga0207710_10001911
1480 Ga0207710_10324522
1481 Ga0207688_10039994
1482 Ga0207688_10516620
1483 Ga0207688_10951548
1484 Ga0207680_10000007
1485 Ga0207680_11117599
1486 Ga0207647_10000270
1487 Ga0207647_10001030
1488 Ga0207647_10002997
1489 Ga0207647_10008132
1490 Ga0207647_10018008
1491 Ga0207647_10103636
1492 Ga0207647_10173756
1493 Ga0207645_10003775
1494 Ga0207645_10014073
1495 Ga0207643_10321138
1496 Ga0207705_10000005
1497 Ga0207705_10000316
1498 Ga0207705_10000340
1499 Ga0207705_10012135
1500 Ga0207705_10073287
1501 Ga0207705_10113946
1502 Ga0207705_10174715
1503 Ga0207705_11055103
1504 Ga0207654_10008007
1505 Ga0207707_10445324
1506 Ga0207707_11354760
1507 Ga0207695_10015209
1508 Ga0207695_10127995
1509 Ga0207695_11740006
1510 Ga0207671_10034401
1511 Ga0207671_10052103
1512 Ga0207671_11182956
1513 Ga0207657_10000832
1514 Ga0207657_10007820
1515 Ga0207657_10018806
1516 Ga0207657_10021901
1517 Ga0207657_10022634
1518 Ga0207657_10086509
1519 Ga0207657_10093489
1520 Ga0207657_10178902
1521 Ga0207649_10207523
1522 Ga0207649_10214589
1523 Ga0207649_11336078
1524 Ga0207652_10538495
1525 Ga0207681_10000053
1526 Ga0207681_10002314
1527 Ga0207681_10008412
1528 Ga0207681_10011479
1529 Ga0207681_10100199
1530 Ga0207681_10785634
1531 Ga0207681_11389497
1532 Ga0207694_10016121
1533 Ga0207694_10176560
1534 Ga0207694_10326340
1535 Ga0207694_10440264
1536 Ga0207694_11204932
1537 Ga0207650_10037516
1538 Ga0207650_10068113
1539 Ga0207650_10207795
1540 Ga0207650_10645301
1541 Ga0207650_10893881
1542 Ga0207659_10004630
1543 Ga0207659_10024906
1544 Ga0207687_10001694
1545 Ga0207687_10005171
1546 Ga0207664_10110773
1547 Ga0207644_10000005
1548 Ga0207644_10000242
1549 Ga0207644_10000964
1550 Ga0207644_10009287
1551 Ga0207644_10115903
1552 Ga0207644_10149378
1553 Ga0207644_10424638
1554 Ga0207644_11680972
1555 Ga0207690_10006391
1556 Ga0207690_10110934
1557 Ga0207690_10328563
1558 Ga0207690_10453815
1559 Ga0207690_10543304
1560 Ga0207690_11316159
1561 Ga0207706_10014101
1562 Ga0207706_10045638
1563 Ga0207706_10053172
1564 Ga0207706_10060688
1565 Ga0207706_10154593
1566 Ga0207706_10156031
1567 Ga0207706_10672610
1568 Ga0207706_10674918
1569 Ga0207686_10000598
1570 Ga0207709_10000050
1571 Ga0207709_10122482
1572 Ga0207670_10009646
1573 Ga0207670_10193618
1574 Ga0207669_10009567
1575 Ga0207669_10169779
1576 Ga0207669_10224758
1577 Ga0207704_10000020
1578 Ga0207704_11032711
1579 Ga0207691_10331253
1580 Ga0207691_10477160
1581 Ga0207691_10533400
1582 Ga0207711_10001087
1583 Ga0207711_10006515
1584 Ga0207711_10022035
1585 Ga0207711_10542889
1586 Ga0207711_11360092
1587 Ga0207711_11405996
1588 Ga0207689_10001110
1589 Ga0207689_10181463
1590 Ga0207689_10867355
1591 Ga0207661_10390443
1592 Ga0207679_10159802
1593 Ga0207679_10391622
1594 Ga0207667_10000035
1595 Ga0207667_10031919
1596 Ga0207667_10351219
1597 Ga0207667_10512940
1598 Ga0207667_10565217
1599 Ga0207667_10884162
1600 Ga0207667_11360958
1601 Ga0207651_10000005
1602 Ga0207651_10184309
1603 Ga0207651_10390156
1604 Ga0207712_10000002
1605 Ga0207712_10000004
1606 Ga0207712_10039051
1607 Ga0207712_10132626
1608 Ga0207668_10004132
1609 Ga0207668_10034891
1610 Ga0207668_10056180
1611 Ga0207668_10103299
1612 Ga0207668_10170441
1613 Ga0207668_10208760
1614 Ga0207668_10499797
1615 Ga0207640_10000436
1616 Ga0207640_10007861
1617 Ga0207640_10041447
1618 Ga0207640_10070511
1619 Ga0207640_10071071
1620 Ga0207640_10274695
1621 Ga0207640_10284936
1622 Ga0207640_10627893
1623 Ga0207658_10000865
1624 Ga0207658_10007156
1625 Ga0207658_10016492
1626 Ga0207658_10183814
1627 Ga0207677_10001245
1628 Ga0207677_11538829
1629 Ga0207703_10000095
1630 Ga0207703_10005905
1631 Ga0207639_10006866
1632 Ga0207639_10277737
1633 Ga0207639_10310222
1634 Ga0207639_10369132
1635 Ga0207639_10971264
1636 Ga0207639_11171880
1637 Ga0207639_11669602
1638 Ga0207639_11782712
1639 Ga0207678_10001958
1640 Ga0207678_10012101
1641 Ga0207678_10314458
1642 Ga0207678_10567166
1643 Ga0207702_10005556
1644 Ga0207702_10011049
1645 Ga0207702_10118420
1646 Ga0207641_10000100
1647 Ga0207641_10000270
1648 Ga0207641_10000481
1649 Ga0207641_10067161
1650 Ga0207641_11828068
1651 Ga0207648_10000017
1652 Ga0207648_10373278
1653 Ga0207648_10730310
1654 Ga0207676_10004649
1655 Ga0207676_10010123
1656 Ga0207676_10876043
1657 Ga0207674_10020635
1658 Ga0207674_10057517
1659 Ga0207674_10260328
1660 Ga0207674_10745865
1661 Ga0207674_11603622
1662 Ga0207675_100000739
1663 Ga0207683_10181595
1664 Ga0207683_10318272
1665 Ga0207683_10497744
1666 Ga0207698_10000858
1667 Ga0207698_10281237
1668 Ga0207698_10396540
1669 Ga0209281_1023255
1670 Ga0209813_10000030
1671 Ga0209974_10007025
1672 Ga0209974_10088425
1673 Ga0268266_10000002
1674 Ga0268266_10000040
1675 Ga0268266_10000198
1676 Ga0268266_10004412
1677 Ga0268266_10086743
1678 Ga0268266_10143199
1679 Ga0268266_10758820
1680 Ga0268265_10000048
1681 Ga0268265_10000128
1682 Ga0268265_10011310
1683 Ga0268265_10016140
1684 Ga0268265_10965870
1685 Ga0268265_11564333
1686 Ga0268265_12035442
1687 Ga0268265_12307515
1688 Ga0268264_10000003
1689 Ga0268264_10000040
1690 Ga0268264_10000304
1691 Ga0268264_10003482
1692 Ga0268264_11012582
1693 Ga0307517_10038523
1694 Ga0307515_10501817
1695 Ga0265327_10041088
1696 Ga0307513_10126993
1697 Ga0307513_10241316
1698 Ga0307408_100053681
1699 Ga0307508_10000202
1700 Ga0316579_10016513
1701 Ga0316579_10585838
1702 Ga0316576_10254501
1703 Ga0316576_10316253
1704 Ga0316578_10311354
1705 Ga0316578_10371171
1706 Ga0307405_10036688
1707 Ga0307405_10086074
1708 Ga0307405_10334494
1709 Ga0307413_10027149
1710 Ga0307413_10063121
1711 Ga0307413_10093923
1712 Ga0307413_10162076
1713 Ga0307413_10206976
1714 Ga0307413_10762278
1715 Ga0307413_10780878
1716 Ga0307413_12008932
1717 Ga0307410_10037654
1718 Ga0307410_10112127
1719 Ga0307406_10429126
1720 Ga0307406_10465841
1721 Ga0307406_10956003
1722 Ga0307406_11646359
1723 Ga0307407_10011706
1724 Ga0307412_10003817
1725 Ga0307412_10020442
1726 Ga0307412_10050601
1727 Ga0307412_10133298
1728 Ga0307412_10173777
1729 Ga0307412_10431618
1730 Ga0307412_10583874
1731 Ga0307409_100033984
1732 Ga0307409_100130733
1733 Ga0307409_100518256
1734 Ga0307409_100865419
1735 Ga0307416_100080945
1736 Ga0307416_100122699
1737 Ga0307416_100184641
1738 Ga0307416_100418141
1739 Ga0307416_100926409
1740 Ga0307414_10001433
1741 Ga0307414_10002743
1742 Ga0307414_10158436
1743 Ga0307414_10328561
1744 Ga0307414_10383929
1745 Ga0307414_10598436
1746 Ga0307414_10660497
1747 Ga0307414_10663567
1748 Ga0307414_10668979
1749 Ga0307411_10000664
1750 Ga0307411_10076688
1751 Ga0307411_10082381
1752 Ga0307411_10246093
1753 Ga0307411_10249435
1754 Ga0307411_10321182
1755 Ga0307411_10592319
1756 Ga0307411_10754935
1757 Ga0307411_10913804
1758 Ga0307411_11213934
1759 Ga0307415_100224771
1760 Ga0307415_100736632
1761 Ga0316583_10002111
1762 Ga0373932_0086904
1763 Ga0316582_0004595
1764 Ga0316584_0089964
1765 Ga0316584_0250934
1766 Ga0395899_0001026
1767 Ga0395899_0023762
1768 Ga0395900_0014297
1769 Ga0395900_0106340
1770 Ga0395900_0175983
1771 Ga0395900_0195584
1772 Ga0395900_0310310
1773 Ga0395900_0332507
1774 Ga0395898_0311781
1775 Ga0395905_0012607
1776 Ga0395905_0096692
1777 Ga0395905_0163569
1778 Ga0395905_0639074
1779 Ga0395905_0888072
1780 Ga0316581_0025968
1781 Ga0436364_0561934
1782 Ga0436364_1421612
1783 Ga0395901_0000375
1784 Ga0395901_0058847
1785 Ga0395901_0144012
1786 Ga0436365_0195281
1787 Ga0436361_0290751
1788 Ga0436361_0936593
1789 Ga0451791_1642827
1790 Ga0451797_1238947
1791 Ga0451795_0595987
1792 Ga0451800_0216242
1793 Ga0451800_1145456
1794 Ga0451802_1293139
1795 Ga0451833_0320310
1796 Ga0451833_0562953
1797 Ga0451849_1104376
1798 Ga0451853_0443311
1799 Ga0451853_2107157
1800 Ga0439448_0007619
1801 Ga0439448_0008821
1802 Ga0439448_0012720
1803 Ga0439432_109721
1804 Ga0439455_0001877
1805 Ga0439455_0026008
1806 Ga0450914_016694
1807 Ga0439458_0000234
1808 Ga0466972_0007096
1809 Ga0466972_0211013
1810 Ga0466961_0145760
1811 Ga0466961_0754341
1812 Ga0466963_0045146
1813 Ga0466964_0001667
1814 Ga0466964_0048332
1815 Ga0466971_0003839
1816 Ga0466968_0152135
1817 Ga0466970_0013581
1818 Ga0466970_0071665
1819 Ga0466957_0011181
1820 Ga0466957_0134065
1821 Ga0466957_0228127
1822 Ga0466960_0018280
1823 Ga0466959_0007287
1824 Ga0451576_0000393
1825 Ga0451576_1044552
1826 Ga0466958_0017879
1827 Ga0466958_0099321
1828 Ga0466967_0045654
1829 Ga0466967_0048001
1830 Ga0495638_0000414
1831 Ga0495638_0078887
1832 Ga0495638_0582062
1833 Ga0495650_0000172
1834 Ga0495650_0039879
1835 Ga0495650_0205230
1836 Ga0495584_0241587
1837 Ga0495585_0005045
1838 Ga0495585_0085973
1839 Ga0495596_0000203
1840 Ga0495596_0021646
1841 Ga0495583_0000286
1842 Ga0495583_0001640
1843 Ga0495583_0005542
1844 Ga0495583_0011178
1845 Ga0495606_0000963
1846 Ga0495606_0001229
1847 Ga0495606_0036857
1848 Ga0495606_0039480
1849 Ga0495606_0065858
1850 Ga0495606_0070487
1851 Ga0495610_0006251
1852 Ga0495610_0207928
1853 Ga0495616_0144257
1854 Ga0495631_0027448
1855 Ga0495637_0218112
1856 Ga0495643_0000786
1857 Ga0495643_0002044
1858 Ga0495643_0053480
1859 Ga0495643_0079391
1860 Ga0495643_0167446
1861 Ga0495648_0000782
1862 Ga0495648_0074519
1863 Ga0495648_0297664
1864 Ga0495663_0006090
1865 Ga0495663_0027062
1866 Ga0495621_0067972
1867 Ga0495633_0005249
1868 Ga0495668_0000080
1869 Ga0495668_0030463
1870 Ga0495668_0417067
1871 Ga0495611_0024359
1872 Ga0495625_0000169
1873 Ga0495625_0000492
1874 Ga0495625_0000819
1875 Ga0495625_0093957
1876 Ga0495625_0311254
1877 Ga0495625_0666275
1878 Ga0495661_0089686
1879 Ga0495661_0109316
1880 Ga0495669_0000011
1881 Ga0495670_0000056
1882 Ga0495670_0014237
1883 Ga0495649_0021504
1884 Ga0495600_0051505
1885 Ga0495660_0108292
1886 Ga0495660_0115295
1887 Ga0495683_0006885
1888 Ga0495687_000684
1889 Ga0495687_002397
1890 Ga0495687_106813
1891 Ga0495673_0005960
1892 Ga0495673_0007812
1893 Ga0495681_0018299
1894 Ga0495681_0026759
1895 Ga0495681_0141217
1896 Ga0495686_0000701
1897 Ga0495686_0003079
1898 Ga0495686_0003843
1899 Ga0495686_0194869
1900 Ga0495686_0375312
1901 Ga0495626_0000995
1902 Ga0496100_0114388
1903 Ga0496100_0912233
1904 Ga0496101_0042986
1905 Ga0496101_0240313
1906 Ga0496101_0344814
1907 Ga0496102_0000213
1908 Ga0496102_0002236
1909 Ga0496102_0013917
1910 Ga0496103_0001102
1911 Ga0496103_0001866
1912 Ga0496103_0281318
1913 Ga0496104_0005683
1914 Ga0496104_0120878
1915 Ga0496104_0122322
1916 Ga0496104_1434224
1917 Ga0496105_0000836
1918 Ga0496105_0013563
1919 Ga0496105_0032491
1920 Ga0496105_0076967
1921 Ga0496105_0253785
1922 Ga0496106_0010856
1923 Ga0496106_0073490
1924 Ga0496107_0280736
1925 Ga0496107_0593979
1926 Ga0496108_1337030
1927 Ga0496109_0120596
1928 Ga0496109_0697809
1929 Ga0496109_1211603
1930 Ga0496110_0105763
1931 Ga0496110_0182521
1932 Ga0496110_0486634
1933 Ga0496110_1468262
1934 Ga0496111_0019440
1935 Ga0496111_0024337
1936 Ga0496111_0037996
1937 Ga0496111_0076062
1938 Ga0496111_0322926
1939 Ga0496113_0058959
1940 Ga0496113_0400702
1941 Ga0496114_0006960
1942 Ga0496115_0000030
1943 Ga0496116_0000028
1944 Ga0496116_0008331
1945 Ga0496116_0052539
1946 Ga0496116_0091919
1947 Ga0496117_0005182
1948 Ga0496117_0024164
1949 Ga0496117_0029255
1950 Ga0496117_0063227
1951 Ga0496117_0114148
1952 Ga0496117_0361003
1953 Ga0496118_0000207
1954 Ga0496118_0001886
1955 Ga0496118_0010653
1956 Ga0496118_0034205
1957 Ga0496118_0069987
1958 Ga0496118_0103051
1959 Ga0496118_0113773
1960 Ga0496119_0012406
1961 Ga0496119_0013018
1962 Ga0496119_0020775
1963 Ga0496120_0023582
1964 Ga0496120_0023713
1965 Ga0496120_0216135
1966 Ga0496121_0000017
1967 Ga0496121_0000069
1968 Ga0496121_0001274
1969 Ga0496121_0002669
1970 Ga0496121_0003231
1971 Ga0496121_0018071
1972 Ga0496121_0020984
1973 Ga0496121_0071851
1974 Ga0496121_0103504
1975 Ga0496121_0209279
1976 Ga0496121_0306596
1977 Ga0496122_0004700
1978 Ga0496122_0177425
1979 Ga0496122_0416579
1980 Ga0496123_0001360
1981 Ga0496123_0043064
1982 Ga0496123_0043471
1983 Ga0496123_0196097
1984 Ga0496123_0253647
1985 Ga0496124_0001058
1986 Ga0496124_0003665
1987 Ga0496124_0004157
1988 Ga0496124_0209931
1989 Ga0496124_0568101
1990 Ga0496124_0663947
1991 Ga0496125_0001207
1992 Ga0496125_0004729
1993 Ga0496125_0032154
1994 Ga0496125_0078900
1995 Ga0496125_0079369
1996 Ga0496125_0086015
1997 Ga0496125_0490349
1998 Ga0496126_0000124
1999 Ga0496126_0001895
2000 Ga0496126_0002142
2001 Ga0496126_0002534
2002 Ga0496126_0202877
2003 Ga0496126_0279213
2004 Ga0496126_0796577
2005 Ga0495682_0014961
2006 Ga0501314_000483
2007 Ga0501031_0209943
2008 Ga0501032_0066467
2009 Ga0501033_0037080
2010 Ga0501034_0001091
2011 Ga0501034_0035819
2012 Ga0501034_0197894
2013 Ga0501034_0285407
2014 Ga0501034_0432858
2015 Ga0501036_0110973
2016 Ga0501037_0052642
2017 Ga0501038_0018286
2018 Ga0501038_0100768
2019 Ga0501043_0116803
2020 Ga0501046_0365960
2021 Ga0501047_0122208
2022 Ga0501069_0010052
2023 Ga0501070_0153960
2024 Ga0501071_0147049
2025 Ga0501076_0328060
2026 Ga0501223_004174
2027 Ga0501223_025784
2028 Ga0501224_000027
2029 Ga0501233_004186
2030 Ga0501235_024630
2031 Ga0501225_0000057
2032 Ga0501234_002771
2033 Ga0501080_0912732
2034 Ga0501080_1181356
2035 Ga0501083_0114285
2036 Ga0501262_004171
2037 Ga0501035_0024288
2038 Ga0501035_0495676
2039 Ga0501044_0013012
2040 Ga0501044_0052175
2041 Ga0501044_0475213
2042 Ga0501044_0526347
2043 Ga0501044_0599876
2044 Ga0501226_001461
2045 nmdc:mga03683_162_c1
2046 nmdc:mga03n38_46774_c1
2047 nmdc:mga03n38_520064_c1
2048 nmdc:mga00v17_268262_c1
2049 nmdc:mga00v17_45214_c1
2050 nmdc:mga00v17_466554_c1
2051 nmdc:mga00v17_676485_c1
2052 nmdc:mga0yw44_89284_c1
2053 nmdc:mga0k408_145641_c1
2054 nmdc:mga0k408_765972_c1
2055 nmdc:mga06z11_182_c1
2056 nmdc:mga06z11_404536_c1
2057 nmdc:mga04h51_252088_c1
2058 nmdc:mga04h51_83_c1
2059 nmdc:mga07m45_146885_c1
2060 nmdc:mga07m45_32_c1
2061 nmdc:mga07m45_450966_c1
2062 nmdc:mga07m45_77392_c1
2063 nmdc:mga0qj67_293097_c1
2064 nmdc:mga0qj67_41529_c1
2065 nmdc:mga0qj67_481221_c1
2066 nmdc:mga0sz30_383076_c1
2067 Ga0500610_0000034
2068 Ga0500643_000803
2069 Ga0500643_000972
2070 Ga0500643_005262
2071 Ga0500647_0108041
2072 Ga0500583_0107988
2073 Ga0500555_000591
2074 Ga0500562_003139
2075 Ga0500592_070547
2076 Ga0500594_0237994
2077 Ga0500595_000211
2078 Ga0500608_000153
2079 Ga0500614_155995
2080 Ga0500618_000964
2081 Ga0500559_0050061
2082 Ga0500564_001024
2083 Ga0500573_0086993
2084 Ga0500573_0461907
2085 Ga0500577_0147512
2086 Ga0500590_009905
2087 Ga0500604_0000146
2088 Ga0500616_0059172
2089 Ga0500622_0007706
2090 Ga0500624_002499
2091 Ga0500636_0010279
2092 Ga0500636_0150096
2093 Ga0500636_0462549
2094 Ga0500567_004232
2095 Ga0500625_000005
2096 Ga0500645_000001
2097 Ga0500645_017970
2098 Ga0500645_072147
2099 Ga0587085_162448
2100 Ga0466962_0012254
2101 2509107760
2102 2509376141
2103 2511389409
2104 2512533130
2105 2524453066
2106 2558865547
2107 2558868376
2108 2643730730
2109 2644044617
2110 2644391458
2111 2738712449
2112 2738850857
2113 2738866603
2114 2739299104
2115 2739360799
2116 2739651334
2117 2740029807
2118 2753359609
2119 2757569945
2120 2758641869
2121 2765466044
2122 2776271692
2123 2776279795
2124 2819553412
2125 2839995228
2126 2840769987
2127 2842872779
2128 2850080921
2129 2852654634
2130 2876373375
2131 2881152153
2132 2881168136
2133 2882808607
2134 2889794654
2135 2889917868
2136 2894654604
2137 2894819886
2138 2896254454
2139 2904583318
2140 2915652998
2141 2919121062
2142 2921211294
2143 2928103501
2144 2928523211
2145 2928962812
2146 2954015481
2147 3002144049
2148 3003670257
2149 8001526622
2150 8045865579

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

134

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

145

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.9021 1 120
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8961 1 120
4mts-assembly1.cif.gz_B ni- and zn-bound gloa2 at high resolution 0.8855 1 120
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8782 1 120
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8737 1 119
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9021 1 120 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8961 1 120 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8929 1 119 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8785 1 57 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.858 4 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A520I3C9-F1-model_v4 Lactoylglutathione lyase 0.9987 1 57 GO:0016829
AF-A0A520I3C9-F1-model_v4 Lactoylglutathione lyase 0.9815 1 57 GO:0016829
AF-A0A3D2GKL9-F1-model_v4 Lactoylglutathione lyase 0.9574 69 137 GO:0016829
AF-A0A654CBS1-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) 0.9523 1 137 GO:0004462
AF-A0A3B0RZP6-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) 0.9486 1 137 GO:0004462
GO:0046872

Map