F489505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1072 | 422 | 2144 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005834|Ga0068851_10238800|Ga0068851_102388001 |
| Length | 238 |
| Sequence | MSNRFGAPNASGQFSTPEMDPRGLTPQVRHEQFAPTMDYYIPQWEERTSYGMRRIDPYTKLFEDRIIFLGTPISDDIANAVMAQLLCLQQMDPDRDINIYINSPGGSFTAMTAIYDTMQFLKPDIQTVCLGQAASAAAVLLAAGTPGKRMALPNSRILIHQPYTEGSYGQSSDIEIQANEILRMRELLEKLIANHTGKTPEEVNADIERDKILTSEAAKEYGLIDGILESLKGTPATI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 100 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 104 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 105 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 106 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 108 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 109 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 127 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 188 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 189 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 212 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 213 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 214 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 231 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 232 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 233 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 240 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 244 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 251 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 306 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 341 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 342 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 343 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 391 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 392 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 393 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 394 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 395 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 396 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 397 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 398 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 399 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 400 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 401 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 402 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 403 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 404 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 405 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 406 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 407 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 408 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 409 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 410 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 411 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 412 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 413 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 414 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 415 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 416 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 417 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 418 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 419 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 420 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 421 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 422 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.56 |
| Metatranscriptomes | 3.54 |
| Isolates | 2.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 0.09 |
| Rhizoplane | 6.9 |
| Rhizosphere | 83.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068851_10238800 | 3300005834 | Bacteria | 1027 |
| 2 | LJQas_1003330 | 3300000549 | Bacteria | 2164 |
| 3 | JGI24740J21852_10017617 | 3300001979 | Bacteria | 2549 |
| 4 | JGI24740J21852_10027305 | 3300001979 | Bacteria | 1901 |
| 5 | JGI24739J22299_10049588 | 3300001989 | Bacteria | 1361 |
| 6 | JGI24739J22299_10059109 | 3300001989 | Bacteria | 1215 |
| 7 | JGI24737J22298_10009059 | 3300001990 | Bacteria | 3318 |
| 8 | JGI24737J22298_10013219 | 3300001990 | Bacteria | 2688 |
| 9 | JGI24737J22298_10030320 | 3300001990 | Bacteria | 1693 |
| 10 | JGI24735J21928_10012771 | 3300002067 | Bacteria | 2652 |
| 11 | JGI24735J21928_10020398 | 3300002067 | Bacteria | 2030 |
| 12 | JGI24735J21928_10073763 | 3300002067 | Bacteria | 977 |
| 13 | JGI24750J21931_1005874 | 3300002070 | Bacteria | 1516 |
| 14 | JGI24738J21930_10006440 | 3300002075 | Bacteria | 2753 |
| 15 | JGI24738J21930_10026683 | 3300002075 | Bacteria | 1185 |
| 16 | JGI24744J21845_10000532 | 3300002077 | Bacteria | 6817 |
| 17 | JGI24033J26618_1009029 | 3300002155 | Bacteria | 1155 |
| 18 | JGI24034J26672_10060791 | 3300002239 | Bacteria | 663 |
| 19 | JGI25406J46586_10073885 | 3300003203 | Bacteria | 1062 |
| 20 | Ga0006562J51391_1005843 | 3300003578 | Bacteria | 3210 |
| 21 | Ga0007429J51699_1066760 | 3300003579 | Bacteria | 1500 |
| 22 | JGI25405J52794_10006714 | 3300003911 | Bacteria | 2106 |
| 23 | Ga0058861_10077169 | 3300004800 | Bacteria | 2133 |
| 24 | Ga0070658_10108982 | 3300005327 | Bacteria | 2292 |
| 25 | Ga0070658_10227262 | 3300005327 | Bacteria | 1579 |
| 26 | Ga0070658_10352458 | 3300005327 | Bacteria | 1260 |
| 27 | Ga0070658_10772361 | 3300005327 | Bacteria | 835 |
| 28 | Ga0070683_100013995 | 3300005329 | Bacteria | 7006 |
| 29 | Ga0070683_100421979 | 3300005329 | Bacteria | 1272 |
| 30 | Ga0070683_100509705 | 3300005329 | Bacteria | 1150 |
| 31 | Ga0070670_100329110 | 3300005331 | Bacteria | 1340 |
| 32 | Ga0068869_100679547 | 3300005334 | Bacteria | 876 |
| 33 | Ga0070682_100018717 | 3300005337 | Bacteria | 4053 |
| 34 | Ga0070682_100030160 | 3300005337 | Bacteria | 3271 |
| 35 | Ga0070682_100170585 | 3300005337 | Bacteria | 1512 |
| 36 | Ga0070682_100374739 | 3300005337 | Bacteria | 1068 |
| 37 | Ga0070682_100526426 | 3300005337 | Bacteria | 921 |
| 38 | Ga0068868_100060199 | 3300005338 | Bacteria | 3006 |
| 39 | Ga0068868_100098699 | 3300005338 | Bacteria | 2361 |
| 40 | Ga0068868_100124901 | 3300005338 | Bacteria | 2101 |
| 41 | Ga0068868_100773024 | 3300005338 | Bacteria | 864 |
| 42 | Ga0070660_100003302 | 3300005339 | Bacteria | 11087 |
| 43 | Ga0070660_100184551 | 3300005339 | Bacteria | 1689 |
| 44 | Ga0070691_10088917 | 3300005341 | Bacteria | 1521 |
| 45 | Ga0070687_100033972 | 3300005343 | Bacteria | 2522 |
| 46 | Ga0070687_100571102 | 3300005343 | Bacteria | 772 |
| 47 | Ga0070661_100424249 | 3300005344 | Bacteria | 1055 |
| 48 | Ga0070692_10020197 | 3300005345 | Bacteria | 3227 |
| 49 | Ga0070692_10243024 | 3300005345 | Bacteria | 1074 |
| 50 | Ga0070668_100060257 | 3300005347 | Bacteria | 2939 |
| 51 | Ga0070668_100098969 | 3300005347 | Bacteria | 2309 |
| 52 | Ga0070668_100101103 | 3300005347 | Bacteria | 2284 |
| 53 | Ga0070668_100116637 | 3300005347 | Bacteria | 2129 |
| 54 | Ga0070668_100226633 | 3300005347 | Bacteria | 1544 |
| 55 | Ga0070668_100295250 | 3300005347 | Bacteria | 1358 |
| 56 | Ga0070668_100761591 | 3300005347 | Bacteria | 858 |
| 57 | Ga0070669_100464871 | 3300005353 | Bacteria | 1045 |
| 58 | Ga0070674_100060173 | 3300005356 | Bacteria | 2647 |
| 59 | Ga0070674_100066817 | 3300005356 | Bacteria | 2528 |
| 60 | Ga0070673_100332496 | 3300005364 | Bacteria | 1344 |
| 61 | Ga0070688_100191318 | 3300005365 | Bacteria | 1426 |
| 62 | Ga0070688_100448779 | 3300005365 | Bacteria | 964 |
| 63 | Ga0070659_100019106 | 3300005366 | Bacteria | 5184 |
| 64 | Ga0070659_100025275 | 3300005366 | Bacteria | 4558 |
| 65 | Ga0070659_100066242 | 3300005366 | Bacteria | 2862 |
| 66 | Ga0070659_100191252 | 3300005366 | Bacteria | 1682 |
| 67 | Ga0070659_100901525 | 3300005366 | Bacteria | 773 |
| 68 | Ga0070667_100072949 | 3300005367 | Bacteria | 2926 |
| 69 | Ga0070667_100279108 | 3300005367 | Bacteria | 1500 |
| 70 | Ga0070667_100746910 | 3300005367 | Bacteria | 907 |
| 71 | Ga0070701_10094608 | 3300005438 | Bacteria | 1644 |
| 72 | Ga0070711_100926075 | 3300005439 | Bacteria | 745 |
| 73 | Ga0070705_100013976 | 3300005440 | Bacteria | 4118 |
| 74 | Ga0070700_100002303 | 3300005441 | Bacteria | 9716 |
| 75 | Ga0070700_100448010 | 3300005441 | Bacteria | 982 |
| 76 | Ga0070663_100036589 | 3300005455 | Bacteria | 3411 |
| 77 | Ga0070663_100114837 | 3300005455 | Bacteria | 2027 |
| 78 | Ga0070663_100163055 | 3300005455 | Bacteria | 1717 |
| 79 | Ga0070663_100363988 | 3300005455 | Bacteria | 1174 |
| 80 | Ga0070678_100104615 | 3300005456 | Bacteria | 2202 |
| 81 | Ga0070678_100453373 | 3300005456 | Bacteria | 1124 |
| 82 | Ga0070662_100036231 | 3300005457 | Bacteria | 3488 |
| 83 | Ga0070662_100041884 | 3300005457 | Bacteria | 3269 |
| 84 | Ga0070662_100155153 | 3300005457 | Bacteria | 1786 |
| 85 | Ga0070662_100199228 | 3300005457 | Bacteria | 1588 |
| 86 | Ga0070681_10295500 | 3300005458 | Bacteria | 1530 |
| 87 | Ga0068867_100007389 | 3300005459 | Bacteria | 7773 |
| 88 | Ga0068867_100049577 | 3300005459 | Bacteria | 3092 |
| 89 | Ga0068867_100604874 | 3300005459 | Bacteria | 956 |
| 90 | Ga0070698_100011005 | 3300005471 | Bacteria | 9624 |
| 91 | Ga0070679_100020810 | 3300005530 | Bacteria | 6399 |
| 92 | Ga0070679_100521181 | 3300005530 | Bacteria | 1132 |
| 93 | Ga0070679_100736568 | 3300005530 | Bacteria | 929 |
| 94 | Ga0070684_100004672 | 3300005535 | Bacteria | 10459 |
| 95 | Ga0070684_100063833 | 3300005535 | Bacteria | 3230 |
| 96 | Ga0070684_100273570 | 3300005535 | Bacteria | 1546 |
| 97 | Ga0070684_100662654 | 3300005535 | Bacteria | 972 |
| 98 | Ga0068853_100338395 | 3300005539 | Bacteria | 1398 |
| 99 | Ga0068853_100526708 | 3300005539 | Bacteria | 1118 |
| 100 | Ga0068853_100750556 | 3300005539 | Bacteria | 932 |
| 101 | Ga0070672_100046686 | 3300005543 | Bacteria | 3356 |
| 102 | Ga0070686_100209024 | 3300005544 | Bacteria | 1403 |
| 103 | Ga0070686_100441218 | 3300005544 | Bacteria | 999 |
| 104 | Ga0070695_100855902 | 3300005545 | Bacteria | 732 |
| 105 | Ga0070693_100006536 | 3300005547 | Bacteria | 5653 |
| 106 | Ga0070665_100000868 | 3300005548 | Bacteria | 39125 |
| 107 | Ga0068855_100551123 | 3300005563 | Bacteria | 1248 |
| 108 | Ga0068855_100626339 | 3300005563 | Bacteria | 1158 |
| 109 | Ga0070664_100475196 | 3300005564 | Bacteria | 1150 |
| 110 | Ga0068857_100367938 | 3300005577 | Bacteria | 1333 |
| 111 | Ga0068854_100016555 | 3300005578 | Bacteria | 4918 |
| 112 | Ga0068854_100518157 | 3300005578 | Bacteria | 1007 |
| 113 | Ga0068856_100240491 | 3300005614 | Bacteria | 1826 |
| 114 | Ga0068856_100329340 | 3300005614 | Bacteria | 1545 |
| 115 | Ga0070702_100015855 | 3300005615 | Bacteria | 3856 |
| 116 | Ga0070702_100026047 | 3300005615 | Bacteria | 3139 |
| 117 | Ga0070702_100720402 | 3300005615 | Bacteria | 763 |
| 118 | Ga0068852_100149897 | 3300005616 | Bacteria | 2168 |
| 119 | Ga0068852_100390172 | 3300005616 | Bacteria | 1367 |
| 120 | Ga0068864_100078679 | 3300005618 | Bacteria | 2886 |
| 121 | Ga0068864_100125496 | 3300005618 | Bacteria | 2300 |
| 122 | Ga0068864_100263266 | 3300005618 | Bacteria | 1605 |
| 123 | Ga0068866_10025798 | 3300005718 | Bacteria | 2768 |
| 124 | Ga0068861_100024654 | 3300005719 | Bacteria | 4354 |
| 125 | Ga0068861_100086135 | 3300005719 | Bacteria | 2469 |
| 126 | Ga0068861_100880154 | 3300005719 | Bacteria | 847 |
| 127 | Ga0068851_10111670 | 3300005834 | Bacteria | 1460 |
| 128 | Ga0068870_10003830 | 3300005840 | Bacteria | 6407 |
| 129 | Ga0068870_10061537 | 3300005840 | Bacteria | 2018 |
| 130 | Ga0068870_10113681 | 3300005840 | Bacteria | 1549 |
| 131 | Ga0068863_100875613 | 3300005841 | Bacteria | 898 |
| 132 | Ga0068858_100045111 | 3300005842 | Bacteria | 4085 |
| 133 | Ga0068860_100000388 | 3300005843 | Bacteria | 57678 |
| 134 | Ga0068860_100100623 | 3300005843 | Bacteria | 2758 |
| 135 | Ga0068860_100550618 | 3300005843 | Bacteria | 1156 |
| 136 | Ga0081455_10000298 | 3300005937 | Bacteria | 65765 |
| 137 | Ga0081455_10002569 | 3300005937 | Bacteria | 21545 |
| 138 | Ga0081455_10006814 | 3300005937 | Bacteria | 12180 |
| 139 | Ga0081455_10010219 | 3300005937 | Bacteria | 9549 |
| 140 | Ga0081455_10020733 | 3300005937 | Bacteria | 6181 |
| 141 | Ga0081455_10038921 | 3300005937 | Bacteria | 4208 |
| 142 | Ga0081455_10056392 | 3300005937 | Bacteria | 3336 |
| 143 | Ga0081538_10000841 | 3300005981 | Bacteria | 33283 |
| 144 | Ga0081538_10016484 | 3300005981 | Bacteria | 5661 |
| 145 | Ga0081538_10017183 | 3300005981 | Bacteria | 5503 |
| 146 | Ga0081540_1069961 | 3300005983 | Bacteria | 1628 |
| 147 | Ga0081539_10000170 | 3300005985 | Bacteria | 152854 |
| 148 | Ga0075365_10019907 | 3300006038 | Bacteria | 4152 |
| 149 | Ga0075365_10050313 | 3300006038 | Bacteria | 2748 |
| 150 | Ga0075365_10146211 | 3300006038 | Bacteria | 1642 |
| 151 | Ga0075365_10308305 | 3300006038 | Bacteria | 1114 |
| 152 | Ga0075365_10316815 | 3300006038 | Bacteria | 1098 |
| 153 | Ga0075365_10478974 | 3300006038 | Bacteria | 879 |
| 154 | Ga0075368_10061383 | 3300006042 | Bacteria | 1505 |
| 155 | Ga0075368_10207217 | 3300006042 | Bacteria | 830 |
| 156 | Ga0075363_100008378 | 3300006048 | Bacteria | 4811 |
| 157 | Ga0075363_100046286 | 3300006048 | Bacteria | 2307 |
| 158 | Ga0075363_100187971 | 3300006048 | Bacteria | 1177 |
| 159 | Ga0075363_100318542 | 3300006048 | Bacteria | 904 |
| 160 | Ga0075363_100367887 | 3300006048 | Bacteria | 841 |
| 161 | Ga0075364_10003388 | 3300006051 | Bacteria | 9053 |
| 162 | Ga0075364_10045314 | 3300006051 | Bacteria | 2862 |
| 163 | Ga0075364_10387199 | 3300006051 | Bacteria | 954 |
| 164 | Ga0075432_10002195 | 3300006058 | Bacteria | 6501 |
| 165 | Ga0075432_10004039 | 3300006058 | Bacteria | 5009 |
| 166 | Ga0075362_10004276 | 3300006177 | Bacteria | 5104 |
| 167 | Ga0075367_10020551 | 3300006178 | Bacteria | 3680 |
| 168 | Ga0075367_10037203 | 3300006178 | Bacteria | 2827 |
| 169 | Ga0075367_10520773 | 3300006178 | Bacteria | 755 |
| 170 | Ga0075370_10024322 | 3300006353 | Bacteria | 3345 |
| 171 | Ga0075370_10043683 | 3300006353 | Bacteria | 2533 |
| 172 | Ga0075370_10078090 | 3300006353 | Bacteria | 1900 |
| 173 | Ga0075370_10094577 | 3300006353 | Bacteria | 1726 |
| 174 | Ga0075428_100003370 | 3300006844 | Bacteria | 17483 |
| 175 | Ga0075428_100022105 | 3300006844 | Bacteria | 7042 |
| 176 | Ga0075428_100024346 | 3300006844 | Bacteria | 6698 |
| 177 | Ga0075428_100027812 | 3300006844 | Bacteria | 6256 |
| 178 | Ga0075428_100096259 | 3300006844 | Bacteria | 3226 |
| 179 | Ga0075430_100008427 | 3300006846 | Bacteria | 8709 |
| 180 | Ga0075430_100072226 | 3300006846 | Bacteria | 2894 |
| 181 | Ga0075431_100001915 | 3300006847 | Bacteria | 19773 |
| 182 | Ga0075431_100036576 | 3300006847 | Bacteria | 5056 |
| 183 | Ga0075431_100051599 | 3300006847 | Bacteria | 4241 |
| 184 | Ga0075433_10004815 | 3300006852 | Bacteria | 10539 |
| 185 | Ga0075433_10066458 | 3300006852 | Bacteria | 3164 |
| 186 | Ga0075433_10290177 | 3300006852 | Bacteria | 1449 |
| 187 | Ga0075434_100004269 | 3300006871 | Bacteria | 12820 |
| 188 | Ga0075434_100021537 | 3300006871 | Bacteria | 6266 |
| 189 | Ga0075434_100535713 | 3300006871 | Bacteria | 1191 |
| 190 | Ga0075429_100016458 | 3300006880 | Bacteria | 6408 |
| 191 | Ga0075429_100030709 | 3300006880 | Bacteria | 4667 |
| 192 | Ga0068865_100004270 | 3300006881 | Bacteria | 8620 |
| 193 | Ga0068865_100007647 | 3300006881 | Bacteria | 6656 |
| 194 | Ga0068865_100131512 | 3300006881 | Bacteria | 1875 |
| 195 | Ga0068865_100330122 | 3300006881 | Bacteria | 1229 |
| 196 | Ga0075436_100000495 | 3300006914 | Bacteria | 25442 |
| 197 | Ga0075435_100003823 | 3300007076 | Bacteria | 10273 |
| 198 | Ga0075435_100024035 | 3300007076 | Bacteria | 4723 |
| 199 | Ga0105240_10853454 | 3300009093 | Bacteria | 983 |
| 200 | Ga0111539_10015199 | 3300009094 | Bacteria | 9589 |
| 201 | Ga0111539_10051724 | 3300009094 | Bacteria | 4891 |
| 202 | Ga0111539_10442384 | 3300009094 | Bacteria | 1513 |
| 203 | Ga0111539_10564497 | 3300009094 | Bacteria | 1325 |
| 204 | Ga0105245_10002262 | 3300009098 | Bacteria | 17436 |
| 205 | Ga0105245_10010146 | 3300009098 | Bacteria | 8202 |
| 206 | Ga0105245_10057213 | 3300009098 | Bacteria | 3506 |
| 207 | Ga0105245_10197954 | 3300009098 | Bacteria | 1928 |
| 208 | Ga0105245_10273941 | 3300009098 | Bacteria | 1647 |
| 209 | Ga0105245_10276777 | 3300009098 | Bacteria | 1639 |
| 210 | Ga0105247_10242582 | 3300009101 | Bacteria | 1228 |
| 211 | Ga0114129_10038001 | 3300009147 | Bacteria | 6791 |
| 212 | Ga0114129_10048557 | 3300009147 | Bacteria | 5963 |
| 213 | Ga0114129_10214007 | 3300009147 | Bacteria | 2603 |
| 214 | Ga0105243_10011969 | 3300009148 | Bacteria | 6558 |
| 215 | Ga0105243_10047697 | 3300009148 | Bacteria | 3374 |
| 216 | Ga0105243_10055770 | 3300009148 | Bacteria | 3140 |
| 217 | Ga0105243_10093944 | 3300009148 | Bacteria | 2476 |
| 218 | Ga0105243_10138780 | 3300009148 | Bacteria | 2071 |
| 219 | Ga0105243_10446906 | 3300009148 | Bacteria | 1212 |
| 220 | Ga0105243_10634791 | 3300009148 | Bacteria | 1033 |
| 221 | Ga0105243_10927957 | 3300009148 | Bacteria | 868 |
| 222 | Ga0105242_10059619 | 3300009176 | Bacteria | 3132 |
| 223 | Ga0105242_10260126 | 3300009176 | Bacteria | 1567 |
| 224 | Ga0105242_10281387 | 3300009176 | Bacteria | 1511 |
| 225 | Ga0105248_10190351 | 3300009177 | Bacteria | 2312 |
| 226 | Ga0105248_10274711 | 3300009177 | Bacteria | 1897 |
| 227 | Ga0105248_10602244 | 3300009177 | Bacteria | 1240 |
| 228 | Ga0105237_10071232 | 3300009545 | Bacteria | 3471 |
| 229 | Ga0105237_10116239 | 3300009545 | Bacteria | 2668 |
| 230 | Ga0105237_10788331 | 3300009545 | Bacteria | 957 |
| 231 | Ga0105237_11113179 | 3300009545 | Bacteria | 796 |
| 232 | Ga0105238_10216710 | 3300009551 | Bacteria | 1890 |
| 233 | Ga0105238_10524756 | 3300009551 | Bacteria | 1187 |
| 234 | Ga0105249_10032279 | 3300009553 | Bacteria | 4737 |
| 235 | Ga0105249_10037581 | 3300009553 | Bacteria | 4394 |
| 236 | Ga0105249_10071139 | 3300009553 | Bacteria | 3213 |
| 237 | Ga0105249_10203984 | 3300009553 | Bacteria | 1936 |
| 238 | Ga0105249_10214519 | 3300009553 | Bacteria | 1891 |
| 239 | Ga0105249_10407079 | 3300009553 | Bacteria | 1392 |
| 240 | Ga0105249_10895474 | 3300009553 | Bacteria | 954 |
| 241 | Ga0105030_109670 | 3300009987 | Bacteria | 823 |
| 242 | Ga0105028_104598 | 3300009993 | Bacteria | 1438 |
| 243 | Ga0105239_10001318 | 3300010375 | Bacteria | 33415 |
| 244 | Ga0105239_10002798 | 3300010375 | Bacteria | 21821 |
| 245 | Ga0105239_10079150 | 3300010375 | Bacteria | 3617 |
| 246 | Ga0105239_10218118 | 3300010375 | Bacteria | 2139 |
| 247 | Ga0105239_10474285 | 3300010375 | Bacteria | 1421 |
| 248 | Ga0105239_10757685 | 3300010375 | Bacteria | 1111 |
| 249 | Ga0105246_10014826 | 3300011119 | Bacteria | 4909 |
| 250 | Ga0105246_10130712 | 3300011119 | Bacteria | 1875 |
| 251 | Ga0105246_10379044 | 3300011119 | Bacteria | 1168 |
| 252 | Ga0157336_1006973 | 3300012477 | Bacteria | 787 |
| 253 | Ga0157329_1003071 | 3300012491 | Bacteria | 998 |
| 254 | Ga0157335_1002177 | 3300012492 | Bacteria | 1159 |
| 255 | Ga0157341_1003790 | 3300012494 | Bacteria | 1071 |
| 256 | Ga0157319_1001204 | 3300012497 | Bacteria | 1298 |
| 257 | Ga0157319_1005147 | 3300012497 | Bacteria | 889 |
| 258 | Ga0157345_1009036 | 3300012498 | Bacteria | 844 |
| 259 | Ga0157338_1010256 | 3300012515 | Bacteria | 942 |
| 260 | Ga0157373_10608154 | 3300013100 | Bacteria | 796 |
| 261 | Ga0157371_10053858 | 3300013102 | Bacteria | 2857 |
| 262 | Ga0157371_10087061 | 3300013102 | Bacteria | 2212 |
| 263 | Ga0157374_10282565 | 3300013296 | Bacteria | 1639 |
| 264 | Ga0157378_10471144 | 3300013297 | Bacteria | 1250 |
| 265 | Ga0157378_10517258 | 3300013297 | Bacteria | 1194 |
| 266 | Ga0163162_10038011 | 3300013306 | Bacteria | 4804 |
| 267 | Ga0163162_10158276 | 3300013306 | Bacteria | 2386 |
| 268 | Ga0163162_10358331 | 3300013306 | Bacteria | 1591 |
| 269 | Ga0163162_10500621 | 3300013306 | Bacteria | 1345 |
| 270 | Ga0163162_10932740 | 3300013306 | Bacteria | 980 |
| 271 | Ga0157372_10027521 | 3300013307 | Bacteria | 6194 |
| 272 | Ga0157372_10083119 | 3300013307 | Bacteria | 3627 |
| 273 | Ga0157372_10116214 | 3300013307 | Bacteria | 3067 |
| 274 | Ga0157372_10273589 | 3300013307 | Bacteria | 1963 |
| 275 | Ga0157372_10284284 | 3300013307 | Bacteria | 1924 |
| 276 | Ga0157372_10507490 | 3300013307 | Bacteria | 1406 |
| 277 | Ga0157375_10277439 | 3300013308 | Bacteria | 1839 |
| 278 | Ga0157375_10421088 | 3300013308 | Bacteria | 1501 |
| 279 | Ga0157375_10431870 | 3300013308 | Bacteria | 1483 |
| 280 | Ga0157375_10558921 | 3300013308 | Bacteria | 1305 |
| 281 | Ga0157375_10682027 | 3300013308 | Bacteria | 1182 |
| 282 | Ga0157375_10847275 | 3300013308 | Bacteria | 1061 |
| 283 | Ga0163163_10129334 | 3300014325 | Bacteria | 2565 |
| 284 | Ga0163163_10160525 | 3300014325 | Bacteria | 2293 |
| 285 | Ga0163163_10287979 | 3300014325 | Bacteria | 1695 |
| 286 | Ga0163163_10788419 | 3300014325 | Bacteria | 1014 |
| 287 | Ga0157380_10005485 | 3300014326 | Bacteria | 8863 |
| 288 | Ga0157380_10174384 | 3300014326 | Bacteria | 1882 |
| 289 | Ga0157380_10200963 | 3300014326 | Bacteria | 1768 |
| 290 | Ga0157380_10386832 | 3300014326 | Bacteria | 1322 |
| 291 | Ga0182008_10190355 | 3300014497 | Bacteria | 1041 |
| 292 | Ga0157377_10316245 | 3300014745 | Bacteria | 1036 |
| 293 | Ga0157379_10040240 | 3300014968 | Bacteria | 4171 |
| 294 | Ga0157376_10340096 | 3300014969 | Bacteria | 1433 |
| 295 | Ga0157376_10350290 | 3300014969 | Bacteria | 1413 |
| 296 | Ga0163161_10017762 | 3300017792 | Bacteria | 4984 |
| 297 | Ga0163161_10048837 | 3300017792 | Bacteria | 3056 |
| 298 | Ga0163161_10153584 | 3300017792 | Bacteria | 1751 |
| 299 | Ga0163161_10162132 | 3300017792 | Bacteria | 1705 |
| 300 | Ga0163161_10326916 | 3300017792 | Bacteria | 1213 |
| 301 | Ga0197907_10208093 | 3300020069 | Bacteria | 907 |
| 302 | Ga0197907_10309606 | 3300020069 | Bacteria | 2142 |
| 303 | Ga0197907_10559225 | 3300020069 | Bacteria | 1832 |
| 304 | Ga0206356_11297441 | 3300020070 | Bacteria | 966 |
| 305 | Ga0206356_11804983 | 3300020070 | Bacteria | 1450 |
| 306 | Ga0206355_1640103 | 3300020076 | Bacteria | 1654 |
| 307 | Ga0206350_10103036 | 3300020080 | Bacteria | 1325 |
| 308 | Ga0154015_1364342 | 3300020610 | Bacteria | 3269 |
| 309 | Ga0213875_10074552 | 3300021388 | Bacteria | 1583 |
| 310 | Ga0207682_10094578 | 3300025893 | Bacteria | 1300 |
| 311 | Ga0207642_10122701 | 3300025899 | Bacteria | 1343 |
| 312 | Ga0207710_10089645 | 3300025900 | Bacteria | 1438 |
| 313 | Ga0207688_10052421 | 3300025901 | Bacteria | 2286 |
| 314 | Ga0207688_10058370 | 3300025901 | Bacteria | 2171 |
| 315 | Ga0207688_10094086 | 3300025901 | Bacteria | 1724 |
| 316 | Ga0207647_10008541 | 3300025904 | Bacteria | 7334 |
| 317 | Ga0207647_10010116 | 3300025904 | Bacteria | 6669 |
| 318 | Ga0207647_10059649 | 3300025904 | Bacteria | 2334 |
| 319 | Ga0207647_10168652 | 3300025904 | Bacteria | 1275 |
| 320 | Ga0207647_10315777 | 3300025904 | Bacteria | 888 |
| 321 | Ga0207647_10370187 | 3300025904 | Bacteria | 810 |
| 322 | Ga0207685_10113134 | 3300025905 | Bacteria | 1180 |
| 323 | Ga0207643_10108564 | 3300025908 | Bacteria | 1633 |
| 324 | Ga0207643_10110657 | 3300025908 | Bacteria | 1618 |
| 325 | Ga0207643_10129421 | 3300025908 | Bacteria | 1501 |
| 326 | Ga0207643_10238608 | 3300025908 | Bacteria | 1117 |
| 327 | Ga0207705_10095945 | 3300025909 | Bacteria | 2177 |
| 328 | Ga0207705_10098957 | 3300025909 | Bacteria | 2144 |
| 329 | Ga0207705_10265900 | 3300025909 | Bacteria | 1310 |
| 330 | Ga0207707_10155432 | 3300025912 | Bacteria | 2000 |
| 331 | Ga0207671_10087463 | 3300025914 | Bacteria | 2343 |
| 332 | Ga0207671_10272065 | 3300025914 | Bacteria | 1335 |
| 333 | Ga0207671_10477858 | 3300025914 | Bacteria | 993 |
| 334 | Ga0207662_10079336 | 3300025918 | Bacteria | 2000 |
| 335 | Ga0207657_10042184 | 3300025919 | Bacteria | 4027 |
| 336 | Ga0207657_10046093 | 3300025919 | Bacteria | 3820 |
| 337 | Ga0207657_10279651 | 3300025919 | Bacteria | 1325 |
| 338 | Ga0207657_10454860 | 3300025919 | Bacteria | 1004 |
| 339 | Ga0207652_10019476 | 3300025921 | Bacteria | 5582 |
| 340 | Ga0207652_10201519 | 3300025921 | Bacteria | 1791 |
| 341 | Ga0207652_11126577 | 3300025921 | Bacteria | 685 |
| 342 | Ga0207646_10129704 | 3300025922 | Bacteria | 2269 |
| 343 | Ga0207681_10345282 | 3300025923 | Bacteria | 1190 |
| 344 | Ga0207681_10421974 | 3300025923 | Bacteria | 1081 |
| 345 | Ga0207694_10095551 | 3300025924 | Bacteria | 2350 |
| 346 | Ga0207694_10125616 | 3300025924 | Bacteria | 2052 |
| 347 | Ga0207694_10155871 | 3300025924 | Bacteria | 1842 |
| 348 | Ga0207650_10499478 | 3300025925 | Bacteria | 1016 |
| 349 | Ga0207687_10063706 | 3300025927 | Bacteria | 2611 |
| 350 | Ga0207687_10146799 | 3300025927 | Bacteria | 1795 |
| 351 | Ga0207687_10257967 | 3300025927 | Bacteria | 1389 |
| 352 | Ga0207687_10429373 | 3300025927 | Bacteria | 1092 |
| 353 | Ga0207687_10453778 | 3300025927 | Bacteria | 1063 |
| 354 | Ga0207664_10046885 | 3300025929 | Bacteria | 3393 |
| 355 | Ga0207690_10014894 | 3300025932 | Bacteria | 4706 |
| 356 | Ga0207690_10036521 | 3300025932 | Bacteria | 3182 |
| 357 | Ga0207690_10074596 | 3300025932 | Bacteria | 2350 |
| 358 | Ga0207690_10077583 | 3300025932 | Bacteria | 2310 |
| 359 | Ga0207690_10199212 | 3300025932 | Bacteria | 1520 |
| 360 | Ga0207706_10022138 | 3300025933 | Bacteria | 5705 |
| 361 | Ga0207706_10190026 | 3300025933 | Bacteria | 1803 |
| 362 | Ga0207706_10281427 | 3300025933 | Bacteria | 1450 |
| 363 | Ga0207706_11069634 | 3300025933 | Bacteria | 675 |
| 364 | Ga0207686_10010760 | 3300025934 | Bacteria | 4985 |
| 365 | Ga0207686_10106628 | 3300025934 | Bacteria | 1881 |
| 366 | Ga0207686_10176922 | 3300025934 | Bacteria | 1510 |
| 367 | Ga0207686_10390934 | 3300025934 | Bacteria | 1057 |
| 368 | Ga0207709_10005306 | 3300025935 | Bacteria | 7331 |
| 369 | Ga0207709_10036229 | 3300025935 | Bacteria | 2923 |
| 370 | Ga0207709_10114062 | 3300025935 | Bacteria | 1813 |
| 371 | Ga0207709_10139341 | 3300025935 | Bacteria | 1665 |
| 372 | Ga0207709_10429124 | 3300025935 | Bacteria | 1017 |
| 373 | Ga0207709_10588515 | 3300025935 | Bacteria | 880 |
| 374 | Ga0207670_10427921 | 3300025936 | Bacteria | 1063 |
| 375 | Ga0207669_10015653 | 3300025937 | Bacteria | 3831 |
| 376 | Ga0207669_10115217 | 3300025937 | Bacteria | 1811 |
| 377 | Ga0207704_10013477 | 3300025938 | Bacteria | 4092 |
| 378 | Ga0207704_10019645 | 3300025938 | Bacteria | 3553 |
| 379 | Ga0207704_10083003 | 3300025938 | Bacteria | 2078 |
| 380 | Ga0207704_10166531 | 3300025938 | Bacteria | 1575 |
| 381 | Ga0207691_10003002 | 3300025940 | Bacteria | 16471 |
| 382 | Ga0207691_10081757 | 3300025940 | Bacteria | 2903 |
| 383 | Ga0207711_10214258 | 3300025941 | Bacteria | 1760 |
| 384 | Ga0207711_10666024 | 3300025941 | Bacteria | 971 |
| 385 | Ga0207689_10363980 | 3300025942 | Bacteria | 1203 |
| 386 | Ga0207661_10005512 | 3300025944 | Bacteria | 8927 |
| 387 | Ga0207661_10203304 | 3300025944 | Bacteria | 1742 |
| 388 | Ga0207661_10263398 | 3300025944 | Bacteria | 1536 |
| 389 | Ga0207679_10250018 | 3300025945 | Bacteria | 1507 |
| 390 | Ga0207679_10334253 | 3300025945 | Bacteria | 1316 |
| 391 | Ga0207679_10693878 | 3300025945 | Bacteria | 923 |
| 392 | Ga0207667_10494453 | 3300025949 | Bacteria | 1241 |
| 393 | Ga0207651_10218246 | 3300025960 | Bacteria | 1540 |
| 394 | Ga0207712_10029451 | 3300025961 | Bacteria | 3683 |
| 395 | Ga0207712_10068944 | 3300025961 | Bacteria | 2536 |
| 396 | Ga0207712_10914457 | 3300025961 | Bacteria | 776 |
| 397 | Ga0207668_10061208 | 3300025972 | Bacteria | 2646 |
| 398 | Ga0207668_10138819 | 3300025972 | Bacteria | 1866 |
| 399 | Ga0207668_10139839 | 3300025972 | Bacteria | 1860 |
| 400 | Ga0207668_10461494 | 3300025972 | Bacteria | 1086 |
| 401 | Ga0207640_10053848 | 3300025981 | Bacteria | 2628 |
| 402 | Ga0207658_10158162 | 3300025986 | Bacteria | 1854 |
| 403 | Ga0207658_10250321 | 3300025986 | Bacteria | 1505 |
| 404 | Ga0207658_10339750 | 3300025986 | Bacteria | 1305 |
| 405 | Ga0207677_10094319 | 3300026023 | Bacteria | 2184 |
| 406 | Ga0207677_10162617 | 3300026023 | Bacteria | 1736 |
| 407 | Ga0207677_10196712 | 3300026023 | Bacteria | 1599 |
| 408 | Ga0207703_10095225 | 3300026035 | Bacteria | 2512 |
| 409 | Ga0207703_10465034 | 3300026035 | Bacteria | 1183 |
| 410 | Ga0207703_11093552 | 3300026035 | Bacteria | 766 |
| 411 | Ga0207639_10051080 | 3300026041 | Bacteria | 3143 |
| 412 | Ga0207639_10137875 | 3300026041 | Bacteria | 2029 |
| 413 | Ga0207639_10185629 | 3300026041 | Bacteria | 1772 |
| 414 | Ga0207639_10516134 | 3300026041 | Bacteria | 1094 |
| 415 | Ga0207678_10065790 | 3300026067 | Bacteria | 3112 |
| 416 | Ga0207678_10127572 | 3300026067 | Bacteria | 2170 |
| 417 | Ga0207678_10186019 | 3300026067 | Bacteria | 1774 |
| 418 | Ga0207678_10217119 | 3300026067 | Bacteria | 1636 |
| 419 | Ga0207678_10231520 | 3300026067 | Bacteria | 1582 |
| 420 | Ga0207678_10355017 | 3300026067 | Bacteria | 1265 |
| 421 | Ga0207678_10378226 | 3300026067 | Bacteria | 1224 |
| 422 | Ga0207708_10001371 | 3300026075 | Bacteria | 18327 |
| 423 | Ga0207708_10095894 | 3300026075 | Bacteria | 2291 |
| 424 | Ga0207708_10107229 | 3300026075 | Bacteria | 2166 |
| 425 | Ga0207708_10251015 | 3300026075 | Bacteria | 1426 |
| 426 | Ga0207708_10355483 | 3300026075 | Bacteria | 1203 |
| 427 | Ga0207702_10126503 | 3300026078 | Bacteria | 2295 |
| 428 | Ga0207641_10484756 | 3300026088 | Bacteria | 1199 |
| 429 | Ga0207648_10050693 | 3300026089 | Bacteria | 3629 |
| 430 | Ga0207648_10056730 | 3300026089 | Bacteria | 3417 |
| 431 | Ga0207648_10269923 | 3300026089 | Bacteria | 1519 |
| 432 | Ga0207676_10403299 | 3300026095 | Bacteria | 1278 |
| 433 | Ga0207676_10454806 | 3300026095 | Bacteria | 1208 |
| 434 | Ga0207676_10521386 | 3300026095 | Bacteria | 1131 |
| 435 | Ga0207674_10007577 | 3300026116 | Bacteria | 12649 |
| 436 | Ga0207674_10114438 | 3300026116 | Bacteria | 2670 |
| 437 | Ga0207674_10327365 | 3300026116 | Bacteria | 1482 |
| 438 | Ga0207675_100016804 | 3300026118 | Bacteria | 6836 |
| 439 | Ga0207675_100043167 | 3300026118 | Bacteria | 4211 |
| 440 | Ga0207675_100089750 | 3300026118 | Bacteria | 2889 |
| 441 | Ga0207675_100118612 | 3300026118 | Bacteria | 2502 |
| 442 | Ga0207675_100322546 | 3300026118 | Bacteria | 1508 |
| 443 | Ga0207683_10093108 | 3300026121 | Bacteria | 2685 |
| 444 | Ga0207683_10121129 | 3300026121 | Bacteria | 2349 |
| 445 | Ga0207698_10223756 | 3300026142 | Bacteria | 1703 |
| 446 | Ga0207698_10468897 | 3300026142 | Bacteria | 1219 |
| 447 | Ga0207698_10576581 | 3300026142 | Bacteria | 1106 |
| 448 | Ga0207698_10630803 | 3300026142 | Bacteria | 1060 |
| 449 | Ga0209999_1058845 | 3300027543 | Bacteria | 730 |
| 450 | Ga0209813_10000658 | 3300027866 | Bacteria | 7921 |
| 451 | Ga0209813_10005764 | 3300027866 | Bacteria | 3025 |
| 452 | Ga0207428_10003055 | 3300027907 | Bacteria | 16475 |
| 453 | Ga0207428_10008733 | 3300027907 | Bacteria | 9139 |
| 454 | Ga0207428_10023825 | 3300027907 | Bacteria | 5142 |
| 455 | Ga0207428_10259012 | 3300027907 | Bacteria | 1296 |
| 456 | Ga0268266_10001392 | 3300028379 | Bacteria | 28952 |
| 457 | Ga0268266_10121698 | 3300028379 | Bacteria | 2323 |
| 458 | Ga0268264_10000387 | 3300028381 | Bacteria | 63349 |
| 459 | Ga0268264_10210935 | 3300028381 | Bacteria | 1783 |
| 460 | Ga0268264_10426826 | 3300028381 | Bacteria | 1280 |
| 461 | Ga0307517_10201545 | 3300028786 | Bacteria | 1243 |
| 462 | Ga0307515_10344927 | 3300028794 | Bacteria | 1139 |
| 463 | Ga0316176_1031002 | 3300030732 | Bacteria | 1161 |
| 464 | Ga0316181_1115169 | 3300030744 | Bacteria | 1841 |
| 465 | Ga0316182_1088044 | 3300030745 | Bacteria | 1074 |
| 466 | Ga0316182_1224164 | 3300030745 | Bacteria | 6404 |
| 467 | Ga0265320_10045531 | 3300031240 | Bacteria | 2155 |
| 468 | Ga0265340_10025160 | 3300031247 | Bacteria | 3018 |
| 469 | Ga0265339_10022215 | 3300031249 | Bacteria | 3678 |
| 470 | Ga0307513_10071567 | 3300031456 | Bacteria | 3618 |
| 471 | Ga0307408_100005933 | 3300031548 | Bacteria | 8137 |
| 472 | Ga0307408_100013944 | 3300031548 | Bacteria | 5337 |
| 473 | Ga0307408_100096374 | 3300031548 | Bacteria | 2244 |
| 474 | Ga0307408_100164326 | 3300031548 | Bacteria | 1766 |
| 475 | Ga0307408_100766208 | 3300031548 | Bacteria | 873 |
| 476 | Ga0316579_10013595 | 3300031691 | Bacteria | 3503 |
| 477 | Ga0265342_10101315 | 3300031712 | Bacteria | 1640 |
| 478 | Ga0316576_10058110 | 3300031727 | Bacteria | 2828 |
| 479 | Ga0316576_10154017 | 3300031727 | Bacteria | 1732 |
| 480 | Ga0316578_10059267 | 3300031728 | Bacteria | 2251 |
| 481 | Ga0307405_10383273 | 3300031731 | Bacteria | 1095 |
| 482 | Ga0316577_10017848 | 3300031733 | Bacteria | 3921 |
| 483 | Ga0307413_10001451 | 3300031824 | Bacteria | 9002 |
| 484 | Ga0307413_10023829 | 3300031824 | Bacteria | 3324 |
| 485 | Ga0307413_10056084 | 3300031824 | Bacteria | 2401 |
| 486 | Ga0307413_10313387 | 3300031824 | Bacteria | 1195 |
| 487 | Ga0307413_10469726 | 3300031824 | Bacteria | 1003 |
| 488 | Ga0307410_10002082 | 3300031852 | Bacteria | 9478 |
| 489 | Ga0307410_10011465 | 3300031852 | Bacteria | 5071 |
| 490 | Ga0307410_10041750 | 3300031852 | Bacteria | 3027 |
| 491 | Ga0307410_10094609 | 3300031852 | Bacteria | 2129 |
| 492 | Ga0307410_10154434 | 3300031852 | Bacteria | 1712 |
| 493 | Ga0307410_10293295 | 3300031852 | Bacteria | 1281 |
| 494 | Ga0307410_10566617 | 3300031852 | Bacteria | 943 |
| 495 | Ga0307406_10000207 | 3300031901 | Bacteria | 35322 |
| 496 | Ga0307406_10010450 | 3300031901 | Bacteria | 5235 |
| 497 | Ga0307406_10101042 | 3300031901 | Bacteria | 1964 |
| 498 | Ga0307407_10007549 | 3300031903 | Bacteria | 4931 |
| 499 | Ga0307407_10020689 | 3300031903 | Bacteria | 3376 |
| 500 | Ga0307412_10067839 | 3300031911 | Bacteria | 2423 |
| 501 | Ga0307412_10092906 | 3300031911 | Bacteria | 2115 |
| 502 | Ga0307412_10166467 | 3300031911 | Bacteria | 1644 |
| 503 | Ga0307409_100003399 | 3300031995 | Bacteria | 8641 |
| 504 | Ga0307409_100021958 | 3300031995 | Bacteria | 4389 |
| 505 | Ga0307409_100121070 | 3300031995 | Bacteria | 2216 |
| 506 | Ga0307409_100297914 | 3300031995 | Bacteria | 1499 |
| 507 | Ga0307409_100853791 | 3300031995 | Bacteria | 921 |
| 508 | Ga0307416_100000064 | 3300032002 | Bacteria | 95532 |
| 509 | Ga0307416_100000622 | 3300032002 | Bacteria | 18287 |
| 510 | Ga0307416_100068237 | 3300032002 | Bacteria | 2937 |
| 511 | Ga0307416_100088949 | 3300032002 | Bacteria | 2642 |
| 512 | Ga0307416_100105910 | 3300032002 | Bacteria | 2463 |
| 513 | Ga0307416_100248489 | 3300032002 | Bacteria | 1729 |
| 514 | Ga0307416_100529099 | 3300032002 | Bacteria | 1248 |
| 515 | Ga0307416_101174522 | 3300032002 | Bacteria | 873 |
| 516 | Ga0307414_10004847 | 3300032004 | Bacteria | 7348 |
| 517 | Ga0307414_10256654 | 3300032004 | Bacteria | 1456 |
| 518 | Ga0307414_10452038 | 3300032004 | Bacteria | 1127 |
| 519 | Ga0307411_10003883 | 3300032005 | Bacteria | 7043 |
| 520 | Ga0307411_10174105 | 3300032005 | Bacteria | 1626 |
| 521 | Ga0307415_100002201 | 3300032126 | Bacteria | 9645 |
| 522 | Ga0307415_100013917 | 3300032126 | Bacteria | 4710 |
| 523 | Ga0307415_100188988 | 3300032126 | Bacteria | 1623 |
| 524 | Ga0307415_100812461 | 3300032126 | Bacteria | 854 |
| 525 | Ga0307415_101124638 | 3300032126 | Bacteria | 736 |
| 526 | Ga0316583_10010836 | 3300032133 | Bacteria | 3283 |
| 527 | Ga0316585_10013028 | 3300032137 | Bacteria | 2472 |
| 528 | Ga0316580_10009815 | 3300032139 | Bacteria | 2882 |
| 529 | Ga0316593_10004157 | 3300032168 | Bacteria | 3681 |
| 530 | Ga0316592_1000942 | 3300033524 | Bacteria | 4453 |
| 531 | Ga0316588_1006432 | 3300033528 | Bacteria | 2348 |
| 532 | Ga0316596_1003274 | 3300033541 | Bacteria | 3527 |
| 533 | Ga0373928_0041623 | 3300035084 | Bacteria | 1057 |
| 534 | Ga0373946_0158242 | 3300035171 | Bacteria | 1062 |
| 535 | Ga0316574_0103207 | 3300035398 | Bacteria | 1825 |
| 536 | Ga0373931_0185772 | 3300035691 | Bacteria | 1234 |
| 537 | Ga0316582_0128927 | 3300036647 | Bacteria | 1697 |
| 538 | Ga0316584_0032972 | 3300036712 | Bacteria | 3833 |
| 539 | Ga0395900_0034125 | 3300037418 | Bacteria | 5238 |
| 540 | Ga0395900_0380545 | 3300037418 | Bacteria | 1379 |
| 541 | Ga0395900_0506248 | 3300037418 | Bacteria | 1157 |
| 542 | Ga0395898_0059562 | 3300037466 | Bacteria | 3713 |
| 543 | Ga0395898_0907652 | 3300037466 | Bacteria | 819 |
| 544 | Ga0395905_0012411 | 3300037471 | Bacteria | 8201 |
| 545 | Ga0395905_0216579 | 3300037471 | Bacteria | 1793 |
| 546 | Ga0395905_0576804 | 3300037471 | Bacteria | 1026 |
| 547 | Ga0316581_0003416 | 3300037588 | Bacteria | 3953 |
| 548 | Ga0436364_0249415 | 3300037853 | Bacteria | 1561 |
| 549 | Ga0395901_0034440 | 3300038443 | Bacteria | 5230 |
| 550 | Ga0395901_0081403 | 3300038443 | Bacteria | 3382 |
| 551 | Ga0395901_0083782 | 3300038443 | Bacteria | 3333 |
| 552 | Ga0395901_0629118 | 3300038443 | Bacteria | 1079 |
| 553 | Ga0242420_004572 | 3300038996 | Bacteria | 2099 |
| 554 | Ga0439438_019084 | 3300041405 | Bacteria | 1943 |
| 555 | Ga0439438_043312 | 3300041405 | Bacteria | 1162 |
| 556 | Ga0439465_0035432 | 3300041413 | Bacteria | 1600 |
| 557 | Ga0439465_0140606 | 3300041413 | Bacteria | 857 |
| 558 | Ga0439465_0146610 | 3300041413 | Bacteria | 841 |
| 559 | Ga0451791_0184620 | 3300041451 | Bacteria | 2871 |
| 560 | Ga0451793_0693788 | 3300041452 | Bacteria | 1007 |
| 561 | Ga0451833_0174897 | 3300041491 | Bacteria | 1088 |
| 562 | Ga0451833_0980981 | 3300041491 | Bacteria | 18627 |
| 563 | Ga0451837_0024633 | 3300041494 | Bacteria | 903 |
| 564 | Ga0451837_0461301 | 3300041494 | Bacteria | 1134 |
| 565 | Ga0451837_0642774 | 3300041494 | Bacteria | 1595 |
| 566 | Ga0451839_0935720 | 3300041496 | Bacteria | 1030 |
| 567 | Ga0451853_1172145 | 3300041512 | Bacteria | 4998 |
| 568 | Ga0439431_0003253 | 3300041997 | Bacteria | 3574 |
| 569 | Ga0439445_0045252 | 3300042004 | Bacteria | 1177 |
| 570 | Ga0439445_0086332 | 3300042004 | Bacteria | 881 |
| 571 | Ga0439448_0011399 | 3300042005 | Bacteria | 2649 |
| 572 | Ga0439449_0083999 | 3300042007 | Bacteria | 1175 |
| 573 | Ga0450900_020589 | 3300042136 | Bacteria | 917 |
| 574 | Ga0450906_044534 | 3300042145 | Bacteria | 783 |
| 575 | Ga0439446_0060257 | 3300042156 | Bacteria | 1146 |
| 576 | Ga0439434_0014704 | 3300042435 | Bacteria | 2329 |
| 577 | Ga0439434_0067714 | 3300042435 | Bacteria | 1121 |
| 578 | Ga0439444_0065800 | 3300042437 | Bacteria | 766 |
| 579 | Ga0439459_0016576 | 3300042438 | Bacteria | 1363 |
| 580 | Ga0439464_0045019 | 3300042439 | Bacteria | 1265 |
| 581 | Ga0439464_0067917 | 3300042439 | Bacteria | 1051 |
| 582 | Ga0450901_015447 | 3300042533 | Bacteria | 803 |
| 583 | Ga0439440_0058435 | 3300042993 | Bacteria | 979 |
| 584 | Ga0466969_0004974 | 3300044656 | Bacteria | 7078 |
| 585 | Ga0466972_0006814 | 3300044658 | Bacteria | 5734 |
| 586 | Ga0466972_0073504 | 3300044658 | Bacteria | 1629 |
| 587 | Ga0466972_0158867 | 3300044658 | Bacteria | 1062 |
| 588 | Ga0466965_0000715 | 3300044683 | Bacteria | 12381 |
| 589 | Ga0466965_0014544 | 3300044683 | Bacteria | 3726 |
| 590 | Ga0466965_0042983 | 3300044683 | Bacteria | 2230 |
| 591 | Ga0466965_0051519 | 3300044683 | Bacteria | 2042 |
| 592 | Ga0466965_0060335 | 3300044683 | Bacteria | 1894 |
| 593 | Ga0466965_0083675 | 3300044683 | Bacteria | 1615 |
| 594 | Ga0466966_0096465 | 3300044684 | Bacteria | 1831 |
| 595 | Ga0466961_0023968 | 3300044693 | Bacteria | 3926 |
| 596 | Ga0466961_0045577 | 3300044693 | Bacteria | 2806 |
| 597 | Ga0466961_0045889 | 3300044693 | Bacteria | 2795 |
| 598 | Ga0466961_0074072 | 3300044693 | Bacteria | 2159 |
| 599 | Ga0466961_0106584 | 3300044693 | Bacteria | 1764 |
| 600 | Ga0466963_0031776 | 3300044694 | Bacteria | 3414 |
| 601 | Ga0466963_0056663 | 3300044694 | Bacteria | 2608 |
| 602 | Ga0466963_0144692 | 3300044694 | Bacteria | 1648 |
| 603 | Ga0466963_0165131 | 3300044694 | Bacteria | 1542 |
| 604 | Ga0466963_0205237 | 3300044694 | Bacteria | 1378 |
| 605 | Ga0466963_0270707 | 3300044694 | Bacteria | 1193 |
| 606 | Ga0466964_0012185 | 3300044706 | Bacteria | 3252 |
| 607 | Ga0466964_0040086 | 3300044706 | Bacteria | 1890 |
| 608 | Ga0466964_0054730 | 3300044706 | Bacteria | 1646 |
| 609 | Ga0466964_0094985 | 3300044706 | Bacteria | 1304 |
| 610 | Ga0466964_0140602 | 3300044706 | Bacteria | 1109 |
| 611 | Ga0466971_0006890 | 3300044719 | Bacteria | 4939 |
| 612 | Ga0466971_0023338 | 3300044719 | Bacteria | 2757 |
| 613 | Ga0466971_0085650 | 3300044719 | Bacteria | 1440 |
| 614 | Ga0466971_0088160 | 3300044719 | Bacteria | 1419 |
| 615 | Ga0466970_0011013 | 3300044765 | Bacteria | 4602 |
| 616 | Ga0466970_0031983 | 3300044765 | Bacteria | 2780 |
| 617 | Ga0466970_0039169 | 3300044765 | Bacteria | 2515 |
| 618 | Ga0466970_0062138 | 3300044765 | Bacteria | 2002 |
| 619 | Ga0466970_0076867 | 3300044765 | Bacteria | 1799 |
| 620 | Ga0466970_0083319 | 3300044765 | Bacteria | 1730 |
| 621 | Ga0466970_0099732 | 3300044765 | Bacteria | 1581 |
| 622 | Ga0466970_0125925 | 3300044765 | Bacteria | 1405 |
| 623 | Ga0466957_0004703 | 3300044842 | Bacteria | 7638 |
| 624 | Ga0466957_0012592 | 3300044842 | Bacteria | 4897 |
| 625 | Ga0466957_0040548 | 3300044842 | Bacteria | 2812 |
| 626 | Ga0466957_0099303 | 3300044842 | Bacteria | 1833 |
| 627 | Ga0466957_0155370 | 3300044842 | Bacteria | 1482 |
| 628 | Ga0466960_0006811 | 3300044901 | Bacteria | 4604 |
| 629 | Ga0466960_0007895 | 3300044901 | Bacteria | 4342 |
| 630 | Ga0466960_0018740 | 3300044901 | Bacteria | 3038 |
| 631 | Ga0466960_0030358 | 3300044901 | Bacteria | 2486 |
| 632 | Ga0466960_0050125 | 3300044901 | Bacteria | 2012 |
| 633 | Ga0466960_0069199 | 3300044901 | Bacteria | 1753 |
| 634 | Ga0466960_0133137 | 3300044901 | Bacteria | 1314 |
| 635 | Ga0466959_0034787 | 3300045049 | Bacteria | 3726 |
| 636 | Ga0466959_0171656 | 3300045049 | Bacteria | 1521 |
| 637 | Ga0466959_0199916 | 3300045049 | Bacteria | 1392 |
| 638 | Ga0466959_0358284 | 3300045049 | Bacteria | 994 |
| 639 | Ga0466958_0051704 | 3300045836 | Bacteria | 2488 |
| 640 | Ga0466958_0058011 | 3300045836 | Bacteria | 2353 |
| 641 | Ga0466958_0079928 | 3300045836 | Bacteria | 2011 |
| 642 | Ga0466958_0230199 | 3300045836 | Bacteria | 1183 |
| 643 | Ga0466958_0416115 | 3300045836 | Bacteria | 869 |
| 644 | Ga0466967_0028650 | 3300045976 | Bacteria | 4652 |
| 645 | Ga0466967_0036868 | 3300045976 | Bacteria | 4178 |
| 646 | Ga0466967_0063164 | 3300045976 | Bacteria | 3289 |
| 647 | Ga0466967_0066702 | 3300045976 | Bacteria | 3207 |
| 648 | Ga0466967_0118561 | 3300045976 | Bacteria | 2441 |
| 649 | Ga0466967_0186317 | 3300045976 | Bacteria | 1960 |
| 650 | Ga0466967_0265494 | 3300045976 | Bacteria | 1643 |
| 651 | Ga0466967_0341839 | 3300045976 | Bacteria | 1447 |
| 652 | Ga0466967_0368228 | 3300045976 | Bacteria | 1393 |
| 653 | Ga0466967_0569989 | 3300045976 | Bacteria | 1115 |
| 654 | Ga0466967_0833640 | 3300045976 | Bacteria | 916 |
| 655 | Ga0495629_0050899 | 3300046459 | Bacteria | 2900 |
| 656 | Ga0495629_0199999 | 3300046459 | Bacteria | 1382 |
| 657 | Ga0495629_0276139 | 3300046459 | Bacteria | 1154 |
| 658 | Ga0495641_0086934 | 3300046461 | Bacteria | 1399 |
| 659 | Ga0495582_0300383 | 3300046473 | Bacteria | 923 |
| 660 | Ga0495664_0043871 | 3300046477 | Bacteria | 2650 |
| 661 | Ga0495608_0172045 | 3300046511 | Bacteria | 1373 |
| 662 | Ga0495620_0039685 | 3300046515 | Bacteria | 2078 |
| 663 | Ga0495631_0037959 | 3300046518 | Bacteria | 2144 |
| 664 | Ga0495663_0028687 | 3300046525 | Bacteria | 1639 |
| 665 | Ga0495598_0118933 | 3300046537 | Bacteria | 894 |
| 666 | Ga0495645_0137243 | 3300046543 | Bacteria | 1710 |
| 667 | Ga0495656_0037182 | 3300046615 | Bacteria | 2009 |
| 668 | Ga0495611_0071346 | 3300046648 | Bacteria | 1588 |
| 669 | Ga0495625_0112505 | 3300046660 | Bacteria | 1860 |
| 670 | Ga0495635_0252042 | 3300046663 | Bacteria | 1190 |
| 671 | Ga0495661_0362075 | 3300046665 | Bacteria | 712 |
| 672 | Ga0495657_0093679 | 3300046675 | Bacteria | 1922 |
| 673 | Ga0495658_0487952 | 3300046683 | Bacteria | 788 |
| 674 | Ga0495671_0035510 | 3300046692 | Bacteria | 2531 |
| 675 | Ga0495674_0287465 | 3300047319 | Bacteria | 1346 |
| 676 | Ga0495672_0099162 | 3300047320 | Bacteria | 1584 |
| 677 | Ga0496100_0172820 | 3300048903 | Bacteria | 1557 |
| 678 | Ga0496100_0338063 | 3300048903 | Bacteria | 1135 |
| 679 | Ga0496100_0410825 | 3300048903 | Bacteria | 1032 |
| 680 | Ga0496100_0552489 | 3300048903 | Bacteria | 891 |
| 681 | Ga0496100_0668790 | 3300048903 | Bacteria | 809 |
| 682 | Ga0496100_0716923 | 3300048903 | Bacteria | 781 |
| 683 | Ga0496101_0007043 | 3300048904 | Bacteria | 7267 |
| 684 | Ga0496101_0168525 | 3300048904 | Bacteria | 1682 |
| 685 | Ga0496102_0026937 | 3300048905 | Bacteria | 5132 |
| 686 | Ga0496102_0073936 | 3300048905 | Bacteria | 3132 |
| 687 | Ga0496102_0185161 | 3300048905 | Bacteria | 1962 |
| 688 | Ga0496102_0348671 | 3300048905 | Bacteria | 1394 |
| 689 | Ga0496102_1088851 | 3300048905 | Bacteria | 719 |
| 690 | Ga0496103_0030095 | 3300048906 | Bacteria | 3302 |
| 691 | Ga0496103_0043837 | 3300048906 | Bacteria | 2755 |
| 692 | Ga0496104_0010288 | 3300048907 | Bacteria | 8353 |
| 693 | Ga0496104_0271503 | 3300048907 | Bacteria | 1608 |
| 694 | Ga0496105_0000828 | 3300048908 | Bacteria | 21030 |
| 695 | Ga0496105_0094817 | 3300048908 | Bacteria | 2465 |
| 696 | Ga0496105_0180101 | 3300048908 | Bacteria | 1731 |
| 697 | Ga0496106_0076410 | 3300048909 | Bacteria | 2567 |
| 698 | Ga0496106_0202027 | 3300048909 | Bacteria | 1582 |
| 699 | Ga0496106_0209480 | 3300048909 | Bacteria | 1552 |
| 700 | Ga0496107_0027700 | 3300048910 | Bacteria | 4024 |
| 701 | Ga0496107_0080851 | 3300048910 | Bacteria | 2370 |
| 702 | Ga0496107_0089094 | 3300048910 | Bacteria | 2253 |
| 703 | Ga0496107_0091736 | 3300048910 | Bacteria | 2220 |
| 704 | Ga0496107_0249265 | 3300048910 | Bacteria | 1321 |
| 705 | Ga0496108_0020531 | 3300048911 | Bacteria | 5429 |
| 706 | Ga0496108_0027320 | 3300048911 | Bacteria | 4711 |
| 707 | Ga0496108_0187241 | 3300048911 | Bacteria | 1793 |
| 708 | Ga0496108_0272194 | 3300048911 | Bacteria | 1474 |
| 709 | Ga0496108_0337611 | 3300048911 | Bacteria | 1314 |
| 710 | Ga0496108_0415330 | 3300048911 | Bacteria | 1175 |
| 711 | Ga0496108_0478945 | 3300048911 | Bacteria | 1087 |
| 712 | Ga0496108_0608482 | 3300048911 | Bacteria | 952 |
| 713 | Ga0496108_0651894 | 3300048911 | Bacteria | 915 |
| 714 | Ga0496109_0018653 | 3300048912 | Bacteria | 6097 |
| 715 | Ga0496109_0073656 | 3300048912 | Bacteria | 3138 |
| 716 | Ga0496109_0214887 | 3300048912 | Bacteria | 1808 |
| 717 | Ga0496109_0217443 | 3300048912 | Bacteria | 1797 |
| 718 | Ga0496109_0307077 | 3300048912 | Bacteria | 1496 |
| 719 | Ga0496109_0344945 | 3300048912 | Bacteria | 1406 |
| 720 | Ga0496109_0403788 | 3300048912 | Bacteria | 1291 |
| 721 | Ga0496109_0708011 | 3300048912 | Bacteria | 944 |
| 722 | Ga0496110_0010462 | 3300048913 | Bacteria | 7547 |
| 723 | Ga0496110_0016485 | 3300048913 | Bacteria | 6171 |
| 724 | Ga0496110_0023038 | 3300048913 | Bacteria | 5295 |
| 725 | Ga0496110_0051176 | 3300048913 | Bacteria | 3630 |
| 726 | Ga0496110_0070304 | 3300048913 | Bacteria | 3101 |
| 727 | Ga0496110_0150551 | 3300048913 | Bacteria | 2107 |
| 728 | Ga0496110_0163642 | 3300048913 | Bacteria | 2017 |
| 729 | Ga0496110_0298723 | 3300048913 | Bacteria | 1467 |
| 730 | Ga0496110_0491141 | 3300048913 | Bacteria | 1118 |
| 731 | Ga0496110_0609190 | 3300048913 | Bacteria | 990 |
| 732 | Ga0496110_0730994 | 3300048913 | Bacteria | 892 |
| 733 | Ga0496111_0004558 | 3300048914 | Bacteria | 8771 |
| 734 | Ga0496111_0171270 | 3300048914 | Bacteria | 1613 |
| 735 | Ga0496111_0176670 | 3300048914 | Bacteria | 1587 |
| 736 | Ga0496113_0038066 | 3300048916 | Bacteria | 3534 |
| 737 | Ga0496113_0203636 | 3300048916 | Bacteria | 1573 |
| 738 | Ga0496114_0073154 | 3300048917 | Bacteria | 2884 |
| 739 | Ga0496114_0075967 | 3300048917 | Bacteria | 2830 |
| 740 | Ga0496114_0156235 | 3300048917 | Bacteria | 1981 |
| 741 | Ga0496114_0161920 | 3300048917 | Bacteria | 1946 |
| 742 | Ga0496114_0205189 | 3300048917 | Bacteria | 1727 |
| 743 | Ga0496114_0238270 | 3300048917 | Bacteria | 1599 |
| 744 | Ga0496114_0246143 | 3300048917 | Bacteria | 1573 |
| 745 | Ga0496114_0398031 | 3300048917 | Bacteria | 1219 |
| 746 | Ga0496115_0171416 | 3300048918 | Bacteria | 1795 |
| 747 | Ga0496115_0199029 | 3300048918 | Bacteria | 1655 |
| 748 | Ga0496115_0265333 | 3300048918 | Bacteria | 1411 |
| 749 | Ga0496123_0035970 | 3300048926 | Bacteria | 3520 |
| 750 | Ga0496124_0113527 | 3300048927 | Bacteria | 2177 |
| 751 | Ga0496124_0305091 | 3300048927 | Bacteria | 1148 |
| 752 | Ga0496126_0522406 | 3300048929 | Bacteria | 946 |
| 753 | Ga0501309_006033 | 3300049129 | Bacteria | 1464 |
| 754 | Ga0501291_014751 | 3300049514 | Bacteria | 1173 |
| 755 | Ga0501292_018768 | 3300049515 | Bacteria | 1103 |
| 756 | Ga0501311_007414 | 3300049527 | Bacteria | 1263 |
| 757 | Ga0501317_018173 | 3300049533 | Bacteria | 928 |
| 758 | Ga0501318_002331 | 3300049534 | Bacteria | 1630 |
| 759 | Ga0501318_005817 | 3300049534 | Bacteria | 1238 |
| 760 | Ga0501320_013627 | 3300049536 | Bacteria | 870 |
| 761 | Ga0501321_019551 | 3300049537 | Bacteria | 831 |
| 762 | Ga0501321_020191 | 3300049537 | Bacteria | 822 |
| 763 | Ga0501321_021118 | 3300049537 | Bacteria | 810 |
| 764 | Ga0501325_002852 | 3300049541 | Bacteria | 1218 |
| 765 | Ga0501340_007031 | 3300049556 | Bacteria | 767 |
| 766 | Ga0501031_0000284 | 3300049568 | Bacteria | 28782 |
| 767 | Ga0501031_0041389 | 3300049568 | Bacteria | 3008 |
| 768 | Ga0501031_0045485 | 3300049568 | Bacteria | 2864 |
| 769 | Ga0501031_0064199 | 3300049568 | Bacteria | 2391 |
| 770 | Ga0501031_0070490 | 3300049568 | Bacteria | 2277 |
| 771 | Ga0501031_0104293 | 3300049568 | Bacteria | 1850 |
| 772 | Ga0501031_0199641 | 3300049568 | Bacteria | 1305 |
| 773 | Ga0501032_0035238 | 3300049569 | Bacteria | 3423 |
| 774 | Ga0501032_0036474 | 3300049569 | Bacteria | 3355 |
| 775 | Ga0501032_0074874 | 3300049569 | Bacteria | 2255 |
| 776 | Ga0501033_0024516 | 3300049570 | Bacteria | 4550 |
| 777 | Ga0501033_0145436 | 3300049570 | Bacteria | 1712 |
| 778 | Ga0501034_0036001 | 3300049571 | Bacteria | 5017 |
| 779 | Ga0501034_0069400 | 3300049571 | Bacteria | 3535 |
| 780 | Ga0501034_0179088 | 3300049571 | Bacteria | 2085 |
| 781 | Ga0501034_0366875 | 3300049571 | Bacteria | 1366 |
| 782 | Ga0501036_0000192 | 3300049572 | Bacteria | 40581 |
| 783 | Ga0501036_0008414 | 3300049572 | Bacteria | 8453 |
| 784 | Ga0501036_0026550 | 3300049572 | Bacteria | 4889 |
| 785 | Ga0501036_0043265 | 3300049572 | Bacteria | 3813 |
| 786 | Ga0501036_0166958 | 3300049572 | Bacteria | 1855 |
| 787 | Ga0501036_0275370 | 3300049572 | Bacteria | 1409 |
| 788 | Ga0501036_0354079 | 3300049572 | Bacteria | 1226 |
| 789 | Ga0501036_0446756 | 3300049572 | Bacteria | 1077 |
| 790 | Ga0501037_0000320 | 3300049573 | Bacteria | 40774 |
| 791 | Ga0501037_0073997 | 3300049573 | Bacteria | 2476 |
| 792 | Ga0501037_0233211 | 3300049573 | Bacteria | 1292 |
| 793 | Ga0501038_0000986 | 3300049574 | Bacteria | 25579 |
| 794 | Ga0501038_0001648 | 3300049574 | Bacteria | 20798 |
| 795 | Ga0501038_0058470 | 3300049574 | Bacteria | 3306 |
| 796 | Ga0501038_0059513 | 3300049574 | Bacteria | 3272 |
| 797 | Ga0501038_0574711 | 3300049574 | Bacteria | 855 |
| 798 | Ga0501039_0004248 | 3300049575 | Bacteria | 10782 |
| 799 | Ga0501039_0020283 | 3300049575 | Bacteria | 5094 |
| 800 | Ga0501039_0083380 | 3300049575 | Bacteria | 2489 |
| 801 | Ga0501039_0116782 | 3300049575 | Bacteria | 2089 |
| 802 | Ga0501039_0126406 | 3300049575 | Bacteria | 2005 |
| 803 | Ga0501039_0402396 | 3300049575 | Bacteria | 1075 |
| 804 | Ga0501039_0533042 | 3300049575 | Bacteria | 921 |
| 805 | Ga0501039_0651524 | 3300049575 | Bacteria | 825 |
| 806 | Ga0501040_0006704 | 3300049576 | Bacteria | 7468 |
| 807 | Ga0501040_0021720 | 3300049576 | Bacteria | 4291 |
| 808 | Ga0501040_0119259 | 3300049576 | Bacteria | 1850 |
| 809 | Ga0501040_0147577 | 3300049576 | Bacteria | 1658 |
| 810 | Ga0501040_0154553 | 3300049576 | Bacteria | 1620 |
| 811 | Ga0501040_0163884 | 3300049576 | Bacteria | 1572 |
| 812 | Ga0501040_0401013 | 3300049576 | Bacteria | 985 |
| 813 | Ga0501040_0579438 | 3300049576 | Bacteria | 810 |
| 814 | Ga0501040_0607908 | 3300049576 | Bacteria | 790 |
| 815 | Ga0501041_0035721 | 3300049577 | Bacteria | 3011 |
| 816 | Ga0501041_0083725 | 3300049577 | Bacteria | 1966 |
| 817 | Ga0501041_0104887 | 3300049577 | Bacteria | 1751 |
| 818 | Ga0501041_0277022 | 3300049577 | Bacteria | 1055 |
| 819 | Ga0501042_0012330 | 3300049578 | Bacteria | 5786 |
| 820 | Ga0501042_0016910 | 3300049578 | Bacteria | 5018 |
| 821 | Ga0501042_0107411 | 3300049578 | Bacteria | 2009 |
| 822 | Ga0501043_0004616 | 3300049579 | Bacteria | 11173 |
| 823 | Ga0501043_0036133 | 3300049579 | Bacteria | 3886 |
| 824 | Ga0501043_0111139 | 3300049579 | Bacteria | 2151 |
| 825 | Ga0501043_0136150 | 3300049579 | Bacteria | 1924 |
| 826 | Ga0501046_0000647 | 3300049580 | Bacteria | 34013 |
| 827 | Ga0501047_0008114 | 3300049581 | Bacteria | 9907 |
| 828 | Ga0501047_0013895 | 3300049581 | Bacteria | 7645 |
| 829 | Ga0501048_0000386 | 3300049582 | Bacteria | 30662 |
| 830 | Ga0501048_0024322 | 3300049582 | Bacteria | 4422 |
| 831 | Ga0501048_0167883 | 3300049582 | Bacteria | 1554 |
| 832 | Ga0501048_0201900 | 3300049582 | Bacteria | 1409 |
| 833 | Ga0501048_0408602 | 3300049582 | Bacteria | 971 |
| 834 | Ga0501067_0031418 | 3300049583 | Bacteria | 2946 |
| 835 | Ga0501067_0045352 | 3300049583 | Bacteria | 2441 |
| 836 | Ga0501067_0062048 | 3300049583 | Bacteria | 2069 |
| 837 | Ga0501067_0082480 | 3300049583 | Bacteria | 1783 |
| 838 | Ga0501067_0111025 | 3300049583 | Bacteria | 1524 |
| 839 | Ga0501067_0127907 | 3300049583 | Bacteria | 1413 |
| 840 | Ga0501067_0181382 | 3300049583 | Bacteria | 1173 |
| 841 | Ga0501067_0192579 | 3300049583 | Bacteria | 1136 |
| 842 | Ga0501068_0027731 | 3300049584 | Bacteria | 3345 |
| 843 | Ga0501068_0027915 | 3300049584 | Bacteria | 3335 |
| 844 | Ga0501068_0060059 | 3300049584 | Bacteria | 2308 |
| 845 | Ga0501068_0078144 | 3300049584 | Bacteria | 2027 |
| 846 | Ga0501068_0137703 | 3300049584 | Bacteria | 1529 |
| 847 | Ga0501068_0187145 | 3300049584 | Bacteria | 1310 |
| 848 | Ga0501069_0000907 | 3300049585 | Bacteria | 14132 |
| 849 | Ga0501069_0007049 | 3300049585 | Bacteria | 5886 |
| 850 | Ga0501069_0082447 | 3300049585 | Bacteria | 1812 |
| 851 | Ga0501069_0086255 | 3300049585 | Bacteria | 1772 |
| 852 | Ga0501069_0113884 | 3300049585 | Bacteria | 1542 |
| 853 | Ga0501069_0137048 | 3300049585 | Bacteria | 1403 |
| 854 | Ga0501069_0202190 | 3300049585 | Bacteria | 1151 |
| 855 | Ga0501070_0000203 | 3300049586 | Bacteria | 55882 |
| 856 | Ga0501070_0000968 | 3300049586 | Bacteria | 25770 |
| 857 | Ga0501070_0001766 | 3300049586 | Bacteria | 19131 |
| 858 | Ga0501070_0002280 | 3300049586 | Bacteria | 16871 |
| 859 | Ga0501070_0015846 | 3300049586 | Bacteria | 6337 |
| 860 | Ga0501070_0051310 | 3300049586 | Bacteria | 3425 |
| 861 | Ga0501070_0057010 | 3300049586 | Bacteria | 3238 |
| 862 | Ga0501070_0184600 | 3300049586 | Bacteria | 1715 |
| 863 | Ga0501070_0427981 | 3300049586 | Bacteria | 1068 |
| 864 | Ga0501070_0453484 | 3300049586 | Bacteria | 1034 |
| 865 | Ga0501070_0664303 | 3300049586 | Bacteria | 826 |
| 866 | Ga0501071_0004926 | 3300049587 | Bacteria | 8522 |
| 867 | Ga0501071_0022463 | 3300049587 | Bacteria | 4397 |
| 868 | Ga0501071_0092716 | 3300049587 | Bacteria | 2220 |
| 869 | Ga0501071_0573777 | 3300049587 | Bacteria | 867 |
| 870 | Ga0501072_0013524 | 3300049588 | Bacteria | 6246 |
| 871 | Ga0501072_0014217 | 3300049588 | Bacteria | 6098 |
| 872 | Ga0501072_0033664 | 3300049588 | Bacteria | 4015 |
| 873 | Ga0501072_0049711 | 3300049588 | Bacteria | 3301 |
| 874 | Ga0501072_0059406 | 3300049588 | Bacteria | 3015 |
| 875 | Ga0501072_0124844 | 3300049588 | Bacteria | 2050 |
| 876 | Ga0501072_0380227 | 3300049588 | Bacteria | 1120 |
| 877 | Ga0501073_0005833 | 3300049589 | Bacteria | 9189 |
| 878 | Ga0501073_0006881 | 3300049589 | Bacteria | 8460 |
| 879 | Ga0501073_0032335 | 3300049589 | Bacteria | 3728 |
| 880 | Ga0501073_0043777 | 3300049589 | Bacteria | 3156 |
| 881 | Ga0501073_0095620 | 3300049589 | Bacteria | 2063 |
| 882 | Ga0501074_0003828 | 3300049590 | Bacteria | 10705 |
| 883 | Ga0501074_0018619 | 3300049590 | Bacteria | 5045 |
| 884 | Ga0501074_0162302 | 3300049590 | Bacteria | 1596 |
| 885 | Ga0501074_0172298 | 3300049590 | Bacteria | 1544 |
| 886 | Ga0501074_0188542 | 3300049590 | Bacteria | 1470 |
| 887 | Ga0501075_0014401 | 3300049591 | Bacteria | 5666 |
| 888 | Ga0501075_0050601 | 3300049591 | Bacteria | 3123 |
| 889 | Ga0501075_0327783 | 3300049591 | Bacteria | 1167 |
| 890 | Ga0501076_0006498 | 3300049592 | Bacteria | 8483 |
| 891 | Ga0501076_0042229 | 3300049592 | Bacteria | 3590 |
| 892 | Ga0501076_0109499 | 3300049592 | Bacteria | 2232 |
| 893 | Ga0501076_0229325 | 3300049592 | Bacteria | 1518 |
| 894 | Ga0501076_0370226 | 3300049592 | Bacteria | 1177 |
| 895 | Ga0501076_0603537 | 3300049592 | Bacteria | 905 |
| 896 | Ga0501077_0001085 | 3300049593 | Bacteria | 16408 |
| 897 | Ga0501077_0015049 | 3300049593 | Bacteria | 4863 |
| 898 | Ga0501077_0052451 | 3300049593 | Bacteria | 2590 |
| 899 | Ga0501077_0540963 | 3300049593 | Bacteria | 747 |
| 900 | Ga0501206_004491 | 3300049653 | Bacteria | 1774 |
| 901 | Ga0501207_047662 | 3300049654 | Bacteria | 759 |
| 902 | Ga0501243_040060 | 3300049675 | Bacteria | 821 |
| 903 | Ga0501259_047001 | 3300049688 | Bacteria | 866 |
| 904 | Ga0501261_033513 | 3300049690 | Bacteria | 785 |
| 905 | Ga0501079_0000589 | 3300049741 | Bacteria | 24044 |
| 906 | Ga0501079_0007427 | 3300049741 | Bacteria | 8294 |
| 907 | Ga0501079_0106826 | 3300049741 | Bacteria | 2172 |
| 908 | Ga0501079_0170974 | 3300049741 | Bacteria | 1694 |
| 909 | Ga0501079_0209582 | 3300049741 | Bacteria | 1522 |
| 910 | Ga0501079_0267742 | 3300049741 | Bacteria | 1336 |
| 911 | Ga0501079_0571900 | 3300049741 | Bacteria | 889 |
| 912 | Ga0501079_1042015 | 3300049741 | Bacteria | 644 |
| 913 | Ga0501080_0000164 | 3300049742 | Bacteria | 47786 |
| 914 | Ga0501080_0000167 | 3300049742 | Bacteria | 47734 |
| 915 | Ga0501080_0005860 | 3300049742 | Bacteria | 11000 |
| 916 | Ga0501080_0020271 | 3300049742 | Bacteria | 6153 |
| 917 | Ga0501080_0022736 | 3300049742 | Bacteria | 5808 |
| 918 | Ga0501080_0038316 | 3300049742 | Bacteria | 4476 |
| 919 | Ga0501080_0057800 | 3300049742 | Bacteria | 3610 |
| 920 | Ga0501080_0058672 | 3300049742 | Bacteria | 3582 |
| 921 | Ga0501080_0113979 | 3300049742 | Bacteria | 2506 |
| 922 | Ga0501080_0203623 | 3300049742 | Bacteria | 1816 |
| 923 | Ga0501080_0382630 | 3300049742 | Bacteria | 1268 |
| 924 | Ga0501081_0382957 | 3300049743 | Bacteria | 1040 |
| 925 | Ga0501081_0530758 | 3300049743 | Bacteria | 878 |
| 926 | Ga0501083_0012194 | 3300049744 | Bacteria | 6016 |
| 927 | Ga0501083_0089548 | 3300049744 | Bacteria | 2033 |
| 928 | Ga0501083_0114109 | 3300049744 | Bacteria | 1774 |
| 929 | Ga0501266_014402 | 3300049763 | Bacteria | 1036 |
| 930 | Ga0501035_0008456 | 3300049822 | Bacteria | 9587 |
| 931 | Ga0501035_0104471 | 3300049822 | Bacteria | 2484 |
| 932 | Ga0501035_0380781 | 3300049822 | Bacteria | 1177 |
| 933 | Ga0501035_0380806 | 3300049822 | Bacteria | 1177 |
| 934 | Ga0501044_0011052 | 3300049823 | Bacteria | 9792 |
| 935 | Ga0501044_0074849 | 3300049823 | Bacteria | 3439 |
| 936 | Ga0501044_0080354 | 3300049823 | Bacteria | 3303 |
| 937 | Ga0501045_0019694 | 3300049824 | Bacteria | 4814 |
| 938 | Ga0501045_0032214 | 3300049824 | Bacteria | 3798 |
| 939 | Ga0501045_0124139 | 3300049824 | Bacteria | 1917 |
| 940 | Ga0501045_0257295 | 3300049824 | Bacteria | 1299 |
| 941 | Ga0501045_0391427 | 3300049824 | Bacteria | 1034 |
| 942 | nmdc:mga03683_18082_c1 | 3300050489 | Bacteria | 2676 |
| 943 | nmdc:mga03n38_14513_c1 | 3300050490 | Bacteria | 3021 |
| 944 | nmdc:mga03n38_53825_c1 | 3300050490 | Bacteria | 1807 |
| 945 | nmdc:mga00v17_106534_c1 | 3300050491 | Bacteria | 1775 |
| 946 | nmdc:mga00v17_161776_c2 | 3300050491 | Bacteria | 1041 |
| 947 | nmdc:mga00v17_16796_c1 | 3300050491 | Bacteria | 4130 |
| 948 | nmdc:mga00v17_204065_c1 | 3300050491 | Bacteria | 1278 |
| 949 | nmdc:mga00v17_276050_c1 | 3300050491 | Bacteria | 1091 |
| 950 | nmdc:mga00v17_31718_c1 | 3300050491 | Bacteria | 3118 |
| 951 | nmdc:mga00v17_34082_c1 | 3300050491 | Bacteria | 3022 |
| 952 | nmdc:mga00v17_83346_c1 | 3300050491 | Bacteria | 2000 |
| 953 | nmdc:mga00v17_87190_c1 | 3300050491 | Bacteria | 1957 |
| 954 | nmdc:mga00v17_990_c1 | 3300050491 | Bacteria | 15177 |
| 955 | nmdc:mga0yw44_214612_c1 | 3300050492 | Bacteria | 1274 |
| 956 | nmdc:mga0yw44_262450_c1 | 3300050492 | Bacteria | 1151 |
| 957 | nmdc:mga0yw44_376812_c1 | 3300050492 | Bacteria | 958 |
| 958 | nmdc:mga0yw44_38510_c1 | 3300050492 | Bacteria | 1323 |
| 959 | nmdc:mga0yw44_40249_c1 | 3300050492 | Bacteria | 2776 |
| 960 | nmdc:mga0yw44_4297_c1 | 3300050492 | Bacteria | 6503 |
| 961 | nmdc:mga0yw44_48106_c1 | 3300050492 | Bacteria | 2571 |
| 962 | nmdc:mga0yw44_528450_c1 | 3300050492 | Bacteria | 801 |
| 963 | nmdc:mga0yw44_570_c2 | 3300050492 | Bacteria | 9097 |
| 964 | nmdc:mga0yw44_65633_c1 | 3300050492 | Bacteria | 2238 |
| 965 | nmdc:mga06z11_17729_c1 | 3300050494 | Bacteria | 3239 |
| 966 | nmdc:mga06z11_21636_c1 | 3300050494 | Bacteria | 2992 |
| 967 | nmdc:mga06z11_76388_c1 | 3300050494 | Bacteria | 1786 |
| 968 | nmdc:mga04h51_7896_c1 | 3300050495 | Bacteria | 2829 |
| 969 | nmdc:mga04h51_8493_c1 | 3300050495 | Bacteria | 2749 |
| 970 | nmdc:mga07m45_105263_c1 | 3300050496 | Bacteria | 1623 |
| 971 | nmdc:mga07m45_266936_c1 | 3300050496 | Bacteria | 996 |
| 972 | nmdc:mga07m45_38031_c1 | 3300050496 | Bacteria | 2685 |
| 973 | nmdc:mga05p37_121398_c1 | 3300050507 | Bacteria | 3210 |
| 974 | nmdc:mga05p37_152_c1 | 3300050507 | Bacteria | 65549 |
| 975 | nmdc:mga05p37_17900_c1 | 3300050507 | Bacteria | 8553 |
| 976 | nmdc:mga09592_17118_c1 | 3300050508 | Bacteria | 5935 |
| 977 | nmdc:mga09592_22327_c1 | 3300050508 | Bacteria | 5222 |
| 978 | nmdc:mga09592_30698_c1 | 3300050508 | Bacteria | 4473 |
| 979 | nmdc:mga0qj67_35146_c1 | 3300050509 | Bacteria | 3917 |
| 980 | nmdc:mga0qj67_61955_c1 | 3300050509 | Bacteria | 2971 |
| 981 | nmdc:mga06r32_273206_c1 | 3300050510 | Bacteria | 1678 |
| 982 | nmdc:mga06r32_30859_c1 | 3300050510 | Bacteria | 5030 |
| 983 | nmdc:mga06r32_5321_c1 | 3300050510 | Bacteria | 11588 |
| 984 | nmdc:mga06r32_7330_c1 | 3300050510 | Bacteria | 9929 |
| 985 | nmdc:mga08y16_206205_c1 | 3300050511 | Bacteria | 2037 |
| 986 | nmdc:mga08y16_30284_c1 | 3300050511 | Bacteria | 5698 |
| 987 | nmdc:mga08y16_363106_c1 | 3300050511 | Bacteria | 1487 |
| 988 | nmdc:mga08y16_69744_c1 | 3300050511 | Bacteria | 3665 |
| 989 | nmdc:mga0n895_14912_c1 | 3300050512 | Bacteria | 7077 |
| 990 | nmdc:mga0n895_5553_c1 | 3300050512 | Bacteria | 10559 |
| 991 | nmdc:mga0rr50_22665_c1 | 3300050513 | Bacteria | 4315 |
| 992 | nmdc:mga0rr50_67628_c1 | 3300050513 | Bacteria | 2715 |
| 993 | nmdc:mga08x19_17228_c1 | 3300050514 | Bacteria | 4418 |
| 994 | nmdc:mga0a205_18587_c1 | 3300050515 | Bacteria | 6539 |
| 995 | nmdc:mga0a205_312201_c1 | 3300050515 | Bacteria | 1444 |
| 996 | nmdc:mga0a205_50188_c1 | 3300050515 | Bacteria | 4028 |
| 997 | Ga0495601_0053680 | 3300053077 | Bacteria | 2548 |
| 998 | Ga0495601_0634824 | 3300053077 | Bacteria | 684 |
| 999 | Ga0495655_0013293 | 3300053083 | Bacteria | 1700 |
| 1000 | Ga0495655_0041913 | 3300053083 | Bacteria | 1173 |
| 1001 | Ga0495655_0064855 | 3300053083 | Bacteria | 1006 |
| 1002 | Ga0495595_0147823 | 3300053084 | Bacteria | 1155 |
| 1003 | Ga0495619_0165813 | 3300053085 | Bacteria | 1527 |
| 1004 | Ga0495619_0585410 | 3300053085 | Bacteria | 764 |
| 1005 | Ga0500644_0000315 | 3300053088 | Bacteria | 25229 |
| 1006 | Ga0500644_0086632 | 3300053088 | Bacteria | 1163 |
| 1007 | Ga0500556_0003839 | 3300053104 | Bacteria | 4357 |
| 1008 | Ga0500593_000520 | 3300053117 | Bacteria | 15117 |
| 1009 | Ga0501084_0000986 | 3300054114 | Bacteria | 22070 |
| 1010 | Ga0501084_0011987 | 3300054114 | Bacteria | 7178 |
| 1011 | Ga0501084_0128079 | 3300054114 | Bacteria | 2137 |
| 1012 | Ga0501084_0137293 | 3300054114 | Bacteria | 2058 |
| 1013 | Ga0501084_0242135 | 3300054114 | Bacteria | 1522 |
| 1014 | Ga0501084_0425008 | 3300054114 | Bacteria | 1123 |
| 1015 | Ga0590074_006702 | 3300059423 | Bacteria | 1912 |
| 1016 | Ga0590077_059480 | 3300059426 | Bacteria | 865 |
| 1017 | Ga0587070_024178 | 3300059491 | Bacteria | 1049 |
| 1018 | Ga0587077_068551 | 3300059493 | Bacteria | 787 |
| 1019 | Ga0587080_009073 | 3300059503 | Bacteria | 1439 |
| 1020 | Ga0587082_002271 | 3300059504 | Bacteria | 2143 |
| 1021 | Ga0587082_011037 | 3300059504 | Bacteria | 1314 |
| 1022 | Ga0587088_055290 | 3300059508 | Bacteria | 789 |
| 1023 | Ga0587091_021534 | 3300059511 | Bacteria | 1130 |
| 1024 | Ga0587098_004846 | 3300059604 | Bacteria | 1291 |
| 1025 | Ga0587098_023925 | 3300059604 | Bacteria | 797 |
| 1026 | Ga0587122_001650 | 3300059628 | Bacteria | 1494 |
| 1027 | Ga0587067_058603 | 3300059640 | Bacteria | 800 |
| 1028 | Ga0587111_0055707 | 3300060346 | Bacteria | 885 |
| 1029 | Ga0501082_0095839 | 3300060353 | Bacteria | 2565 |
| 1030 | Ga0501082_0096953 | 3300060353 | Bacteria | 2549 |
| 1031 | Ga0501082_0097008 | 3300060353 | Bacteria | 2548 |
| 1032 | Ga0501082_0163559 | 3300060353 | Bacteria | 1934 |
| 1033 | Ga0501082_0385222 | 3300060353 | Bacteria | 1223 |
| 1034 | Ga0466962_0005850 | 3300061719 | Bacteria | 5910 |
| 1035 | Ga0466962_0017971 | 3300061719 | Bacteria | 3403 |
| 1036 | Ga0466962_0114975 | 3300061719 | Bacteria | 1296 |
| 1037 | Ga0466962_0157030 | 3300061719 | Bacteria | 1105 |
| 1038 | Ga0530510_0037409 | 3300061734 | Bacteria | 3499 |
| 1039 | Ga0530510_0170303 | 3300061734 | Bacteria | 1613 |
| 1040 | Ga0530510_0218603 | 3300061734 | Bacteria | 1416 |
| 1041 | Ga0530510_0351509 | 3300061734 | Bacteria | 1107 |
| 1042 | 2643828099 | 2643221561 | Bacteria | 4984412 |
| 1043 | 2643892431 | 2643221576 | Bacteria | 5214352 |
| 1044 | 2643961483 | 2643221590 | Bacteria | 5214697 |
| 1045 | 2644032418 | 2643221604 | Bacteria | 5014917 |
| 1046 | 2644090744 | 2643221615 | Bacteria | 5487866 |
| 1047 | 2644102693 | 2643221617 | Bacteria | 5139111 |
| 1048 | 2644118355 | 2643221620 | Bacteria | 5134593 |
| 1049 | 2644231290 | 2643221641 | Bacteria | 4490190 |
| 1050 | 2644320548 | 2643221657 | Bacteria | 5490246 |
| 1051 | 2644458093 | 2643221681 | Bacteria | 3707866 |
| 1052 | 2644531188 | 2643221696 | Bacteria | 5431823 |
| 1053 | 2644536910 | 2643221697 | Bacteria | 3575694 |
| 1054 | 2645722973 | 2643221961 | Bacteria | 3919167 |
| 1055 | 2645725928 | 2643221962 | Bacteria | 3874254 |
| 1056 | 2738870596 | 2738541305 | Bacteria | 4910150 |
| 1057 | 2740166617 | 2739367898 | Bacteria | 4367674 |
| 1058 | 2774393802 | 2773857762 | Bacteria | 5971770 |
| 1059 | 2809195323 | 2808606439 | Bacteria | 5952208 |
| 1060 | 2812334122 | 2811994874 | Bacteria | 5367947 |
| 1061 | 2812350197 | 2811994878 | Bacteria | 5992952 |
| 1062 | 2816424504 | 2816332119 | Bacteria | 8120218 |
| 1063 | 2837272420 | 2837268691 | Bacteria | 7850704 |
| 1064 | 2855387440 | 2855386786 | Bacteria | 4752232 |
| 1065 | 2857482790 | 2857481737 | Bacteria | 4761446 |
| 1066 | 2868093020 | 2868088558 | Bacteria | 7609351 |
| 1067 | 2883823567 | 2883821847 | Bacteria | 5121194 |
| 1068 | 2891972178 | 2891968417 | Bacteria | 5821697 |
| 1069 | 2984577142 | 2984576629 | Bacteria | 4248407 |
| 1070 | 2984594157 | 2984592036 | Bacteria | 3670284 |
| 1071 | 2990260463 | 2990256926 | Bacteria | 4252839 |
| 1072 | 8054612348 | 8054609563 | Bacteria | 5170090 |
| 1073 | Ga0068851_10238800 | |||
| 1074 | LJQas_1003330 | |||
| 1075 | JGI24740J21852_10017617 | |||
| 1076 | JGI24740J21852_10027305 | |||
| 1077 | JGI24739J22299_10049588 | |||
| 1078 | JGI24739J22299_10059109 | |||
| 1079 | JGI24737J22298_10009059 | |||
| 1080 | JGI24737J22298_10013219 | |||
| 1081 | JGI24737J22298_10030320 | |||
| 1082 | JGI24735J21928_10012771 | |||
| 1083 | JGI24735J21928_10020398 | |||
| 1084 | JGI24735J21928_10073763 | |||
| 1085 | JGI24750J21931_1005874 | |||
| 1086 | JGI24738J21930_10006440 | |||
| 1087 | JGI24738J21930_10026683 | |||
| 1088 | JGI24744J21845_10000532 | |||
| 1089 | JGI24033J26618_1009029 | |||
| 1090 | JGI24034J26672_10060791 | |||
| 1091 | JGI25406J46586_10073885 | |||
| 1092 | Ga0006562J51391_1005843 | |||
| 1093 | Ga0007429J51699_1066760 | |||
| 1094 | JGI25405J52794_10006714 | |||
| 1095 | Ga0058861_10077169 | |||
| 1096 | Ga0070658_10108982 | |||
| 1097 | Ga0070658_10227262 | |||
| 1098 | Ga0070658_10352458 | |||
| 1099 | Ga0070658_10772361 | |||
| 1100 | Ga0070683_100013995 | |||
| 1101 | Ga0070683_100421979 | |||
| 1102 | Ga0070683_100509705 | |||
| 1103 | Ga0070670_100329110 | |||
| 1104 | Ga0068869_100679547 | |||
| 1105 | Ga0070682_100018717 | |||
| 1106 | Ga0070682_100030160 | |||
| 1107 | Ga0070682_100170585 | |||
| 1108 | Ga0070682_100374739 | |||
| 1109 | Ga0070682_100526426 | |||
| 1110 | Ga0068868_100060199 | |||
| 1111 | Ga0068868_100098699 | |||
| 1112 | Ga0068868_100124901 | |||
| 1113 | Ga0068868_100773024 | |||
| 1114 | Ga0070660_100003302 | |||
| 1115 | Ga0070660_100184551 | |||
| 1116 | Ga0070691_10088917 | |||
| 1117 | Ga0070687_100033972 | |||
| 1118 | Ga0070687_100571102 | |||
| 1119 | Ga0070661_100424249 | |||
| 1120 | Ga0070692_10020197 | |||
| 1121 | Ga0070692_10243024 | |||
| 1122 | Ga0070668_100060257 | |||
| 1123 | Ga0070668_100098969 | |||
| 1124 | Ga0070668_100101103 | |||
| 1125 | Ga0070668_100116637 | |||
| 1126 | Ga0070668_100226633 | |||
| 1127 | Ga0070668_100295250 | |||
| 1128 | Ga0070668_100761591 | |||
| 1129 | Ga0070669_100464871 | |||
| 1130 | Ga0070674_100060173 | |||
| 1131 | Ga0070674_100066817 | |||
| 1132 | Ga0070673_100332496 | |||
| 1133 | Ga0070688_100191318 | |||
| 1134 | Ga0070688_100448779 | |||
| 1135 | Ga0070659_100019106 | |||
| 1136 | Ga0070659_100025275 | |||
| 1137 | Ga0070659_100066242 | |||
| 1138 | Ga0070659_100191252 | |||
| 1139 | Ga0070659_100901525 | |||
| 1140 | Ga0070667_100072949 | |||
| 1141 | Ga0070667_100279108 | |||
| 1142 | Ga0070667_100746910 | |||
| 1143 | Ga0070701_10094608 | |||
| 1144 | Ga0070711_100926075 | |||
| 1145 | Ga0070705_100013976 | |||
| 1146 | Ga0070700_100002303 | |||
| 1147 | Ga0070700_100448010 | |||
| 1148 | Ga0070663_100036589 | |||
| 1149 | Ga0070663_100114837 | |||
| 1150 | Ga0070663_100163055 | |||
| 1151 | Ga0070663_100363988 | |||
| 1152 | Ga0070678_100104615 | |||
| 1153 | Ga0070678_100453373 | |||
| 1154 | Ga0070662_100036231 | |||
| 1155 | Ga0070662_100041884 | |||
| 1156 | Ga0070662_100155153 | |||
| 1157 | Ga0070662_100199228 | |||
| 1158 | Ga0070681_10295500 | |||
| 1159 | Ga0068867_100007389 | |||
| 1160 | Ga0068867_100049577 | |||
| 1161 | Ga0068867_100604874 | |||
| 1162 | Ga0070698_100011005 | |||
| 1163 | Ga0070679_100020810 | |||
| 1164 | Ga0070679_100521181 | |||
| 1165 | Ga0070679_100736568 | |||
| 1166 | Ga0070684_100004672 | |||
| 1167 | Ga0070684_100063833 | |||
| 1168 | Ga0070684_100273570 | |||
| 1169 | Ga0070684_100662654 | |||
| 1170 | Ga0068853_100338395 | |||
| 1171 | Ga0068853_100526708 | |||
| 1172 | Ga0068853_100750556 | |||
| 1173 | Ga0070672_100046686 | |||
| 1174 | Ga0070686_100209024 | |||
| 1175 | Ga0070686_100441218 | |||
| 1176 | Ga0070695_100855902 | |||
| 1177 | Ga0070693_100006536 | |||
| 1178 | Ga0070665_100000868 | |||
| 1179 | Ga0068855_100551123 | |||
| 1180 | Ga0068855_100626339 | |||
| 1181 | Ga0070664_100475196 | |||
| 1182 | Ga0068857_100367938 | |||
| 1183 | Ga0068854_100016555 | |||
| 1184 | Ga0068854_100518157 | |||
| 1185 | Ga0068856_100240491 | |||
| 1186 | Ga0068856_100329340 | |||
| 1187 | Ga0070702_100015855 | |||
| 1188 | Ga0070702_100026047 | |||
| 1189 | Ga0070702_100720402 | |||
| 1190 | Ga0068852_100149897 | |||
| 1191 | Ga0068852_100390172 | |||
| 1192 | Ga0068864_100078679 | |||
| 1193 | Ga0068864_100125496 | |||
| 1194 | Ga0068864_100263266 | |||
| 1195 | Ga0068866_10025798 | |||
| 1196 | Ga0068861_100024654 | |||
| 1197 | Ga0068861_100086135 | |||
| 1198 | Ga0068861_100880154 | |||
| 1199 | Ga0068851_10111670 | |||
| 1200 | Ga0068870_10003830 | |||
| 1201 | Ga0068870_10061537 | |||
| 1202 | Ga0068870_10113681 | |||
| 1203 | Ga0068863_100875613 | |||
| 1204 | Ga0068858_100045111 | |||
| 1205 | Ga0068860_100000388 | |||
| 1206 | Ga0068860_100100623 | |||
| 1207 | Ga0068860_100550618 | |||
| 1208 | Ga0081455_10000298 | |||
| 1209 | Ga0081455_10002569 | |||
| 1210 | Ga0081455_10006814 | |||
| 1211 | Ga0081455_10010219 | |||
| 1212 | Ga0081455_10020733 | |||
| 1213 | Ga0081455_10038921 | |||
| 1214 | Ga0081455_10056392 | |||
| 1215 | Ga0081538_10000841 | |||
| 1216 | Ga0081538_10016484 | |||
| 1217 | Ga0081538_10017183 | |||
| 1218 | Ga0081540_1069961 | |||
| 1219 | Ga0081539_10000170 | |||
| 1220 | Ga0075365_10019907 | |||
| 1221 | Ga0075365_10050313 | |||
| 1222 | Ga0075365_10146211 | |||
| 1223 | Ga0075365_10308305 | |||
| 1224 | Ga0075365_10316815 | |||
| 1225 | Ga0075365_10478974 | |||
| 1226 | Ga0075368_10061383 | |||
| 1227 | Ga0075368_10207217 | |||
| 1228 | Ga0075363_100008378 | |||
| 1229 | Ga0075363_100046286 | |||
| 1230 | Ga0075363_100187971 | |||
| 1231 | Ga0075363_100318542 | |||
| 1232 | Ga0075363_100367887 | |||
| 1233 | Ga0075364_10003388 | |||
| 1234 | Ga0075364_10045314 | |||
| 1235 | Ga0075364_10387199 | |||
| 1236 | Ga0075432_10002195 | |||
| 1237 | Ga0075432_10004039 | |||
| 1238 | Ga0075362_10004276 | |||
| 1239 | Ga0075367_10020551 | |||
| 1240 | Ga0075367_10037203 | |||
| 1241 | Ga0075367_10520773 | |||
| 1242 | Ga0075370_10024322 | |||
| 1243 | Ga0075370_10043683 | |||
| 1244 | Ga0075370_10078090 | |||
| 1245 | Ga0075370_10094577 | |||
| 1246 | Ga0075428_100003370 | |||
| 1247 | Ga0075428_100022105 | |||
| 1248 | Ga0075428_100024346 | |||
| 1249 | Ga0075428_100027812 | |||
| 1250 | Ga0075428_100096259 | |||
| 1251 | Ga0075430_100008427 | |||
| 1252 | Ga0075430_100072226 | |||
| 1253 | Ga0075431_100001915 | |||
| 1254 | Ga0075431_100036576 | |||
| 1255 | Ga0075431_100051599 | |||
| 1256 | Ga0075433_10004815 | |||
| 1257 | Ga0075433_10066458 | |||
| 1258 | Ga0075433_10290177 | |||
| 1259 | Ga0075434_100004269 | |||
| 1260 | Ga0075434_100021537 | |||
| 1261 | Ga0075434_100535713 | |||
| 1262 | Ga0075429_100016458 | |||
| 1263 | Ga0075429_100030709 | |||
| 1264 | Ga0068865_100004270 | |||
| 1265 | Ga0068865_100007647 | |||
| 1266 | Ga0068865_100131512 | |||
| 1267 | Ga0068865_100330122 | |||
| 1268 | Ga0075436_100000495 | |||
| 1269 | Ga0075435_100003823 | |||
| 1270 | Ga0075435_100024035 | |||
| 1271 | Ga0105240_10853454 | |||
| 1272 | Ga0111539_10015199 | |||
| 1273 | Ga0111539_10051724 | |||
| 1274 | Ga0111539_10442384 | |||
| 1275 | Ga0111539_10564497 | |||
| 1276 | Ga0105245_10002262 | |||
| 1277 | Ga0105245_10010146 | |||
| 1278 | Ga0105245_10057213 | |||
| 1279 | Ga0105245_10197954 | |||
| 1280 | Ga0105245_10273941 | |||
| 1281 | Ga0105245_10276777 | |||
| 1282 | Ga0105247_10242582 | |||
| 1283 | Ga0114129_10038001 | |||
| 1284 | Ga0114129_10048557 | |||
| 1285 | Ga0114129_10214007 | |||
| 1286 | Ga0105243_10011969 | |||
| 1287 | Ga0105243_10047697 | |||
| 1288 | Ga0105243_10055770 | |||
| 1289 | Ga0105243_10093944 | |||
| 1290 | Ga0105243_10138780 | |||
| 1291 | Ga0105243_10446906 | |||
| 1292 | Ga0105243_10634791 | |||
| 1293 | Ga0105243_10927957 | |||
| 1294 | Ga0105242_10059619 | |||
| 1295 | Ga0105242_10260126 | |||
| 1296 | Ga0105242_10281387 | |||
| 1297 | Ga0105248_10190351 | |||
| 1298 | Ga0105248_10274711 | |||
| 1299 | Ga0105248_10602244 | |||
| 1300 | Ga0105237_10071232 | |||
| 1301 | Ga0105237_10116239 | |||
| 1302 | Ga0105237_10788331 | |||
| 1303 | Ga0105237_11113179 | |||
| 1304 | Ga0105238_10216710 | |||
| 1305 | Ga0105238_10524756 | |||
| 1306 | Ga0105249_10032279 | |||
| 1307 | Ga0105249_10037581 | |||
| 1308 | Ga0105249_10071139 | |||
| 1309 | Ga0105249_10203984 | |||
| 1310 | Ga0105249_10214519 | |||
| 1311 | Ga0105249_10407079 | |||
| 1312 | Ga0105249_10895474 | |||
| 1313 | Ga0105030_109670 | |||
| 1314 | Ga0105028_104598 | |||
| 1315 | Ga0105239_10001318 | |||
| 1316 | Ga0105239_10002798 | |||
| 1317 | Ga0105239_10079150 | |||
| 1318 | Ga0105239_10218118 | |||
| 1319 | Ga0105239_10474285 | |||
| 1320 | Ga0105239_10757685 | |||
| 1321 | Ga0105246_10014826 | |||
| 1322 | Ga0105246_10130712 | |||
| 1323 | Ga0105246_10379044 | |||
| 1324 | Ga0157336_1006973 | |||
| 1325 | Ga0157329_1003071 | |||
| 1326 | Ga0157335_1002177 | |||
| 1327 | Ga0157341_1003790 | |||
| 1328 | Ga0157319_1001204 | |||
| 1329 | Ga0157319_1005147 | |||
| 1330 | Ga0157345_1009036 | |||
| 1331 | Ga0157338_1010256 | |||
| 1332 | Ga0157373_10608154 | |||
| 1333 | Ga0157371_10053858 | |||
| 1334 | Ga0157371_10087061 | |||
| 1335 | Ga0157374_10282565 | |||
| 1336 | Ga0157378_10471144 | |||
| 1337 | Ga0157378_10517258 | |||
| 1338 | Ga0163162_10038011 | |||
| 1339 | Ga0163162_10158276 | |||
| 1340 | Ga0163162_10358331 | |||
| 1341 | Ga0163162_10500621 | |||
| 1342 | Ga0163162_10932740 | |||
| 1343 | Ga0157372_10027521 | |||
| 1344 | Ga0157372_10083119 | |||
| 1345 | Ga0157372_10116214 | |||
| 1346 | Ga0157372_10273589 | |||
| 1347 | Ga0157372_10284284 | |||
| 1348 | Ga0157372_10507490 | |||
| 1349 | Ga0157375_10277439 | |||
| 1350 | Ga0157375_10421088 | |||
| 1351 | Ga0157375_10431870 | |||
| 1352 | Ga0157375_10558921 | |||
| 1353 | Ga0157375_10682027 | |||
| 1354 | Ga0157375_10847275 | |||
| 1355 | Ga0163163_10129334 | |||
| 1356 | Ga0163163_10160525 | |||
| 1357 | Ga0163163_10287979 | |||
| 1358 | Ga0163163_10788419 | |||
| 1359 | Ga0157380_10005485 | |||
| 1360 | Ga0157380_10174384 | |||
| 1361 | Ga0157380_10200963 | |||
| 1362 | Ga0157380_10386832 | |||
| 1363 | Ga0182008_10190355 | |||
| 1364 | Ga0157377_10316245 | |||
| 1365 | Ga0157379_10040240 | |||
| 1366 | Ga0157376_10340096 | |||
| 1367 | Ga0157376_10350290 | |||
| 1368 | Ga0163161_10017762 | |||
| 1369 | Ga0163161_10048837 | |||
| 1370 | Ga0163161_10153584 | |||
| 1371 | Ga0163161_10162132 | |||
| 1372 | Ga0163161_10326916 | |||
| 1373 | Ga0197907_10208093 | |||
| 1374 | Ga0197907_10309606 | |||
| 1375 | Ga0197907_10559225 | |||
| 1376 | Ga0206356_11297441 | |||
| 1377 | Ga0206356_11804983 | |||
| 1378 | Ga0206355_1640103 | |||
| 1379 | Ga0206350_10103036 | |||
| 1380 | Ga0154015_1364342 | |||
| 1381 | Ga0213875_10074552 | |||
| 1382 | Ga0207682_10094578 | |||
| 1383 | Ga0207642_10122701 | |||
| 1384 | Ga0207710_10089645 | |||
| 1385 | Ga0207688_10052421 | |||
| 1386 | Ga0207688_10058370 | |||
| 1387 | Ga0207688_10094086 | |||
| 1388 | Ga0207647_10008541 | |||
| 1389 | Ga0207647_10010116 | |||
| 1390 | Ga0207647_10059649 | |||
| 1391 | Ga0207647_10168652 | |||
| 1392 | Ga0207647_10315777 | |||
| 1393 | Ga0207647_10370187 | |||
| 1394 | Ga0207685_10113134 | |||
| 1395 | Ga0207643_10108564 | |||
| 1396 | Ga0207643_10110657 | |||
| 1397 | Ga0207643_10129421 | |||
| 1398 | Ga0207643_10238608 | |||
| 1399 | Ga0207705_10095945 | |||
| 1400 | Ga0207705_10098957 | |||
| 1401 | Ga0207705_10265900 | |||
| 1402 | Ga0207707_10155432 | |||
| 1403 | Ga0207671_10087463 | |||
| 1404 | Ga0207671_10272065 | |||
| 1405 | Ga0207671_10477858 | |||
| 1406 | Ga0207662_10079336 | |||
| 1407 | Ga0207657_10042184 | |||
| 1408 | Ga0207657_10046093 | |||
| 1409 | Ga0207657_10279651 | |||
| 1410 | Ga0207657_10454860 | |||
| 1411 | Ga0207652_10019476 | |||
| 1412 | Ga0207652_10201519 | |||
| 1413 | Ga0207652_11126577 | |||
| 1414 | Ga0207646_10129704 | |||
| 1415 | Ga0207681_10345282 | |||
| 1416 | Ga0207681_10421974 | |||
| 1417 | Ga0207694_10095551 | |||
| 1418 | Ga0207694_10125616 | |||
| 1419 | Ga0207694_10155871 | |||
| 1420 | Ga0207650_10499478 | |||
| 1421 | Ga0207687_10063706 | |||
| 1422 | Ga0207687_10146799 | |||
| 1423 | Ga0207687_10257967 | |||
| 1424 | Ga0207687_10429373 | |||
| 1425 | Ga0207687_10453778 | |||
| 1426 | Ga0207664_10046885 | |||
| 1427 | Ga0207690_10014894 | |||
| 1428 | Ga0207690_10036521 | |||
| 1429 | Ga0207690_10074596 | |||
| 1430 | Ga0207690_10077583 | |||
| 1431 | Ga0207690_10199212 | |||
| 1432 | Ga0207706_10022138 | |||
| 1433 | Ga0207706_10190026 | |||
| 1434 | Ga0207706_10281427 | |||
| 1435 | Ga0207706_11069634 | |||
| 1436 | Ga0207686_10010760 | |||
| 1437 | Ga0207686_10106628 | |||
| 1438 | Ga0207686_10176922 | |||
| 1439 | Ga0207686_10390934 | |||
| 1440 | Ga0207709_10005306 | |||
| 1441 | Ga0207709_10036229 | |||
| 1442 | Ga0207709_10114062 | |||
| 1443 | Ga0207709_10139341 | |||
| 1444 | Ga0207709_10429124 | |||
| 1445 | Ga0207709_10588515 | |||
| 1446 | Ga0207670_10427921 | |||
| 1447 | Ga0207669_10015653 | |||
| 1448 | Ga0207669_10115217 | |||
| 1449 | Ga0207704_10013477 | |||
| 1450 | Ga0207704_10019645 | |||
| 1451 | Ga0207704_10083003 | |||
| 1452 | Ga0207704_10166531 | |||
| 1453 | Ga0207691_10003002 | |||
| 1454 | Ga0207691_10081757 | |||
| 1455 | Ga0207711_10214258 | |||
| 1456 | Ga0207711_10666024 | |||
| 1457 | Ga0207689_10363980 | |||
| 1458 | Ga0207661_10005512 | |||
| 1459 | Ga0207661_10203304 | |||
| 1460 | Ga0207661_10263398 | |||
| 1461 | Ga0207679_10250018 | |||
| 1462 | Ga0207679_10334253 | |||
| 1463 | Ga0207679_10693878 | |||
| 1464 | Ga0207667_10494453 | |||
| 1465 | Ga0207651_10218246 | |||
| 1466 | Ga0207712_10029451 | |||
| 1467 | Ga0207712_10068944 | |||
| 1468 | Ga0207712_10914457 | |||
| 1469 | Ga0207668_10061208 | |||
| 1470 | Ga0207668_10138819 | |||
| 1471 | Ga0207668_10139839 | |||
| 1472 | Ga0207668_10461494 | |||
| 1473 | Ga0207640_10053848 | |||
| 1474 | Ga0207658_10158162 | |||
| 1475 | Ga0207658_10250321 | |||
| 1476 | Ga0207658_10339750 | |||
| 1477 | Ga0207677_10094319 | |||
| 1478 | Ga0207677_10162617 | |||
| 1479 | Ga0207677_10196712 | |||
| 1480 | Ga0207703_10095225 | |||
| 1481 | Ga0207703_10465034 | |||
| 1482 | Ga0207703_11093552 | |||
| 1483 | Ga0207639_10051080 | |||
| 1484 | Ga0207639_10137875 | |||
| 1485 | Ga0207639_10185629 | |||
| 1486 | Ga0207639_10516134 | |||
| 1487 | Ga0207678_10065790 | |||
| 1488 | Ga0207678_10127572 | |||
| 1489 | Ga0207678_10186019 | |||
| 1490 | Ga0207678_10217119 | |||
| 1491 | Ga0207678_10231520 | |||
| 1492 | Ga0207678_10355017 | |||
| 1493 | Ga0207678_10378226 | |||
| 1494 | Ga0207708_10001371 | |||
| 1495 | Ga0207708_10095894 | |||
| 1496 | Ga0207708_10107229 | |||
| 1497 | Ga0207708_10251015 | |||
| 1498 | Ga0207708_10355483 | |||
| 1499 | Ga0207702_10126503 | |||
| 1500 | Ga0207641_10484756 | |||
| 1501 | Ga0207648_10050693 | |||
| 1502 | Ga0207648_10056730 | |||
| 1503 | Ga0207648_10269923 | |||
| 1504 | Ga0207676_10403299 | |||
| 1505 | Ga0207676_10454806 | |||
| 1506 | Ga0207676_10521386 | |||
| 1507 | Ga0207674_10007577 | |||
| 1508 | Ga0207674_10114438 | |||
| 1509 | Ga0207674_10327365 | |||
| 1510 | Ga0207675_100016804 | |||
| 1511 | Ga0207675_100043167 | |||
| 1512 | Ga0207675_100089750 | |||
| 1513 | Ga0207675_100118612 | |||
| 1514 | Ga0207675_100322546 | |||
| 1515 | Ga0207683_10093108 | |||
| 1516 | Ga0207683_10121129 | |||
| 1517 | Ga0207698_10223756 | |||
| 1518 | Ga0207698_10468897 | |||
| 1519 | Ga0207698_10576581 | |||
| 1520 | Ga0207698_10630803 | |||
| 1521 | Ga0209999_1058845 | |||
| 1522 | Ga0209813_10000658 | |||
| 1523 | Ga0209813_10005764 | |||
| 1524 | Ga0207428_10003055 | |||
| 1525 | Ga0207428_10008733 | |||
| 1526 | Ga0207428_10023825 | |||
| 1527 | Ga0207428_10259012 | |||
| 1528 | Ga0268266_10001392 | |||
| 1529 | Ga0268266_10121698 | |||
| 1530 | Ga0268264_10000387 | |||
| 1531 | Ga0268264_10210935 | |||
| 1532 | Ga0268264_10426826 | |||
| 1533 | Ga0307517_10201545 | |||
| 1534 | Ga0307515_10344927 | |||
| 1535 | Ga0316176_1031002 | |||
| 1536 | Ga0316181_1115169 | |||
| 1537 | Ga0316182_1088044 | |||
| 1538 | Ga0316182_1224164 | |||
| 1539 | Ga0265320_10045531 | |||
| 1540 | Ga0265340_10025160 | |||
| 1541 | Ga0265339_10022215 | |||
| 1542 | Ga0307513_10071567 | |||
| 1543 | Ga0307408_100005933 | |||
| 1544 | Ga0307408_100013944 | |||
| 1545 | Ga0307408_100096374 | |||
| 1546 | Ga0307408_100164326 | |||
| 1547 | Ga0307408_100766208 | |||
| 1548 | Ga0316579_10013595 | |||
| 1549 | Ga0265342_10101315 | |||
| 1550 | Ga0316576_10058110 | |||
| 1551 | Ga0316576_10154017 | |||
| 1552 | Ga0316578_10059267 | |||
| 1553 | Ga0307405_10383273 | |||
| 1554 | Ga0316577_10017848 | |||
| 1555 | Ga0307413_10001451 | |||
| 1556 | Ga0307413_10023829 | |||
| 1557 | Ga0307413_10056084 | |||
| 1558 | Ga0307413_10313387 | |||
| 1559 | Ga0307413_10469726 | |||
| 1560 | Ga0307410_10002082 | |||
| 1561 | Ga0307410_10011465 | |||
| 1562 | Ga0307410_10041750 | |||
| 1563 | Ga0307410_10094609 | |||
| 1564 | Ga0307410_10154434 | |||
| 1565 | Ga0307410_10293295 | |||
| 1566 | Ga0307410_10566617 | |||
| 1567 | Ga0307406_10000207 | |||
| 1568 | Ga0307406_10010450 | |||
| 1569 | Ga0307406_10101042 | |||
| 1570 | Ga0307407_10007549 | |||
| 1571 | Ga0307407_10020689 | |||
| 1572 | Ga0307412_10067839 | |||
| 1573 | Ga0307412_10092906 | |||
| 1574 | Ga0307412_10166467 | |||
| 1575 | Ga0307409_100003399 | |||
| 1576 | Ga0307409_100021958 | |||
| 1577 | Ga0307409_100121070 | |||
| 1578 | Ga0307409_100297914 | |||
| 1579 | Ga0307409_100853791 | |||
| 1580 | Ga0307416_100000064 | |||
| 1581 | Ga0307416_100000622 | |||
| 1582 | Ga0307416_100068237 | |||
| 1583 | Ga0307416_100088949 | |||
| 1584 | Ga0307416_100105910 | |||
| 1585 | Ga0307416_100248489 | |||
| 1586 | Ga0307416_100529099 | |||
| 1587 | Ga0307416_101174522 | |||
| 1588 | Ga0307414_10004847 | |||
| 1589 | Ga0307414_10256654 | |||
| 1590 | Ga0307414_10452038 | |||
| 1591 | Ga0307411_10003883 | |||
| 1592 | Ga0307411_10174105 | |||
| 1593 | Ga0307415_100002201 | |||
| 1594 | Ga0307415_100013917 | |||
| 1595 | Ga0307415_100188988 | |||
| 1596 | Ga0307415_100812461 | |||
| 1597 | Ga0307415_101124638 | |||
| 1598 | Ga0316583_10010836 | |||
| 1599 | Ga0316585_10013028 | |||
| 1600 | Ga0316580_10009815 | |||
| 1601 | Ga0316593_10004157 | |||
| 1602 | Ga0316592_1000942 | |||
| 1603 | Ga0316588_1006432 | |||
| 1604 | Ga0316596_1003274 | |||
| 1605 | Ga0373928_0041623 | |||
| 1606 | Ga0373946_0158242 | |||
| 1607 | Ga0316574_0103207 | |||
| 1608 | Ga0373931_0185772 | |||
| 1609 | Ga0316582_0128927 | |||
| 1610 | Ga0316584_0032972 | |||
| 1611 | Ga0395900_0034125 | |||
| 1612 | Ga0395900_0380545 | |||
| 1613 | Ga0395900_0506248 | |||
| 1614 | Ga0395898_0059562 | |||
| 1615 | Ga0395898_0907652 | |||
| 1616 | Ga0395905_0012411 | |||
| 1617 | Ga0395905_0216579 | |||
| 1618 | Ga0395905_0576804 | |||
| 1619 | Ga0316581_0003416 | |||
| 1620 | Ga0436364_0249415 | |||
| 1621 | Ga0395901_0034440 | |||
| 1622 | Ga0395901_0081403 | |||
| 1623 | Ga0395901_0083782 | |||
| 1624 | Ga0395901_0629118 | |||
| 1625 | Ga0242420_004572 | |||
| 1626 | Ga0439438_019084 | |||
| 1627 | Ga0439438_043312 | |||
| 1628 | Ga0439465_0035432 | |||
| 1629 | Ga0439465_0140606 | |||
| 1630 | Ga0439465_0146610 | |||
| 1631 | Ga0451791_0184620 | |||
| 1632 | Ga0451793_0693788 | |||
| 1633 | Ga0451833_0174897 | |||
| 1634 | Ga0451833_0980981 | |||
| 1635 | Ga0451837_0024633 | |||
| 1636 | Ga0451837_0461301 | |||
| 1637 | Ga0451837_0642774 | |||
| 1638 | Ga0451839_0935720 | |||
| 1639 | Ga0451853_1172145 | |||
| 1640 | Ga0439431_0003253 | |||
| 1641 | Ga0439445_0045252 | |||
| 1642 | Ga0439445_0086332 | |||
| 1643 | Ga0439448_0011399 | |||
| 1644 | Ga0439449_0083999 | |||
| 1645 | Ga0450900_020589 | |||
| 1646 | Ga0450906_044534 | |||
| 1647 | Ga0439446_0060257 | |||
| 1648 | Ga0439434_0014704 | |||
| 1649 | Ga0439434_0067714 | |||
| 1650 | Ga0439444_0065800 | |||
| 1651 | Ga0439459_0016576 | |||
| 1652 | Ga0439464_0045019 | |||
| 1653 | Ga0439464_0067917 | |||
| 1654 | Ga0450901_015447 | |||
| 1655 | Ga0439440_0058435 | |||
| 1656 | Ga0466969_0004974 | |||
| 1657 | Ga0466972_0006814 | |||
| 1658 | Ga0466972_0073504 | |||
| 1659 | Ga0466972_0158867 | |||
| 1660 | Ga0466965_0000715 | |||
| 1661 | Ga0466965_0014544 | |||
| 1662 | Ga0466965_0042983 | |||
| 1663 | Ga0466965_0051519 | |||
| 1664 | Ga0466965_0060335 | |||
| 1665 | Ga0466965_0083675 | |||
| 1666 | Ga0466966_0096465 | |||
| 1667 | Ga0466961_0023968 | |||
| 1668 | Ga0466961_0045577 | |||
| 1669 | Ga0466961_0045889 | |||
| 1670 | Ga0466961_0074072 | |||
| 1671 | Ga0466961_0106584 | |||
| 1672 | Ga0466963_0031776 | |||
| 1673 | Ga0466963_0056663 | |||
| 1674 | Ga0466963_0144692 | |||
| 1675 | Ga0466963_0165131 | |||
| 1676 | Ga0466963_0205237 | |||
| 1677 | Ga0466963_0270707 | |||
| 1678 | Ga0466964_0012185 | |||
| 1679 | Ga0466964_0040086 | |||
| 1680 | Ga0466964_0054730 | |||
| 1681 | Ga0466964_0094985 | |||
| 1682 | Ga0466964_0140602 | |||
| 1683 | Ga0466971_0006890 | |||
| 1684 | Ga0466971_0023338 | |||
| 1685 | Ga0466971_0085650 | |||
| 1686 | Ga0466971_0088160 | |||
| 1687 | Ga0466970_0011013 | |||
| 1688 | Ga0466970_0031983 | |||
| 1689 | Ga0466970_0039169 | |||
| 1690 | Ga0466970_0062138 | |||
| 1691 | Ga0466970_0076867 | |||
| 1692 | Ga0466970_0083319 | |||
| 1693 | Ga0466970_0099732 | |||
| 1694 | Ga0466970_0125925 | |||
| 1695 | Ga0466957_0004703 | |||
| 1696 | Ga0466957_0012592 | |||
| 1697 | Ga0466957_0040548 | |||
| 1698 | Ga0466957_0099303 | |||
| 1699 | Ga0466957_0155370 | |||
| 1700 | Ga0466960_0006811 | |||
| 1701 | Ga0466960_0007895 | |||
| 1702 | Ga0466960_0018740 | |||
| 1703 | Ga0466960_0030358 | |||
| 1704 | Ga0466960_0050125 | |||
| 1705 | Ga0466960_0069199 | |||
| 1706 | Ga0466960_0133137 | |||
| 1707 | Ga0466959_0034787 | |||
| 1708 | Ga0466959_0171656 | |||
| 1709 | Ga0466959_0199916 | |||
| 1710 | Ga0466959_0358284 | |||
| 1711 | Ga0466958_0051704 | |||
| 1712 | Ga0466958_0058011 | |||
| 1713 | Ga0466958_0079928 | |||
| 1714 | Ga0466958_0230199 | |||
| 1715 | Ga0466958_0416115 | |||
| 1716 | Ga0466967_0028650 | |||
| 1717 | Ga0466967_0036868 | |||
| 1718 | Ga0466967_0063164 | |||
| 1719 | Ga0466967_0066702 | |||
| 1720 | Ga0466967_0118561 | |||
| 1721 | Ga0466967_0186317 | |||
| 1722 | Ga0466967_0265494 | |||
| 1723 | Ga0466967_0341839 | |||
| 1724 | Ga0466967_0368228 | |||
| 1725 | Ga0466967_0569989 | |||
| 1726 | Ga0466967_0833640 | |||
| 1727 | Ga0495629_0050899 | |||
| 1728 | Ga0495629_0199999 | |||
| 1729 | Ga0495629_0276139 | |||
| 1730 | Ga0495641_0086934 | |||
| 1731 | Ga0495582_0300383 | |||
| 1732 | Ga0495664_0043871 | |||
| 1733 | Ga0495608_0172045 | |||
| 1734 | Ga0495620_0039685 | |||
| 1735 | Ga0495631_0037959 | |||
| 1736 | Ga0495663_0028687 | |||
| 1737 | Ga0495598_0118933 | |||
| 1738 | Ga0495645_0137243 | |||
| 1739 | Ga0495656_0037182 | |||
| 1740 | Ga0495611_0071346 | |||
| 1741 | Ga0495625_0112505 | |||
| 1742 | Ga0495635_0252042 | |||
| 1743 | Ga0495661_0362075 | |||
| 1744 | Ga0495657_0093679 | |||
| 1745 | Ga0495658_0487952 | |||
| 1746 | Ga0495671_0035510 | |||
| 1747 | Ga0495674_0287465 | |||
| 1748 | Ga0495672_0099162 | |||
| 1749 | Ga0496100_0172820 | |||
| 1750 | Ga0496100_0338063 | |||
| 1751 | Ga0496100_0410825 | |||
| 1752 | Ga0496100_0552489 | |||
| 1753 | Ga0496100_0668790 | |||
| 1754 | Ga0496100_0716923 | |||
| 1755 | Ga0496101_0007043 | |||
| 1756 | Ga0496101_0168525 | |||
| 1757 | Ga0496102_0026937 | |||
| 1758 | Ga0496102_0073936 | |||
| 1759 | Ga0496102_0185161 | |||
| 1760 | Ga0496102_0348671 | |||
| 1761 | Ga0496102_1088851 | |||
| 1762 | Ga0496103_0030095 | |||
| 1763 | Ga0496103_0043837 | |||
| 1764 | Ga0496104_0010288 | |||
| 1765 | Ga0496104_0271503 | |||
| 1766 | Ga0496105_0000828 | |||
| 1767 | Ga0496105_0094817 | |||
| 1768 | Ga0496105_0180101 | |||
| 1769 | Ga0496106_0076410 | |||
| 1770 | Ga0496106_0202027 | |||
| 1771 | Ga0496106_0209480 | |||
| 1772 | Ga0496107_0027700 | |||
| 1773 | Ga0496107_0080851 | |||
| 1774 | Ga0496107_0089094 | |||
| 1775 | Ga0496107_0091736 | |||
| 1776 | Ga0496107_0249265 | |||
| 1777 | Ga0496108_0020531 | |||
| 1778 | Ga0496108_0027320 | |||
| 1779 | Ga0496108_0187241 | |||
| 1780 | Ga0496108_0272194 | |||
| 1781 | Ga0496108_0337611 | |||
| 1782 | Ga0496108_0415330 | |||
| 1783 | Ga0496108_0478945 | |||
| 1784 | Ga0496108_0608482 | |||
| 1785 | Ga0496108_0651894 | |||
| 1786 | Ga0496109_0018653 | |||
| 1787 | Ga0496109_0073656 | |||
| 1788 | Ga0496109_0214887 | |||
| 1789 | Ga0496109_0217443 | |||
| 1790 | Ga0496109_0307077 | |||
| 1791 | Ga0496109_0344945 | |||
| 1792 | Ga0496109_0403788 | |||
| 1793 | Ga0496109_0708011 | |||
| 1794 | Ga0496110_0010462 | |||
| 1795 | Ga0496110_0016485 | |||
| 1796 | Ga0496110_0023038 | |||
| 1797 | Ga0496110_0051176 | |||
| 1798 | Ga0496110_0070304 | |||
| 1799 | Ga0496110_0150551 | |||
| 1800 | Ga0496110_0163642 | |||
| 1801 | Ga0496110_0298723 | |||
| 1802 | Ga0496110_0491141 | |||
| 1803 | Ga0496110_0609190 | |||
| 1804 | Ga0496110_0730994 | |||
| 1805 | Ga0496111_0004558 | |||
| 1806 | Ga0496111_0171270 | |||
| 1807 | Ga0496111_0176670 | |||
| 1808 | Ga0496113_0038066 | |||
| 1809 | Ga0496113_0203636 | |||
| 1810 | Ga0496114_0073154 | |||
| 1811 | Ga0496114_0075967 | |||
| 1812 | Ga0496114_0156235 | |||
| 1813 | Ga0496114_0161920 | |||
| 1814 | Ga0496114_0205189 | |||
| 1815 | Ga0496114_0238270 | |||
| 1816 | Ga0496114_0246143 | |||
| 1817 | Ga0496114_0398031 | |||
| 1818 | Ga0496115_0171416 | |||
| 1819 | Ga0496115_0199029 | |||
| 1820 | Ga0496115_0265333 | |||
| 1821 | Ga0496123_0035970 | |||
| 1822 | Ga0496124_0113527 | |||
| 1823 | Ga0496124_0305091 | |||
| 1824 | Ga0496126_0522406 | |||
| 1825 | Ga0501309_006033 | |||
| 1826 | Ga0501291_014751 | |||
| 1827 | Ga0501292_018768 | |||
| 1828 | Ga0501311_007414 | |||
| 1829 | Ga0501317_018173 | |||
| 1830 | Ga0501318_002331 | |||
| 1831 | Ga0501318_005817 | |||
| 1832 | Ga0501320_013627 | |||
| 1833 | Ga0501321_019551 | |||
| 1834 | Ga0501321_020191 | |||
| 1835 | Ga0501321_021118 | |||
| 1836 | Ga0501325_002852 | |||
| 1837 | Ga0501340_007031 | |||
| 1838 | Ga0501031_0000284 | |||
| 1839 | Ga0501031_0041389 | |||
| 1840 | Ga0501031_0045485 | |||
| 1841 | Ga0501031_0064199 | |||
| 1842 | Ga0501031_0070490 | |||
| 1843 | Ga0501031_0104293 | |||
| 1844 | Ga0501031_0199641 | |||
| 1845 | Ga0501032_0035238 | |||
| 1846 | Ga0501032_0036474 | |||
| 1847 | Ga0501032_0074874 | |||
| 1848 | Ga0501033_0024516 | |||
| 1849 | Ga0501033_0145436 | |||
| 1850 | Ga0501034_0036001 | |||
| 1851 | Ga0501034_0069400 | |||
| 1852 | Ga0501034_0179088 | |||
| 1853 | Ga0501034_0366875 | |||
| 1854 | Ga0501036_0000192 | |||
| 1855 | Ga0501036_0008414 | |||
| 1856 | Ga0501036_0026550 | |||
| 1857 | Ga0501036_0043265 | |||
| 1858 | Ga0501036_0166958 | |||
| 1859 | Ga0501036_0275370 | |||
| 1860 | Ga0501036_0354079 | |||
| 1861 | Ga0501036_0446756 | |||
| 1862 | Ga0501037_0000320 | |||
| 1863 | Ga0501037_0073997 | |||
| 1864 | Ga0501037_0233211 | |||
| 1865 | Ga0501038_0000986 | |||
| 1866 | Ga0501038_0001648 | |||
| 1867 | Ga0501038_0058470 | |||
| 1868 | Ga0501038_0059513 | |||
| 1869 | Ga0501038_0574711 | |||
| 1870 | Ga0501039_0004248 | |||
| 1871 | Ga0501039_0020283 | |||
| 1872 | Ga0501039_0083380 | |||
| 1873 | Ga0501039_0116782 | |||
| 1874 | Ga0501039_0126406 | |||
| 1875 | Ga0501039_0402396 | |||
| 1876 | Ga0501039_0533042 | |||
| 1877 | Ga0501039_0651524 | |||
| 1878 | Ga0501040_0006704 | |||
| 1879 | Ga0501040_0021720 | |||
| 1880 | Ga0501040_0119259 | |||
| 1881 | Ga0501040_0147577 | |||
| 1882 | Ga0501040_0154553 | |||
| 1883 | Ga0501040_0163884 | |||
| 1884 | Ga0501040_0401013 | |||
| 1885 | Ga0501040_0579438 | |||
| 1886 | Ga0501040_0607908 | |||
| 1887 | Ga0501041_0035721 | |||
| 1888 | Ga0501041_0083725 | |||
| 1889 | Ga0501041_0104887 | |||
| 1890 | Ga0501041_0277022 | |||
| 1891 | Ga0501042_0012330 | |||
| 1892 | Ga0501042_0016910 | |||
| 1893 | Ga0501042_0107411 | |||
| 1894 | Ga0501043_0004616 | |||
| 1895 | Ga0501043_0036133 | |||
| 1896 | Ga0501043_0111139 | |||
| 1897 | Ga0501043_0136150 | |||
| 1898 | Ga0501046_0000647 | |||
| 1899 | Ga0501047_0008114 | |||
| 1900 | Ga0501047_0013895 | |||
| 1901 | Ga0501048_0000386 | |||
| 1902 | Ga0501048_0024322 | |||
| 1903 | Ga0501048_0167883 | |||
| 1904 | Ga0501048_0201900 | |||
| 1905 | Ga0501048_0408602 | |||
| 1906 | Ga0501067_0031418 | |||
| 1907 | Ga0501067_0045352 | |||
| 1908 | Ga0501067_0062048 | |||
| 1909 | Ga0501067_0082480 | |||
| 1910 | Ga0501067_0111025 | |||
| 1911 | Ga0501067_0127907 | |||
| 1912 | Ga0501067_0181382 | |||
| 1913 | Ga0501067_0192579 | |||
| 1914 | Ga0501068_0027731 | |||
| 1915 | Ga0501068_0027915 | |||
| 1916 | Ga0501068_0060059 | |||
| 1917 | Ga0501068_0078144 | |||
| 1918 | Ga0501068_0137703 | |||
| 1919 | Ga0501068_0187145 | |||
| 1920 | Ga0501069_0000907 | |||
| 1921 | Ga0501069_0007049 | |||
| 1922 | Ga0501069_0082447 | |||
| 1923 | Ga0501069_0086255 | |||
| 1924 | Ga0501069_0113884 | |||
| 1925 | Ga0501069_0137048 | |||
| 1926 | Ga0501069_0202190 | |||
| 1927 | Ga0501070_0000203 | |||
| 1928 | Ga0501070_0000968 | |||
| 1929 | Ga0501070_0001766 | |||
| 1930 | Ga0501070_0002280 | |||
| 1931 | Ga0501070_0015846 | |||
| 1932 | Ga0501070_0051310 | |||
| 1933 | Ga0501070_0057010 | |||
| 1934 | Ga0501070_0184600 | |||
| 1935 | Ga0501070_0427981 | |||
| 1936 | Ga0501070_0453484 | |||
| 1937 | Ga0501070_0664303 | |||
| 1938 | Ga0501071_0004926 | |||
| 1939 | Ga0501071_0022463 | |||
| 1940 | Ga0501071_0092716 | |||
| 1941 | Ga0501071_0573777 | |||
| 1942 | Ga0501072_0013524 | |||
| 1943 | Ga0501072_0014217 | |||
| 1944 | Ga0501072_0033664 | |||
| 1945 | Ga0501072_0049711 | |||
| 1946 | Ga0501072_0059406 | |||
| 1947 | Ga0501072_0124844 | |||
| 1948 | Ga0501072_0380227 | |||
| 1949 | Ga0501073_0005833 | |||
| 1950 | Ga0501073_0006881 | |||
| 1951 | Ga0501073_0032335 | |||
| 1952 | Ga0501073_0043777 | |||
| 1953 | Ga0501073_0095620 | |||
| 1954 | Ga0501074_0003828 | |||
| 1955 | Ga0501074_0018619 | |||
| 1956 | Ga0501074_0162302 | |||
| 1957 | Ga0501074_0172298 | |||
| 1958 | Ga0501074_0188542 | |||
| 1959 | Ga0501075_0014401 | |||
| 1960 | Ga0501075_0050601 | |||
| 1961 | Ga0501075_0327783 | |||
| 1962 | Ga0501076_0006498 | |||
| 1963 | Ga0501076_0042229 | |||
| 1964 | Ga0501076_0109499 | |||
| 1965 | Ga0501076_0229325 | |||
| 1966 | Ga0501076_0370226 | |||
| 1967 | Ga0501076_0603537 | |||
| 1968 | Ga0501077_0001085 | |||
| 1969 | Ga0501077_0015049 | |||
| 1970 | Ga0501077_0052451 | |||
| 1971 | Ga0501077_0540963 | |||
| 1972 | Ga0501206_004491 | |||
| 1973 | Ga0501207_047662 | |||
| 1974 | Ga0501243_040060 | |||
| 1975 | Ga0501259_047001 | |||
| 1976 | Ga0501261_033513 | |||
| 1977 | Ga0501079_0000589 | |||
| 1978 | Ga0501079_0007427 | |||
| 1979 | Ga0501079_0106826 | |||
| 1980 | Ga0501079_0170974 | |||
| 1981 | Ga0501079_0209582 | |||
| 1982 | Ga0501079_0267742 | |||
| 1983 | Ga0501079_0571900 | |||
| 1984 | Ga0501079_1042015 | |||
| 1985 | Ga0501080_0000164 | |||
| 1986 | Ga0501080_0000167 | |||
| 1987 | Ga0501080_0005860 | |||
| 1988 | Ga0501080_0020271 | |||
| 1989 | Ga0501080_0022736 | |||
| 1990 | Ga0501080_0038316 | |||
| 1991 | Ga0501080_0057800 | |||
| 1992 | Ga0501080_0058672 | |||
| 1993 | Ga0501080_0113979 | |||
| 1994 | Ga0501080_0203623 | |||
| 1995 | Ga0501080_0382630 | |||
| 1996 | Ga0501081_0382957 | |||
| 1997 | Ga0501081_0530758 | |||
| 1998 | Ga0501083_0012194 | |||
| 1999 | Ga0501083_0089548 | |||
| 2000 | Ga0501083_0114109 | |||
| 2001 | Ga0501266_014402 | |||
| 2002 | Ga0501035_0008456 | |||
| 2003 | Ga0501035_0104471 | |||
| 2004 | Ga0501035_0380781 | |||
| 2005 | Ga0501035_0380806 | |||
| 2006 | Ga0501044_0011052 | |||
| 2007 | Ga0501044_0074849 | |||
| 2008 | Ga0501044_0080354 | |||
| 2009 | Ga0501045_0019694 | |||
| 2010 | Ga0501045_0032214 | |||
| 2011 | Ga0501045_0124139 | |||
| 2012 | Ga0501045_0257295 | |||
| 2013 | Ga0501045_0391427 | |||
| 2014 | nmdc:mga03683_18082_c1 | |||
| 2015 | nmdc:mga03n38_14513_c1 | |||
| 2016 | nmdc:mga03n38_53825_c1 | |||
| 2017 | nmdc:mga00v17_106534_c1 | |||
| 2018 | nmdc:mga00v17_161776_c2 | |||
| 2019 | nmdc:mga00v17_16796_c1 | |||
| 2020 | nmdc:mga00v17_204065_c1 | |||
| 2021 | nmdc:mga00v17_276050_c1 | |||
| 2022 | nmdc:mga00v17_31718_c1 | |||
| 2023 | nmdc:mga00v17_34082_c1 | |||
| 2024 | nmdc:mga00v17_83346_c1 | |||
| 2025 | nmdc:mga00v17_87190_c1 | |||
| 2026 | nmdc:mga00v17_990_c1 | |||
| 2027 | nmdc:mga0yw44_214612_c1 | |||
| 2028 | nmdc:mga0yw44_262450_c1 | |||
| 2029 | nmdc:mga0yw44_376812_c1 | |||
| 2030 | nmdc:mga0yw44_38510_c1 | |||
| 2031 | nmdc:mga0yw44_40249_c1 | |||
| 2032 | nmdc:mga0yw44_4297_c1 | |||
| 2033 | nmdc:mga0yw44_48106_c1 | |||
| 2034 | nmdc:mga0yw44_528450_c1 | |||
| 2035 | nmdc:mga0yw44_570_c2 | |||
| 2036 | nmdc:mga0yw44_65633_c1 | |||
| 2037 | nmdc:mga06z11_17729_c1 | |||
| 2038 | nmdc:mga06z11_21636_c1 | |||
| 2039 | nmdc:mga06z11_76388_c1 | |||
| 2040 | nmdc:mga04h51_7896_c1 | |||
| 2041 | nmdc:mga04h51_8493_c1 | |||
| 2042 | nmdc:mga07m45_105263_c1 | |||
| 2043 | nmdc:mga07m45_266936_c1 | |||
| 2044 | nmdc:mga07m45_38031_c1 | |||
| 2045 | nmdc:mga05p37_121398_c1 | |||
| 2046 | nmdc:mga05p37_152_c1 | |||
| 2047 | nmdc:mga05p37_17900_c1 | |||
| 2048 | nmdc:mga09592_17118_c1 | |||
| 2049 | nmdc:mga09592_22327_c1 | |||
| 2050 | nmdc:mga09592_30698_c1 | |||
| 2051 | nmdc:mga0qj67_35146_c1 | |||
| 2052 | nmdc:mga0qj67_61955_c1 | |||
| 2053 | nmdc:mga06r32_273206_c1 | |||
| 2054 | nmdc:mga06r32_30859_c1 | |||
| 2055 | nmdc:mga06r32_5321_c1 | |||
| 2056 | nmdc:mga06r32_7330_c1 | |||
| 2057 | nmdc:mga08y16_206205_c1 | |||
| 2058 | nmdc:mga08y16_30284_c1 | |||
| 2059 | nmdc:mga08y16_363106_c1 | |||
| 2060 | nmdc:mga08y16_69744_c1 | |||
| 2061 | nmdc:mga0n895_14912_c1 | |||
| 2062 | nmdc:mga0n895_5553_c1 | |||
| 2063 | nmdc:mga0rr50_22665_c1 | |||
| 2064 | nmdc:mga0rr50_67628_c1 | |||
| 2065 | nmdc:mga08x19_17228_c1 | |||
| 2066 | nmdc:mga0a205_18587_c1 | |||
| 2067 | nmdc:mga0a205_312201_c1 | |||
| 2068 | nmdc:mga0a205_50188_c1 | |||
| 2069 | Ga0495601_0053680 | |||
| 2070 | Ga0495601_0634824 | |||
| 2071 | Ga0495655_0013293 | |||
| 2072 | Ga0495655_0041913 | |||
| 2073 | Ga0495655_0064855 | |||
| 2074 | Ga0495595_0147823 | |||
| 2075 | Ga0495619_0165813 | |||
| 2076 | Ga0495619_0585410 | |||
| 2077 | Ga0500644_0000315 | |||
| 2078 | Ga0500644_0086632 | |||
| 2079 | Ga0500556_0003839 | |||
| 2080 | Ga0500593_000520 | |||
| 2081 | Ga0501084_0000986 | |||
| 2082 | Ga0501084_0011987 | |||
| 2083 | Ga0501084_0128079 | |||
| 2084 | Ga0501084_0137293 | |||
| 2085 | Ga0501084_0242135 | |||
| 2086 | Ga0501084_0425008 | |||
| 2087 | Ga0590074_006702 | |||
| 2088 | Ga0590077_059480 | |||
| 2089 | Ga0587070_024178 | |||
| 2090 | Ga0587077_068551 | |||
| 2091 | Ga0587080_009073 | |||
| 2092 | Ga0587082_002271 | |||
| 2093 | Ga0587082_011037 | |||
| 2094 | Ga0587088_055290 | |||
| 2095 | Ga0587091_021534 | |||
| 2096 | Ga0587098_004846 | |||
| 2097 | Ga0587098_023925 | |||
| 2098 | Ga0587122_001650 | |||
| 2099 | Ga0587067_058603 | |||
| 2100 | Ga0587111_0055707 | |||
| 2101 | Ga0501082_0095839 | |||
| 2102 | Ga0501082_0096953 | |||
| 2103 | Ga0501082_0097008 | |||
| 2104 | Ga0501082_0163559 | |||
| 2105 | Ga0501082_0385222 | |||
| 2106 | Ga0466962_0005850 | |||
| 2107 | Ga0466962_0017971 | |||
| 2108 | Ga0466962_0114975 | |||
| 2109 | Ga0466962_0157030 | |||
| 2110 | Ga0530510_0037409 | |||
| 2111 | Ga0530510_0170303 | |||
| 2112 | Ga0530510_0218603 | |||
| 2113 | Ga0530510_0351509 | |||
| 2114 | 2643828099 | |||
| 2115 | 2643892431 | |||
| 2116 | 2643961483 | |||
| 2117 | 2644032418 | |||
| 2118 | 2644090744 | |||
| 2119 | 2644102693 | |||
| 2120 | 2644118355 | |||
| 2121 | 2644231290 | |||
| 2122 | 2644320548 | |||
| 2123 | 2644458093 | |||
| 2124 | 2644531188 | |||
| 2125 | 2644536910 | |||
| 2126 | 2645722973 | |||
| 2127 | 2645725928 | |||
| 2128 | 2738870596 | |||
| 2129 | 2740166617 | |||
| 2130 | 2774393802 | |||
| 2131 | 2809195323 | |||
| 2132 | 2812334122 | |||
| 2133 | 2812350197 | |||
| 2134 | 2816424504 | |||
| 2135 | 2837272420 | |||
| 2136 | 2855387440 | |||
| 2137 | 2857482790 | |||
| 2138 | 2868093020 | |||
| 2139 | 2883823567 | |||
| 2140 | 2891972178 | |||
| 2141 | 2984577142 | |||
| 2142 | 2984594157 | |||
| 2143 | 2990260463 | |||
| 2144 | 8054612348 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p81-assembly1.cif.gz_K | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.9758 | 20 | 192 |
| 8ef8-assembly1.cif.gz_M | staphylococcus aureus clpp y63w in complex with compound 3471 | 0.9751 | 20 | 194 |
| 7p81-assembly2.cif.gz_T | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.9745 | 20 | 192 |
| 4emp-assembly1.cif.gz_B | crystal structure of the mutant of clpp e137a from staphylococcus aureus | 0.9742 | 20 | 194 |
| 8i7x-assembly1.cif.gz_H | crystal structure of human clpp in complex with zg36 | 0.974 | 20 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l5gB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;CarD-like, C-terminal domain | 0.9778 | 139 | 173 | 1.20.58.1290 |
| 1y7oA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.963 | 18 | 194 | 3.90.226.10 |
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9592 | 22 | 195 | 3.90.226.10 |
| af_Q2PMR0_6_196_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9524 | 6 | 194 | 3.90.226.10 |
| af_P9WPC3_1_214_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9392 | 1 | 195 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z6P473-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9973 | 22 | 97 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009532 GO:0051117 |
| AF-F8TGT4-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9936 | 24 | 95 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009532 GO:0051117 |
| AF-A0A428VV44-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.979 | 22 | 118 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A2W4J8K3-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9781 | 22 | 121 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A6M0C5U5-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9767 | 5 | 93 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |