F489505

General Info

Members Datasets Scaffolds Average Seq Length
1072 422 2144 208

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10238800|Ga0068851_102388001
Length 238
Sequence MSNRFGAPNASGQFSTPEMDPRGLTPQVRHEQFAPTMDYYIPQWEERTSYGMRRIDPYTKLFEDRIIFLGTPISDDIANAVMAQLLCLQQMDPDRDINIYINSPGGSFTAMTAIYDTMQFLKPDIQTVCLGQAASAAAVLLAAGTPGKRMALPNSRILIHQPYTEGSYGQSSDIEIQANEILRMRELLEKLIANHTGKTPEEVNADIERDKILTSEAAKEYGLIDGILESLKGTPATI

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
100 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
104 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
105 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
108 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
109 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
188 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
189 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
212 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
213 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
214 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
231 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
237 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
306 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
307 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
341 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
342 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
343 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
344 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
392 2643221561 Nocardioides sp. Root151 Isolate Unclassified
393 2643221576 Nocardioides sp. Root614 Isolate Unclassified
394 2643221590 Nocardioides sp. Root682 Isolate Unclassified
395 2643221604 Nocardioides sp. Root190 Isolate Unclassified
396 2643221615 Nocardioides sp. Root224 Isolate Unclassified
397 2643221617 Nocardioides sp. Root79 Isolate Unclassified
398 2643221620 Nocardioides sp. Root240 Isolate Unclassified
399 2643221641 Nocardioides sp. Root122 Isolate Unclassified
400 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
401 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
402 2643221696 Nocardioides sp. Root140 Isolate Unclassified
403 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
404 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
405 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
406 2738541305 Nocardioides sp. CF167 Isolate Unclassified
407 2739367898 Nocardioides sp. CF479 Isolate Unclassified
408 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
409 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
410 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
411 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
412 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
413 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
414 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
415 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
416 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
417 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
418 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
419 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
420 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
421 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
422 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.56
Metatranscriptomes 3.54
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 5.69
Nodule 0.09
Rhizoplane 6.9
Rhizosphere 83.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10238800 3300005834 Bacteria 1027
2 LJQas_1003330 3300000549 Bacteria 2164
3 JGI24740J21852_10017617 3300001979 Bacteria 2549
4 JGI24740J21852_10027305 3300001979 Bacteria 1901
5 JGI24739J22299_10049588 3300001989 Bacteria 1361
6 JGI24739J22299_10059109 3300001989 Bacteria 1215
7 JGI24737J22298_10009059 3300001990 Bacteria 3318
8 JGI24737J22298_10013219 3300001990 Bacteria 2688
9 JGI24737J22298_10030320 3300001990 Bacteria 1693
10 JGI24735J21928_10012771 3300002067 Bacteria 2652
11 JGI24735J21928_10020398 3300002067 Bacteria 2030
12 JGI24735J21928_10073763 3300002067 Bacteria 977
13 JGI24750J21931_1005874 3300002070 Bacteria 1516
14 JGI24738J21930_10006440 3300002075 Bacteria 2753
15 JGI24738J21930_10026683 3300002075 Bacteria 1185
16 JGI24744J21845_10000532 3300002077 Bacteria 6817
17 JGI24033J26618_1009029 3300002155 Bacteria 1155
18 JGI24034J26672_10060791 3300002239 Bacteria 663
19 JGI25406J46586_10073885 3300003203 Bacteria 1062
20 Ga0006562J51391_1005843 3300003578 Bacteria 3210
21 Ga0007429J51699_1066760 3300003579 Bacteria 1500
22 JGI25405J52794_10006714 3300003911 Bacteria 2106
23 Ga0058861_10077169 3300004800 Bacteria 2133
24 Ga0070658_10108982 3300005327 Bacteria 2292
25 Ga0070658_10227262 3300005327 Bacteria 1579
26 Ga0070658_10352458 3300005327 Bacteria 1260
27 Ga0070658_10772361 3300005327 Bacteria 835
28 Ga0070683_100013995 3300005329 Bacteria 7006
29 Ga0070683_100421979 3300005329 Bacteria 1272
30 Ga0070683_100509705 3300005329 Bacteria 1150
31 Ga0070670_100329110 3300005331 Bacteria 1340
32 Ga0068869_100679547 3300005334 Bacteria 876
33 Ga0070682_100018717 3300005337 Bacteria 4053
34 Ga0070682_100030160 3300005337 Bacteria 3271
35 Ga0070682_100170585 3300005337 Bacteria 1512
36 Ga0070682_100374739 3300005337 Bacteria 1068
37 Ga0070682_100526426 3300005337 Bacteria 921
38 Ga0068868_100060199 3300005338 Bacteria 3006
39 Ga0068868_100098699 3300005338 Bacteria 2361
40 Ga0068868_100124901 3300005338 Bacteria 2101
41 Ga0068868_100773024 3300005338 Bacteria 864
42 Ga0070660_100003302 3300005339 Bacteria 11087
43 Ga0070660_100184551 3300005339 Bacteria 1689
44 Ga0070691_10088917 3300005341 Bacteria 1521
45 Ga0070687_100033972 3300005343 Bacteria 2522
46 Ga0070687_100571102 3300005343 Bacteria 772
47 Ga0070661_100424249 3300005344 Bacteria 1055
48 Ga0070692_10020197 3300005345 Bacteria 3227
49 Ga0070692_10243024 3300005345 Bacteria 1074
50 Ga0070668_100060257 3300005347 Bacteria 2939
51 Ga0070668_100098969 3300005347 Bacteria 2309
52 Ga0070668_100101103 3300005347 Bacteria 2284
53 Ga0070668_100116637 3300005347 Bacteria 2129
54 Ga0070668_100226633 3300005347 Bacteria 1544
55 Ga0070668_100295250 3300005347 Bacteria 1358
56 Ga0070668_100761591 3300005347 Bacteria 858
57 Ga0070669_100464871 3300005353 Bacteria 1045
58 Ga0070674_100060173 3300005356 Bacteria 2647
59 Ga0070674_100066817 3300005356 Bacteria 2528
60 Ga0070673_100332496 3300005364 Bacteria 1344
61 Ga0070688_100191318 3300005365 Bacteria 1426
62 Ga0070688_100448779 3300005365 Bacteria 964
63 Ga0070659_100019106 3300005366 Bacteria 5184
64 Ga0070659_100025275 3300005366 Bacteria 4558
65 Ga0070659_100066242 3300005366 Bacteria 2862
66 Ga0070659_100191252 3300005366 Bacteria 1682
67 Ga0070659_100901525 3300005366 Bacteria 773
68 Ga0070667_100072949 3300005367 Bacteria 2926
69 Ga0070667_100279108 3300005367 Bacteria 1500
70 Ga0070667_100746910 3300005367 Bacteria 907
71 Ga0070701_10094608 3300005438 Bacteria 1644
72 Ga0070711_100926075 3300005439 Bacteria 745
73 Ga0070705_100013976 3300005440 Bacteria 4118
74 Ga0070700_100002303 3300005441 Bacteria 9716
75 Ga0070700_100448010 3300005441 Bacteria 982
76 Ga0070663_100036589 3300005455 Bacteria 3411
77 Ga0070663_100114837 3300005455 Bacteria 2027
78 Ga0070663_100163055 3300005455 Bacteria 1717
79 Ga0070663_100363988 3300005455 Bacteria 1174
80 Ga0070678_100104615 3300005456 Bacteria 2202
81 Ga0070678_100453373 3300005456 Bacteria 1124
82 Ga0070662_100036231 3300005457 Bacteria 3488
83 Ga0070662_100041884 3300005457 Bacteria 3269
84 Ga0070662_100155153 3300005457 Bacteria 1786
85 Ga0070662_100199228 3300005457 Bacteria 1588
86 Ga0070681_10295500 3300005458 Bacteria 1530
87 Ga0068867_100007389 3300005459 Bacteria 7773
88 Ga0068867_100049577 3300005459 Bacteria 3092
89 Ga0068867_100604874 3300005459 Bacteria 956
90 Ga0070698_100011005 3300005471 Bacteria 9624
91 Ga0070679_100020810 3300005530 Bacteria 6399
92 Ga0070679_100521181 3300005530 Bacteria 1132
93 Ga0070679_100736568 3300005530 Bacteria 929
94 Ga0070684_100004672 3300005535 Bacteria 10459
95 Ga0070684_100063833 3300005535 Bacteria 3230
96 Ga0070684_100273570 3300005535 Bacteria 1546
97 Ga0070684_100662654 3300005535 Bacteria 972
98 Ga0068853_100338395 3300005539 Bacteria 1398
99 Ga0068853_100526708 3300005539 Bacteria 1118
100 Ga0068853_100750556 3300005539 Bacteria 932
101 Ga0070672_100046686 3300005543 Bacteria 3356
102 Ga0070686_100209024 3300005544 Bacteria 1403
103 Ga0070686_100441218 3300005544 Bacteria 999
104 Ga0070695_100855902 3300005545 Bacteria 732
105 Ga0070693_100006536 3300005547 Bacteria 5653
106 Ga0070665_100000868 3300005548 Bacteria 39125
107 Ga0068855_100551123 3300005563 Bacteria 1248
108 Ga0068855_100626339 3300005563 Bacteria 1158
109 Ga0070664_100475196 3300005564 Bacteria 1150
110 Ga0068857_100367938 3300005577 Bacteria 1333
111 Ga0068854_100016555 3300005578 Bacteria 4918
112 Ga0068854_100518157 3300005578 Bacteria 1007
113 Ga0068856_100240491 3300005614 Bacteria 1826
114 Ga0068856_100329340 3300005614 Bacteria 1545
115 Ga0070702_100015855 3300005615 Bacteria 3856
116 Ga0070702_100026047 3300005615 Bacteria 3139
117 Ga0070702_100720402 3300005615 Bacteria 763
118 Ga0068852_100149897 3300005616 Bacteria 2168
119 Ga0068852_100390172 3300005616 Bacteria 1367
120 Ga0068864_100078679 3300005618 Bacteria 2886
121 Ga0068864_100125496 3300005618 Bacteria 2300
122 Ga0068864_100263266 3300005618 Bacteria 1605
123 Ga0068866_10025798 3300005718 Bacteria 2768
124 Ga0068861_100024654 3300005719 Bacteria 4354
125 Ga0068861_100086135 3300005719 Bacteria 2469
126 Ga0068861_100880154 3300005719 Bacteria 847
127 Ga0068851_10111670 3300005834 Bacteria 1460
128 Ga0068870_10003830 3300005840 Bacteria 6407
129 Ga0068870_10061537 3300005840 Bacteria 2018
130 Ga0068870_10113681 3300005840 Bacteria 1549
131 Ga0068863_100875613 3300005841 Bacteria 898
132 Ga0068858_100045111 3300005842 Bacteria 4085
133 Ga0068860_100000388 3300005843 Bacteria 57678
134 Ga0068860_100100623 3300005843 Bacteria 2758
135 Ga0068860_100550618 3300005843 Bacteria 1156
136 Ga0081455_10000298 3300005937 Bacteria 65765
137 Ga0081455_10002569 3300005937 Bacteria 21545
138 Ga0081455_10006814 3300005937 Bacteria 12180
139 Ga0081455_10010219 3300005937 Bacteria 9549
140 Ga0081455_10020733 3300005937 Bacteria 6181
141 Ga0081455_10038921 3300005937 Bacteria 4208
142 Ga0081455_10056392 3300005937 Bacteria 3336
143 Ga0081538_10000841 3300005981 Bacteria 33283
144 Ga0081538_10016484 3300005981 Bacteria 5661
145 Ga0081538_10017183 3300005981 Bacteria 5503
146 Ga0081540_1069961 3300005983 Bacteria 1628
147 Ga0081539_10000170 3300005985 Bacteria 152854
148 Ga0075365_10019907 3300006038 Bacteria 4152
149 Ga0075365_10050313 3300006038 Bacteria 2748
150 Ga0075365_10146211 3300006038 Bacteria 1642
151 Ga0075365_10308305 3300006038 Bacteria 1114
152 Ga0075365_10316815 3300006038 Bacteria 1098
153 Ga0075365_10478974 3300006038 Bacteria 879
154 Ga0075368_10061383 3300006042 Bacteria 1505
155 Ga0075368_10207217 3300006042 Bacteria 830
156 Ga0075363_100008378 3300006048 Bacteria 4811
157 Ga0075363_100046286 3300006048 Bacteria 2307
158 Ga0075363_100187971 3300006048 Bacteria 1177
159 Ga0075363_100318542 3300006048 Bacteria 904
160 Ga0075363_100367887 3300006048 Bacteria 841
161 Ga0075364_10003388 3300006051 Bacteria 9053
162 Ga0075364_10045314 3300006051 Bacteria 2862
163 Ga0075364_10387199 3300006051 Bacteria 954
164 Ga0075432_10002195 3300006058 Bacteria 6501
165 Ga0075432_10004039 3300006058 Bacteria 5009
166 Ga0075362_10004276 3300006177 Bacteria 5104
167 Ga0075367_10020551 3300006178 Bacteria 3680
168 Ga0075367_10037203 3300006178 Bacteria 2827
169 Ga0075367_10520773 3300006178 Bacteria 755
170 Ga0075370_10024322 3300006353 Bacteria 3345
171 Ga0075370_10043683 3300006353 Bacteria 2533
172 Ga0075370_10078090 3300006353 Bacteria 1900
173 Ga0075370_10094577 3300006353 Bacteria 1726
174 Ga0075428_100003370 3300006844 Bacteria 17483
175 Ga0075428_100022105 3300006844 Bacteria 7042
176 Ga0075428_100024346 3300006844 Bacteria 6698
177 Ga0075428_100027812 3300006844 Bacteria 6256
178 Ga0075428_100096259 3300006844 Bacteria 3226
179 Ga0075430_100008427 3300006846 Bacteria 8709
180 Ga0075430_100072226 3300006846 Bacteria 2894
181 Ga0075431_100001915 3300006847 Bacteria 19773
182 Ga0075431_100036576 3300006847 Bacteria 5056
183 Ga0075431_100051599 3300006847 Bacteria 4241
184 Ga0075433_10004815 3300006852 Bacteria 10539
185 Ga0075433_10066458 3300006852 Bacteria 3164
186 Ga0075433_10290177 3300006852 Bacteria 1449
187 Ga0075434_100004269 3300006871 Bacteria 12820
188 Ga0075434_100021537 3300006871 Bacteria 6266
189 Ga0075434_100535713 3300006871 Bacteria 1191
190 Ga0075429_100016458 3300006880 Bacteria 6408
191 Ga0075429_100030709 3300006880 Bacteria 4667
192 Ga0068865_100004270 3300006881 Bacteria 8620
193 Ga0068865_100007647 3300006881 Bacteria 6656
194 Ga0068865_100131512 3300006881 Bacteria 1875
195 Ga0068865_100330122 3300006881 Bacteria 1229
196 Ga0075436_100000495 3300006914 Bacteria 25442
197 Ga0075435_100003823 3300007076 Bacteria 10273
198 Ga0075435_100024035 3300007076 Bacteria 4723
199 Ga0105240_10853454 3300009093 Bacteria 983
200 Ga0111539_10015199 3300009094 Bacteria 9589
201 Ga0111539_10051724 3300009094 Bacteria 4891
202 Ga0111539_10442384 3300009094 Bacteria 1513
203 Ga0111539_10564497 3300009094 Bacteria 1325
204 Ga0105245_10002262 3300009098 Bacteria 17436
205 Ga0105245_10010146 3300009098 Bacteria 8202
206 Ga0105245_10057213 3300009098 Bacteria 3506
207 Ga0105245_10197954 3300009098 Bacteria 1928
208 Ga0105245_10273941 3300009098 Bacteria 1647
209 Ga0105245_10276777 3300009098 Bacteria 1639
210 Ga0105247_10242582 3300009101 Bacteria 1228
211 Ga0114129_10038001 3300009147 Bacteria 6791
212 Ga0114129_10048557 3300009147 Bacteria 5963
213 Ga0114129_10214007 3300009147 Bacteria 2603
214 Ga0105243_10011969 3300009148 Bacteria 6558
215 Ga0105243_10047697 3300009148 Bacteria 3374
216 Ga0105243_10055770 3300009148 Bacteria 3140
217 Ga0105243_10093944 3300009148 Bacteria 2476
218 Ga0105243_10138780 3300009148 Bacteria 2071
219 Ga0105243_10446906 3300009148 Bacteria 1212
220 Ga0105243_10634791 3300009148 Bacteria 1033
221 Ga0105243_10927957 3300009148 Bacteria 868
222 Ga0105242_10059619 3300009176 Bacteria 3132
223 Ga0105242_10260126 3300009176 Bacteria 1567
224 Ga0105242_10281387 3300009176 Bacteria 1511
225 Ga0105248_10190351 3300009177 Bacteria 2312
226 Ga0105248_10274711 3300009177 Bacteria 1897
227 Ga0105248_10602244 3300009177 Bacteria 1240
228 Ga0105237_10071232 3300009545 Bacteria 3471
229 Ga0105237_10116239 3300009545 Bacteria 2668
230 Ga0105237_10788331 3300009545 Bacteria 957
231 Ga0105237_11113179 3300009545 Bacteria 796
232 Ga0105238_10216710 3300009551 Bacteria 1890
233 Ga0105238_10524756 3300009551 Bacteria 1187
234 Ga0105249_10032279 3300009553 Bacteria 4737
235 Ga0105249_10037581 3300009553 Bacteria 4394
236 Ga0105249_10071139 3300009553 Bacteria 3213
237 Ga0105249_10203984 3300009553 Bacteria 1936
238 Ga0105249_10214519 3300009553 Bacteria 1891
239 Ga0105249_10407079 3300009553 Bacteria 1392
240 Ga0105249_10895474 3300009553 Bacteria 954
241 Ga0105030_109670 3300009987 Bacteria 823
242 Ga0105028_104598 3300009993 Bacteria 1438
243 Ga0105239_10001318 3300010375 Bacteria 33415
244 Ga0105239_10002798 3300010375 Bacteria 21821
245 Ga0105239_10079150 3300010375 Bacteria 3617
246 Ga0105239_10218118 3300010375 Bacteria 2139
247 Ga0105239_10474285 3300010375 Bacteria 1421
248 Ga0105239_10757685 3300010375 Bacteria 1111
249 Ga0105246_10014826 3300011119 Bacteria 4909
250 Ga0105246_10130712 3300011119 Bacteria 1875
251 Ga0105246_10379044 3300011119 Bacteria 1168
252 Ga0157336_1006973 3300012477 Bacteria 787
253 Ga0157329_1003071 3300012491 Bacteria 998
254 Ga0157335_1002177 3300012492 Bacteria 1159
255 Ga0157341_1003790 3300012494 Bacteria 1071
256 Ga0157319_1001204 3300012497 Bacteria 1298
257 Ga0157319_1005147 3300012497 Bacteria 889
258 Ga0157345_1009036 3300012498 Bacteria 844
259 Ga0157338_1010256 3300012515 Bacteria 942
260 Ga0157373_10608154 3300013100 Bacteria 796
261 Ga0157371_10053858 3300013102 Bacteria 2857
262 Ga0157371_10087061 3300013102 Bacteria 2212
263 Ga0157374_10282565 3300013296 Bacteria 1639
264 Ga0157378_10471144 3300013297 Bacteria 1250
265 Ga0157378_10517258 3300013297 Bacteria 1194
266 Ga0163162_10038011 3300013306 Bacteria 4804
267 Ga0163162_10158276 3300013306 Bacteria 2386
268 Ga0163162_10358331 3300013306 Bacteria 1591
269 Ga0163162_10500621 3300013306 Bacteria 1345
270 Ga0163162_10932740 3300013306 Bacteria 980
271 Ga0157372_10027521 3300013307 Bacteria 6194
272 Ga0157372_10083119 3300013307 Bacteria 3627
273 Ga0157372_10116214 3300013307 Bacteria 3067
274 Ga0157372_10273589 3300013307 Bacteria 1963
275 Ga0157372_10284284 3300013307 Bacteria 1924
276 Ga0157372_10507490 3300013307 Bacteria 1406
277 Ga0157375_10277439 3300013308 Bacteria 1839
278 Ga0157375_10421088 3300013308 Bacteria 1501
279 Ga0157375_10431870 3300013308 Bacteria 1483
280 Ga0157375_10558921 3300013308 Bacteria 1305
281 Ga0157375_10682027 3300013308 Bacteria 1182
282 Ga0157375_10847275 3300013308 Bacteria 1061
283 Ga0163163_10129334 3300014325 Bacteria 2565
284 Ga0163163_10160525 3300014325 Bacteria 2293
285 Ga0163163_10287979 3300014325 Bacteria 1695
286 Ga0163163_10788419 3300014325 Bacteria 1014
287 Ga0157380_10005485 3300014326 Bacteria 8863
288 Ga0157380_10174384 3300014326 Bacteria 1882
289 Ga0157380_10200963 3300014326 Bacteria 1768
290 Ga0157380_10386832 3300014326 Bacteria 1322
291 Ga0182008_10190355 3300014497 Bacteria 1041
292 Ga0157377_10316245 3300014745 Bacteria 1036
293 Ga0157379_10040240 3300014968 Bacteria 4171
294 Ga0157376_10340096 3300014969 Bacteria 1433
295 Ga0157376_10350290 3300014969 Bacteria 1413
296 Ga0163161_10017762 3300017792 Bacteria 4984
297 Ga0163161_10048837 3300017792 Bacteria 3056
298 Ga0163161_10153584 3300017792 Bacteria 1751
299 Ga0163161_10162132 3300017792 Bacteria 1705
300 Ga0163161_10326916 3300017792 Bacteria 1213
301 Ga0197907_10208093 3300020069 Bacteria 907
302 Ga0197907_10309606 3300020069 Bacteria 2142
303 Ga0197907_10559225 3300020069 Bacteria 1832
304 Ga0206356_11297441 3300020070 Bacteria 966
305 Ga0206356_11804983 3300020070 Bacteria 1450
306 Ga0206355_1640103 3300020076 Bacteria 1654
307 Ga0206350_10103036 3300020080 Bacteria 1325
308 Ga0154015_1364342 3300020610 Bacteria 3269
309 Ga0213875_10074552 3300021388 Bacteria 1583
310 Ga0207682_10094578 3300025893 Bacteria 1300
311 Ga0207642_10122701 3300025899 Bacteria 1343
312 Ga0207710_10089645 3300025900 Bacteria 1438
313 Ga0207688_10052421 3300025901 Bacteria 2286
314 Ga0207688_10058370 3300025901 Bacteria 2171
315 Ga0207688_10094086 3300025901 Bacteria 1724
316 Ga0207647_10008541 3300025904 Bacteria 7334
317 Ga0207647_10010116 3300025904 Bacteria 6669
318 Ga0207647_10059649 3300025904 Bacteria 2334
319 Ga0207647_10168652 3300025904 Bacteria 1275
320 Ga0207647_10315777 3300025904 Bacteria 888
321 Ga0207647_10370187 3300025904 Bacteria 810
322 Ga0207685_10113134 3300025905 Bacteria 1180
323 Ga0207643_10108564 3300025908 Bacteria 1633
324 Ga0207643_10110657 3300025908 Bacteria 1618
325 Ga0207643_10129421 3300025908 Bacteria 1501
326 Ga0207643_10238608 3300025908 Bacteria 1117
327 Ga0207705_10095945 3300025909 Bacteria 2177
328 Ga0207705_10098957 3300025909 Bacteria 2144
329 Ga0207705_10265900 3300025909 Bacteria 1310
330 Ga0207707_10155432 3300025912 Bacteria 2000
331 Ga0207671_10087463 3300025914 Bacteria 2343
332 Ga0207671_10272065 3300025914 Bacteria 1335
333 Ga0207671_10477858 3300025914 Bacteria 993
334 Ga0207662_10079336 3300025918 Bacteria 2000
335 Ga0207657_10042184 3300025919 Bacteria 4027
336 Ga0207657_10046093 3300025919 Bacteria 3820
337 Ga0207657_10279651 3300025919 Bacteria 1325
338 Ga0207657_10454860 3300025919 Bacteria 1004
339 Ga0207652_10019476 3300025921 Bacteria 5582
340 Ga0207652_10201519 3300025921 Bacteria 1791
341 Ga0207652_11126577 3300025921 Bacteria 685
342 Ga0207646_10129704 3300025922 Bacteria 2269
343 Ga0207681_10345282 3300025923 Bacteria 1190
344 Ga0207681_10421974 3300025923 Bacteria 1081
345 Ga0207694_10095551 3300025924 Bacteria 2350
346 Ga0207694_10125616 3300025924 Bacteria 2052
347 Ga0207694_10155871 3300025924 Bacteria 1842
348 Ga0207650_10499478 3300025925 Bacteria 1016
349 Ga0207687_10063706 3300025927 Bacteria 2611
350 Ga0207687_10146799 3300025927 Bacteria 1795
351 Ga0207687_10257967 3300025927 Bacteria 1389
352 Ga0207687_10429373 3300025927 Bacteria 1092
353 Ga0207687_10453778 3300025927 Bacteria 1063
354 Ga0207664_10046885 3300025929 Bacteria 3393
355 Ga0207690_10014894 3300025932 Bacteria 4706
356 Ga0207690_10036521 3300025932 Bacteria 3182
357 Ga0207690_10074596 3300025932 Bacteria 2350
358 Ga0207690_10077583 3300025932 Bacteria 2310
359 Ga0207690_10199212 3300025932 Bacteria 1520
360 Ga0207706_10022138 3300025933 Bacteria 5705
361 Ga0207706_10190026 3300025933 Bacteria 1803
362 Ga0207706_10281427 3300025933 Bacteria 1450
363 Ga0207706_11069634 3300025933 Bacteria 675
364 Ga0207686_10010760 3300025934 Bacteria 4985
365 Ga0207686_10106628 3300025934 Bacteria 1881
366 Ga0207686_10176922 3300025934 Bacteria 1510
367 Ga0207686_10390934 3300025934 Bacteria 1057
368 Ga0207709_10005306 3300025935 Bacteria 7331
369 Ga0207709_10036229 3300025935 Bacteria 2923
370 Ga0207709_10114062 3300025935 Bacteria 1813
371 Ga0207709_10139341 3300025935 Bacteria 1665
372 Ga0207709_10429124 3300025935 Bacteria 1017
373 Ga0207709_10588515 3300025935 Bacteria 880
374 Ga0207670_10427921 3300025936 Bacteria 1063
375 Ga0207669_10015653 3300025937 Bacteria 3831
376 Ga0207669_10115217 3300025937 Bacteria 1811
377 Ga0207704_10013477 3300025938 Bacteria 4092
378 Ga0207704_10019645 3300025938 Bacteria 3553
379 Ga0207704_10083003 3300025938 Bacteria 2078
380 Ga0207704_10166531 3300025938 Bacteria 1575
381 Ga0207691_10003002 3300025940 Bacteria 16471
382 Ga0207691_10081757 3300025940 Bacteria 2903
383 Ga0207711_10214258 3300025941 Bacteria 1760
384 Ga0207711_10666024 3300025941 Bacteria 971
385 Ga0207689_10363980 3300025942 Bacteria 1203
386 Ga0207661_10005512 3300025944 Bacteria 8927
387 Ga0207661_10203304 3300025944 Bacteria 1742
388 Ga0207661_10263398 3300025944 Bacteria 1536
389 Ga0207679_10250018 3300025945 Bacteria 1507
390 Ga0207679_10334253 3300025945 Bacteria 1316
391 Ga0207679_10693878 3300025945 Bacteria 923
392 Ga0207667_10494453 3300025949 Bacteria 1241
393 Ga0207651_10218246 3300025960 Bacteria 1540
394 Ga0207712_10029451 3300025961 Bacteria 3683
395 Ga0207712_10068944 3300025961 Bacteria 2536
396 Ga0207712_10914457 3300025961 Bacteria 776
397 Ga0207668_10061208 3300025972 Bacteria 2646
398 Ga0207668_10138819 3300025972 Bacteria 1866
399 Ga0207668_10139839 3300025972 Bacteria 1860
400 Ga0207668_10461494 3300025972 Bacteria 1086
401 Ga0207640_10053848 3300025981 Bacteria 2628
402 Ga0207658_10158162 3300025986 Bacteria 1854
403 Ga0207658_10250321 3300025986 Bacteria 1505
404 Ga0207658_10339750 3300025986 Bacteria 1305
405 Ga0207677_10094319 3300026023 Bacteria 2184
406 Ga0207677_10162617 3300026023 Bacteria 1736
407 Ga0207677_10196712 3300026023 Bacteria 1599
408 Ga0207703_10095225 3300026035 Bacteria 2512
409 Ga0207703_10465034 3300026035 Bacteria 1183
410 Ga0207703_11093552 3300026035 Bacteria 766
411 Ga0207639_10051080 3300026041 Bacteria 3143
412 Ga0207639_10137875 3300026041 Bacteria 2029
413 Ga0207639_10185629 3300026041 Bacteria 1772
414 Ga0207639_10516134 3300026041 Bacteria 1094
415 Ga0207678_10065790 3300026067 Bacteria 3112
416 Ga0207678_10127572 3300026067 Bacteria 2170
417 Ga0207678_10186019 3300026067 Bacteria 1774
418 Ga0207678_10217119 3300026067 Bacteria 1636
419 Ga0207678_10231520 3300026067 Bacteria 1582
420 Ga0207678_10355017 3300026067 Bacteria 1265
421 Ga0207678_10378226 3300026067 Bacteria 1224
422 Ga0207708_10001371 3300026075 Bacteria 18327
423 Ga0207708_10095894 3300026075 Bacteria 2291
424 Ga0207708_10107229 3300026075 Bacteria 2166
425 Ga0207708_10251015 3300026075 Bacteria 1426
426 Ga0207708_10355483 3300026075 Bacteria 1203
427 Ga0207702_10126503 3300026078 Bacteria 2295
428 Ga0207641_10484756 3300026088 Bacteria 1199
429 Ga0207648_10050693 3300026089 Bacteria 3629
430 Ga0207648_10056730 3300026089 Bacteria 3417
431 Ga0207648_10269923 3300026089 Bacteria 1519
432 Ga0207676_10403299 3300026095 Bacteria 1278
433 Ga0207676_10454806 3300026095 Bacteria 1208
434 Ga0207676_10521386 3300026095 Bacteria 1131
435 Ga0207674_10007577 3300026116 Bacteria 12649
436 Ga0207674_10114438 3300026116 Bacteria 2670
437 Ga0207674_10327365 3300026116 Bacteria 1482
438 Ga0207675_100016804 3300026118 Bacteria 6836
439 Ga0207675_100043167 3300026118 Bacteria 4211
440 Ga0207675_100089750 3300026118 Bacteria 2889
441 Ga0207675_100118612 3300026118 Bacteria 2502
442 Ga0207675_100322546 3300026118 Bacteria 1508
443 Ga0207683_10093108 3300026121 Bacteria 2685
444 Ga0207683_10121129 3300026121 Bacteria 2349
445 Ga0207698_10223756 3300026142 Bacteria 1703
446 Ga0207698_10468897 3300026142 Bacteria 1219
447 Ga0207698_10576581 3300026142 Bacteria 1106
448 Ga0207698_10630803 3300026142 Bacteria 1060
449 Ga0209999_1058845 3300027543 Bacteria 730
450 Ga0209813_10000658 3300027866 Bacteria 7921
451 Ga0209813_10005764 3300027866 Bacteria 3025
452 Ga0207428_10003055 3300027907 Bacteria 16475
453 Ga0207428_10008733 3300027907 Bacteria 9139
454 Ga0207428_10023825 3300027907 Bacteria 5142
455 Ga0207428_10259012 3300027907 Bacteria 1296
456 Ga0268266_10001392 3300028379 Bacteria 28952
457 Ga0268266_10121698 3300028379 Bacteria 2323
458 Ga0268264_10000387 3300028381 Bacteria 63349
459 Ga0268264_10210935 3300028381 Bacteria 1783
460 Ga0268264_10426826 3300028381 Bacteria 1280
461 Ga0307517_10201545 3300028786 Bacteria 1243
462 Ga0307515_10344927 3300028794 Bacteria 1139
463 Ga0316176_1031002 3300030732 Bacteria 1161
464 Ga0316181_1115169 3300030744 Bacteria 1841
465 Ga0316182_1088044 3300030745 Bacteria 1074
466 Ga0316182_1224164 3300030745 Bacteria 6404
467 Ga0265320_10045531 3300031240 Bacteria 2155
468 Ga0265340_10025160 3300031247 Bacteria 3018
469 Ga0265339_10022215 3300031249 Bacteria 3678
470 Ga0307513_10071567 3300031456 Bacteria 3618
471 Ga0307408_100005933 3300031548 Bacteria 8137
472 Ga0307408_100013944 3300031548 Bacteria 5337
473 Ga0307408_100096374 3300031548 Bacteria 2244
474 Ga0307408_100164326 3300031548 Bacteria 1766
475 Ga0307408_100766208 3300031548 Bacteria 873
476 Ga0316579_10013595 3300031691 Bacteria 3503
477 Ga0265342_10101315 3300031712 Bacteria 1640
478 Ga0316576_10058110 3300031727 Bacteria 2828
479 Ga0316576_10154017 3300031727 Bacteria 1732
480 Ga0316578_10059267 3300031728 Bacteria 2251
481 Ga0307405_10383273 3300031731 Bacteria 1095
482 Ga0316577_10017848 3300031733 Bacteria 3921
483 Ga0307413_10001451 3300031824 Bacteria 9002
484 Ga0307413_10023829 3300031824 Bacteria 3324
485 Ga0307413_10056084 3300031824 Bacteria 2401
486 Ga0307413_10313387 3300031824 Bacteria 1195
487 Ga0307413_10469726 3300031824 Bacteria 1003
488 Ga0307410_10002082 3300031852 Bacteria 9478
489 Ga0307410_10011465 3300031852 Bacteria 5071
490 Ga0307410_10041750 3300031852 Bacteria 3027
491 Ga0307410_10094609 3300031852 Bacteria 2129
492 Ga0307410_10154434 3300031852 Bacteria 1712
493 Ga0307410_10293295 3300031852 Bacteria 1281
494 Ga0307410_10566617 3300031852 Bacteria 943
495 Ga0307406_10000207 3300031901 Bacteria 35322
496 Ga0307406_10010450 3300031901 Bacteria 5235
497 Ga0307406_10101042 3300031901 Bacteria 1964
498 Ga0307407_10007549 3300031903 Bacteria 4931
499 Ga0307407_10020689 3300031903 Bacteria 3376
500 Ga0307412_10067839 3300031911 Bacteria 2423
501 Ga0307412_10092906 3300031911 Bacteria 2115
502 Ga0307412_10166467 3300031911 Bacteria 1644
503 Ga0307409_100003399 3300031995 Bacteria 8641
504 Ga0307409_100021958 3300031995 Bacteria 4389
505 Ga0307409_100121070 3300031995 Bacteria 2216
506 Ga0307409_100297914 3300031995 Bacteria 1499
507 Ga0307409_100853791 3300031995 Bacteria 921
508 Ga0307416_100000064 3300032002 Bacteria 95532
509 Ga0307416_100000622 3300032002 Bacteria 18287
510 Ga0307416_100068237 3300032002 Bacteria 2937
511 Ga0307416_100088949 3300032002 Bacteria 2642
512 Ga0307416_100105910 3300032002 Bacteria 2463
513 Ga0307416_100248489 3300032002 Bacteria 1729
514 Ga0307416_100529099 3300032002 Bacteria 1248
515 Ga0307416_101174522 3300032002 Bacteria 873
516 Ga0307414_10004847 3300032004 Bacteria 7348
517 Ga0307414_10256654 3300032004 Bacteria 1456
518 Ga0307414_10452038 3300032004 Bacteria 1127
519 Ga0307411_10003883 3300032005 Bacteria 7043
520 Ga0307411_10174105 3300032005 Bacteria 1626
521 Ga0307415_100002201 3300032126 Bacteria 9645
522 Ga0307415_100013917 3300032126 Bacteria 4710
523 Ga0307415_100188988 3300032126 Bacteria 1623
524 Ga0307415_100812461 3300032126 Bacteria 854
525 Ga0307415_101124638 3300032126 Bacteria 736
526 Ga0316583_10010836 3300032133 Bacteria 3283
527 Ga0316585_10013028 3300032137 Bacteria 2472
528 Ga0316580_10009815 3300032139 Bacteria 2882
529 Ga0316593_10004157 3300032168 Bacteria 3681
530 Ga0316592_1000942 3300033524 Bacteria 4453
531 Ga0316588_1006432 3300033528 Bacteria 2348
532 Ga0316596_1003274 3300033541 Bacteria 3527
533 Ga0373928_0041623 3300035084 Bacteria 1057
534 Ga0373946_0158242 3300035171 Bacteria 1062
535 Ga0316574_0103207 3300035398 Bacteria 1825
536 Ga0373931_0185772 3300035691 Bacteria 1234
537 Ga0316582_0128927 3300036647 Bacteria 1697
538 Ga0316584_0032972 3300036712 Bacteria 3833
539 Ga0395900_0034125 3300037418 Bacteria 5238
540 Ga0395900_0380545 3300037418 Bacteria 1379
541 Ga0395900_0506248 3300037418 Bacteria 1157
542 Ga0395898_0059562 3300037466 Bacteria 3713
543 Ga0395898_0907652 3300037466 Bacteria 819
544 Ga0395905_0012411 3300037471 Bacteria 8201
545 Ga0395905_0216579 3300037471 Bacteria 1793
546 Ga0395905_0576804 3300037471 Bacteria 1026
547 Ga0316581_0003416 3300037588 Bacteria 3953
548 Ga0436364_0249415 3300037853 Bacteria 1561
549 Ga0395901_0034440 3300038443 Bacteria 5230
550 Ga0395901_0081403 3300038443 Bacteria 3382
551 Ga0395901_0083782 3300038443 Bacteria 3333
552 Ga0395901_0629118 3300038443 Bacteria 1079
553 Ga0242420_004572 3300038996 Bacteria 2099
554 Ga0439438_019084 3300041405 Bacteria 1943
555 Ga0439438_043312 3300041405 Bacteria 1162
556 Ga0439465_0035432 3300041413 Bacteria 1600
557 Ga0439465_0140606 3300041413 Bacteria 857
558 Ga0439465_0146610 3300041413 Bacteria 841
559 Ga0451791_0184620 3300041451 Bacteria 2871
560 Ga0451793_0693788 3300041452 Bacteria 1007
561 Ga0451833_0174897 3300041491 Bacteria 1088
562 Ga0451833_0980981 3300041491 Bacteria 18627
563 Ga0451837_0024633 3300041494 Bacteria 903
564 Ga0451837_0461301 3300041494 Bacteria 1134
565 Ga0451837_0642774 3300041494 Bacteria 1595
566 Ga0451839_0935720 3300041496 Bacteria 1030
567 Ga0451853_1172145 3300041512 Bacteria 4998
568 Ga0439431_0003253 3300041997 Bacteria 3574
569 Ga0439445_0045252 3300042004 Bacteria 1177
570 Ga0439445_0086332 3300042004 Bacteria 881
571 Ga0439448_0011399 3300042005 Bacteria 2649
572 Ga0439449_0083999 3300042007 Bacteria 1175
573 Ga0450900_020589 3300042136 Bacteria 917
574 Ga0450906_044534 3300042145 Bacteria 783
575 Ga0439446_0060257 3300042156 Bacteria 1146
576 Ga0439434_0014704 3300042435 Bacteria 2329
577 Ga0439434_0067714 3300042435 Bacteria 1121
578 Ga0439444_0065800 3300042437 Bacteria 766
579 Ga0439459_0016576 3300042438 Bacteria 1363
580 Ga0439464_0045019 3300042439 Bacteria 1265
581 Ga0439464_0067917 3300042439 Bacteria 1051
582 Ga0450901_015447 3300042533 Bacteria 803
583 Ga0439440_0058435 3300042993 Bacteria 979
584 Ga0466969_0004974 3300044656 Bacteria 7078
585 Ga0466972_0006814 3300044658 Bacteria 5734
586 Ga0466972_0073504 3300044658 Bacteria 1629
587 Ga0466972_0158867 3300044658 Bacteria 1062
588 Ga0466965_0000715 3300044683 Bacteria 12381
589 Ga0466965_0014544 3300044683 Bacteria 3726
590 Ga0466965_0042983 3300044683 Bacteria 2230
591 Ga0466965_0051519 3300044683 Bacteria 2042
592 Ga0466965_0060335 3300044683 Bacteria 1894
593 Ga0466965_0083675 3300044683 Bacteria 1615
594 Ga0466966_0096465 3300044684 Bacteria 1831
595 Ga0466961_0023968 3300044693 Bacteria 3926
596 Ga0466961_0045577 3300044693 Bacteria 2806
597 Ga0466961_0045889 3300044693 Bacteria 2795
598 Ga0466961_0074072 3300044693 Bacteria 2159
599 Ga0466961_0106584 3300044693 Bacteria 1764
600 Ga0466963_0031776 3300044694 Bacteria 3414
601 Ga0466963_0056663 3300044694 Bacteria 2608
602 Ga0466963_0144692 3300044694 Bacteria 1648
603 Ga0466963_0165131 3300044694 Bacteria 1542
604 Ga0466963_0205237 3300044694 Bacteria 1378
605 Ga0466963_0270707 3300044694 Bacteria 1193
606 Ga0466964_0012185 3300044706 Bacteria 3252
607 Ga0466964_0040086 3300044706 Bacteria 1890
608 Ga0466964_0054730 3300044706 Bacteria 1646
609 Ga0466964_0094985 3300044706 Bacteria 1304
610 Ga0466964_0140602 3300044706 Bacteria 1109
611 Ga0466971_0006890 3300044719 Bacteria 4939
612 Ga0466971_0023338 3300044719 Bacteria 2757
613 Ga0466971_0085650 3300044719 Bacteria 1440
614 Ga0466971_0088160 3300044719 Bacteria 1419
615 Ga0466970_0011013 3300044765 Bacteria 4602
616 Ga0466970_0031983 3300044765 Bacteria 2780
617 Ga0466970_0039169 3300044765 Bacteria 2515
618 Ga0466970_0062138 3300044765 Bacteria 2002
619 Ga0466970_0076867 3300044765 Bacteria 1799
620 Ga0466970_0083319 3300044765 Bacteria 1730
621 Ga0466970_0099732 3300044765 Bacteria 1581
622 Ga0466970_0125925 3300044765 Bacteria 1405
623 Ga0466957_0004703 3300044842 Bacteria 7638
624 Ga0466957_0012592 3300044842 Bacteria 4897
625 Ga0466957_0040548 3300044842 Bacteria 2812
626 Ga0466957_0099303 3300044842 Bacteria 1833
627 Ga0466957_0155370 3300044842 Bacteria 1482
628 Ga0466960_0006811 3300044901 Bacteria 4604
629 Ga0466960_0007895 3300044901 Bacteria 4342
630 Ga0466960_0018740 3300044901 Bacteria 3038
631 Ga0466960_0030358 3300044901 Bacteria 2486
632 Ga0466960_0050125 3300044901 Bacteria 2012
633 Ga0466960_0069199 3300044901 Bacteria 1753
634 Ga0466960_0133137 3300044901 Bacteria 1314
635 Ga0466959_0034787 3300045049 Bacteria 3726
636 Ga0466959_0171656 3300045049 Bacteria 1521
637 Ga0466959_0199916 3300045049 Bacteria 1392
638 Ga0466959_0358284 3300045049 Bacteria 994
639 Ga0466958_0051704 3300045836 Bacteria 2488
640 Ga0466958_0058011 3300045836 Bacteria 2353
641 Ga0466958_0079928 3300045836 Bacteria 2011
642 Ga0466958_0230199 3300045836 Bacteria 1183
643 Ga0466958_0416115 3300045836 Bacteria 869
644 Ga0466967_0028650 3300045976 Bacteria 4652
645 Ga0466967_0036868 3300045976 Bacteria 4178
646 Ga0466967_0063164 3300045976 Bacteria 3289
647 Ga0466967_0066702 3300045976 Bacteria 3207
648 Ga0466967_0118561 3300045976 Bacteria 2441
649 Ga0466967_0186317 3300045976 Bacteria 1960
650 Ga0466967_0265494 3300045976 Bacteria 1643
651 Ga0466967_0341839 3300045976 Bacteria 1447
652 Ga0466967_0368228 3300045976 Bacteria 1393
653 Ga0466967_0569989 3300045976 Bacteria 1115
654 Ga0466967_0833640 3300045976 Bacteria 916
655 Ga0495629_0050899 3300046459 Bacteria 2900
656 Ga0495629_0199999 3300046459 Bacteria 1382
657 Ga0495629_0276139 3300046459 Bacteria 1154
658 Ga0495641_0086934 3300046461 Bacteria 1399
659 Ga0495582_0300383 3300046473 Bacteria 923
660 Ga0495664_0043871 3300046477 Bacteria 2650
661 Ga0495608_0172045 3300046511 Bacteria 1373
662 Ga0495620_0039685 3300046515 Bacteria 2078
663 Ga0495631_0037959 3300046518 Bacteria 2144
664 Ga0495663_0028687 3300046525 Bacteria 1639
665 Ga0495598_0118933 3300046537 Bacteria 894
666 Ga0495645_0137243 3300046543 Bacteria 1710
667 Ga0495656_0037182 3300046615 Bacteria 2009
668 Ga0495611_0071346 3300046648 Bacteria 1588
669 Ga0495625_0112505 3300046660 Bacteria 1860
670 Ga0495635_0252042 3300046663 Bacteria 1190
671 Ga0495661_0362075 3300046665 Bacteria 712
672 Ga0495657_0093679 3300046675 Bacteria 1922
673 Ga0495658_0487952 3300046683 Bacteria 788
674 Ga0495671_0035510 3300046692 Bacteria 2531
675 Ga0495674_0287465 3300047319 Bacteria 1346
676 Ga0495672_0099162 3300047320 Bacteria 1584
677 Ga0496100_0172820 3300048903 Bacteria 1557
678 Ga0496100_0338063 3300048903 Bacteria 1135
679 Ga0496100_0410825 3300048903 Bacteria 1032
680 Ga0496100_0552489 3300048903 Bacteria 891
681 Ga0496100_0668790 3300048903 Bacteria 809
682 Ga0496100_0716923 3300048903 Bacteria 781
683 Ga0496101_0007043 3300048904 Bacteria 7267
684 Ga0496101_0168525 3300048904 Bacteria 1682
685 Ga0496102_0026937 3300048905 Bacteria 5132
686 Ga0496102_0073936 3300048905 Bacteria 3132
687 Ga0496102_0185161 3300048905 Bacteria 1962
688 Ga0496102_0348671 3300048905 Bacteria 1394
689 Ga0496102_1088851 3300048905 Bacteria 719
690 Ga0496103_0030095 3300048906 Bacteria 3302
691 Ga0496103_0043837 3300048906 Bacteria 2755
692 Ga0496104_0010288 3300048907 Bacteria 8353
693 Ga0496104_0271503 3300048907 Bacteria 1608
694 Ga0496105_0000828 3300048908 Bacteria 21030
695 Ga0496105_0094817 3300048908 Bacteria 2465
696 Ga0496105_0180101 3300048908 Bacteria 1731
697 Ga0496106_0076410 3300048909 Bacteria 2567
698 Ga0496106_0202027 3300048909 Bacteria 1582
699 Ga0496106_0209480 3300048909 Bacteria 1552
700 Ga0496107_0027700 3300048910 Bacteria 4024
701 Ga0496107_0080851 3300048910 Bacteria 2370
702 Ga0496107_0089094 3300048910 Bacteria 2253
703 Ga0496107_0091736 3300048910 Bacteria 2220
704 Ga0496107_0249265 3300048910 Bacteria 1321
705 Ga0496108_0020531 3300048911 Bacteria 5429
706 Ga0496108_0027320 3300048911 Bacteria 4711
707 Ga0496108_0187241 3300048911 Bacteria 1793
708 Ga0496108_0272194 3300048911 Bacteria 1474
709 Ga0496108_0337611 3300048911 Bacteria 1314
710 Ga0496108_0415330 3300048911 Bacteria 1175
711 Ga0496108_0478945 3300048911 Bacteria 1087
712 Ga0496108_0608482 3300048911 Bacteria 952
713 Ga0496108_0651894 3300048911 Bacteria 915
714 Ga0496109_0018653 3300048912 Bacteria 6097
715 Ga0496109_0073656 3300048912 Bacteria 3138
716 Ga0496109_0214887 3300048912 Bacteria 1808
717 Ga0496109_0217443 3300048912 Bacteria 1797
718 Ga0496109_0307077 3300048912 Bacteria 1496
719 Ga0496109_0344945 3300048912 Bacteria 1406
720 Ga0496109_0403788 3300048912 Bacteria 1291
721 Ga0496109_0708011 3300048912 Bacteria 944
722 Ga0496110_0010462 3300048913 Bacteria 7547
723 Ga0496110_0016485 3300048913 Bacteria 6171
724 Ga0496110_0023038 3300048913 Bacteria 5295
725 Ga0496110_0051176 3300048913 Bacteria 3630
726 Ga0496110_0070304 3300048913 Bacteria 3101
727 Ga0496110_0150551 3300048913 Bacteria 2107
728 Ga0496110_0163642 3300048913 Bacteria 2017
729 Ga0496110_0298723 3300048913 Bacteria 1467
730 Ga0496110_0491141 3300048913 Bacteria 1118
731 Ga0496110_0609190 3300048913 Bacteria 990
732 Ga0496110_0730994 3300048913 Bacteria 892
733 Ga0496111_0004558 3300048914 Bacteria 8771
734 Ga0496111_0171270 3300048914 Bacteria 1613
735 Ga0496111_0176670 3300048914 Bacteria 1587
736 Ga0496113_0038066 3300048916 Bacteria 3534
737 Ga0496113_0203636 3300048916 Bacteria 1573
738 Ga0496114_0073154 3300048917 Bacteria 2884
739 Ga0496114_0075967 3300048917 Bacteria 2830
740 Ga0496114_0156235 3300048917 Bacteria 1981
741 Ga0496114_0161920 3300048917 Bacteria 1946
742 Ga0496114_0205189 3300048917 Bacteria 1727
743 Ga0496114_0238270 3300048917 Bacteria 1599
744 Ga0496114_0246143 3300048917 Bacteria 1573
745 Ga0496114_0398031 3300048917 Bacteria 1219
746 Ga0496115_0171416 3300048918 Bacteria 1795
747 Ga0496115_0199029 3300048918 Bacteria 1655
748 Ga0496115_0265333 3300048918 Bacteria 1411
749 Ga0496123_0035970 3300048926 Bacteria 3520
750 Ga0496124_0113527 3300048927 Bacteria 2177
751 Ga0496124_0305091 3300048927 Bacteria 1148
752 Ga0496126_0522406 3300048929 Bacteria 946
753 Ga0501309_006033 3300049129 Bacteria 1464
754 Ga0501291_014751 3300049514 Bacteria 1173
755 Ga0501292_018768 3300049515 Bacteria 1103
756 Ga0501311_007414 3300049527 Bacteria 1263
757 Ga0501317_018173 3300049533 Bacteria 928
758 Ga0501318_002331 3300049534 Bacteria 1630
759 Ga0501318_005817 3300049534 Bacteria 1238
760 Ga0501320_013627 3300049536 Bacteria 870
761 Ga0501321_019551 3300049537 Bacteria 831
762 Ga0501321_020191 3300049537 Bacteria 822
763 Ga0501321_021118 3300049537 Bacteria 810
764 Ga0501325_002852 3300049541 Bacteria 1218
765 Ga0501340_007031 3300049556 Bacteria 767
766 Ga0501031_0000284 3300049568 Bacteria 28782
767 Ga0501031_0041389 3300049568 Bacteria 3008
768 Ga0501031_0045485 3300049568 Bacteria 2864
769 Ga0501031_0064199 3300049568 Bacteria 2391
770 Ga0501031_0070490 3300049568 Bacteria 2277
771 Ga0501031_0104293 3300049568 Bacteria 1850
772 Ga0501031_0199641 3300049568 Bacteria 1305
773 Ga0501032_0035238 3300049569 Bacteria 3423
774 Ga0501032_0036474 3300049569 Bacteria 3355
775 Ga0501032_0074874 3300049569 Bacteria 2255
776 Ga0501033_0024516 3300049570 Bacteria 4550
777 Ga0501033_0145436 3300049570 Bacteria 1712
778 Ga0501034_0036001 3300049571 Bacteria 5017
779 Ga0501034_0069400 3300049571 Bacteria 3535
780 Ga0501034_0179088 3300049571 Bacteria 2085
781 Ga0501034_0366875 3300049571 Bacteria 1366
782 Ga0501036_0000192 3300049572 Bacteria 40581
783 Ga0501036_0008414 3300049572 Bacteria 8453
784 Ga0501036_0026550 3300049572 Bacteria 4889
785 Ga0501036_0043265 3300049572 Bacteria 3813
786 Ga0501036_0166958 3300049572 Bacteria 1855
787 Ga0501036_0275370 3300049572 Bacteria 1409
788 Ga0501036_0354079 3300049572 Bacteria 1226
789 Ga0501036_0446756 3300049572 Bacteria 1077
790 Ga0501037_0000320 3300049573 Bacteria 40774
791 Ga0501037_0073997 3300049573 Bacteria 2476
792 Ga0501037_0233211 3300049573 Bacteria 1292
793 Ga0501038_0000986 3300049574 Bacteria 25579
794 Ga0501038_0001648 3300049574 Bacteria 20798
795 Ga0501038_0058470 3300049574 Bacteria 3306
796 Ga0501038_0059513 3300049574 Bacteria 3272
797 Ga0501038_0574711 3300049574 Bacteria 855
798 Ga0501039_0004248 3300049575 Bacteria 10782
799 Ga0501039_0020283 3300049575 Bacteria 5094
800 Ga0501039_0083380 3300049575 Bacteria 2489
801 Ga0501039_0116782 3300049575 Bacteria 2089
802 Ga0501039_0126406 3300049575 Bacteria 2005
803 Ga0501039_0402396 3300049575 Bacteria 1075
804 Ga0501039_0533042 3300049575 Bacteria 921
805 Ga0501039_0651524 3300049575 Bacteria 825
806 Ga0501040_0006704 3300049576 Bacteria 7468
807 Ga0501040_0021720 3300049576 Bacteria 4291
808 Ga0501040_0119259 3300049576 Bacteria 1850
809 Ga0501040_0147577 3300049576 Bacteria 1658
810 Ga0501040_0154553 3300049576 Bacteria 1620
811 Ga0501040_0163884 3300049576 Bacteria 1572
812 Ga0501040_0401013 3300049576 Bacteria 985
813 Ga0501040_0579438 3300049576 Bacteria 810
814 Ga0501040_0607908 3300049576 Bacteria 790
815 Ga0501041_0035721 3300049577 Bacteria 3011
816 Ga0501041_0083725 3300049577 Bacteria 1966
817 Ga0501041_0104887 3300049577 Bacteria 1751
818 Ga0501041_0277022 3300049577 Bacteria 1055
819 Ga0501042_0012330 3300049578 Bacteria 5786
820 Ga0501042_0016910 3300049578 Bacteria 5018
821 Ga0501042_0107411 3300049578 Bacteria 2009
822 Ga0501043_0004616 3300049579 Bacteria 11173
823 Ga0501043_0036133 3300049579 Bacteria 3886
824 Ga0501043_0111139 3300049579 Bacteria 2151
825 Ga0501043_0136150 3300049579 Bacteria 1924
826 Ga0501046_0000647 3300049580 Bacteria 34013
827 Ga0501047_0008114 3300049581 Bacteria 9907
828 Ga0501047_0013895 3300049581 Bacteria 7645
829 Ga0501048_0000386 3300049582 Bacteria 30662
830 Ga0501048_0024322 3300049582 Bacteria 4422
831 Ga0501048_0167883 3300049582 Bacteria 1554
832 Ga0501048_0201900 3300049582 Bacteria 1409
833 Ga0501048_0408602 3300049582 Bacteria 971
834 Ga0501067_0031418 3300049583 Bacteria 2946
835 Ga0501067_0045352 3300049583 Bacteria 2441
836 Ga0501067_0062048 3300049583 Bacteria 2069
837 Ga0501067_0082480 3300049583 Bacteria 1783
838 Ga0501067_0111025 3300049583 Bacteria 1524
839 Ga0501067_0127907 3300049583 Bacteria 1413
840 Ga0501067_0181382 3300049583 Bacteria 1173
841 Ga0501067_0192579 3300049583 Bacteria 1136
842 Ga0501068_0027731 3300049584 Bacteria 3345
843 Ga0501068_0027915 3300049584 Bacteria 3335
844 Ga0501068_0060059 3300049584 Bacteria 2308
845 Ga0501068_0078144 3300049584 Bacteria 2027
846 Ga0501068_0137703 3300049584 Bacteria 1529
847 Ga0501068_0187145 3300049584 Bacteria 1310
848 Ga0501069_0000907 3300049585 Bacteria 14132
849 Ga0501069_0007049 3300049585 Bacteria 5886
850 Ga0501069_0082447 3300049585 Bacteria 1812
851 Ga0501069_0086255 3300049585 Bacteria 1772
852 Ga0501069_0113884 3300049585 Bacteria 1542
853 Ga0501069_0137048 3300049585 Bacteria 1403
854 Ga0501069_0202190 3300049585 Bacteria 1151
855 Ga0501070_0000203 3300049586 Bacteria 55882
856 Ga0501070_0000968 3300049586 Bacteria 25770
857 Ga0501070_0001766 3300049586 Bacteria 19131
858 Ga0501070_0002280 3300049586 Bacteria 16871
859 Ga0501070_0015846 3300049586 Bacteria 6337
860 Ga0501070_0051310 3300049586 Bacteria 3425
861 Ga0501070_0057010 3300049586 Bacteria 3238
862 Ga0501070_0184600 3300049586 Bacteria 1715
863 Ga0501070_0427981 3300049586 Bacteria 1068
864 Ga0501070_0453484 3300049586 Bacteria 1034
865 Ga0501070_0664303 3300049586 Bacteria 826
866 Ga0501071_0004926 3300049587 Bacteria 8522
867 Ga0501071_0022463 3300049587 Bacteria 4397
868 Ga0501071_0092716 3300049587 Bacteria 2220
869 Ga0501071_0573777 3300049587 Bacteria 867
870 Ga0501072_0013524 3300049588 Bacteria 6246
871 Ga0501072_0014217 3300049588 Bacteria 6098
872 Ga0501072_0033664 3300049588 Bacteria 4015
873 Ga0501072_0049711 3300049588 Bacteria 3301
874 Ga0501072_0059406 3300049588 Bacteria 3015
875 Ga0501072_0124844 3300049588 Bacteria 2050
876 Ga0501072_0380227 3300049588 Bacteria 1120
877 Ga0501073_0005833 3300049589 Bacteria 9189
878 Ga0501073_0006881 3300049589 Bacteria 8460
879 Ga0501073_0032335 3300049589 Bacteria 3728
880 Ga0501073_0043777 3300049589 Bacteria 3156
881 Ga0501073_0095620 3300049589 Bacteria 2063
882 Ga0501074_0003828 3300049590 Bacteria 10705
883 Ga0501074_0018619 3300049590 Bacteria 5045
884 Ga0501074_0162302 3300049590 Bacteria 1596
885 Ga0501074_0172298 3300049590 Bacteria 1544
886 Ga0501074_0188542 3300049590 Bacteria 1470
887 Ga0501075_0014401 3300049591 Bacteria 5666
888 Ga0501075_0050601 3300049591 Bacteria 3123
889 Ga0501075_0327783 3300049591 Bacteria 1167
890 Ga0501076_0006498 3300049592 Bacteria 8483
891 Ga0501076_0042229 3300049592 Bacteria 3590
892 Ga0501076_0109499 3300049592 Bacteria 2232
893 Ga0501076_0229325 3300049592 Bacteria 1518
894 Ga0501076_0370226 3300049592 Bacteria 1177
895 Ga0501076_0603537 3300049592 Bacteria 905
896 Ga0501077_0001085 3300049593 Bacteria 16408
897 Ga0501077_0015049 3300049593 Bacteria 4863
898 Ga0501077_0052451 3300049593 Bacteria 2590
899 Ga0501077_0540963 3300049593 Bacteria 747
900 Ga0501206_004491 3300049653 Bacteria 1774
901 Ga0501207_047662 3300049654 Bacteria 759
902 Ga0501243_040060 3300049675 Bacteria 821
903 Ga0501259_047001 3300049688 Bacteria 866
904 Ga0501261_033513 3300049690 Bacteria 785
905 Ga0501079_0000589 3300049741 Bacteria 24044
906 Ga0501079_0007427 3300049741 Bacteria 8294
907 Ga0501079_0106826 3300049741 Bacteria 2172
908 Ga0501079_0170974 3300049741 Bacteria 1694
909 Ga0501079_0209582 3300049741 Bacteria 1522
910 Ga0501079_0267742 3300049741 Bacteria 1336
911 Ga0501079_0571900 3300049741 Bacteria 889
912 Ga0501079_1042015 3300049741 Bacteria 644
913 Ga0501080_0000164 3300049742 Bacteria 47786
914 Ga0501080_0000167 3300049742 Bacteria 47734
915 Ga0501080_0005860 3300049742 Bacteria 11000
916 Ga0501080_0020271 3300049742 Bacteria 6153
917 Ga0501080_0022736 3300049742 Bacteria 5808
918 Ga0501080_0038316 3300049742 Bacteria 4476
919 Ga0501080_0057800 3300049742 Bacteria 3610
920 Ga0501080_0058672 3300049742 Bacteria 3582
921 Ga0501080_0113979 3300049742 Bacteria 2506
922 Ga0501080_0203623 3300049742 Bacteria 1816
923 Ga0501080_0382630 3300049742 Bacteria 1268
924 Ga0501081_0382957 3300049743 Bacteria 1040
925 Ga0501081_0530758 3300049743 Bacteria 878
926 Ga0501083_0012194 3300049744 Bacteria 6016
927 Ga0501083_0089548 3300049744 Bacteria 2033
928 Ga0501083_0114109 3300049744 Bacteria 1774
929 Ga0501266_014402 3300049763 Bacteria 1036
930 Ga0501035_0008456 3300049822 Bacteria 9587
931 Ga0501035_0104471 3300049822 Bacteria 2484
932 Ga0501035_0380781 3300049822 Bacteria 1177
933 Ga0501035_0380806 3300049822 Bacteria 1177
934 Ga0501044_0011052 3300049823 Bacteria 9792
935 Ga0501044_0074849 3300049823 Bacteria 3439
936 Ga0501044_0080354 3300049823 Bacteria 3303
937 Ga0501045_0019694 3300049824 Bacteria 4814
938 Ga0501045_0032214 3300049824 Bacteria 3798
939 Ga0501045_0124139 3300049824 Bacteria 1917
940 Ga0501045_0257295 3300049824 Bacteria 1299
941 Ga0501045_0391427 3300049824 Bacteria 1034
942 nmdc:mga03683_18082_c1 3300050489 Bacteria 2676
943 nmdc:mga03n38_14513_c1 3300050490 Bacteria 3021
944 nmdc:mga03n38_53825_c1 3300050490 Bacteria 1807
945 nmdc:mga00v17_106534_c1 3300050491 Bacteria 1775
946 nmdc:mga00v17_161776_c2 3300050491 Bacteria 1041
947 nmdc:mga00v17_16796_c1 3300050491 Bacteria 4130
948 nmdc:mga00v17_204065_c1 3300050491 Bacteria 1278
949 nmdc:mga00v17_276050_c1 3300050491 Bacteria 1091
950 nmdc:mga00v17_31718_c1 3300050491 Bacteria 3118
951 nmdc:mga00v17_34082_c1 3300050491 Bacteria 3022
952 nmdc:mga00v17_83346_c1 3300050491 Bacteria 2000
953 nmdc:mga00v17_87190_c1 3300050491 Bacteria 1957
954 nmdc:mga00v17_990_c1 3300050491 Bacteria 15177
955 nmdc:mga0yw44_214612_c1 3300050492 Bacteria 1274
956 nmdc:mga0yw44_262450_c1 3300050492 Bacteria 1151
957 nmdc:mga0yw44_376812_c1 3300050492 Bacteria 958
958 nmdc:mga0yw44_38510_c1 3300050492 Bacteria 1323
959 nmdc:mga0yw44_40249_c1 3300050492 Bacteria 2776
960 nmdc:mga0yw44_4297_c1 3300050492 Bacteria 6503
961 nmdc:mga0yw44_48106_c1 3300050492 Bacteria 2571
962 nmdc:mga0yw44_528450_c1 3300050492 Bacteria 801
963 nmdc:mga0yw44_570_c2 3300050492 Bacteria 9097
964 nmdc:mga0yw44_65633_c1 3300050492 Bacteria 2238
965 nmdc:mga06z11_17729_c1 3300050494 Bacteria 3239
966 nmdc:mga06z11_21636_c1 3300050494 Bacteria 2992
967 nmdc:mga06z11_76388_c1 3300050494 Bacteria 1786
968 nmdc:mga04h51_7896_c1 3300050495 Bacteria 2829
969 nmdc:mga04h51_8493_c1 3300050495 Bacteria 2749
970 nmdc:mga07m45_105263_c1 3300050496 Bacteria 1623
971 nmdc:mga07m45_266936_c1 3300050496 Bacteria 996
972 nmdc:mga07m45_38031_c1 3300050496 Bacteria 2685
973 nmdc:mga05p37_121398_c1 3300050507 Bacteria 3210
974 nmdc:mga05p37_152_c1 3300050507 Bacteria 65549
975 nmdc:mga05p37_17900_c1 3300050507 Bacteria 8553
976 nmdc:mga09592_17118_c1 3300050508 Bacteria 5935
977 nmdc:mga09592_22327_c1 3300050508 Bacteria 5222
978 nmdc:mga09592_30698_c1 3300050508 Bacteria 4473
979 nmdc:mga0qj67_35146_c1 3300050509 Bacteria 3917
980 nmdc:mga0qj67_61955_c1 3300050509 Bacteria 2971
981 nmdc:mga06r32_273206_c1 3300050510 Bacteria 1678
982 nmdc:mga06r32_30859_c1 3300050510 Bacteria 5030
983 nmdc:mga06r32_5321_c1 3300050510 Bacteria 11588
984 nmdc:mga06r32_7330_c1 3300050510 Bacteria 9929
985 nmdc:mga08y16_206205_c1 3300050511 Bacteria 2037
986 nmdc:mga08y16_30284_c1 3300050511 Bacteria 5698
987 nmdc:mga08y16_363106_c1 3300050511 Bacteria 1487
988 nmdc:mga08y16_69744_c1 3300050511 Bacteria 3665
989 nmdc:mga0n895_14912_c1 3300050512 Bacteria 7077
990 nmdc:mga0n895_5553_c1 3300050512 Bacteria 10559
991 nmdc:mga0rr50_22665_c1 3300050513 Bacteria 4315
992 nmdc:mga0rr50_67628_c1 3300050513 Bacteria 2715
993 nmdc:mga08x19_17228_c1 3300050514 Bacteria 4418
994 nmdc:mga0a205_18587_c1 3300050515 Bacteria 6539
995 nmdc:mga0a205_312201_c1 3300050515 Bacteria 1444
996 nmdc:mga0a205_50188_c1 3300050515 Bacteria 4028
997 Ga0495601_0053680 3300053077 Bacteria 2548
998 Ga0495601_0634824 3300053077 Bacteria 684
999 Ga0495655_0013293 3300053083 Bacteria 1700
1000 Ga0495655_0041913 3300053083 Bacteria 1173
1001 Ga0495655_0064855 3300053083 Bacteria 1006
1002 Ga0495595_0147823 3300053084 Bacteria 1155
1003 Ga0495619_0165813 3300053085 Bacteria 1527
1004 Ga0495619_0585410 3300053085 Bacteria 764
1005 Ga0500644_0000315 3300053088 Bacteria 25229
1006 Ga0500644_0086632 3300053088 Bacteria 1163
1007 Ga0500556_0003839 3300053104 Bacteria 4357
1008 Ga0500593_000520 3300053117 Bacteria 15117
1009 Ga0501084_0000986 3300054114 Bacteria 22070
1010 Ga0501084_0011987 3300054114 Bacteria 7178
1011 Ga0501084_0128079 3300054114 Bacteria 2137
1012 Ga0501084_0137293 3300054114 Bacteria 2058
1013 Ga0501084_0242135 3300054114 Bacteria 1522
1014 Ga0501084_0425008 3300054114 Bacteria 1123
1015 Ga0590074_006702 3300059423 Bacteria 1912
1016 Ga0590077_059480 3300059426 Bacteria 865
1017 Ga0587070_024178 3300059491 Bacteria 1049
1018 Ga0587077_068551 3300059493 Bacteria 787
1019 Ga0587080_009073 3300059503 Bacteria 1439
1020 Ga0587082_002271 3300059504 Bacteria 2143
1021 Ga0587082_011037 3300059504 Bacteria 1314
1022 Ga0587088_055290 3300059508 Bacteria 789
1023 Ga0587091_021534 3300059511 Bacteria 1130
1024 Ga0587098_004846 3300059604 Bacteria 1291
1025 Ga0587098_023925 3300059604 Bacteria 797
1026 Ga0587122_001650 3300059628 Bacteria 1494
1027 Ga0587067_058603 3300059640 Bacteria 800
1028 Ga0587111_0055707 3300060346 Bacteria 885
1029 Ga0501082_0095839 3300060353 Bacteria 2565
1030 Ga0501082_0096953 3300060353 Bacteria 2549
1031 Ga0501082_0097008 3300060353 Bacteria 2548
1032 Ga0501082_0163559 3300060353 Bacteria 1934
1033 Ga0501082_0385222 3300060353 Bacteria 1223
1034 Ga0466962_0005850 3300061719 Bacteria 5910
1035 Ga0466962_0017971 3300061719 Bacteria 3403
1036 Ga0466962_0114975 3300061719 Bacteria 1296
1037 Ga0466962_0157030 3300061719 Bacteria 1105
1038 Ga0530510_0037409 3300061734 Bacteria 3499
1039 Ga0530510_0170303 3300061734 Bacteria 1613
1040 Ga0530510_0218603 3300061734 Bacteria 1416
1041 Ga0530510_0351509 3300061734 Bacteria 1107
1042 2643828099 2643221561 Bacteria 4984412
1043 2643892431 2643221576 Bacteria 5214352
1044 2643961483 2643221590 Bacteria 5214697
1045 2644032418 2643221604 Bacteria 5014917
1046 2644090744 2643221615 Bacteria 5487866
1047 2644102693 2643221617 Bacteria 5139111
1048 2644118355 2643221620 Bacteria 5134593
1049 2644231290 2643221641 Bacteria 4490190
1050 2644320548 2643221657 Bacteria 5490246
1051 2644458093 2643221681 Bacteria 3707866
1052 2644531188 2643221696 Bacteria 5431823
1053 2644536910 2643221697 Bacteria 3575694
1054 2645722973 2643221961 Bacteria 3919167
1055 2645725928 2643221962 Bacteria 3874254
1056 2738870596 2738541305 Bacteria 4910150
1057 2740166617 2739367898 Bacteria 4367674
1058 2774393802 2773857762 Bacteria 5971770
1059 2809195323 2808606439 Bacteria 5952208
1060 2812334122 2811994874 Bacteria 5367947
1061 2812350197 2811994878 Bacteria 5992952
1062 2816424504 2816332119 Bacteria 8120218
1063 2837272420 2837268691 Bacteria 7850704
1064 2855387440 2855386786 Bacteria 4752232
1065 2857482790 2857481737 Bacteria 4761446
1066 2868093020 2868088558 Bacteria 7609351
1067 2883823567 2883821847 Bacteria 5121194
1068 2891972178 2891968417 Bacteria 5821697
1069 2984577142 2984576629 Bacteria 4248407
1070 2984594157 2984592036 Bacteria 3670284
1071 2990260463 2990256926 Bacteria 4252839
1072 8054612348 8054609563 Bacteria 5170090
1073 Ga0068851_10238800
1074 LJQas_1003330
1075 JGI24740J21852_10017617
1076 JGI24740J21852_10027305
1077 JGI24739J22299_10049588
1078 JGI24739J22299_10059109
1079 JGI24737J22298_10009059
1080 JGI24737J22298_10013219
1081 JGI24737J22298_10030320
1082 JGI24735J21928_10012771
1083 JGI24735J21928_10020398
1084 JGI24735J21928_10073763
1085 JGI24750J21931_1005874
1086 JGI24738J21930_10006440
1087 JGI24738J21930_10026683
1088 JGI24744J21845_10000532
1089 JGI24033J26618_1009029
1090 JGI24034J26672_10060791
1091 JGI25406J46586_10073885
1092 Ga0006562J51391_1005843
1093 Ga0007429J51699_1066760
1094 JGI25405J52794_10006714
1095 Ga0058861_10077169
1096 Ga0070658_10108982
1097 Ga0070658_10227262
1098 Ga0070658_10352458
1099 Ga0070658_10772361
1100 Ga0070683_100013995
1101 Ga0070683_100421979
1102 Ga0070683_100509705
1103 Ga0070670_100329110
1104 Ga0068869_100679547
1105 Ga0070682_100018717
1106 Ga0070682_100030160
1107 Ga0070682_100170585
1108 Ga0070682_100374739
1109 Ga0070682_100526426
1110 Ga0068868_100060199
1111 Ga0068868_100098699
1112 Ga0068868_100124901
1113 Ga0068868_100773024
1114 Ga0070660_100003302
1115 Ga0070660_100184551
1116 Ga0070691_10088917
1117 Ga0070687_100033972
1118 Ga0070687_100571102
1119 Ga0070661_100424249
1120 Ga0070692_10020197
1121 Ga0070692_10243024
1122 Ga0070668_100060257
1123 Ga0070668_100098969
1124 Ga0070668_100101103
1125 Ga0070668_100116637
1126 Ga0070668_100226633
1127 Ga0070668_100295250
1128 Ga0070668_100761591
1129 Ga0070669_100464871
1130 Ga0070674_100060173
1131 Ga0070674_100066817
1132 Ga0070673_100332496
1133 Ga0070688_100191318
1134 Ga0070688_100448779
1135 Ga0070659_100019106
1136 Ga0070659_100025275
1137 Ga0070659_100066242
1138 Ga0070659_100191252
1139 Ga0070659_100901525
1140 Ga0070667_100072949
1141 Ga0070667_100279108
1142 Ga0070667_100746910
1143 Ga0070701_10094608
1144 Ga0070711_100926075
1145 Ga0070705_100013976
1146 Ga0070700_100002303
1147 Ga0070700_100448010
1148 Ga0070663_100036589
1149 Ga0070663_100114837
1150 Ga0070663_100163055
1151 Ga0070663_100363988
1152 Ga0070678_100104615
1153 Ga0070678_100453373
1154 Ga0070662_100036231
1155 Ga0070662_100041884
1156 Ga0070662_100155153
1157 Ga0070662_100199228
1158 Ga0070681_10295500
1159 Ga0068867_100007389
1160 Ga0068867_100049577
1161 Ga0068867_100604874
1162 Ga0070698_100011005
1163 Ga0070679_100020810
1164 Ga0070679_100521181
1165 Ga0070679_100736568
1166 Ga0070684_100004672
1167 Ga0070684_100063833
1168 Ga0070684_100273570
1169 Ga0070684_100662654
1170 Ga0068853_100338395
1171 Ga0068853_100526708
1172 Ga0068853_100750556
1173 Ga0070672_100046686
1174 Ga0070686_100209024
1175 Ga0070686_100441218
1176 Ga0070695_100855902
1177 Ga0070693_100006536
1178 Ga0070665_100000868
1179 Ga0068855_100551123
1180 Ga0068855_100626339
1181 Ga0070664_100475196
1182 Ga0068857_100367938
1183 Ga0068854_100016555
1184 Ga0068854_100518157
1185 Ga0068856_100240491
1186 Ga0068856_100329340
1187 Ga0070702_100015855
1188 Ga0070702_100026047
1189 Ga0070702_100720402
1190 Ga0068852_100149897
1191 Ga0068852_100390172
1192 Ga0068864_100078679
1193 Ga0068864_100125496
1194 Ga0068864_100263266
1195 Ga0068866_10025798
1196 Ga0068861_100024654
1197 Ga0068861_100086135
1198 Ga0068861_100880154
1199 Ga0068851_10111670
1200 Ga0068870_10003830
1201 Ga0068870_10061537
1202 Ga0068870_10113681
1203 Ga0068863_100875613
1204 Ga0068858_100045111
1205 Ga0068860_100000388
1206 Ga0068860_100100623
1207 Ga0068860_100550618
1208 Ga0081455_10000298
1209 Ga0081455_10002569
1210 Ga0081455_10006814
1211 Ga0081455_10010219
1212 Ga0081455_10020733
1213 Ga0081455_10038921
1214 Ga0081455_10056392
1215 Ga0081538_10000841
1216 Ga0081538_10016484
1217 Ga0081538_10017183
1218 Ga0081540_1069961
1219 Ga0081539_10000170
1220 Ga0075365_10019907
1221 Ga0075365_10050313
1222 Ga0075365_10146211
1223 Ga0075365_10308305
1224 Ga0075365_10316815
1225 Ga0075365_10478974
1226 Ga0075368_10061383
1227 Ga0075368_10207217
1228 Ga0075363_100008378
1229 Ga0075363_100046286
1230 Ga0075363_100187971
1231 Ga0075363_100318542
1232 Ga0075363_100367887
1233 Ga0075364_10003388
1234 Ga0075364_10045314
1235 Ga0075364_10387199
1236 Ga0075432_10002195
1237 Ga0075432_10004039
1238 Ga0075362_10004276
1239 Ga0075367_10020551
1240 Ga0075367_10037203
1241 Ga0075367_10520773
1242 Ga0075370_10024322
1243 Ga0075370_10043683
1244 Ga0075370_10078090
1245 Ga0075370_10094577
1246 Ga0075428_100003370
1247 Ga0075428_100022105
1248 Ga0075428_100024346
1249 Ga0075428_100027812
1250 Ga0075428_100096259
1251 Ga0075430_100008427
1252 Ga0075430_100072226
1253 Ga0075431_100001915
1254 Ga0075431_100036576
1255 Ga0075431_100051599
1256 Ga0075433_10004815
1257 Ga0075433_10066458
1258 Ga0075433_10290177
1259 Ga0075434_100004269
1260 Ga0075434_100021537
1261 Ga0075434_100535713
1262 Ga0075429_100016458
1263 Ga0075429_100030709
1264 Ga0068865_100004270
1265 Ga0068865_100007647
1266 Ga0068865_100131512
1267 Ga0068865_100330122
1268 Ga0075436_100000495
1269 Ga0075435_100003823
1270 Ga0075435_100024035
1271 Ga0105240_10853454
1272 Ga0111539_10015199
1273 Ga0111539_10051724
1274 Ga0111539_10442384
1275 Ga0111539_10564497
1276 Ga0105245_10002262
1277 Ga0105245_10010146
1278 Ga0105245_10057213
1279 Ga0105245_10197954
1280 Ga0105245_10273941
1281 Ga0105245_10276777
1282 Ga0105247_10242582
1283 Ga0114129_10038001
1284 Ga0114129_10048557
1285 Ga0114129_10214007
1286 Ga0105243_10011969
1287 Ga0105243_10047697
1288 Ga0105243_10055770
1289 Ga0105243_10093944
1290 Ga0105243_10138780
1291 Ga0105243_10446906
1292 Ga0105243_10634791
1293 Ga0105243_10927957
1294 Ga0105242_10059619
1295 Ga0105242_10260126
1296 Ga0105242_10281387
1297 Ga0105248_10190351
1298 Ga0105248_10274711
1299 Ga0105248_10602244
1300 Ga0105237_10071232
1301 Ga0105237_10116239
1302 Ga0105237_10788331
1303 Ga0105237_11113179
1304 Ga0105238_10216710
1305 Ga0105238_10524756
1306 Ga0105249_10032279
1307 Ga0105249_10037581
1308 Ga0105249_10071139
1309 Ga0105249_10203984
1310 Ga0105249_10214519
1311 Ga0105249_10407079
1312 Ga0105249_10895474
1313 Ga0105030_109670
1314 Ga0105028_104598
1315 Ga0105239_10001318
1316 Ga0105239_10002798
1317 Ga0105239_10079150
1318 Ga0105239_10218118
1319 Ga0105239_10474285
1320 Ga0105239_10757685
1321 Ga0105246_10014826
1322 Ga0105246_10130712
1323 Ga0105246_10379044
1324 Ga0157336_1006973
1325 Ga0157329_1003071
1326 Ga0157335_1002177
1327 Ga0157341_1003790
1328 Ga0157319_1001204
1329 Ga0157319_1005147
1330 Ga0157345_1009036
1331 Ga0157338_1010256
1332 Ga0157373_10608154
1333 Ga0157371_10053858
1334 Ga0157371_10087061
1335 Ga0157374_10282565
1336 Ga0157378_10471144
1337 Ga0157378_10517258
1338 Ga0163162_10038011
1339 Ga0163162_10158276
1340 Ga0163162_10358331
1341 Ga0163162_10500621
1342 Ga0163162_10932740
1343 Ga0157372_10027521
1344 Ga0157372_10083119
1345 Ga0157372_10116214
1346 Ga0157372_10273589
1347 Ga0157372_10284284
1348 Ga0157372_10507490
1349 Ga0157375_10277439
1350 Ga0157375_10421088
1351 Ga0157375_10431870
1352 Ga0157375_10558921
1353 Ga0157375_10682027
1354 Ga0157375_10847275
1355 Ga0163163_10129334
1356 Ga0163163_10160525
1357 Ga0163163_10287979
1358 Ga0163163_10788419
1359 Ga0157380_10005485
1360 Ga0157380_10174384
1361 Ga0157380_10200963
1362 Ga0157380_10386832
1363 Ga0182008_10190355
1364 Ga0157377_10316245
1365 Ga0157379_10040240
1366 Ga0157376_10340096
1367 Ga0157376_10350290
1368 Ga0163161_10017762
1369 Ga0163161_10048837
1370 Ga0163161_10153584
1371 Ga0163161_10162132
1372 Ga0163161_10326916
1373 Ga0197907_10208093
1374 Ga0197907_10309606
1375 Ga0197907_10559225
1376 Ga0206356_11297441
1377 Ga0206356_11804983
1378 Ga0206355_1640103
1379 Ga0206350_10103036
1380 Ga0154015_1364342
1381 Ga0213875_10074552
1382 Ga0207682_10094578
1383 Ga0207642_10122701
1384 Ga0207710_10089645
1385 Ga0207688_10052421
1386 Ga0207688_10058370
1387 Ga0207688_10094086
1388 Ga0207647_10008541
1389 Ga0207647_10010116
1390 Ga0207647_10059649
1391 Ga0207647_10168652
1392 Ga0207647_10315777
1393 Ga0207647_10370187
1394 Ga0207685_10113134
1395 Ga0207643_10108564
1396 Ga0207643_10110657
1397 Ga0207643_10129421
1398 Ga0207643_10238608
1399 Ga0207705_10095945
1400 Ga0207705_10098957
1401 Ga0207705_10265900
1402 Ga0207707_10155432
1403 Ga0207671_10087463
1404 Ga0207671_10272065
1405 Ga0207671_10477858
1406 Ga0207662_10079336
1407 Ga0207657_10042184
1408 Ga0207657_10046093
1409 Ga0207657_10279651
1410 Ga0207657_10454860
1411 Ga0207652_10019476
1412 Ga0207652_10201519
1413 Ga0207652_11126577
1414 Ga0207646_10129704
1415 Ga0207681_10345282
1416 Ga0207681_10421974
1417 Ga0207694_10095551
1418 Ga0207694_10125616
1419 Ga0207694_10155871
1420 Ga0207650_10499478
1421 Ga0207687_10063706
1422 Ga0207687_10146799
1423 Ga0207687_10257967
1424 Ga0207687_10429373
1425 Ga0207687_10453778
1426 Ga0207664_10046885
1427 Ga0207690_10014894
1428 Ga0207690_10036521
1429 Ga0207690_10074596
1430 Ga0207690_10077583
1431 Ga0207690_10199212
1432 Ga0207706_10022138
1433 Ga0207706_10190026
1434 Ga0207706_10281427
1435 Ga0207706_11069634
1436 Ga0207686_10010760
1437 Ga0207686_10106628
1438 Ga0207686_10176922
1439 Ga0207686_10390934
1440 Ga0207709_10005306
1441 Ga0207709_10036229
1442 Ga0207709_10114062
1443 Ga0207709_10139341
1444 Ga0207709_10429124
1445 Ga0207709_10588515
1446 Ga0207670_10427921
1447 Ga0207669_10015653
1448 Ga0207669_10115217
1449 Ga0207704_10013477
1450 Ga0207704_10019645
1451 Ga0207704_10083003
1452 Ga0207704_10166531
1453 Ga0207691_10003002
1454 Ga0207691_10081757
1455 Ga0207711_10214258
1456 Ga0207711_10666024
1457 Ga0207689_10363980
1458 Ga0207661_10005512
1459 Ga0207661_10203304
1460 Ga0207661_10263398
1461 Ga0207679_10250018
1462 Ga0207679_10334253
1463 Ga0207679_10693878
1464 Ga0207667_10494453
1465 Ga0207651_10218246
1466 Ga0207712_10029451
1467 Ga0207712_10068944
1468 Ga0207712_10914457
1469 Ga0207668_10061208
1470 Ga0207668_10138819
1471 Ga0207668_10139839
1472 Ga0207668_10461494
1473 Ga0207640_10053848
1474 Ga0207658_10158162
1475 Ga0207658_10250321
1476 Ga0207658_10339750
1477 Ga0207677_10094319
1478 Ga0207677_10162617
1479 Ga0207677_10196712
1480 Ga0207703_10095225
1481 Ga0207703_10465034
1482 Ga0207703_11093552
1483 Ga0207639_10051080
1484 Ga0207639_10137875
1485 Ga0207639_10185629
1486 Ga0207639_10516134
1487 Ga0207678_10065790
1488 Ga0207678_10127572
1489 Ga0207678_10186019
1490 Ga0207678_10217119
1491 Ga0207678_10231520
1492 Ga0207678_10355017
1493 Ga0207678_10378226
1494 Ga0207708_10001371
1495 Ga0207708_10095894
1496 Ga0207708_10107229
1497 Ga0207708_10251015
1498 Ga0207708_10355483
1499 Ga0207702_10126503
1500 Ga0207641_10484756
1501 Ga0207648_10050693
1502 Ga0207648_10056730
1503 Ga0207648_10269923
1504 Ga0207676_10403299
1505 Ga0207676_10454806
1506 Ga0207676_10521386
1507 Ga0207674_10007577
1508 Ga0207674_10114438
1509 Ga0207674_10327365
1510 Ga0207675_100016804
1511 Ga0207675_100043167
1512 Ga0207675_100089750
1513 Ga0207675_100118612
1514 Ga0207675_100322546
1515 Ga0207683_10093108
1516 Ga0207683_10121129
1517 Ga0207698_10223756
1518 Ga0207698_10468897
1519 Ga0207698_10576581
1520 Ga0207698_10630803
1521 Ga0209999_1058845
1522 Ga0209813_10000658
1523 Ga0209813_10005764
1524 Ga0207428_10003055
1525 Ga0207428_10008733
1526 Ga0207428_10023825
1527 Ga0207428_10259012
1528 Ga0268266_10001392
1529 Ga0268266_10121698
1530 Ga0268264_10000387
1531 Ga0268264_10210935
1532 Ga0268264_10426826
1533 Ga0307517_10201545
1534 Ga0307515_10344927
1535 Ga0316176_1031002
1536 Ga0316181_1115169
1537 Ga0316182_1088044
1538 Ga0316182_1224164
1539 Ga0265320_10045531
1540 Ga0265340_10025160
1541 Ga0265339_10022215
1542 Ga0307513_10071567
1543 Ga0307408_100005933
1544 Ga0307408_100013944
1545 Ga0307408_100096374
1546 Ga0307408_100164326
1547 Ga0307408_100766208
1548 Ga0316579_10013595
1549 Ga0265342_10101315
1550 Ga0316576_10058110
1551 Ga0316576_10154017
1552 Ga0316578_10059267
1553 Ga0307405_10383273
1554 Ga0316577_10017848
1555 Ga0307413_10001451
1556 Ga0307413_10023829
1557 Ga0307413_10056084
1558 Ga0307413_10313387
1559 Ga0307413_10469726
1560 Ga0307410_10002082
1561 Ga0307410_10011465
1562 Ga0307410_10041750
1563 Ga0307410_10094609
1564 Ga0307410_10154434
1565 Ga0307410_10293295
1566 Ga0307410_10566617
1567 Ga0307406_10000207
1568 Ga0307406_10010450
1569 Ga0307406_10101042
1570 Ga0307407_10007549
1571 Ga0307407_10020689
1572 Ga0307412_10067839
1573 Ga0307412_10092906
1574 Ga0307412_10166467
1575 Ga0307409_100003399
1576 Ga0307409_100021958
1577 Ga0307409_100121070
1578 Ga0307409_100297914
1579 Ga0307409_100853791
1580 Ga0307416_100000064
1581 Ga0307416_100000622
1582 Ga0307416_100068237
1583 Ga0307416_100088949
1584 Ga0307416_100105910
1585 Ga0307416_100248489
1586 Ga0307416_100529099
1587 Ga0307416_101174522
1588 Ga0307414_10004847
1589 Ga0307414_10256654
1590 Ga0307414_10452038
1591 Ga0307411_10003883
1592 Ga0307411_10174105
1593 Ga0307415_100002201
1594 Ga0307415_100013917
1595 Ga0307415_100188988
1596 Ga0307415_100812461
1597 Ga0307415_101124638
1598 Ga0316583_10010836
1599 Ga0316585_10013028
1600 Ga0316580_10009815
1601 Ga0316593_10004157
1602 Ga0316592_1000942
1603 Ga0316588_1006432
1604 Ga0316596_1003274
1605 Ga0373928_0041623
1606 Ga0373946_0158242
1607 Ga0316574_0103207
1608 Ga0373931_0185772
1609 Ga0316582_0128927
1610 Ga0316584_0032972
1611 Ga0395900_0034125
1612 Ga0395900_0380545
1613 Ga0395900_0506248
1614 Ga0395898_0059562
1615 Ga0395898_0907652
1616 Ga0395905_0012411
1617 Ga0395905_0216579
1618 Ga0395905_0576804
1619 Ga0316581_0003416
1620 Ga0436364_0249415
1621 Ga0395901_0034440
1622 Ga0395901_0081403
1623 Ga0395901_0083782
1624 Ga0395901_0629118
1625 Ga0242420_004572
1626 Ga0439438_019084
1627 Ga0439438_043312
1628 Ga0439465_0035432
1629 Ga0439465_0140606
1630 Ga0439465_0146610
1631 Ga0451791_0184620
1632 Ga0451793_0693788
1633 Ga0451833_0174897
1634 Ga0451833_0980981
1635 Ga0451837_0024633
1636 Ga0451837_0461301
1637 Ga0451837_0642774
1638 Ga0451839_0935720
1639 Ga0451853_1172145
1640 Ga0439431_0003253
1641 Ga0439445_0045252
1642 Ga0439445_0086332
1643 Ga0439448_0011399
1644 Ga0439449_0083999
1645 Ga0450900_020589
1646 Ga0450906_044534
1647 Ga0439446_0060257
1648 Ga0439434_0014704
1649 Ga0439434_0067714
1650 Ga0439444_0065800
1651 Ga0439459_0016576
1652 Ga0439464_0045019
1653 Ga0439464_0067917
1654 Ga0450901_015447
1655 Ga0439440_0058435
1656 Ga0466969_0004974
1657 Ga0466972_0006814
1658 Ga0466972_0073504
1659 Ga0466972_0158867
1660 Ga0466965_0000715
1661 Ga0466965_0014544
1662 Ga0466965_0042983
1663 Ga0466965_0051519
1664 Ga0466965_0060335
1665 Ga0466965_0083675
1666 Ga0466966_0096465
1667 Ga0466961_0023968
1668 Ga0466961_0045577
1669 Ga0466961_0045889
1670 Ga0466961_0074072
1671 Ga0466961_0106584
1672 Ga0466963_0031776
1673 Ga0466963_0056663
1674 Ga0466963_0144692
1675 Ga0466963_0165131
1676 Ga0466963_0205237
1677 Ga0466963_0270707
1678 Ga0466964_0012185
1679 Ga0466964_0040086
1680 Ga0466964_0054730
1681 Ga0466964_0094985
1682 Ga0466964_0140602
1683 Ga0466971_0006890
1684 Ga0466971_0023338
1685 Ga0466971_0085650
1686 Ga0466971_0088160
1687 Ga0466970_0011013
1688 Ga0466970_0031983
1689 Ga0466970_0039169
1690 Ga0466970_0062138
1691 Ga0466970_0076867
1692 Ga0466970_0083319
1693 Ga0466970_0099732
1694 Ga0466970_0125925
1695 Ga0466957_0004703
1696 Ga0466957_0012592
1697 Ga0466957_0040548
1698 Ga0466957_0099303
1699 Ga0466957_0155370
1700 Ga0466960_0006811
1701 Ga0466960_0007895
1702 Ga0466960_0018740
1703 Ga0466960_0030358
1704 Ga0466960_0050125
1705 Ga0466960_0069199
1706 Ga0466960_0133137
1707 Ga0466959_0034787
1708 Ga0466959_0171656
1709 Ga0466959_0199916
1710 Ga0466959_0358284
1711 Ga0466958_0051704
1712 Ga0466958_0058011
1713 Ga0466958_0079928
1714 Ga0466958_0230199
1715 Ga0466958_0416115
1716 Ga0466967_0028650
1717 Ga0466967_0036868
1718 Ga0466967_0063164
1719 Ga0466967_0066702
1720 Ga0466967_0118561
1721 Ga0466967_0186317
1722 Ga0466967_0265494
1723 Ga0466967_0341839
1724 Ga0466967_0368228
1725 Ga0466967_0569989
1726 Ga0466967_0833640
1727 Ga0495629_0050899
1728 Ga0495629_0199999
1729 Ga0495629_0276139
1730 Ga0495641_0086934
1731 Ga0495582_0300383
1732 Ga0495664_0043871
1733 Ga0495608_0172045
1734 Ga0495620_0039685
1735 Ga0495631_0037959
1736 Ga0495663_0028687
1737 Ga0495598_0118933
1738 Ga0495645_0137243
1739 Ga0495656_0037182
1740 Ga0495611_0071346
1741 Ga0495625_0112505
1742 Ga0495635_0252042
1743 Ga0495661_0362075
1744 Ga0495657_0093679
1745 Ga0495658_0487952
1746 Ga0495671_0035510
1747 Ga0495674_0287465
1748 Ga0495672_0099162
1749 Ga0496100_0172820
1750 Ga0496100_0338063
1751 Ga0496100_0410825
1752 Ga0496100_0552489
1753 Ga0496100_0668790
1754 Ga0496100_0716923
1755 Ga0496101_0007043
1756 Ga0496101_0168525
1757 Ga0496102_0026937
1758 Ga0496102_0073936
1759 Ga0496102_0185161
1760 Ga0496102_0348671
1761 Ga0496102_1088851
1762 Ga0496103_0030095
1763 Ga0496103_0043837
1764 Ga0496104_0010288
1765 Ga0496104_0271503
1766 Ga0496105_0000828
1767 Ga0496105_0094817
1768 Ga0496105_0180101
1769 Ga0496106_0076410
1770 Ga0496106_0202027
1771 Ga0496106_0209480
1772 Ga0496107_0027700
1773 Ga0496107_0080851
1774 Ga0496107_0089094
1775 Ga0496107_0091736
1776 Ga0496107_0249265
1777 Ga0496108_0020531
1778 Ga0496108_0027320
1779 Ga0496108_0187241
1780 Ga0496108_0272194
1781 Ga0496108_0337611
1782 Ga0496108_0415330
1783 Ga0496108_0478945
1784 Ga0496108_0608482
1785 Ga0496108_0651894
1786 Ga0496109_0018653
1787 Ga0496109_0073656
1788 Ga0496109_0214887
1789 Ga0496109_0217443
1790 Ga0496109_0307077
1791 Ga0496109_0344945
1792 Ga0496109_0403788
1793 Ga0496109_0708011
1794 Ga0496110_0010462
1795 Ga0496110_0016485
1796 Ga0496110_0023038
1797 Ga0496110_0051176
1798 Ga0496110_0070304
1799 Ga0496110_0150551
1800 Ga0496110_0163642
1801 Ga0496110_0298723
1802 Ga0496110_0491141
1803 Ga0496110_0609190
1804 Ga0496110_0730994
1805 Ga0496111_0004558
1806 Ga0496111_0171270
1807 Ga0496111_0176670
1808 Ga0496113_0038066
1809 Ga0496113_0203636
1810 Ga0496114_0073154
1811 Ga0496114_0075967
1812 Ga0496114_0156235
1813 Ga0496114_0161920
1814 Ga0496114_0205189
1815 Ga0496114_0238270
1816 Ga0496114_0246143
1817 Ga0496114_0398031
1818 Ga0496115_0171416
1819 Ga0496115_0199029
1820 Ga0496115_0265333
1821 Ga0496123_0035970
1822 Ga0496124_0113527
1823 Ga0496124_0305091
1824 Ga0496126_0522406
1825 Ga0501309_006033
1826 Ga0501291_014751
1827 Ga0501292_018768
1828 Ga0501311_007414
1829 Ga0501317_018173
1830 Ga0501318_002331
1831 Ga0501318_005817
1832 Ga0501320_013627
1833 Ga0501321_019551
1834 Ga0501321_020191
1835 Ga0501321_021118
1836 Ga0501325_002852
1837 Ga0501340_007031
1838 Ga0501031_0000284
1839 Ga0501031_0041389
1840 Ga0501031_0045485
1841 Ga0501031_0064199
1842 Ga0501031_0070490
1843 Ga0501031_0104293
1844 Ga0501031_0199641
1845 Ga0501032_0035238
1846 Ga0501032_0036474
1847 Ga0501032_0074874
1848 Ga0501033_0024516
1849 Ga0501033_0145436
1850 Ga0501034_0036001
1851 Ga0501034_0069400
1852 Ga0501034_0179088
1853 Ga0501034_0366875
1854 Ga0501036_0000192
1855 Ga0501036_0008414
1856 Ga0501036_0026550
1857 Ga0501036_0043265
1858 Ga0501036_0166958
1859 Ga0501036_0275370
1860 Ga0501036_0354079
1861 Ga0501036_0446756
1862 Ga0501037_0000320
1863 Ga0501037_0073997
1864 Ga0501037_0233211
1865 Ga0501038_0000986
1866 Ga0501038_0001648
1867 Ga0501038_0058470
1868 Ga0501038_0059513
1869 Ga0501038_0574711
1870 Ga0501039_0004248
1871 Ga0501039_0020283
1872 Ga0501039_0083380
1873 Ga0501039_0116782
1874 Ga0501039_0126406
1875 Ga0501039_0402396
1876 Ga0501039_0533042
1877 Ga0501039_0651524
1878 Ga0501040_0006704
1879 Ga0501040_0021720
1880 Ga0501040_0119259
1881 Ga0501040_0147577
1882 Ga0501040_0154553
1883 Ga0501040_0163884
1884 Ga0501040_0401013
1885 Ga0501040_0579438
1886 Ga0501040_0607908
1887 Ga0501041_0035721
1888 Ga0501041_0083725
1889 Ga0501041_0104887
1890 Ga0501041_0277022
1891 Ga0501042_0012330
1892 Ga0501042_0016910
1893 Ga0501042_0107411
1894 Ga0501043_0004616
1895 Ga0501043_0036133
1896 Ga0501043_0111139
1897 Ga0501043_0136150
1898 Ga0501046_0000647
1899 Ga0501047_0008114
1900 Ga0501047_0013895
1901 Ga0501048_0000386
1902 Ga0501048_0024322
1903 Ga0501048_0167883
1904 Ga0501048_0201900
1905 Ga0501048_0408602
1906 Ga0501067_0031418
1907 Ga0501067_0045352
1908 Ga0501067_0062048
1909 Ga0501067_0082480
1910 Ga0501067_0111025
1911 Ga0501067_0127907
1912 Ga0501067_0181382
1913 Ga0501067_0192579
1914 Ga0501068_0027731
1915 Ga0501068_0027915
1916 Ga0501068_0060059
1917 Ga0501068_0078144
1918 Ga0501068_0137703
1919 Ga0501068_0187145
1920 Ga0501069_0000907
1921 Ga0501069_0007049
1922 Ga0501069_0082447
1923 Ga0501069_0086255
1924 Ga0501069_0113884
1925 Ga0501069_0137048
1926 Ga0501069_0202190
1927 Ga0501070_0000203
1928 Ga0501070_0000968
1929 Ga0501070_0001766
1930 Ga0501070_0002280
1931 Ga0501070_0015846
1932 Ga0501070_0051310
1933 Ga0501070_0057010
1934 Ga0501070_0184600
1935 Ga0501070_0427981
1936 Ga0501070_0453484
1937 Ga0501070_0664303
1938 Ga0501071_0004926
1939 Ga0501071_0022463
1940 Ga0501071_0092716
1941 Ga0501071_0573777
1942 Ga0501072_0013524
1943 Ga0501072_0014217
1944 Ga0501072_0033664
1945 Ga0501072_0049711
1946 Ga0501072_0059406
1947 Ga0501072_0124844
1948 Ga0501072_0380227
1949 Ga0501073_0005833
1950 Ga0501073_0006881
1951 Ga0501073_0032335
1952 Ga0501073_0043777
1953 Ga0501073_0095620
1954 Ga0501074_0003828
1955 Ga0501074_0018619
1956 Ga0501074_0162302
1957 Ga0501074_0172298
1958 Ga0501074_0188542
1959 Ga0501075_0014401
1960 Ga0501075_0050601
1961 Ga0501075_0327783
1962 Ga0501076_0006498
1963 Ga0501076_0042229
1964 Ga0501076_0109499
1965 Ga0501076_0229325
1966 Ga0501076_0370226
1967 Ga0501076_0603537
1968 Ga0501077_0001085
1969 Ga0501077_0015049
1970 Ga0501077_0052451
1971 Ga0501077_0540963
1972 Ga0501206_004491
1973 Ga0501207_047662
1974 Ga0501243_040060
1975 Ga0501259_047001
1976 Ga0501261_033513
1977 Ga0501079_0000589
1978 Ga0501079_0007427
1979 Ga0501079_0106826
1980 Ga0501079_0170974
1981 Ga0501079_0209582
1982 Ga0501079_0267742
1983 Ga0501079_0571900
1984 Ga0501079_1042015
1985 Ga0501080_0000164
1986 Ga0501080_0000167
1987 Ga0501080_0005860
1988 Ga0501080_0020271
1989 Ga0501080_0022736
1990 Ga0501080_0038316
1991 Ga0501080_0057800
1992 Ga0501080_0058672
1993 Ga0501080_0113979
1994 Ga0501080_0203623
1995 Ga0501080_0382630
1996 Ga0501081_0382957
1997 Ga0501081_0530758
1998 Ga0501083_0012194
1999 Ga0501083_0089548
2000 Ga0501083_0114109
2001 Ga0501266_014402
2002 Ga0501035_0008456
2003 Ga0501035_0104471
2004 Ga0501035_0380781
2005 Ga0501035_0380806
2006 Ga0501044_0011052
2007 Ga0501044_0074849
2008 Ga0501044_0080354
2009 Ga0501045_0019694
2010 Ga0501045_0032214
2011 Ga0501045_0124139
2012 Ga0501045_0257295
2013 Ga0501045_0391427
2014 nmdc:mga03683_18082_c1
2015 nmdc:mga03n38_14513_c1
2016 nmdc:mga03n38_53825_c1
2017 nmdc:mga00v17_106534_c1
2018 nmdc:mga00v17_161776_c2
2019 nmdc:mga00v17_16796_c1
2020 nmdc:mga00v17_204065_c1
2021 nmdc:mga00v17_276050_c1
2022 nmdc:mga00v17_31718_c1
2023 nmdc:mga00v17_34082_c1
2024 nmdc:mga00v17_83346_c1
2025 nmdc:mga00v17_87190_c1
2026 nmdc:mga00v17_990_c1
2027 nmdc:mga0yw44_214612_c1
2028 nmdc:mga0yw44_262450_c1
2029 nmdc:mga0yw44_376812_c1
2030 nmdc:mga0yw44_38510_c1
2031 nmdc:mga0yw44_40249_c1
2032 nmdc:mga0yw44_4297_c1
2033 nmdc:mga0yw44_48106_c1
2034 nmdc:mga0yw44_528450_c1
2035 nmdc:mga0yw44_570_c2
2036 nmdc:mga0yw44_65633_c1
2037 nmdc:mga06z11_17729_c1
2038 nmdc:mga06z11_21636_c1
2039 nmdc:mga06z11_76388_c1
2040 nmdc:mga04h51_7896_c1
2041 nmdc:mga04h51_8493_c1
2042 nmdc:mga07m45_105263_c1
2043 nmdc:mga07m45_266936_c1
2044 nmdc:mga07m45_38031_c1
2045 nmdc:mga05p37_121398_c1
2046 nmdc:mga05p37_152_c1
2047 nmdc:mga05p37_17900_c1
2048 nmdc:mga09592_17118_c1
2049 nmdc:mga09592_22327_c1
2050 nmdc:mga09592_30698_c1
2051 nmdc:mga0qj67_35146_c1
2052 nmdc:mga0qj67_61955_c1
2053 nmdc:mga06r32_273206_c1
2054 nmdc:mga06r32_30859_c1
2055 nmdc:mga06r32_5321_c1
2056 nmdc:mga06r32_7330_c1
2057 nmdc:mga08y16_206205_c1
2058 nmdc:mga08y16_30284_c1
2059 nmdc:mga08y16_363106_c1
2060 nmdc:mga08y16_69744_c1
2061 nmdc:mga0n895_14912_c1
2062 nmdc:mga0n895_5553_c1
2063 nmdc:mga0rr50_22665_c1
2064 nmdc:mga0rr50_67628_c1
2065 nmdc:mga08x19_17228_c1
2066 nmdc:mga0a205_18587_c1
2067 nmdc:mga0a205_312201_c1
2068 nmdc:mga0a205_50188_c1
2069 Ga0495601_0053680
2070 Ga0495601_0634824
2071 Ga0495655_0013293
2072 Ga0495655_0041913
2073 Ga0495655_0064855
2074 Ga0495595_0147823
2075 Ga0495619_0165813
2076 Ga0495619_0585410
2077 Ga0500644_0000315
2078 Ga0500644_0086632
2079 Ga0500556_0003839
2080 Ga0500593_000520
2081 Ga0501084_0000986
2082 Ga0501084_0011987
2083 Ga0501084_0128079
2084 Ga0501084_0137293
2085 Ga0501084_0242135
2086 Ga0501084_0425008
2087 Ga0590074_006702
2088 Ga0590077_059480
2089 Ga0587070_024178
2090 Ga0587077_068551
2091 Ga0587080_009073
2092 Ga0587082_002271
2093 Ga0587082_011037
2094 Ga0587088_055290
2095 Ga0587091_021534
2096 Ga0587098_004846
2097 Ga0587098_023925
2098 Ga0587122_001650
2099 Ga0587067_058603
2100 Ga0587111_0055707
2101 Ga0501082_0095839
2102 Ga0501082_0096953
2103 Ga0501082_0097008
2104 Ga0501082_0163559
2105 Ga0501082_0385222
2106 Ga0466962_0005850
2107 Ga0466962_0017971
2108 Ga0466962_0114975
2109 Ga0466962_0157030
2110 Ga0530510_0037409
2111 Ga0530510_0170303
2112 Ga0530510_0218603
2113 Ga0530510_0351509
2114 2643828099
2115 2643892431
2116 2643961483
2117 2644032418
2118 2644090744
2119 2644102693
2120 2644118355
2121 2644231290
2122 2644320548
2123 2644458093
2124 2644531188
2125 2644536910
2126 2645722973
2127 2645725928
2128 2738870596
2129 2740166617
2130 2774393802
2131 2809195323
2132 2812334122
2133 2812350197
2134 2816424504
2135 2837272420
2136 2855387440
2137 2857482790
2138 2868093020
2139 2883823567
2140 2891972178
2141 2984577142
2142 2984594157
2143 2990260463
2144 8054612348

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

49

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p81-assembly1.cif.gz_K crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9758 20 192
8ef8-assembly1.cif.gz_M staphylococcus aureus clpp y63w in complex with compound 3471 0.9751 20 194
7p81-assembly2.cif.gz_T crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9745 20 192
4emp-assembly1.cif.gz_B crystal structure of the mutant of clpp e137a from staphylococcus aureus 0.9742 20 194
8i7x-assembly1.cif.gz_H crystal structure of human clpp in complex with zg36 0.974 20 194
ID Description Score Start End Superfamily
4l5gB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain 0.9778 139 173 1.20.58.1290
1y7oA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.963 18 194 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9592 22 195 3.90.226.10
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9524 6 194 3.90.226.10
af_P9WPC3_1_214_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9392 1 195 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2Z6P473-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9973 22 97 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117
AF-F8TGT4-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9936 24 95 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009532
GO:0051117
AF-A0A428VV44-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.979 22 118 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A2W4J8K3-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9781 22 121 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A6M0C5U5-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9767 5 93 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117

Map