F489397

General Info

Members Datasets Scaffolds Average Seq Length
1066 477 2132 149

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10007287|Ga0114129_1000728722
Length 182
Sequence MSSAVFSGSDRTGGRSQPAVPAFVRRAANRKELAVDRAAKKELVTTLNELFKNTNVVVVAHYSGLTVAQMQTLRRQMKQAGAAVKVAKNRLAKIALEGTDAAAVVPLLKGPTLIAYSGDPVAAPKVANDFAKAHEKFVILGGAMGKTVLNPDGIKALAVLPSLDELRAKIVGLIQAPAGEAA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
158 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
260 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
291 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
292 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
334 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
335 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
359 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
360 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
378 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
379 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
394 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
395 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
396 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
423 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
424 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
425 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
429 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.28
Metatranscriptomes 5.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 10.23
Rhizosphere 82.08
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10007287 3300009147 Bacteria 15747
2 SwRhRL2b_contig_928900 2162886007 Bacteria 6306
3 JGI24752J21851_1010794 3300001976 Bacteria 1193
4 JGI24746J21847_1034767 3300001977 Bacteria 696
5 JGI24747J21853_1000783 3300001978 Bacteria 2157
6 JGI24743J22301_10000545 3300001991 Bacteria 4476
7 JGI24750J21931_1000608 3300002070 Bacteria 5404
8 JGI24745J21846_1001324 3300002073 Bacteria 2389
9 JGI24748J21848_1016301 3300002074 Bacteria 887
10 JGI24738J21930_10017214 3300002075 Bacteria 1521
11 JGI24744J21845_10021401 3300002077 Bacteria 1272
12 JGI24033J26618_1022590 3300002155 Bacteria 814
13 JGI24034J26672_10013420 3300002239 Bacteria 1243
14 JGI24742J22300_10000494 3300002244 Bacteria 5875
15 JGI24751J29686_10070723 3300002459 Bacteria 720
16 Ga0006778J45830_1025950 3300003162 Bacteria 870
17 Ga0006759J45824_1025221 3300003163 Bacteria 886
18 JGI25153J46596_10027869 3300003215 Bacteria 1970
19 Ga0006770J48903_1016436 3300003305 Bacteria 1118
20 Ga0006770J48903_1018624 3300003305 Bacteria 991
21 Ga0006777J48905_1026730 3300003308 Bacteria 1337
22 Ga0007417J51691_1011846 3300003544 Bacteria 1337
23 Ga0007417J51691_1064053 3300003544 Bacteria 919
24 Ga0007417J51691_1090788 3300003544 Bacteria 931
25 Ga0007410J51695_1011393 3300003574 Bacteria 1505
26 Ga0007410J51695_1017954 3300003574 Bacteria 847
27 Ga0007409J51694_1012438 3300003575 Bacteria 1237
28 Ga0007416J51690_1011541 3300003577 Bacteria 1440
29 Ga0007416J51690_1027190 3300003577 Bacteria 951
30 Ga0007429J51699_1012285 3300003579 Bacteria 1339
31 Ga0007429J51699_1028685 3300003579 Bacteria 795
32 Ga0032354_1007221 3300003693 Bacteria 1023
33 Ga0032354_1009030 3300003693 Bacteria 1364
34 Ga0032354_1055567 3300003693 Bacteria 1037
35 Ga0006780_1014936 3300003735 Bacteria 1191
36 Ga0058859_10006780 3300004798 Bacteria 1006
37 Ga0058859_10053581 3300004798 Bacteria 1445
38 Ga0058863_10040969 3300004799 Bacteria 1246
39 Ga0058863_10089195 3300004799 Bacteria 1508
40 Ga0058861_11915796 3300004800 Bacteria 1396
41 Ga0058861_11965021 3300004800 Bacteria 1439
42 Ga0058860_10086571 3300004801 Bacteria 1446
43 Ga0058860_12029249 3300004801 Bacteria 822
44 Ga0058860_12099535 3300004801 Bacteria 881
45 Ga0058862_10049443 3300004803 Bacteria 1667
46 Ga0065704_10000553 3300005289 Bacteria 24228
47 Ga0070658_10689467 3300005327 Bacteria 886
48 Ga0070676_10278864 3300005328 Bacteria 1126
49 Ga0070683_100698280 3300005329 Bacteria 972
50 Ga0070690_100810136 3300005330 Bacteria 727
51 Ga0070670_100011506 3300005331 Bacteria 7570
52 Ga0070670_100036131 3300005331 Bacteria 4252
53 Ga0070670_100349936 3300005331 Bacteria 1298
54 Ga0070670_100422356 3300005331 Bacteria 1179
55 Ga0070670_100772342 3300005331 Bacteria 867
56 Ga0070677_10043878 3300005333 Bacteria 1777
57 Ga0070677_10165959 3300005333 Bacteria 1040
58 Ga0068869_100228871 3300005334 Bacteria 1476
59 Ga0070666_10028586 3300005335 Bacteria 3660
60 Ga0070666_10206231 3300005335 Bacteria 1383
61 Ga0070680_100260440 3300005336 Bacteria 1467
62 Ga0070682_100393926 3300005337 Bacteria 1045
63 Ga0068868_100038242 3300005338 Bacteria 3724
64 Ga0068868_100894253 3300005338 Bacteria 807
65 Ga0070660_100130663 3300005339 Bacteria 2009
66 Ga0070689_100033167 3300005340 Bacteria 3932
67 Ga0070689_100087845 3300005340 Bacteria 2446
68 Ga0070691_10131503 3300005341 Bacteria 1269
69 Ga0070691_10151234 3300005341 Bacteria 1190
70 Ga0070687_100014984 3300005343 Bacteria 3495
71 Ga0070687_100064073 3300005343 Bacteria 1951
72 Ga0070661_100563821 3300005344 Bacteria 918
73 Ga0070692_10007754 3300005345 Bacteria 4754
74 Ga0070668_100001285 3300005347 Bacteria 17956
75 Ga0070668_100143988 3300005347 Bacteria 1922
76 Ga0070668_100507773 3300005347 Bacteria 1044
77 Ga0070669_100000074 3300005353 Bacteria 99054
78 Ga0070669_100752916 3300005353 Bacteria 825
79 Ga0070669_100759942 3300005353 Bacteria 822
80 Ga0070675_100030048 3300005354 Bacteria 4384
81 Ga0070671_100000375 3300005355 Bacteria 30813
82 Ga0070671_100036384 3300005355 Bacteria 4082
83 Ga0070671_100127062 3300005355 Bacteria 2147
84 Ga0070671_100263577 3300005355 Bacteria 1465
85 Ga0070674_100055867 3300005356 Bacteria 2736
86 Ga0070674_100404345 3300005356 Bacteria 1116
87 Ga0070673_100024238 3300005364 Bacteria 4446
88 Ga0070673_100032283 3300005364 Bacteria 3940
89 Ga0070673_100300195 3300005364 Bacteria 1414
90 Ga0070688_100010662 3300005365 Bacteria 5075
91 Ga0070659_100025282 3300005366 Bacteria 4558
92 Ga0070667_100005448 3300005367 Bacteria 10630
93 Ga0070667_100038588 3300005367 Bacteria 4004
94 Ga0070667_100093784 3300005367 Bacteria 2585
95 Ga0070667_100671108 3300005367 Bacteria 958
96 Ga0070709_10008033 3300005434 Bacteria 5791
97 Ga0070709_10310767 3300005434 Bacteria 1154
98 Ga0070714_100117554 3300005435 Bacteria 2362
99 Ga0070714_100178008 3300005435 Bacteria 1934
100 Ga0070714_100463706 3300005435 Bacteria 1205
101 Ga0070714_100471968 3300005435 Bacteria 1194
102 Ga0070714_100608313 3300005435 Bacteria 1050
103 Ga0070714_100633876 3300005435 Bacteria 1028
104 Ga0070714_100839419 3300005435 Bacteria 891
105 Ga0070713_100021935 3300005436 Bacteria 4925
106 Ga0070713_100051961 3300005436 Bacteria 3392
107 Ga0070713_100053967 3300005436 Bacteria 3332
108 Ga0070713_100211368 3300005436 Bacteria 1756
109 Ga0070713_100212197 3300005436 Bacteria 1753
110 Ga0070713_100350927 3300005436 Bacteria 1369
111 Ga0070713_100403607 3300005436 Bacteria 1277
112 Ga0070713_101668449 3300005436 Bacteria 619
113 Ga0070710_10019414 3300005437 Bacteria 3512
114 Ga0070710_10045592 3300005437 Bacteria 2438
115 Ga0070710_10116972 3300005437 Bacteria 1608
116 Ga0070701_10007231 3300005438 Bacteria 4726
117 Ga0070711_100075083 3300005439 Bacteria 2392
118 Ga0070711_100123458 3300005439 Bacteria 1919
119 Ga0070711_100206839 3300005439 Bacteria 1517
120 Ga0070705_100064131 3300005440 Bacteria 2194
121 Ga0070700_100207103 3300005441 Bacteria 1381
122 Ga0070694_100231643 3300005444 Bacteria 1390
123 Ga0070694_100303832 3300005444 Bacteria 1223
124 Ga0070708_100113114 3300005445 Bacteria 2496
125 Ga0070708_100632261 3300005445 Bacteria 1009
126 Ga0070663_101246631 3300005455 Bacteria 655
127 Ga0070678_100295195 3300005456 Bacteria 1375
128 Ga0070678_100681612 3300005456 Bacteria 924
129 Ga0070662_100032411 3300005457 Bacteria 3673
130 Ga0070662_100240719 3300005457 Bacteria 1451
131 Ga0068867_100037084 3300005459 Bacteria 3542
132 Ga0070685_10172323 3300005466 Bacteria 1387
133 Ga0070707_100083729 3300005468 Bacteria 3082
134 Ga0070698_100427130 3300005471 Bacteria 1260
135 Ga0070699_100165360 3300005518 Bacteria 1959
136 Ga0070679_100122101 3300005530 Bacteria 2589
137 Ga0070684_100095669 3300005535 Bacteria 2647
138 Ga0070697_100129515 3300005536 Bacteria 2115
139 Ga0068853_100009776 3300005539 Bacteria 7740
140 Ga0068853_100520349 3300005539 Bacteria 1125
141 Ga0070672_100048470 3300005543 Bacteria 3301
142 Ga0070672_100197208 3300005543 Bacteria 1682
143 Ga0070695_100313458 3300005545 Bacteria 1164
144 Ga0070696_100023722 3300005546 Bacteria 4171
145 Ga0070696_100082878 3300005546 Bacteria 2274
146 Ga0070693_100233962 3300005547 Bacteria 1210
147 Ga0070665_100001089 3300005548 Bacteria 33704
148 Ga0070665_100065818 3300005548 Bacteria 3635
149 Ga0070665_100418862 3300005548 Bacteria 1348
150 Ga0070665_100805357 3300005548 Bacteria 952
151 Ga0068855_100577271 3300005563 Bacteria 1215
152 Ga0068855_100799945 3300005563 Bacteria 1002
153 Ga0070664_100074806 3300005564 Bacteria 2907
154 Ga0070664_100158279 3300005564 Bacteria 2002
155 Ga0068857_100323033 3300005577 Bacteria 1426
156 Ga0068854_100045799 3300005578 Bacteria 3111
157 Ga0068854_100400426 3300005578 Bacteria 1136
158 Ga0068854_100576948 3300005578 Bacteria 957
159 Ga0068856_100530235 3300005614 Bacteria 1199
160 Ga0070702_100108968 3300005615 Bacteria 1713
161 Ga0070702_100282332 3300005615 Bacteria 1140
162 Ga0070702_100822591 3300005615 Bacteria 720
163 Ga0068852_100041698 3300005616 Bacteria 3881
164 Ga0068859_100235955 3300005617 Bacteria 1918
165 Ga0068859_100432387 3300005617 Bacteria 1413
166 Ga0068859_100764296 3300005617 Bacteria 1055
167 Ga0068864_100013204 3300005618 Bacteria 6840
168 Ga0068864_100383399 3300005618 Bacteria 1332
169 Ga0068864_100875848 3300005618 Bacteria 886
170 Ga0068866_10223926 3300005718 Bacteria 1136
171 Ga0068866_10288332 3300005718 Bacteria 1020
172 Ga0068861_100098448 3300005719 Bacteria 2321
173 Ga0068870_10005952 3300005840 Bacteria 5359
174 Ga0068863_100044328 3300005841 Bacteria 4222
175 Ga0068863_100485800 3300005841 Bacteria 1215
176 Ga0068858_101297496 3300005842 Bacteria 716
177 Ga0068858_101484172 3300005842 Bacteria 668
178 Ga0068860_100038459 3300005843 Bacteria 4577
179 Ga0068860_100091662 3300005843 Bacteria 2895
180 Ga0068860_100118185 3300005843 Bacteria 2537
181 Ga0068862_100019410 3300005844 Bacteria 5673
182 Ga0068862_100877665 3300005844 Bacteria 880
183 Ga0081455_10169980 3300005937 Bacteria 1662
184 Ga0081455_10305339 3300005937 Bacteria 1140
185 Ga0081538_10004920 3300005981 Bacteria 12166
186 Ga0081538_10076620 3300005981 Bacteria 1806
187 Ga0081540_1005919 3300005983 Bacteria 9024
188 Ga0081540_1007542 3300005983 Bacteria 7742
189 Ga0081540_1030574 3300005983 Bacteria 2979
190 Ga0081540_1126788 3300005983 Bacteria 1049
191 Ga0070717_10034090 3300006028 Bacteria 4112
192 Ga0070717_10079263 3300006028 Bacteria 2753
193 Ga0070717_10321877 3300006028 Bacteria 1378
194 Ga0070717_10453768 3300006028 Bacteria 1155
195 Ga0070717_10632082 3300006028 Bacteria 971
196 Ga0070717_11134740 3300006028 Bacteria 712
197 Ga0075365_10117528 3300006038 Bacteria 1832
198 Ga0075365_10179088 3300006038 Bacteria 1482
199 Ga0075365_10440222 3300006038 Bacteria 920
200 Ga0075368_10052249 3300006042 Bacteria 1625
201 Ga0075368_10074571 3300006042 Bacteria 1374
202 Ga0075363_100070204 3300006048 Bacteria 1902
203 Ga0075363_100181564 3300006048 Bacteria 1198
204 Ga0075363_100226878 3300006048 Bacteria 1071
205 Ga0075364_10011733 3300006051 Bacteria 5333
206 Ga0075364_10084979 3300006051 Bacteria 2095
207 Ga0075364_10293041 3300006051 Bacteria 1107
208 Ga0075432_10055230 3300006058 Bacteria 1407
209 Ga0070715_10012690 3300006163 Bacteria 3074
210 Ga0070715_10105031 3300006163 Bacteria 1324
211 Ga0070715_10204740 3300006163 Bacteria 1005
212 Ga0070716_100015147 3300006173 Bacteria 3956
213 Ga0070716_100427392 3300006173 Bacteria 960
214 Ga0070712_100010627 3300006175 Bacteria 5815
215 Ga0070712_100018041 3300006175 Bacteria 4577
216 Ga0070712_100041648 3300006175 Bacteria 3154
217 Ga0070712_100056705 3300006175 Bacteria 2749
218 Ga0070712_100065083 3300006175 Bacteria 2586
219 Ga0070712_100163755 3300006175 Bacteria 1720
220 Ga0070712_100192560 3300006175 Bacteria 1597
221 Ga0070712_100907245 3300006175 Bacteria 760
222 Ga0075362_10026673 3300006177 Bacteria 2470
223 Ga0075362_10039073 3300006177 Bacteria 2085
224 Ga0075367_10011106 3300006178 Bacteria 4751
225 Ga0075367_10109248 3300006178 Bacteria 1696
226 Ga0075367_10286847 3300006178 Bacteria 1035
227 Ga0075366_10015762 3300006195 Bacteria 4338
228 Ga0075366_10039704 3300006195 Bacteria 2781
229 Ga0075366_10104857 3300006195 Bacteria 1699
230 Ga0097621_100003283 3300006237 Bacteria 11126
231 Ga0097621_100080957 3300006237 Bacteria 2702
232 Ga0097621_100103822 3300006237 Bacteria 2394
233 Ga0097621_100242651 3300006237 Bacteria 1575
234 Ga0075370_10137747 3300006353 Bacteria 1426
235 Ga0068871_100175297 3300006358 Bacteria 1840
236 Ga0075428_100100107 3300006844 Bacteria 3160
237 Ga0075428_100153084 3300006844 Bacteria 2505
238 Ga0075428_100371413 3300006844 Bacteria 1533
239 Ga0075430_100028424 3300006846 Bacteria 4751
240 Ga0075430_100341576 3300006846 Bacteria 1237
241 Ga0075431_100051432 3300006847 Bacteria 4248
242 Ga0075431_100233213 3300006847 Bacteria 1874
243 Ga0075431_100264878 3300006847 Bacteria 1743
244 Ga0075433_10030909 3300006852 Bacteria 4573
245 Ga0075433_10337684 3300006852 Bacteria 1332
246 Ga0075434_100042433 3300006871 Bacteria 4509
247 Ga0075434_100058778 3300006871 Bacteria 3821
248 Ga0075434_100169863 3300006871 Bacteria 2201
249 Ga0075429_100021082 3300006880 Bacteria 5651
250 Ga0075429_100787876 3300006880 Bacteria 833
251 Ga0075429_101309680 3300006880 Bacteria 632
252 Ga0068865_100384570 3300006881 Bacteria 1145
253 Ga0075436_100095437 3300006914 Bacteria 2069
254 Ga0075436_100106564 3300006914 Bacteria 1955
255 Ga0075436_100373811 3300006914 Bacteria 1030
256 Ga0075436_100742655 3300006914 Bacteria 729
257 Ga0097620_100235947 3300006931 Bacteria 1918
258 Ga0097620_100432402 3300006931 Bacteria 1413
259 Ga0097620_100764430 3300006931 Bacteria 1055
260 Ga0097620_101008743 3300006931 Bacteria 914
261 Ga0075435_100117174 3300007076 Bacteria 2219
262 Ga0075435_100366488 3300007076 Bacteria 1236
263 Ga0099795_10016969 3300007788 Bacteria 2314
264 Ga0099795_10017711 3300007788 Bacteria 2276
265 Ga0099795_10025379 3300007788 Bacteria 1987
266 Ga0099795_10056890 3300007788 Bacteria 1440
267 Ga0105251_10103005 3300009011 Bacteria 1304
268 Ga0105251_10129428 3300009011 Bacteria 1144
269 Ga0105250_10020355 3300009092 Bacteria 2683
270 Ga0105240_10926261 3300009093 Bacteria 936
271 Ga0105240_11409374 3300009093 Bacteria 732
272 Ga0111539_10055897 3300009094 Bacteria 4692
273 Ga0111539_10060602 3300009094 Bacteria 4484
274 Ga0111539_10167489 3300009094 Bacteria 2568
275 Ga0111539_10249567 3300009094 Bacteria 2066
276 Ga0111539_10663537 3300009094 Bacteria 1214
277 Ga0105245_10077373 3300009098 Bacteria 3033
278 Ga0105245_11150102 3300009098 Bacteria 823
279 Ga0105247_10065287 3300009101 Bacteria 2264
280 Ga0105247_10133347 3300009101 Bacteria 1621
281 Ga0105247_10133490 3300009101 Bacteria 1620
282 Ga0114129_10139148 3300009147 Bacteria 3329
283 Ga0114129_10163034 3300009147 Bacteria 3044
284 Ga0114129_10240265 3300009147 Bacteria 2435
285 Ga0114129_10313513 3300009147 Bacteria 2087
286 Ga0105243_10139521 3300009148 Bacteria 2066
287 Ga0105243_10434768 3300009148 Bacteria 1227
288 Ga0105243_10455965 3300009148 Bacteria 1201
289 Ga0105242_10080490 3300009176 Bacteria 2723
290 Ga0105242_10205975 3300009176 Bacteria 1749
291 Ga0105242_10952357 3300009176 Bacteria 863
292 Ga0105248_10053885 3300009177 Bacteria 4512
293 Ga0105248_10129824 3300009177 Bacteria 2843
294 Ga0105248_10633868 3300009177 Bacteria 1206
295 Ga0105248_11430904 3300009177 Bacteria 782
296 Ga0105237_10960115 3300009545 Bacteria 862
297 Ga0105238_10182439 3300009551 Bacteria 2075
298 Ga0105238_10263892 3300009551 Bacteria 1702
299 Ga0105249_10055163 3300009553 Bacteria 3634
300 Ga0105249_10422180 3300009553 Bacteria 1368
301 Ga0105249_12091444 3300009553 Bacteria 639
302 Ga0099796_10006589 3300010159 Bacteria 2983
303 Ga0105246_10087118 3300011119 Bacteria 2240
304 Ga0105246_10294026 3300011119 Bacteria 1308
305 Ga0105246_10749121 3300011119 Bacteria 861
306 Ga0157369_10947527 3300013105 Bacteria 882
307 Ga0157374_10769553 3300013296 Bacteria 978
308 Ga0157374_11021397 3300013296 Bacteria 846
309 Ga0157374_11485043 3300013296 Bacteria 701
310 Ga0157378_10078447 3300013297 Bacteria 2979
311 Ga0157378_10109345 3300013297 Bacteria 2532
312 Ga0157378_10288073 3300013297 Bacteria 1585
313 Ga0157378_10837300 3300013297 Bacteria 948
314 Ga0163162_10210408 3300013306 Bacteria 2074
315 Ga0163162_10714602 3300013306 Bacteria 1123
316 Ga0163162_11209901 3300013306 Bacteria 857
317 Ga0163163_10036791 3300014325 Bacteria 4757
318 Ga0163163_10948437 3300014325 Bacteria 924
319 Ga0157380_10388555 3300014326 Bacteria 1320
320 Ga0157380_11842114 3300014326 Bacteria 665
321 Ga0157380_12094331 3300014326 Bacteria 629
322 Ga0157377_10023027 3300014745 Bacteria 3296
323 Ga0157377_10560054 3300014745 Bacteria 809
324 Ga0157379_10224796 3300014968 Bacteria 1701
325 Ga0157379_10248716 3300014968 Bacteria 1614
326 Ga0157379_10768197 3300014968 Bacteria 908
327 Ga0157379_10796344 3300014968 Bacteria 892
328 Ga0157376_10069246 3300014969 Bacteria 2991
329 Ga0157376_10113841 3300014969 Bacteria 2386
330 Ga0157376_10316086 3300014969 Bacteria 1483
331 Ga0157376_10320130 3300014969 Bacteria 1474
332 Ga0157376_10832026 3300014969 Bacteria 937
333 Ga0157376_11751307 3300014969 Bacteria 657
334 Ga0163161_10096408 3300017792 Bacteria 2195
335 Ga0163161_10198313 3300017792 Bacteria 1546
336 Ga0184601_134629 3300019183 Bacteria 1051
337 Ga0213873_10000783 3300021358 Bacteria 5130
338 Ga0213872_10172377 3300021361 Bacteria 937
339 Ga0213876_10015540 3300021384 Bacteria 4027
340 Ga0213875_10000744 3300021388 Bacteria 24624
341 Ga0224712_10119940 3300022467 Bacteria 1138
342 Ga0247551_100775 3300023552 Bacteria 966
343 Ga0247550_100578 3300023660 Bacteria 984
344 Ga0228598_1000391 3300024227 Bacteria 8815
345 Ga0209233_1058471 3300025261 Bacteria 753
346 Ga0209758_1000264 3300025297 Bacteria 104107
347 Ga0209758_1067961 3300025297 Bacteria 1137
348 Ga0207656_10018449 3300025321 Bacteria 2748
349 Ga0207696_1024218 3300025711 Bacteria 1906
350 Ga0207713_1001618 3300025735 Bacteria 17547
351 Ga0207653_10114299 3300025885 Bacteria 966
352 Ga0207682_10019465 3300025893 Bacteria 2657
353 Ga0207692_10180797 3300025898 Bacteria 1228
354 Ga0207692_10234532 3300025898 Bacteria 1093
355 Ga0207692_10372569 3300025898 Bacteria 885
356 Ga0207710_10056498 3300025900 Bacteria 1771
357 Ga0207688_10038177 3300025901 Bacteria 2664
358 Ga0207688_10112121 3300025901 Bacteria 1584
359 Ga0207680_10060884 3300025903 Bacteria 2300
360 Ga0207647_10019223 3300025904 Bacteria 4598
361 Ga0207685_10003801 3300025905 Bacteria 3733
362 Ga0207685_10222904 3300025905 Bacteria 898
363 Ga0207699_10007486 3300025906 Bacteria 5341
364 Ga0207699_10610523 3300025906 Bacteria 795
365 Ga0207645_10016804 3300025907 Bacteria 4838
366 Ga0207645_10075151 3300025907 Bacteria 2163
367 Ga0207643_10004505 3300025908 Bacteria 7489
368 Ga0207684_10004491 3300025910 Bacteria 13124
369 Ga0207654_10058099 3300025911 Bacteria 2251
370 Ga0207707_10434110 3300025912 Bacteria 1125
371 Ga0207693_10004308 3300025915 Bacteria 12047
372 Ga0207693_10009534 3300025915 Bacteria 7908
373 Ga0207693_10019562 3300025915 Bacteria 5384
374 Ga0207693_10085248 3300025915 Bacteria 2475
375 Ga0207693_10125123 3300025915 Bacteria 2020
376 Ga0207693_10136027 3300025915 Bacteria 1932
377 Ga0207693_10150796 3300025915 Bacteria 1828
378 Ga0207693_10237354 3300025915 Bacteria 1431
379 Ga0207693_10441928 3300025915 Bacteria 1017
380 Ga0207663_10027273 3300025916 Bacteria 3326
381 Ga0207663_10087084 3300025916 Bacteria 2062
382 Ga0207663_10181335 3300025916 Bacteria 1504
383 Ga0207663_10492411 3300025916 Bacteria 951
384 Ga0207660_10305635 3300025917 Bacteria 1267
385 Ga0207660_10337102 3300025917 Bacteria 1207
386 Ga0207660_10408297 3300025917 Bacteria 1094
387 Ga0207662_10008043 3300025918 Bacteria 5755
388 Ga0207662_10036496 3300025918 Bacteria 2873
389 Ga0207657_10058541 3300025919 Bacteria 3315
390 Ga0207657_10253968 3300025919 Bacteria 1401
391 Ga0207649_10289269 3300025920 Bacteria 1194
392 Ga0207646_10071839 3300025922 Bacteria 3091
393 Ga0207681_10000120 3300025923 Bacteria 66235
394 Ga0207681_10076311 3300025923 Bacteria 2353
395 Ga0207681_10576112 3300025923 Bacteria 928
396 Ga0207694_10115617 3300025924 Bacteria 2137
397 Ga0207650_10016935 3300025925 Bacteria 5098
398 Ga0207659_10026275 3300025926 Bacteria 3926
399 Ga0207659_10365394 3300025926 Bacteria 1200
400 Ga0207687_10078388 3300025927 Bacteria 2379
401 Ga0207687_10457681 3300025927 Bacteria 1059
402 Ga0207700_10022265 3300025928 Bacteria 4345
403 Ga0207700_10071446 3300025928 Bacteria 2672
404 Ga0207700_10270004 3300025928 Bacteria 1460
405 Ga0207700_10463103 3300025928 Bacteria 1118
406 Ga0207700_10556101 3300025928 Bacteria 1019
407 Ga0207664_10052893 3300025929 Bacteria 3213
408 Ga0207664_10155474 3300025929 Bacteria 1946
409 Ga0207664_10164941 3300025929 Bacteria 1892
410 Ga0207664_10297861 3300025929 Bacteria 1418
411 Ga0207664_10733360 3300025929 Bacteria 889
412 Ga0207644_10003076 3300025931 Bacteria 10748
413 Ga0207644_10007178 3300025931 Bacteria 7254
414 Ga0207644_10591904 3300025931 Bacteria 920
415 Ga0207690_10538475 3300025932 Bacteria 948
416 Ga0207690_10921253 3300025932 Bacteria 725
417 Ga0207706_10010412 3300025933 Bacteria 8495
418 Ga0207706_10058181 3300025933 Bacteria 3405
419 Ga0207686_10096633 3300025934 Bacteria 1963
420 Ga0207686_10098941 3300025934 Bacteria 1943
421 Ga0207686_10375314 3300025934 Bacteria 1077
422 Ga0207709_10092173 3300025935 Bacteria 1983
423 Ga0207709_10470075 3300025935 Bacteria 976
424 Ga0207670_10016903 3300025936 Bacteria 4398
425 Ga0207670_10038481 3300025936 Bacteria 3124
426 Ga0207670_10090521 3300025936 Bacteria 2162
427 Ga0207670_10151216 3300025936 Bacteria 1723
428 Ga0207669_10036065 3300025937 Bacteria 2821
429 Ga0207669_10070099 3300025937 Bacteria 2196
430 Ga0207669_10250843 3300025937 Bacteria 1318
431 Ga0207704_10342295 3300025938 Bacteria 1161
432 Ga0207704_10444605 3300025938 Bacteria 1033
433 Ga0207665_10005011 3300025939 Bacteria 8841
434 Ga0207665_10067266 3300025939 Bacteria 2439
435 Ga0207665_10278298 3300025939 Bacteria 1245
436 Ga0207691_10006373 3300025940 Bacteria 11400
437 Ga0207691_10295141 3300025940 Bacteria 1393
438 Ga0207711_10494017 3300025941 Bacteria 1140
439 Ga0207711_10576912 3300025941 Bacteria 1049
440 Ga0207689_10027476 3300025942 Bacteria 4762
441 Ga0207661_10692879 3300025944 Bacteria 937
442 Ga0207679_10123316 3300025945 Bacteria 2066
443 Ga0207679_10379266 3300025945 Bacteria 1239
444 Ga0207679_10639205 3300025945 Bacteria 962
445 Ga0207667_10299423 3300025949 Bacteria 1643
446 Ga0207667_10415785 3300025949 Bacteria 1368
447 Ga0207651_10257314 3300025960 Bacteria 1431
448 Ga0207712_10034832 3300025961 Bacteria 3415
449 Ga0207668_10013844 3300025972 Bacteria 4980
450 Ga0207640_10998555 3300025981 Bacteria 736
451 Ga0207658_10003744 3300025986 Bacteria 10711
452 Ga0207658_10021569 3300025986 Bacteria 4475
453 Ga0207677_10043125 3300026023 Bacteria 2997
454 Ga0207677_11253073 3300026023 Bacteria 680
455 Ga0207703_10022093 3300026035 Bacteria 4986
456 Ga0207703_10149045 3300026035 Bacteria 2038
457 Ga0207639_10378667 3300026041 Bacteria 1270
458 Ga0207639_10404656 3300026041 Bacteria 1230
459 Ga0207678_10011936 3300026067 Bacteria 7630
460 Ga0207708_10012231 3300026075 Bacteria 6399
461 Ga0207702_10512669 3300026078 Bacteria 1170
462 Ga0207641_10323947 3300026088 Bacteria 1462
463 Ga0207641_10471642 3300026088 Bacteria 1215
464 Ga0207641_10564469 3300026088 Bacteria 1111
465 Ga0207641_10618311 3300026088 Bacteria 1062
466 Ga0207648_10034264 3300026089 Bacteria 4477
467 Ga0207648_10244893 3300026089 Bacteria 1597
468 Ga0207676_10125186 3300026095 Bacteria 2175
469 Ga0207676_10991276 3300026095 Bacteria 827
470 Ga0207674_10141745 3300026116 Bacteria 2363
471 Ga0207674_10926297 3300026116 Bacteria 840
472 Ga0207675_100007070 3300026118 Bacteria 10605
473 Ga0207683_10012795 3300026121 Bacteria 7161
474 Ga0207683_10341747 3300026121 Bacteria 1373
475 Ga0207698_10116732 3300026142 Bacteria 2250
476 Ga0207698_11348420 3300026142 Bacteria 728
477 Ga0207698_11730637 3300026142 Bacteria 640
478 Ga0209179_1030460 3300027512 Bacteria 1103
479 Ga0209588_1013394 3300027671 Bacteria 2500
480 Ga0209813_10030686 3300027866 Bacteria 1581
481 Ga0209813_10289415 3300027866 Bacteria 633
482 Ga0268266_10019456 3300028379 Bacteria 5783
483 Ga0268266_10130599 3300028379 Bacteria 2246
484 Ga0268266_10251937 3300028379 Bacteria 1633
485 Ga0268265_10005699 3300028380 Bacteria 8505
486 Ga0268265_10316216 3300028380 Bacteria 1412
487 Ga0268265_10787845 3300028380 Bacteria 925
488 Ga0268264_10029003 3300028381 Bacteria 4531
489 Ga0268264_10346580 3300028381 Bacteria 1412
490 Ga0268264_10680645 3300028381 Bacteria 1020
491 Ga0265762_1037164 3300030760 Bacteria 942
492 Ga0265770_1027242 3300030878 Bacteria 939
493 Ga0265764_102059 3300030882 Bacteria 955
494 Ga0265769_101548 3300030888 Bacteria 1116
495 Ga0265768_101626 3300030963 Bacteria 1075
496 Ga0265779_103053 3300031043 Bacteria 831
497 Ga0265760_10032426 3300031090 Bacteria 1542
498 Ga0265760_10034203 3300031090 Bacteria 1503
499 Ga0265760_10054051 3300031090 Bacteria 1212
500 Ga0265760_10075037 3300031090 Bacteria 1041
501 Ga0265760_10144350 3300031090 Bacteria 777
502 Ga0265328_10002562 3300031239 Bacteria 8137
503 Ga0265328_10002767 3300031239 Bacteria 7856
504 Ga0265325_10004526 3300031241 Bacteria 8761
505 Ga0265325_10095719 3300031241 Bacteria 1459
506 Ga0265340_10061845 3300031247 Bacteria 1790
507 Ga0265331_10000090 3300031250 Bacteria 123628
508 Ga0307513_10381013 3300031456 Bacteria 1150
509 Ga0307416_101626509 3300032002 Bacteria 751
510 Ga0316593_10095395 3300032168 Bacteria 1050
511 Ga0316593_10259870 3300032168 Bacteria 651
512 Ga0373948_0111424 3300034817 Bacteria 653
513 Ga0373958_0007926 3300034819 Bacteria 1707
514 Ga0373958_0036509 3300034819 Bacteria 988
515 Ga0373958_0117280 3300034819 Bacteria 640
516 Ga0373938_0032302 3300034957 Bacteria 1127
517 Ga0373926_0138408 3300035083 Bacteria 924
518 Ga0373926_0180864 3300035083 Bacteria 808
519 Ga0373928_0006795 3300035084 Bacteria 2204
520 Ga0373934_0135630 3300035086 Bacteria 1005
521 Ga0373934_0172891 3300035086 Bacteria 887
522 Ga0373940_0067916 3300035088 Bacteria 1032
523 Ga0373940_0103194 3300035088 Bacteria 868
524 Ga0373944_0034009 3300035089 Bacteria 1547
525 Ga0373949_0033618 3300035090 Bacteria 1233
526 Ga0373949_0087617 3300035090 Bacteria 838
527 Ga0373951_0017272 3300035091 Bacteria 1632
528 Ga0373923_0093422 3300035111 Bacteria 1319
529 Ga0373923_0173074 3300035111 Bacteria 989
530 Ga0373932_0089031 3300035112 Bacteria 987
531 Ga0373936_0021427 3300035113 Bacteria 2513
532 Ga0373936_0072039 3300035113 Bacteria 1426
533 Ga0373936_0179630 3300035113 Bacteria 928
534 Ga0373936_0353060 3300035113 Bacteria 670
535 Ga0373939_0349455 3300035114 Bacteria 601
536 Ga0373941_0061084 3300035115 Bacteria 1226
537 Ga0373941_0117029 3300035115 Bacteria 946
538 Ga0373945_0077430 3300035116 Bacteria 1269
539 Ga0373953_0134765 3300035117 Bacteria 1054
540 Ga0373954_0007780 3300035118 Bacteria 4691
541 Ga0373954_0110205 3300035118 Bacteria 1331
542 Ga0373957_0127343 3300035120 Bacteria 1034
543 Ga0373960_0008802 3300035121 Bacteria 2430
544 Ga0373960_0014402 3300035121 Bacteria 2003
545 Ga0373943_0021221 3300035170 Bacteria 2997
546 Ga0373943_0034585 3300035170 Bacteria 2411
547 Ga0373943_0051687 3300035170 Bacteria 2024
548 Ga0373946_0005255 3300035171 Bacteria 4668
549 Ga0373946_0259982 3300035171 Bacteria 849
550 Ga0373955_0025466 3300035172 Bacteria 3038
551 Ga0373955_0075552 3300035172 Bacteria 1894
552 Ga0373955_0249196 3300035172 Bacteria 1065
553 Ga0373955_0251425 3300035172 Bacteria 1060
554 Ga0373955_0532458 3300035172 Bacteria 718
555 Ga0373961_0040826 3300035241 Bacteria 1338
556 Ga0373961_0072878 3300035241 Bacteria 1065
557 Ga0373961_0169632 3300035241 Bacteria 754
558 Ga0373962_0076662 3300035242 Bacteria 1008
559 Ga0373962_0096421 3300035242 Bacteria 917
560 Ga0373924_0076838 3300035410 Bacteria 1415
561 Ga0373924_0219780 3300035410 Bacteria 839
562 Ga0373924_0222923 3300035410 Bacteria 833
563 Ga0373931_0002378 3300035691 Bacteria 8324
564 Ga0373931_0005234 3300035691 Bacteria 5985
565 Ga0373931_0006055 3300035691 Bacteria 5633
566 Ga0373931_0038610 3300035691 Bacteria 2499
567 Ga0373931_0422717 3300035691 Bacteria 847
568 Ga0373931_0757878 3300035691 Bacteria 645
569 Ga0373935_0053390 3300035692 Bacteria 2571
570 Ga0373935_0066271 3300035692 Bacteria 2319
571 Ga0373935_0075461 3300035692 Bacteria 2181
572 Ga0373935_0207475 3300035692 Bacteria 1356
573 Ga0373935_0311368 3300035692 Bacteria 1115
574 Ga0373935_0904239 3300035692 Bacteria 654
575 Ga0373927_0020216 3300035695 Bacteria 4365
576 Ga0373927_0034994 3300035695 Bacteria 3266
577 Ga0373927_0052050 3300035695 Bacteria 2648
578 Ga0373927_0076102 3300035695 Bacteria 2174
579 Ga0373927_0111654 3300035695 Bacteria 1781
580 Ga0373927_0555889 3300035695 Bacteria 758
581 Ga0373933_0018591 3300035724 Bacteria 3910
582 Ga0373933_0037236 3300035724 Bacteria 2853
583 Ga0373933_0103876 3300035724 Bacteria 1766
584 Ga0373933_0129893 3300035724 Bacteria 1583
585 Ga0373933_0232654 3300035724 Bacteria 1184
586 Ga0373933_0395963 3300035724 Bacteria 901
587 Ga0373933_0444398 3300035724 Bacteria 848
588 Ga0373947_0027740 3300035725 Bacteria 3315
589 Ga0373947_0028186 3300035725 Bacteria 3290
590 Ga0373947_0362263 3300035725 Bacteria 974
591 Ga0373947_0666391 3300035725 Bacteria 709
592 Ga0373937_0000738 3300036401 Bacteria 28294
593 Ga0373937_0049095 3300036401 Bacteria 3865
594 Ga0373937_0061168 3300036401 Bacteria 3461
595 Ga0373925_0038780 3300037068 Bacteria 3524
596 Ga0373925_0223894 3300037068 Bacteria 1502
597 Ga0373925_0262950 3300037068 Bacteria 1386
598 Ga0373925_0291232 3300037068 Bacteria 1317
599 Ga0373925_0327007 3300037068 Bacteria 1241
600 Ga0373925_0604719 3300037068 Bacteria 903
601 Ga0436364_1301289 3300037853 Bacteria 6961
602 Ga0400483_208194 3300039062 Bacteria 2289
603 Ga0436365_1177006 3300039437 Bacteria 12291
604 Ga0436365_1478616 3300039437 Bacteria 2080
605 Ga0436360_0000114 3300039438 Bacteria 1400
606 Ga0436360_1180523 3300039438 Bacteria 771
607 Ga0436360_1284835 3300039438 Unclassified 651
608 Ga0436361_0461209 3300039447 Bacteria 8012
609 Ga0436362_0545650 3300039453 Bacteria 738
610 Ga0436362_0849582 3300039453 Bacteria 4873
611 Ga0451787_591290 3300041441 Bacteria 579
612 Ga0451847_0495246 3300041503 Bacteria 777
613 Ga0451851_0357189 3300041507 Bacteria 1000
614 Ga0451853_3316096 3300041512 Bacteria 1631
615 Ga0439434_0182935 3300042435 Bacteria 702
616 Ga0466966_0040519 3300044684 Bacteria 2998
617 Ga0466963_0199400 3300044694 Bacteria 1400
618 Ga0466964_0458620 3300044706 Bacteria 677
619 Ga0466959_0034253 3300045049 Bacteria 3757
620 Ga0466958_0068971 3300045836 Bacteria 2162
621 Ga0466967_0739032 3300045976 Bacteria 976
622 Ga0466967_0753926 3300045976 Bacteria 965
623 Ga0466967_0877860 3300045976 Bacteria 892
624 Ga0466967_1415665 3300045976 Bacteria 692
625 Ga0495617_109315 3300046452 Bacteria 895
626 Ga0495592_0063387 3300046454 Bacteria 2711
627 Ga0495592_0100776 3300046454 Bacteria 2059
628 Ga0495592_0283656 3300046454 Bacteria 1082
629 Ga0495603_0163516 3300046455 Bacteria 1291
630 Ga0495603_0280983 3300046455 Bacteria 957
631 Ga0495590_0028005 3300046457 Bacteria 1977
632 Ga0495590_0123905 3300046457 Bacteria 927
633 Ga0495590_0276239 3300046457 Bacteria 629
634 Ga0495629_0074732 3300046459 Bacteria 2366
635 Ga0495629_0159793 3300046459 Bacteria 1565
636 Ga0495629_0183237 3300046459 Bacteria 1451
637 Ga0495629_0215213 3300046459 Bacteria 1326
638 Ga0495638_0019017 3300046460 Bacteria 4550
639 Ga0495638_0264511 3300046460 Bacteria 942
640 Ga0495641_0011908 3300046461 Bacteria 4909
641 Ga0495651_0001350 3300046462 Bacteria 18992
642 Ga0495651_0099025 3300046462 Bacteria 2174
643 Ga0495651_0304506 3300046462 Bacteria 1068
644 Ga0495653_0000370 3300046463 Bacteria 36284
645 Ga0495580_0014484 3300046472 Bacteria 5981
646 Ga0495582_0364829 3300046473 Bacteria 832
647 Ga0495605_0052400 3300046474 Bacteria 1983
648 Ga0495639_0139504 3300046475 Bacteria 1165
649 Ga0495639_0197551 3300046475 Bacteria 984
650 Ga0495662_0090625 3300046476 Bacteria 1491
651 Ga0495662_0200094 3300046476 Bacteria 985
652 Ga0495662_0207649 3300046476 Bacteria 965
653 Ga0495664_0224846 3300046477 Bacteria 1136
654 Ga0495664_0252450 3300046477 Bacteria 1066
655 Ga0495664_0336221 3300046477 Bacteria 910
656 Ga0495584_0033743 3300046491 Bacteria 2590
657 Ga0495584_0041190 3300046491 Bacteria 2332
658 Ga0495584_0434132 3300046491 Bacteria 668
659 Ga0495585_0126948 3300046492 Bacteria 1345
660 Ga0495594_0294777 3300046499 Bacteria 924
661 Ga0495594_0613398 3300046499 Bacteria 617
662 Ga0495596_0115972 3300046500 Bacteria 1040
663 Ga0495607_0193359 3300046501 Bacteria 1012
664 Ga0495608_0011250 3300046511 Bacteria 6229
665 Ga0495608_0090482 3300046511 Bacteria 1980
666 Ga0495608_0249692 3300046511 Bacteria 1106
667 Ga0495608_0268853 3300046511 Bacteria 1060
668 Ga0495616_0078135 3300046513 Bacteria 1588
669 Ga0495618_0152903 3300046514 Bacteria 1473
670 Ga0495618_0382210 3300046514 Bacteria 864
671 Ga0495618_0427352 3300046514 Bacteria 807
672 Ga0495628_0059243 3300046516 Bacteria 3006
673 Ga0495628_0074123 3300046516 Bacteria 2652
674 Ga0495628_0618631 3300046516 Bacteria 772
675 Ga0495631_0121723 3300046518 Bacteria 1122
676 Ga0495632_0189414 3300046519 Bacteria 940
677 Ga0495666_0101647 3300046526 Bacteria 1354
678 Ga0495642_0183546 3300046528 Bacteria 911
679 Ga0495652_0030444 3300046529 Bacteria 4734
680 Ga0495652_0153276 3300046529 Bacteria 1797
681 Ga0495652_0475115 3300046529 Bacteria 871
682 Ga0495640_0015332 3300046533 Bacteria 5769
683 Ga0495640_0060714 3300046533 Bacteria 2570
684 Ga0495640_0275042 3300046533 Bacteria 1050
685 Ga0495586_0232644 3300046535 Bacteria 1049
686 Ga0495586_0288423 3300046535 Bacteria 940
687 Ga0495586_0425799 3300046535 Bacteria 765
688 Ga0495586_0784575 3300046535 Bacteria 550
689 Ga0495587_0003682 3300046536 Bacteria 10197
690 Ga0495587_0145268 3300046536 Bacteria 1353
691 Ga0495587_0150089 3300046536 Bacteria 1328
692 Ga0495598_0137616 3300046537 Bacteria 842
693 Ga0495621_0081324 3300046539 Bacteria 1208
694 Ga0495597_0120857 3300046542 Bacteria 1092
695 Ga0495645_0070870 3300046543 Bacteria 2515
696 Ga0495645_0311898 3300046543 Bacteria 1024
697 Ga0495622_0139519 3300046557 Bacteria 1101
698 Ga0495633_0388565 3300046558 Bacteria 631
699 Ga0495667_0130782 3300046559 Bacteria 1619
700 Ga0495667_0695433 3300046559 Bacteria 630
701 Ga0495656_0068481 3300046615 Bacteria 1569
702 Ga0495656_0073183 3300046615 Bacteria 1527
703 Ga0495656_0104884 3300046615 Bacteria 1313
704 Ga0495656_0340944 3300046615 Bacteria 775
705 Ga0495668_0051446 3300046616 Bacteria 2281
706 Ga0495668_0388276 3300046616 Bacteria 767
707 Ga0495668_0406025 3300046616 Bacteria 749
708 Ga0495634_0098263 3300046642 Bacteria 1894
709 Ga0495634_0122871 3300046642 Bacteria 1662
710 Ga0495634_0142180 3300046642 Bacteria 1523
711 Ga0495625_0549528 3300046660 Bacteria 700
712 Ga0495635_0151004 3300046663 Bacteria 1582
713 Ga0495635_0292641 3300046663 Bacteria 1092
714 Ga0495661_0104429 3300046665 Bacteria 1589
715 Ga0495657_0059369 3300046675 Bacteria 2537
716 Ga0495657_0247402 3300046675 Bacteria 1074
717 Ga0495657_0517338 3300046675 Bacteria 695
718 Ga0495599_0027303 3300046678 Bacteria 3578
719 Ga0495599_0162456 3300046678 Bacteria 1380
720 Ga0495599_0250164 3300046678 Bacteria 1079
721 Ga0495623_0250024 3300046679 Bacteria 997
722 Ga0495646_0017780 3300046680 Bacteria 4507
723 Ga0495646_0073204 3300046680 Bacteria 2013
724 Ga0495647_0015066 3300046681 Bacteria 2703
725 Ga0495647_0133349 3300046681 Bacteria 1054
726 Ga0495647_0158271 3300046681 Bacteria 975
727 Ga0495658_0078400 3300046683 Bacteria 1934
728 Ga0495658_0523945 3300046683 Bacteria 759
729 Ga0495658_0654726 3300046683 Bacteria 673
730 Ga0495669_0021802 3300046684 Bacteria 2783
731 Ga0495613_0044468 3300046689 Bacteria 3286
732 Ga0495613_0134657 3300046689 Bacteria 1768
733 Ga0495613_0177227 3300046689 Bacteria 1511
734 Ga0495613_0300573 3300046689 Bacteria 1111
735 Ga0495624_0124651 3300046690 Bacteria 1581
736 Ga0495670_0228795 3300046691 Bacteria 988
737 Ga0495671_0163956 3300046692 Bacteria 1081
738 Ga0495671_0322940 3300046692 Bacteria 741
739 Ga0495649_0252518 3300046694 Bacteria 905
740 Ga0495589_0145129 3300046794 Bacteria 1135
741 Ga0495589_0198799 3300046794 Bacteria 947
742 Ga0495600_0047489 3300046809 Bacteria 2800
743 Ga0495600_0048458 3300046809 Bacteria 2772
744 Ga0495600_0075956 3300046809 Bacteria 2194
745 Ga0495660_0055552 3300046810 Bacteria 2143
746 Ga0495581_0035801 3300047315 Bacteria 2872
747 Ga0495581_0204554 3300047315 Bacteria 1155
748 Ga0495604_0000406 3300047317 Bacteria 38847
749 Ga0495604_0187842 3300047317 Bacteria 1442
750 Ga0495604_0280163 3300047317 Bacteria 1127
751 Ga0495674_0000757 3300047319 Bacteria 30677
752 Ga0495674_0163882 3300047319 Bacteria 1859
753 Ga0495674_0181468 3300047319 Bacteria 1753
754 Ga0495676_0108799 3300047321 Bacteria 2038
755 Ga0495676_0178920 3300047321 Bacteria 1487
756 Ga0495680_0017428 3300047322 Bacteria 6135
757 Ga0495680_0040052 3300047322 Bacteria 3734
758 Ga0495680_0152467 3300047322 Bacteria 1684
759 Ga0495680_0244580 3300047322 Bacteria 1273
760 Ga0495680_0596809 3300047322 Bacteria 739
761 Ga0495683_0124444 3300047323 Bacteria 1221
762 Ga0495675_0054537 3300047444 Bacteria 2536
763 Ga0495675_0131278 3300047444 Bacteria 1557
764 Ga0495675_0406419 3300047444 Bacteria 793
765 Ga0495677_0021350 3300047445 Bacteria 2347
766 Ga0495684_0021662 3300047471 Bacteria 4949
767 Ga0495684_0247682 3300047471 Bacteria 1297
768 Ga0495684_0584699 3300047471 Bacteria 755
769 Ga0495593_0205678 3300047673 Bacteria 989
770 Ga0495593_0244166 3300047673 Bacteria 899
771 Ga0495602_0024694 3300048088 Bacteria 5828
772 Ga0495602_0146594 3300048088 Bacteria 1861
773 Ga0495602_0149309 3300048088 Bacteria 1839
774 Ga0495615_0066604 3300048090 Bacteria 962
775 Ga0496100_0035219 3300048903 Bacteria 3147
776 Ga0496100_0110841 3300048903 Bacteria 1906
777 Ga0496100_0220690 3300048903 Bacteria 1391
778 Ga0496100_0224610 3300048903 Bacteria 1379
779 Ga0496100_0256400 3300048903 Bacteria 1295
780 Ga0496100_0454174 3300048903 Bacteria 982
781 Ga0496100_0550976 3300048903 Bacteria 892
782 Ga0496100_0884031 3300048903 Bacteria 701
783 Ga0496101_0008120 3300048904 Bacteria 6848
784 Ga0496101_0014496 3300048904 Bacteria 5298
785 Ga0496101_0041258 3300048904 Bacteria 3290
786 Ga0496101_0062158 3300048904 Bacteria 2714
787 Ga0496101_0134052 3300048904 Bacteria 1883
788 Ga0496102_0000209 3300048905 Bacteria 78525
789 Ga0496102_0021152 3300048905 Bacteria 5752
790 Ga0496102_0053476 3300048905 Bacteria 3680
791 Ga0496102_0163428 3300048905 Bacteria 2094
792 Ga0496102_0172697 3300048905 Bacteria 2035
793 Ga0496102_0327775 3300048905 Bacteria 1442
794 Ga0496102_0388955 3300048905 Bacteria 1312
795 Ga0496103_0000136 3300048906 Bacteria 76530
796 Ga0496103_0007584 3300048906 Bacteria 6461
797 Ga0496103_0043000 3300048906 Bacteria 2782
798 Ga0496103_0174468 3300048906 Bacteria 1381
799 Ga0496103_0594710 3300048906 Bacteria 705
800 Ga0496104_0000216 3300048907 Bacteria 50674
801 Ga0496104_0006745 3300048907 Bacteria 10111
802 Ga0496104_0019461 3300048907 Bacteria 6212
803 Ga0496104_0039907 3300048907 Bacteria 4397
804 Ga0496104_0050460 3300048907 Bacteria 3925
805 Ga0496104_0063677 3300048907 Bacteria 3498
806 Ga0496104_0091707 3300048907 Bacteria 2905
807 Ga0496104_0121336 3300048907 Bacteria 2509
808 Ga0496104_0131005 3300048907 Bacteria 2408
809 Ga0496104_0452236 3300048907 Bacteria 1196
810 Ga0496105_0001544 3300048908 Bacteria 16304
811 Ga0496105_0007866 3300048908 Bacteria 8276
812 Ga0496105_0017685 3300048908 Bacteria 5719
813 Ga0496105_0022105 3300048908 Bacteria 5152
814 Ga0496105_0044071 3300048908 Bacteria 3678
815 Ga0496105_0072606 3300048908 Bacteria 2844
816 Ga0496105_0157444 3300048908 Bacteria 1865
817 Ga0496105_0166640 3300048908 Bacteria 1808
818 Ga0496105_0843429 3300048908 Bacteria 694
819 Ga0496106_0002752 3300048909 Bacteria 13020
820 Ga0496106_0032427 3300048909 Bacteria 3894
821 Ga0496106_0145015 3300048909 Bacteria 1869
822 Ga0496106_0546073 3300048909 Bacteria 930
823 Ga0496106_0892852 3300048909 Bacteria 702
824 Ga0496107_0010775 3300048910 Bacteria 6357
825 Ga0496107_0070941 3300048910 Bacteria 2530
826 Ga0496107_0232832 3300048910 Bacteria 1371
827 Ga0496107_0236811 3300048910 Bacteria 1358
828 Ga0496107_0418851 3300048910 Bacteria 996
829 Ga0496108_0004212 3300048911 Bacteria 11584
830 Ga0496108_0011283 3300048911 Bacteria 7258
831 Ga0496108_0073188 3300048911 Bacteria 2893
832 Ga0496108_0087385 3300048911 Bacteria 2647
833 Ga0496108_0170428 3300048911 Bacteria 1883
834 Ga0496108_0223930 3300048911 Bacteria 1634
835 Ga0496108_0336329 3300048911 Bacteria 1317
836 Ga0496108_1044934 3300048911 Bacteria 696
837 Ga0496109_0002089 3300048912 Bacteria 16594
838 Ga0496109_0034169 3300048912 Bacteria 4577
839 Ga0496109_0077980 3300048912 Bacteria 3049
840 Ga0496109_0142277 3300048912 Bacteria 2243
841 Ga0496109_0409308 3300048912 Bacteria 1281
842 Ga0496110_0000957 3300048913 Bacteria 20216
843 Ga0496110_0005751 3300048913 Bacteria 9739
844 Ga0496110_0027980 3300048913 Bacteria 4837
845 Ga0496110_0039920 3300048913 Bacteria 4089
846 Ga0496110_0049475 3300048913 Bacteria 3688
847 Ga0496110_0076934 3300048913 Bacteria 2967
848 Ga0496110_0310029 3300048913 Bacteria 1437
849 Ga0496110_0514936 3300048913 Bacteria 1089
850 Ga0496111_0003285 3300048914 Bacteria 9991
851 Ga0496111_0016660 3300048914 Bacteria 5068
852 Ga0496111_0067330 3300048914 Bacteria 2602
853 Ga0496111_0146065 3300048914 Bacteria 1753
854 Ga0496111_0157384 3300048914 Bacteria 1686
855 Ga0496111_0190774 3300048914 Bacteria 1523
856 Ga0496111_0334862 3300048914 Unclassified 1120
857 Ga0496111_0484582 3300048914 Bacteria 911
858 Ga0496112_0001871 3300048915 Bacteria 16591
859 Ga0496112_0016832 3300048915 Bacteria 6859
860 Ga0496112_0020950 3300048915 Bacteria 6208
861 Ga0496112_0033830 3300048915 Bacteria 4971
862 Ga0496112_0037563 3300048915 Bacteria 4726
863 Ga0496112_0235478 3300048915 Bacteria 1784
864 Ga0496112_0253719 3300048915 Bacteria 1709
865 Ga0496112_0461241 3300048915 Bacteria 1208
866 Ga0496112_0593791 3300048915 Bacteria 1039
867 Ga0496113_0001187 3300048916 Bacteria 14244
868 Ga0496113_0004691 3300048916 Bacteria 8433
869 Ga0496113_0010148 3300048916 Bacteria 6215
870 Ga0496113_0029812 3300048916 Bacteria 3944
871 Ga0496113_0079684 3300048916 Bacteria 2508
872 Ga0496113_0145424 3300048916 Bacteria 1867
873 Ga0496114_0015539 3300048917 Bacteria 6120
874 Ga0496114_0197218 3300048917 Bacteria 1762
875 Ga0496114_0244952 3300048917 Bacteria 1577
876 Ga0496114_0268813 3300048917 Bacteria 1502
877 Ga0496114_0548029 3300048917 Bacteria 1022
878 Ga0496115_0003653 3300048918 Bacteria 11071
879 Ga0496115_0013250 3300048918 Bacteria 6231
880 Ga0496115_0021874 3300048918 Bacteria 4945
881 Ga0496115_0178411 3300048918 Bacteria 1756
882 Ga0496115_0365208 3300048918 Bacteria 1175
883 Ga0496116_0074607 3300048919 Bacteria 2132
884 Ga0496117_0003081 3300048920 Bacteria 19958
885 Ga0496118_0002164 3300048921 Bacteria 27354
886 Ga0496119_0025264 3300048922 Bacteria 4152
887 Ga0496120_0005023 3300048923 Bacteria 10727
888 Ga0496121_0014188 3300048924 Bacteria 8479
889 Ga0496122_0036930 3300048925 Bacteria 3941
890 Ga0496123_0047532 3300048926 Bacteria 2897
891 Ga0496124_0006468 3300048927 Bacteria 12757
892 Ga0496125_0038811 3300048928 Bacteria 4112
893 Ga0496126_0000365 3300048929 Bacteria 93461
894 Ga0495682_0230361 3300049460 Bacteria 656
895 Ga0501031_0028040 3300049568 Bacteria 3670
896 Ga0501031_0156056 3300049568 Bacteria 1492
897 Ga0501031_0267401 3300049568 Bacteria 1111
898 Ga0501033_0009158 3300049570 Bacteria 7628
899 Ga0501033_0101173 3300049570 Bacteria 2103
900 Ga0501033_0223249 3300049570 Bacteria 1340
901 Ga0501034_0018837 3300049571 Bacteria 7075
902 Ga0501034_0102551 3300049571 Bacteria 2854
903 Ga0501034_0200814 3300049571 Bacteria 1952
904 Ga0501034_0633547 3300049571 Bacteria 972
905 Ga0501036_0020436 3300049572 Bacteria 5562
906 Ga0501036_0113295 3300049572 Bacteria 2292
907 Ga0501036_0158651 3300049572 Bacteria 1908
908 Ga0501037_0014734 3300049573 Bacteria 5750
909 Ga0501038_0052812 3300049574 Bacteria 3502
910 Ga0501038_0294709 3300049574 Bacteria 1274
911 Ga0501039_0101980 3300049575 Bacteria 2240
912 Ga0501039_0162274 3300049575 Bacteria 1757
913 Ga0501041_0273886 3300049577 Bacteria 1062
914 Ga0501042_0156301 3300049578 Bacteria 1645
915 Ga0501042_0391232 3300049578 Bacteria 1007
916 Ga0501042_0617977 3300049578 Bacteria 788
917 Ga0501043_0120689 3300049579 Bacteria 2055
918 Ga0501043_0126003 3300049579 Bacteria 2008
919 Ga0501046_0084481 3300049580 Bacteria 2448
920 Ga0501046_0337348 3300049580 Bacteria 1096
921 Ga0501047_0041996 3300049581 Bacteria 4419
922 Ga0501047_0061189 3300049581 Bacteria 3633
923 Ga0501047_0178680 3300049581 Bacteria 1989
924 Ga0501047_0472238 3300049581 Bacteria 1082
925 Ga0501048_0016143 3300049582 Bacteria 5504
926 Ga0501048_0657362 3300049582 Bacteria 753
927 Ga0501048_0657654 3300049582 Bacteria 752
928 Ga0501067_0050188 3300049583 Bacteria 2313
929 Ga0501067_0278463 3300049583 Bacteria 931
930 Ga0501068_0010731 3300049584 Bacteria 5151
931 Ga0501068_0219719 3300049584 Bacteria 1208
932 Ga0501069_0007541 3300049585 Bacteria 5710
933 Ga0501069_0834934 3300049585 Bacteria 559
934 Ga0501070_0011236 3300049586 Bacteria 7561
935 Ga0501070_0075859 3300049586 Bacteria 2783
936 Ga0501071_0084803 3300049587 Bacteria 2323
937 Ga0501071_0225740 3300049587 Bacteria 1410
938 Ga0501072_0031974 3300049588 Bacteria 4120
939 Ga0501072_0154019 3300049588 Bacteria 1833
940 Ga0501072_0403463 3300049588 Bacteria 1084
941 Ga0501073_0742847 3300049589 Bacteria 677
942 Ga0501074_0009597 3300049590 Bacteria 7026
943 Ga0501074_0654284 3300049590 Bacteria 742
944 Ga0501075_0037316 3300049591 Bacteria 3630
945 Ga0501076_0450385 3300049592 Bacteria 1060
946 Ga0501076_0457805 3300049592 Bacteria 1050
947 Ga0501076_0467618 3300049592 Bacteria 1039
948 Ga0501077_0435853 3300049593 Bacteria 839
949 Ga0501077_0844258 3300049593 Bacteria 589
950 Ga0501079_0342739 3300049741 Bacteria 1171
951 Ga0501080_0024779 3300049742 Bacteria 5564
952 Ga0501080_0052695 3300049742 Bacteria 3787
953 Ga0501080_1512344 3300049742 Bacteria 570
954 Ga0501081_0140995 3300049743 Bacteria 1728
955 Ga0501083_0026337 3300049744 Bacteria 4019
956 Ga0501035_0206899 3300049822 Bacteria 1680
957 Ga0501035_0572725 3300049822 Bacteria 923
958 Ga0501044_0000222 3300049823 Bacteria 71930
959 Ga0501044_0058684 3300049823 Bacteria 3945
960 Ga0501044_0258115 3300049823 Bacteria 1681
961 Ga0501044_0345920 3300049823 Bacteria 1407
962 Ga0501045_0152435 3300049824 Bacteria 1720
963 Ga0501045_0761108 3300049824 Bacteria 714
964 nmdc:mga03683_14874_c1 3300050489 Bacteria 2890
965 nmdc:mga03683_40755_c1 3300050489 Bacteria 1906
966 nmdc:mga03683_61659_c1 3300050489 Bacteria 1587
967 nmdc:mga03n38_334605_c1 3300050490 Bacteria 821
968 nmdc:mga03n38_46294_c1 3300050490 Bacteria 1920
969 nmdc:mga00v17_125125_c1 3300050491 Bacteria 1640
970 nmdc:mga00v17_136323_c1 3300050491 Bacteria 1572
971 nmdc:mga00v17_290693_c1 3300050491 Bacteria 1061
972 nmdc:mga00v17_8455_c1 3300050491 Bacteria 5540
973 nmdc:mga0yw44_12993_c2 3300050492 Bacteria 3661
974 nmdc:mga0yw44_396701_c1 3300050492 Bacteria 933
975 nmdc:mga0yw44_99059_c1 3300050492 Bacteria 1854
976 nmdc:mga0k408_146520_c1 3300050493 Bacteria 1406
977 nmdc:mga06z11_114765_c1 3300050494 Bacteria 1496
978 nmdc:mga06z11_31320_c1 3300050494 Bacteria 2583
979 nmdc:mga06z11_435059_c1 3300050494 Bacteria 792
980 nmdc:mga06z11_52880_c2 3300050494 Bacteria 1383
981 nmdc:mga04h51_17605_c1 3300050495 Bacteria 2093
982 nmdc:mga04h51_323858_c1 3300050495 Bacteria 632
983 nmdc:mga07m45_111984_c1 3300050496 Bacteria 1572
984 nmdc:mga07m45_161526_c1 3300050496 Bacteria 1301
985 nmdc:mga07m45_167343_c1 3300050496 Bacteria 1277
986 nmdc:mga07m45_28225_c2 3300050496 Bacteria 2627
987 nmdc:mga05p37_112059_c1 3300050507 Bacteria 3355
988 nmdc:mga05p37_436445_c1 3300050507 Bacteria 1520
989 nmdc:mga05p37_57360_c1 3300050507 Bacteria 4796
990 nmdc:mga05p37_726278_c1 3300050507 Bacteria 1099
991 nmdc:mga05p37_8282_c1 3300050507 Bacteria 12293
992 nmdc:mga05p37_87997_c1 3300050507 Bacteria 3829
993 nmdc:mga09592_49714_c1 3300050508 Bacteria 3535
994 nmdc:mga0qj67_169369_c1 3300050509 Bacteria 1773
995 nmdc:mga0qj67_42263_c1 3300050509 Bacteria 3588
996 nmdc:mga06r32_121400_c1 3300050510 Bacteria 2578
997 nmdc:mga06r32_227144_c1 3300050510 Bacteria 1855
998 nmdc:mga06r32_257049_c1 3300050510 Bacteria 1734
999 nmdc:mga06r32_84343_c1 3300050510 Bacteria 3096
1000 nmdc:mga06r32_984980_c1 3300050510 Bacteria 796
1001 nmdc:mga08y16_332126_c1 3300050511 Bacteria 1564
1002 nmdc:mga08y16_458143_c1 3300050511 Bacteria 1300
1003 nmdc:mga08y16_746274_c1 3300050511 Bacteria 975
1004 nmdc:mga08y16_751155_c1 3300050511 Bacteria 971
1005 nmdc:mga08y16_766335_c1 3300050511 Bacteria 960
1006 nmdc:mga08y16_968828_c1 3300050511 Bacteria 832
1007 nmdc:mga0n895_139301_c1 3300050512 Bacteria 2454
1008 nmdc:mga0n895_158203_c1 3300050512 Bacteria 2297
1009 nmdc:mga0n895_21813_c1 3300050512 Bacteria 5995
1010 nmdc:mga0n895_35152_c1 3300050512 Bacteria 4829
1011 nmdc:mga0n895_704222_c1 3300050512 Bacteria 1006
1012 nmdc:mga0n895_90250_c1 3300050512 Bacteria 3066
1013 nmdc:mga0rr50_159903_c1 3300050513 Bacteria 1827
1014 nmdc:mga0rr50_16458_c1 3300050513 Bacteria 4914
1015 nmdc:mga0rr50_67288_c1 3300050513 Bacteria 2720
1016 nmdc:mga08x19_243839_c1 3300050514 Bacteria 1239
1017 nmdc:mga08x19_707223_c1 3300050514 Bacteria 715
1018 nmdc:mga08x19_90213_c1 3300050514 Bacteria 2022
1019 nmdc:mga0a205_20293_c1 3300050515 Bacteria 6267
1020 nmdc:mga0a205_225769_c1 3300050515 Bacteria 1757
1021 nmdc:mga0a205_56225_c1 3300050515 Bacteria 3799
1022 nmdc:mga0sz30_190704_c1 3300050516 Bacteria 910
1023 Ga0495601_0015405 3300053077 Bacteria 4621
1024 Ga0495601_0053584 3300053077 Bacteria 2550
1025 Ga0495601_0094928 3300053077 Bacteria 1922
1026 Ga0495601_0121362 3300053077 Bacteria 1697
1027 Ga0495601_0198257 3300053077 Bacteria 1312
1028 Ga0495612_0011337 3300053078 Bacteria 3592
1029 Ga0495612_0018234 3300053078 Bacteria 2811
1030 Ga0495612_0074633 3300053078 Bacteria 1418
1031 Ga0495612_0092669 3300053078 Bacteria 1281
1032 Ga0495612_0123919 3300053078 Bacteria 1113
1033 Ga0495655_0001908 3300053083 Bacteria 3251
1034 Ga0495595_0005553 3300053084 Bacteria 5104
1035 Ga0495595_0018912 3300053084 Bacteria 2983
1036 Ga0495619_0000352 3300053085 Bacteria 32130
1037 Ga0495619_0081016 3300053085 Bacteria 2185
1038 Ga0495619_0115696 3300053085 Bacteria 1835
1039 Ga0495619_0184034 3300053085 Bacteria 1445
1040 Ga0500651_0347081 3300053093 Bacteria 843
1041 Ga0500566_0181781 3300053094 Bacteria 1078
1042 Ga0500556_0157977 3300053104 Bacteria 895
1043 Ga0500592_040323 3300053116 Bacteria 755
1044 Ga0500595_054206 3300053119 Bacteria 1231
1045 Ga0500652_110847 3300053131 Bacteria 1147
1046 Ga0501084_0901999 3300054114 Bacteria 743
1047 Ga0587080_025475 3300059503 Bacteria 999
1048 Ga0587080_054655 3300059503 Bacteria 763
1049 Ga0587083_0060285 3300059505 Bacteria 853
1050 Ga0587085_012695 3300059506 Bacteria 1160
1051 Ga0587088_025739 3300059508 Bacteria 1017
1052 Ga0587089_017516 3300059509 Bacteria 964
1053 Ga0587092_025380 3300059512 Bacteria 946
1054 Ga0587094_019395 3300059513 Bacteria 975
1055 Ga0587106_038044 3300059605 Bacteria 804
1056 Ga0587109_032454 3300059624 Bacteria 998
1057 Ga0587115_030563 3300059626 Bacteria 799
1058 Ga0587067_122581 3300059640 Bacteria 626
1059 Ga0587076_026938 3300059645 Bacteria 993
1060 Ga0587119_025332 3300059658 Bacteria 782
1061 Ga0587071_067179 3300060344 Bacteria 773
1062 Ga0501082_0150052 3300060353 Bacteria 2024
1063 Ga0501082_0315485 3300060353 Bacteria 1362
1064 Ga0501082_0470576 3300060353 Bacteria 1098
1065 Ga0530510_0212718 3300061734 Bacteria 1436
1066 Ga0530510_0369401 3300061734 Bacteria 1079
1067 Ga0114129_10007287
1068 SwRhRL2b_contig_928900
1069 JGI24752J21851_1010794
1070 JGI24746J21847_1034767
1071 JGI24747J21853_1000783
1072 JGI24743J22301_10000545
1073 JGI24750J21931_1000608
1074 JGI24745J21846_1001324
1075 JGI24748J21848_1016301
1076 JGI24738J21930_10017214
1077 JGI24744J21845_10021401
1078 JGI24033J26618_1022590
1079 JGI24034J26672_10013420
1080 JGI24742J22300_10000494
1081 JGI24751J29686_10070723
1082 Ga0006778J45830_1025950
1083 Ga0006759J45824_1025221
1084 JGI25153J46596_10027869
1085 Ga0006770J48903_1016436
1086 Ga0006770J48903_1018624
1087 Ga0006777J48905_1026730
1088 Ga0007417J51691_1011846
1089 Ga0007417J51691_1064053
1090 Ga0007417J51691_1090788
1091 Ga0007410J51695_1011393
1092 Ga0007410J51695_1017954
1093 Ga0007409J51694_1012438
1094 Ga0007416J51690_1011541
1095 Ga0007416J51690_1027190
1096 Ga0007429J51699_1012285
1097 Ga0007429J51699_1028685
1098 Ga0032354_1007221
1099 Ga0032354_1009030
1100 Ga0032354_1055567
1101 Ga0006780_1014936
1102 Ga0058859_10006780
1103 Ga0058859_10053581
1104 Ga0058863_10040969
1105 Ga0058863_10089195
1106 Ga0058861_11915796
1107 Ga0058861_11965021
1108 Ga0058860_10086571
1109 Ga0058860_12029249
1110 Ga0058860_12099535
1111 Ga0058862_10049443
1112 Ga0065704_10000553
1113 Ga0070658_10689467
1114 Ga0070676_10278864
1115 Ga0070683_100698280
1116 Ga0070690_100810136
1117 Ga0070670_100011506
1118 Ga0070670_100036131
1119 Ga0070670_100349936
1120 Ga0070670_100422356
1121 Ga0070670_100772342
1122 Ga0070677_10043878
1123 Ga0070677_10165959
1124 Ga0068869_100228871
1125 Ga0070666_10028586
1126 Ga0070666_10206231
1127 Ga0070680_100260440
1128 Ga0070682_100393926
1129 Ga0068868_100038242
1130 Ga0068868_100894253
1131 Ga0070660_100130663
1132 Ga0070689_100033167
1133 Ga0070689_100087845
1134 Ga0070691_10131503
1135 Ga0070691_10151234
1136 Ga0070687_100014984
1137 Ga0070687_100064073
1138 Ga0070661_100563821
1139 Ga0070692_10007754
1140 Ga0070668_100001285
1141 Ga0070668_100143988
1142 Ga0070668_100507773
1143 Ga0070669_100000074
1144 Ga0070669_100752916
1145 Ga0070669_100759942
1146 Ga0070675_100030048
1147 Ga0070671_100000375
1148 Ga0070671_100036384
1149 Ga0070671_100127062
1150 Ga0070671_100263577
1151 Ga0070674_100055867
1152 Ga0070674_100404345
1153 Ga0070673_100024238
1154 Ga0070673_100032283
1155 Ga0070673_100300195
1156 Ga0070688_100010662
1157 Ga0070659_100025282
1158 Ga0070667_100005448
1159 Ga0070667_100038588
1160 Ga0070667_100093784
1161 Ga0070667_100671108
1162 Ga0070709_10008033
1163 Ga0070709_10310767
1164 Ga0070714_100117554
1165 Ga0070714_100178008
1166 Ga0070714_100463706
1167 Ga0070714_100471968
1168 Ga0070714_100608313
1169 Ga0070714_100633876
1170 Ga0070714_100839419
1171 Ga0070713_100021935
1172 Ga0070713_100051961
1173 Ga0070713_100053967
1174 Ga0070713_100211368
1175 Ga0070713_100212197
1176 Ga0070713_100350927
1177 Ga0070713_100403607
1178 Ga0070713_101668449
1179 Ga0070710_10019414
1180 Ga0070710_10045592
1181 Ga0070710_10116972
1182 Ga0070701_10007231
1183 Ga0070711_100075083
1184 Ga0070711_100123458
1185 Ga0070711_100206839
1186 Ga0070705_100064131
1187 Ga0070700_100207103
1188 Ga0070694_100231643
1189 Ga0070694_100303832
1190 Ga0070708_100113114
1191 Ga0070708_100632261
1192 Ga0070663_101246631
1193 Ga0070678_100295195
1194 Ga0070678_100681612
1195 Ga0070662_100032411
1196 Ga0070662_100240719
1197 Ga0068867_100037084
1198 Ga0070685_10172323
1199 Ga0070707_100083729
1200 Ga0070698_100427130
1201 Ga0070699_100165360
1202 Ga0070679_100122101
1203 Ga0070684_100095669
1204 Ga0070697_100129515
1205 Ga0068853_100009776
1206 Ga0068853_100520349
1207 Ga0070672_100048470
1208 Ga0070672_100197208
1209 Ga0070695_100313458
1210 Ga0070696_100023722
1211 Ga0070696_100082878
1212 Ga0070693_100233962
1213 Ga0070665_100001089
1214 Ga0070665_100065818
1215 Ga0070665_100418862
1216 Ga0070665_100805357
1217 Ga0068855_100577271
1218 Ga0068855_100799945
1219 Ga0070664_100074806
1220 Ga0070664_100158279
1221 Ga0068857_100323033
1222 Ga0068854_100045799
1223 Ga0068854_100400426
1224 Ga0068854_100576948
1225 Ga0068856_100530235
1226 Ga0070702_100108968
1227 Ga0070702_100282332
1228 Ga0070702_100822591
1229 Ga0068852_100041698
1230 Ga0068859_100235955
1231 Ga0068859_100432387
1232 Ga0068859_100764296
1233 Ga0068864_100013204
1234 Ga0068864_100383399
1235 Ga0068864_100875848
1236 Ga0068866_10223926
1237 Ga0068866_10288332
1238 Ga0068861_100098448
1239 Ga0068870_10005952
1240 Ga0068863_100044328
1241 Ga0068863_100485800
1242 Ga0068858_101297496
1243 Ga0068858_101484172
1244 Ga0068860_100038459
1245 Ga0068860_100091662
1246 Ga0068860_100118185
1247 Ga0068862_100019410
1248 Ga0068862_100877665
1249 Ga0081455_10169980
1250 Ga0081455_10305339
1251 Ga0081538_10004920
1252 Ga0081538_10076620
1253 Ga0081540_1005919
1254 Ga0081540_1007542
1255 Ga0081540_1030574
1256 Ga0081540_1126788
1257 Ga0070717_10034090
1258 Ga0070717_10079263
1259 Ga0070717_10321877
1260 Ga0070717_10453768
1261 Ga0070717_10632082
1262 Ga0070717_11134740
1263 Ga0075365_10117528
1264 Ga0075365_10179088
1265 Ga0075365_10440222
1266 Ga0075368_10052249
1267 Ga0075368_10074571
1268 Ga0075363_100070204
1269 Ga0075363_100181564
1270 Ga0075363_100226878
1271 Ga0075364_10011733
1272 Ga0075364_10084979
1273 Ga0075364_10293041
1274 Ga0075432_10055230
1275 Ga0070715_10012690
1276 Ga0070715_10105031
1277 Ga0070715_10204740
1278 Ga0070716_100015147
1279 Ga0070716_100427392
1280 Ga0070712_100010627
1281 Ga0070712_100018041
1282 Ga0070712_100041648
1283 Ga0070712_100056705
1284 Ga0070712_100065083
1285 Ga0070712_100163755
1286 Ga0070712_100192560
1287 Ga0070712_100907245
1288 Ga0075362_10026673
1289 Ga0075362_10039073
1290 Ga0075367_10011106
1291 Ga0075367_10109248
1292 Ga0075367_10286847
1293 Ga0075366_10015762
1294 Ga0075366_10039704
1295 Ga0075366_10104857
1296 Ga0097621_100003283
1297 Ga0097621_100080957
1298 Ga0097621_100103822
1299 Ga0097621_100242651
1300 Ga0075370_10137747
1301 Ga0068871_100175297
1302 Ga0075428_100100107
1303 Ga0075428_100153084
1304 Ga0075428_100371413
1305 Ga0075430_100028424
1306 Ga0075430_100341576
1307 Ga0075431_100051432
1308 Ga0075431_100233213
1309 Ga0075431_100264878
1310 Ga0075433_10030909
1311 Ga0075433_10337684
1312 Ga0075434_100042433
1313 Ga0075434_100058778
1314 Ga0075434_100169863
1315 Ga0075429_100021082
1316 Ga0075429_100787876
1317 Ga0075429_101309680
1318 Ga0068865_100384570
1319 Ga0075436_100095437
1320 Ga0075436_100106564
1321 Ga0075436_100373811
1322 Ga0075436_100742655
1323 Ga0097620_100235947
1324 Ga0097620_100432402
1325 Ga0097620_100764430
1326 Ga0097620_101008743
1327 Ga0075435_100117174
1328 Ga0075435_100366488
1329 Ga0099795_10016969
1330 Ga0099795_10017711
1331 Ga0099795_10025379
1332 Ga0099795_10056890
1333 Ga0105251_10103005
1334 Ga0105251_10129428
1335 Ga0105250_10020355
1336 Ga0105240_10926261
1337 Ga0105240_11409374
1338 Ga0111539_10055897
1339 Ga0111539_10060602
1340 Ga0111539_10167489
1341 Ga0111539_10249567
1342 Ga0111539_10663537
1343 Ga0105245_10077373
1344 Ga0105245_11150102
1345 Ga0105247_10065287
1346 Ga0105247_10133347
1347 Ga0105247_10133490
1348 Ga0114129_10139148
1349 Ga0114129_10163034
1350 Ga0114129_10240265
1351 Ga0114129_10313513
1352 Ga0105243_10139521
1353 Ga0105243_10434768
1354 Ga0105243_10455965
1355 Ga0105242_10080490
1356 Ga0105242_10205975
1357 Ga0105242_10952357
1358 Ga0105248_10053885
1359 Ga0105248_10129824
1360 Ga0105248_10633868
1361 Ga0105248_11430904
1362 Ga0105237_10960115
1363 Ga0105238_10182439
1364 Ga0105238_10263892
1365 Ga0105249_10055163
1366 Ga0105249_10422180
1367 Ga0105249_12091444
1368 Ga0099796_10006589
1369 Ga0105246_10087118
1370 Ga0105246_10294026
1371 Ga0105246_10749121
1372 Ga0157369_10947527
1373 Ga0157374_10769553
1374 Ga0157374_11021397
1375 Ga0157374_11485043
1376 Ga0157378_10078447
1377 Ga0157378_10109345
1378 Ga0157378_10288073
1379 Ga0157378_10837300
1380 Ga0163162_10210408
1381 Ga0163162_10714602
1382 Ga0163162_11209901
1383 Ga0163163_10036791
1384 Ga0163163_10948437
1385 Ga0157380_10388555
1386 Ga0157380_11842114
1387 Ga0157380_12094331
1388 Ga0157377_10023027
1389 Ga0157377_10560054
1390 Ga0157379_10224796
1391 Ga0157379_10248716
1392 Ga0157379_10768197
1393 Ga0157379_10796344
1394 Ga0157376_10069246
1395 Ga0157376_10113841
1396 Ga0157376_10316086
1397 Ga0157376_10320130
1398 Ga0157376_10832026
1399 Ga0157376_11751307
1400 Ga0163161_10096408
1401 Ga0163161_10198313
1402 Ga0184601_134629
1403 Ga0213873_10000783
1404 Ga0213872_10172377
1405 Ga0213876_10015540
1406 Ga0213875_10000744
1407 Ga0224712_10119940
1408 Ga0247551_100775
1409 Ga0247550_100578
1410 Ga0228598_1000391
1411 Ga0209233_1058471
1412 Ga0209758_1000264
1413 Ga0209758_1067961
1414 Ga0207656_10018449
1415 Ga0207696_1024218
1416 Ga0207713_1001618
1417 Ga0207653_10114299
1418 Ga0207682_10019465
1419 Ga0207692_10180797
1420 Ga0207692_10234532
1421 Ga0207692_10372569
1422 Ga0207710_10056498
1423 Ga0207688_10038177
1424 Ga0207688_10112121
1425 Ga0207680_10060884
1426 Ga0207647_10019223
1427 Ga0207685_10003801
1428 Ga0207685_10222904
1429 Ga0207699_10007486
1430 Ga0207699_10610523
1431 Ga0207645_10016804
1432 Ga0207645_10075151
1433 Ga0207643_10004505
1434 Ga0207684_10004491
1435 Ga0207654_10058099
1436 Ga0207707_10434110
1437 Ga0207693_10004308
1438 Ga0207693_10009534
1439 Ga0207693_10019562
1440 Ga0207693_10085248
1441 Ga0207693_10125123
1442 Ga0207693_10136027
1443 Ga0207693_10150796
1444 Ga0207693_10237354
1445 Ga0207693_10441928
1446 Ga0207663_10027273
1447 Ga0207663_10087084
1448 Ga0207663_10181335
1449 Ga0207663_10492411
1450 Ga0207660_10305635
1451 Ga0207660_10337102
1452 Ga0207660_10408297
1453 Ga0207662_10008043
1454 Ga0207662_10036496
1455 Ga0207657_10058541
1456 Ga0207657_10253968
1457 Ga0207649_10289269
1458 Ga0207646_10071839
1459 Ga0207681_10000120
1460 Ga0207681_10076311
1461 Ga0207681_10576112
1462 Ga0207694_10115617
1463 Ga0207650_10016935
1464 Ga0207659_10026275
1465 Ga0207659_10365394
1466 Ga0207687_10078388
1467 Ga0207687_10457681
1468 Ga0207700_10022265
1469 Ga0207700_10071446
1470 Ga0207700_10270004
1471 Ga0207700_10463103
1472 Ga0207700_10556101
1473 Ga0207664_10052893
1474 Ga0207664_10155474
1475 Ga0207664_10164941
1476 Ga0207664_10297861
1477 Ga0207664_10733360
1478 Ga0207644_10003076
1479 Ga0207644_10007178
1480 Ga0207644_10591904
1481 Ga0207690_10538475
1482 Ga0207690_10921253
1483 Ga0207706_10010412
1484 Ga0207706_10058181
1485 Ga0207686_10096633
1486 Ga0207686_10098941
1487 Ga0207686_10375314
1488 Ga0207709_10092173
1489 Ga0207709_10470075
1490 Ga0207670_10016903
1491 Ga0207670_10038481
1492 Ga0207670_10090521
1493 Ga0207670_10151216
1494 Ga0207669_10036065
1495 Ga0207669_10070099
1496 Ga0207669_10250843
1497 Ga0207704_10342295
1498 Ga0207704_10444605
1499 Ga0207665_10005011
1500 Ga0207665_10067266
1501 Ga0207665_10278298
1502 Ga0207691_10006373
1503 Ga0207691_10295141
1504 Ga0207711_10494017
1505 Ga0207711_10576912
1506 Ga0207689_10027476
1507 Ga0207661_10692879
1508 Ga0207679_10123316
1509 Ga0207679_10379266
1510 Ga0207679_10639205
1511 Ga0207667_10299423
1512 Ga0207667_10415785
1513 Ga0207651_10257314
1514 Ga0207712_10034832
1515 Ga0207668_10013844
1516 Ga0207640_10998555
1517 Ga0207658_10003744
1518 Ga0207658_10021569
1519 Ga0207677_10043125
1520 Ga0207677_11253073
1521 Ga0207703_10022093
1522 Ga0207703_10149045
1523 Ga0207639_10378667
1524 Ga0207639_10404656
1525 Ga0207678_10011936
1526 Ga0207708_10012231
1527 Ga0207702_10512669
1528 Ga0207641_10323947
1529 Ga0207641_10471642
1530 Ga0207641_10564469
1531 Ga0207641_10618311
1532 Ga0207648_10034264
1533 Ga0207648_10244893
1534 Ga0207676_10125186
1535 Ga0207676_10991276
1536 Ga0207674_10141745
1537 Ga0207674_10926297
1538 Ga0207675_100007070
1539 Ga0207683_10012795
1540 Ga0207683_10341747
1541 Ga0207698_10116732
1542 Ga0207698_11348420
1543 Ga0207698_11730637
1544 Ga0209179_1030460
1545 Ga0209588_1013394
1546 Ga0209813_10030686
1547 Ga0209813_10289415
1548 Ga0268266_10019456
1549 Ga0268266_10130599
1550 Ga0268266_10251937
1551 Ga0268265_10005699
1552 Ga0268265_10316216
1553 Ga0268265_10787845
1554 Ga0268264_10029003
1555 Ga0268264_10346580
1556 Ga0268264_10680645
1557 Ga0265762_1037164
1558 Ga0265770_1027242
1559 Ga0265764_102059
1560 Ga0265769_101548
1561 Ga0265768_101626
1562 Ga0265779_103053
1563 Ga0265760_10032426
1564 Ga0265760_10034203
1565 Ga0265760_10054051
1566 Ga0265760_10075037
1567 Ga0265760_10144350
1568 Ga0265328_10002562
1569 Ga0265328_10002767
1570 Ga0265325_10004526
1571 Ga0265325_10095719
1572 Ga0265340_10061845
1573 Ga0265331_10000090
1574 Ga0307513_10381013
1575 Ga0307416_101626509
1576 Ga0316593_10095395
1577 Ga0316593_10259870
1578 Ga0373948_0111424
1579 Ga0373958_0007926
1580 Ga0373958_0036509
1581 Ga0373958_0117280
1582 Ga0373938_0032302
1583 Ga0373926_0138408
1584 Ga0373926_0180864
1585 Ga0373928_0006795
1586 Ga0373934_0135630
1587 Ga0373934_0172891
1588 Ga0373940_0067916
1589 Ga0373940_0103194
1590 Ga0373944_0034009
1591 Ga0373949_0033618
1592 Ga0373949_0087617
1593 Ga0373951_0017272
1594 Ga0373923_0093422
1595 Ga0373923_0173074
1596 Ga0373932_0089031
1597 Ga0373936_0021427
1598 Ga0373936_0072039
1599 Ga0373936_0179630
1600 Ga0373936_0353060
1601 Ga0373939_0349455
1602 Ga0373941_0061084
1603 Ga0373941_0117029
1604 Ga0373945_0077430
1605 Ga0373953_0134765
1606 Ga0373954_0007780
1607 Ga0373954_0110205
1608 Ga0373957_0127343
1609 Ga0373960_0008802
1610 Ga0373960_0014402
1611 Ga0373943_0021221
1612 Ga0373943_0034585
1613 Ga0373943_0051687
1614 Ga0373946_0005255
1615 Ga0373946_0259982
1616 Ga0373955_0025466
1617 Ga0373955_0075552
1618 Ga0373955_0249196
1619 Ga0373955_0251425
1620 Ga0373955_0532458
1621 Ga0373961_0040826
1622 Ga0373961_0072878
1623 Ga0373961_0169632
1624 Ga0373962_0076662
1625 Ga0373962_0096421
1626 Ga0373924_0076838
1627 Ga0373924_0219780
1628 Ga0373924_0222923
1629 Ga0373931_0002378
1630 Ga0373931_0005234
1631 Ga0373931_0006055
1632 Ga0373931_0038610
1633 Ga0373931_0422717
1634 Ga0373931_0757878
1635 Ga0373935_0053390
1636 Ga0373935_0066271
1637 Ga0373935_0075461
1638 Ga0373935_0207475
1639 Ga0373935_0311368
1640 Ga0373935_0904239
1641 Ga0373927_0020216
1642 Ga0373927_0034994
1643 Ga0373927_0052050
1644 Ga0373927_0076102
1645 Ga0373927_0111654
1646 Ga0373927_0555889
1647 Ga0373933_0018591
1648 Ga0373933_0037236
1649 Ga0373933_0103876
1650 Ga0373933_0129893
1651 Ga0373933_0232654
1652 Ga0373933_0395963
1653 Ga0373933_0444398
1654 Ga0373947_0027740
1655 Ga0373947_0028186
1656 Ga0373947_0362263
1657 Ga0373947_0666391
1658 Ga0373937_0000738
1659 Ga0373937_0049095
1660 Ga0373937_0061168
1661 Ga0373925_0038780
1662 Ga0373925_0223894
1663 Ga0373925_0262950
1664 Ga0373925_0291232
1665 Ga0373925_0327007
1666 Ga0373925_0604719
1667 Ga0436364_1301289
1668 Ga0400483_208194
1669 Ga0436365_1177006
1670 Ga0436365_1478616
1671 Ga0436360_0000114
1672 Ga0436360_1180523
1673 Ga0436360_1284835
1674 Ga0436361_0461209
1675 Ga0436362_0545650
1676 Ga0436362_0849582
1677 Ga0451787_591290
1678 Ga0451847_0495246
1679 Ga0451851_0357189
1680 Ga0451853_3316096
1681 Ga0439434_0182935
1682 Ga0466966_0040519
1683 Ga0466963_0199400
1684 Ga0466964_0458620
1685 Ga0466959_0034253
1686 Ga0466958_0068971
1687 Ga0466967_0739032
1688 Ga0466967_0753926
1689 Ga0466967_0877860
1690 Ga0466967_1415665
1691 Ga0495617_109315
1692 Ga0495592_0063387
1693 Ga0495592_0100776
1694 Ga0495592_0283656
1695 Ga0495603_0163516
1696 Ga0495603_0280983
1697 Ga0495590_0028005
1698 Ga0495590_0123905
1699 Ga0495590_0276239
1700 Ga0495629_0074732
1701 Ga0495629_0159793
1702 Ga0495629_0183237
1703 Ga0495629_0215213
1704 Ga0495638_0019017
1705 Ga0495638_0264511
1706 Ga0495641_0011908
1707 Ga0495651_0001350
1708 Ga0495651_0099025
1709 Ga0495651_0304506
1710 Ga0495653_0000370
1711 Ga0495580_0014484
1712 Ga0495582_0364829
1713 Ga0495605_0052400
1714 Ga0495639_0139504
1715 Ga0495639_0197551
1716 Ga0495662_0090625
1717 Ga0495662_0200094
1718 Ga0495662_0207649
1719 Ga0495664_0224846
1720 Ga0495664_0252450
1721 Ga0495664_0336221
1722 Ga0495584_0033743
1723 Ga0495584_0041190
1724 Ga0495584_0434132
1725 Ga0495585_0126948
1726 Ga0495594_0294777
1727 Ga0495594_0613398
1728 Ga0495596_0115972
1729 Ga0495607_0193359
1730 Ga0495608_0011250
1731 Ga0495608_0090482
1732 Ga0495608_0249692
1733 Ga0495608_0268853
1734 Ga0495616_0078135
1735 Ga0495618_0152903
1736 Ga0495618_0382210
1737 Ga0495618_0427352
1738 Ga0495628_0059243
1739 Ga0495628_0074123
1740 Ga0495628_0618631
1741 Ga0495631_0121723
1742 Ga0495632_0189414
1743 Ga0495666_0101647
1744 Ga0495642_0183546
1745 Ga0495652_0030444
1746 Ga0495652_0153276
1747 Ga0495652_0475115
1748 Ga0495640_0015332
1749 Ga0495640_0060714
1750 Ga0495640_0275042
1751 Ga0495586_0232644
1752 Ga0495586_0288423
1753 Ga0495586_0425799
1754 Ga0495586_0784575
1755 Ga0495587_0003682
1756 Ga0495587_0145268
1757 Ga0495587_0150089
1758 Ga0495598_0137616
1759 Ga0495621_0081324
1760 Ga0495597_0120857
1761 Ga0495645_0070870
1762 Ga0495645_0311898
1763 Ga0495622_0139519
1764 Ga0495633_0388565
1765 Ga0495667_0130782
1766 Ga0495667_0695433
1767 Ga0495656_0068481
1768 Ga0495656_0073183
1769 Ga0495656_0104884
1770 Ga0495656_0340944
1771 Ga0495668_0051446
1772 Ga0495668_0388276
1773 Ga0495668_0406025
1774 Ga0495634_0098263
1775 Ga0495634_0122871
1776 Ga0495634_0142180
1777 Ga0495625_0549528
1778 Ga0495635_0151004
1779 Ga0495635_0292641
1780 Ga0495661_0104429
1781 Ga0495657_0059369
1782 Ga0495657_0247402
1783 Ga0495657_0517338
1784 Ga0495599_0027303
1785 Ga0495599_0162456
1786 Ga0495599_0250164
1787 Ga0495623_0250024
1788 Ga0495646_0017780
1789 Ga0495646_0073204
1790 Ga0495647_0015066
1791 Ga0495647_0133349
1792 Ga0495647_0158271
1793 Ga0495658_0078400
1794 Ga0495658_0523945
1795 Ga0495658_0654726
1796 Ga0495669_0021802
1797 Ga0495613_0044468
1798 Ga0495613_0134657
1799 Ga0495613_0177227
1800 Ga0495613_0300573
1801 Ga0495624_0124651
1802 Ga0495670_0228795
1803 Ga0495671_0163956
1804 Ga0495671_0322940
1805 Ga0495649_0252518
1806 Ga0495589_0145129
1807 Ga0495589_0198799
1808 Ga0495600_0047489
1809 Ga0495600_0048458
1810 Ga0495600_0075956
1811 Ga0495660_0055552
1812 Ga0495581_0035801
1813 Ga0495581_0204554
1814 Ga0495604_0000406
1815 Ga0495604_0187842
1816 Ga0495604_0280163
1817 Ga0495674_0000757
1818 Ga0495674_0163882
1819 Ga0495674_0181468
1820 Ga0495676_0108799
1821 Ga0495676_0178920
1822 Ga0495680_0017428
1823 Ga0495680_0040052
1824 Ga0495680_0152467
1825 Ga0495680_0244580
1826 Ga0495680_0596809
1827 Ga0495683_0124444
1828 Ga0495675_0054537
1829 Ga0495675_0131278
1830 Ga0495675_0406419
1831 Ga0495677_0021350
1832 Ga0495684_0021662
1833 Ga0495684_0247682
1834 Ga0495684_0584699
1835 Ga0495593_0205678
1836 Ga0495593_0244166
1837 Ga0495602_0024694
1838 Ga0495602_0146594
1839 Ga0495602_0149309
1840 Ga0495615_0066604
1841 Ga0496100_0035219
1842 Ga0496100_0110841
1843 Ga0496100_0220690
1844 Ga0496100_0224610
1845 Ga0496100_0256400
1846 Ga0496100_0454174
1847 Ga0496100_0550976
1848 Ga0496100_0884031
1849 Ga0496101_0008120
1850 Ga0496101_0014496
1851 Ga0496101_0041258
1852 Ga0496101_0062158
1853 Ga0496101_0134052
1854 Ga0496102_0000209
1855 Ga0496102_0021152
1856 Ga0496102_0053476
1857 Ga0496102_0163428
1858 Ga0496102_0172697
1859 Ga0496102_0327775
1860 Ga0496102_0388955
1861 Ga0496103_0000136
1862 Ga0496103_0007584
1863 Ga0496103_0043000
1864 Ga0496103_0174468
1865 Ga0496103_0594710
1866 Ga0496104_0000216
1867 Ga0496104_0006745
1868 Ga0496104_0019461
1869 Ga0496104_0039907
1870 Ga0496104_0050460
1871 Ga0496104_0063677
1872 Ga0496104_0091707
1873 Ga0496104_0121336
1874 Ga0496104_0131005
1875 Ga0496104_0452236
1876 Ga0496105_0001544
1877 Ga0496105_0007866
1878 Ga0496105_0017685
1879 Ga0496105_0022105
1880 Ga0496105_0044071
1881 Ga0496105_0072606
1882 Ga0496105_0157444
1883 Ga0496105_0166640
1884 Ga0496105_0843429
1885 Ga0496106_0002752
1886 Ga0496106_0032427
1887 Ga0496106_0145015
1888 Ga0496106_0546073
1889 Ga0496106_0892852
1890 Ga0496107_0010775
1891 Ga0496107_0070941
1892 Ga0496107_0232832
1893 Ga0496107_0236811
1894 Ga0496107_0418851
1895 Ga0496108_0004212
1896 Ga0496108_0011283
1897 Ga0496108_0073188
1898 Ga0496108_0087385
1899 Ga0496108_0170428
1900 Ga0496108_0223930
1901 Ga0496108_0336329
1902 Ga0496108_1044934
1903 Ga0496109_0002089
1904 Ga0496109_0034169
1905 Ga0496109_0077980
1906 Ga0496109_0142277
1907 Ga0496109_0409308
1908 Ga0496110_0000957
1909 Ga0496110_0005751
1910 Ga0496110_0027980
1911 Ga0496110_0039920
1912 Ga0496110_0049475
1913 Ga0496110_0076934
1914 Ga0496110_0310029
1915 Ga0496110_0514936
1916 Ga0496111_0003285
1917 Ga0496111_0016660
1918 Ga0496111_0067330
1919 Ga0496111_0146065
1920 Ga0496111_0157384
1921 Ga0496111_0190774
1922 Ga0496111_0334862
1923 Ga0496111_0484582
1924 Ga0496112_0001871
1925 Ga0496112_0016832
1926 Ga0496112_0020950
1927 Ga0496112_0033830
1928 Ga0496112_0037563
1929 Ga0496112_0235478
1930 Ga0496112_0253719
1931 Ga0496112_0461241
1932 Ga0496112_0593791
1933 Ga0496113_0001187
1934 Ga0496113_0004691
1935 Ga0496113_0010148
1936 Ga0496113_0029812
1937 Ga0496113_0079684
1938 Ga0496113_0145424
1939 Ga0496114_0015539
1940 Ga0496114_0197218
1941 Ga0496114_0244952
1942 Ga0496114_0268813
1943 Ga0496114_0548029
1944 Ga0496115_0003653
1945 Ga0496115_0013250
1946 Ga0496115_0021874
1947 Ga0496115_0178411
1948 Ga0496115_0365208
1949 Ga0496116_0074607
1950 Ga0496117_0003081
1951 Ga0496118_0002164
1952 Ga0496119_0025264
1953 Ga0496120_0005023
1954 Ga0496121_0014188
1955 Ga0496122_0036930
1956 Ga0496123_0047532
1957 Ga0496124_0006468
1958 Ga0496125_0038811
1959 Ga0496126_0000365
1960 Ga0495682_0230361
1961 Ga0501031_0028040
1962 Ga0501031_0156056
1963 Ga0501031_0267401
1964 Ga0501033_0009158
1965 Ga0501033_0101173
1966 Ga0501033_0223249
1967 Ga0501034_0018837
1968 Ga0501034_0102551
1969 Ga0501034_0200814
1970 Ga0501034_0633547
1971 Ga0501036_0020436
1972 Ga0501036_0113295
1973 Ga0501036_0158651
1974 Ga0501037_0014734
1975 Ga0501038_0052812
1976 Ga0501038_0294709
1977 Ga0501039_0101980
1978 Ga0501039_0162274
1979 Ga0501041_0273886
1980 Ga0501042_0156301
1981 Ga0501042_0391232
1982 Ga0501042_0617977
1983 Ga0501043_0120689
1984 Ga0501043_0126003
1985 Ga0501046_0084481
1986 Ga0501046_0337348
1987 Ga0501047_0041996
1988 Ga0501047_0061189
1989 Ga0501047_0178680
1990 Ga0501047_0472238
1991 Ga0501048_0016143
1992 Ga0501048_0657362
1993 Ga0501048_0657654
1994 Ga0501067_0050188
1995 Ga0501067_0278463
1996 Ga0501068_0010731
1997 Ga0501068_0219719
1998 Ga0501069_0007541
1999 Ga0501069_0834934
2000 Ga0501070_0011236
2001 Ga0501070_0075859
2002 Ga0501071_0084803
2003 Ga0501071_0225740
2004 Ga0501072_0031974
2005 Ga0501072_0154019
2006 Ga0501072_0403463
2007 Ga0501073_0742847
2008 Ga0501074_0009597
2009 Ga0501074_0654284
2010 Ga0501075_0037316
2011 Ga0501076_0450385
2012 Ga0501076_0457805
2013 Ga0501076_0467618
2014 Ga0501077_0435853
2015 Ga0501077_0844258
2016 Ga0501079_0342739
2017 Ga0501080_0024779
2018 Ga0501080_0052695
2019 Ga0501080_1512344
2020 Ga0501081_0140995
2021 Ga0501083_0026337
2022 Ga0501035_0206899
2023 Ga0501035_0572725
2024 Ga0501044_0000222
2025 Ga0501044_0058684
2026 Ga0501044_0258115
2027 Ga0501044_0345920
2028 Ga0501045_0152435
2029 Ga0501045_0761108
2030 nmdc:mga03683_14874_c1
2031 nmdc:mga03683_40755_c1
2032 nmdc:mga03683_61659_c1
2033 nmdc:mga03n38_334605_c1
2034 nmdc:mga03n38_46294_c1
2035 nmdc:mga00v17_125125_c1
2036 nmdc:mga00v17_136323_c1
2037 nmdc:mga00v17_290693_c1
2038 nmdc:mga00v17_8455_c1
2039 nmdc:mga0yw44_12993_c2
2040 nmdc:mga0yw44_396701_c1
2041 nmdc:mga0yw44_99059_c1
2042 nmdc:mga0k408_146520_c1
2043 nmdc:mga06z11_114765_c1
2044 nmdc:mga06z11_31320_c1
2045 nmdc:mga06z11_435059_c1
2046 nmdc:mga06z11_52880_c2
2047 nmdc:mga04h51_17605_c1
2048 nmdc:mga04h51_323858_c1
2049 nmdc:mga07m45_111984_c1
2050 nmdc:mga07m45_161526_c1
2051 nmdc:mga07m45_167343_c1
2052 nmdc:mga07m45_28225_c2
2053 nmdc:mga05p37_112059_c1
2054 nmdc:mga05p37_436445_c1
2055 nmdc:mga05p37_57360_c1
2056 nmdc:mga05p37_726278_c1
2057 nmdc:mga05p37_8282_c1
2058 nmdc:mga05p37_87997_c1
2059 nmdc:mga09592_49714_c1
2060 nmdc:mga0qj67_169369_c1
2061 nmdc:mga0qj67_42263_c1
2062 nmdc:mga06r32_121400_c1
2063 nmdc:mga06r32_227144_c1
2064 nmdc:mga06r32_257049_c1
2065 nmdc:mga06r32_84343_c1
2066 nmdc:mga06r32_984980_c1
2067 nmdc:mga08y16_332126_c1
2068 nmdc:mga08y16_458143_c1
2069 nmdc:mga08y16_746274_c1
2070 nmdc:mga08y16_751155_c1
2071 nmdc:mga08y16_766335_c1
2072 nmdc:mga08y16_968828_c1
2073 nmdc:mga0n895_139301_c1
2074 nmdc:mga0n895_158203_c1
2075 nmdc:mga0n895_21813_c1
2076 nmdc:mga0n895_35152_c1
2077 nmdc:mga0n895_704222_c1
2078 nmdc:mga0n895_90250_c1
2079 nmdc:mga0rr50_159903_c1
2080 nmdc:mga0rr50_16458_c1
2081 nmdc:mga0rr50_67288_c1
2082 nmdc:mga08x19_243839_c1
2083 nmdc:mga08x19_707223_c1
2084 nmdc:mga08x19_90213_c1
2085 nmdc:mga0a205_20293_c1
2086 nmdc:mga0a205_225769_c1
2087 nmdc:mga0a205_56225_c1
2088 nmdc:mga0sz30_190704_c1
2089 Ga0495601_0015405
2090 Ga0495601_0053584
2091 Ga0495601_0094928
2092 Ga0495601_0121362
2093 Ga0495601_0198257
2094 Ga0495612_0011337
2095 Ga0495612_0018234
2096 Ga0495612_0074633
2097 Ga0495612_0092669
2098 Ga0495612_0123919
2099 Ga0495655_0001908
2100 Ga0495595_0005553
2101 Ga0495595_0018912
2102 Ga0495619_0000352
2103 Ga0495619_0081016
2104 Ga0495619_0115696
2105 Ga0495619_0184034
2106 Ga0500651_0347081
2107 Ga0500566_0181781
2108 Ga0500556_0157977
2109 Ga0500592_040323
2110 Ga0500595_054206
2111 Ga0500652_110847
2112 Ga0501084_0901999
2113 Ga0587080_025475
2114 Ga0587080_054655
2115 Ga0587083_0060285
2116 Ga0587085_012695
2117 Ga0587088_025739
2118 Ga0587089_017516
2119 Ga0587092_025380
2120 Ga0587094_019395
2121 Ga0587106_038044
2122 Ga0587109_032454
2123 Ga0587115_030563
2124 Ga0587067_122581
2125 Ga0587076_026938
2126 Ga0587119_025332
2127 Ga0587071_067179
2128 Ga0501082_0150052
2129 Ga0501082_0315485
2130 Ga0501082_0470576
2131 Ga0530510_0212718
2132 Ga0530510_0369401

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

35

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9683 2 126
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.9461 1 122
8phj-assembly1.cif.gz_5 ca4-bound cami1 in complex with 70s ribosome 0.9455 1 127
5j5b-assembly1.cif.gz_DI structure of the wt e coli ribosome bound to tetracycline 0.9431 1 132
6s0k-assembly1.cif.gz_I ribosome nascent chain in complex with seca 0.9355 2 122
ID Description Score Start End Superfamily
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9032 1 128 3.30.70.1730
af_Q9VPL3_26_196_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9031 1 126 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8988 3 126 3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8961 1 126 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8715 1 128 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A529X4S3-F1-model_v4 deleted 0.9839 1 131
AF-A0A498EML6-F1-model_v4 deleted 0.9804 1 130
AF-A0A1G9FEU5-F1-model_v4 Large ribosomal subunit protein uL10 0.9794 2 141 GO:0005840
GO:0006412
GO:0070180
GO:1990904
AF-A0A3M5R9A1-F1-model_v4 deleted 0.977 1 127
AF-A0A529X4S3-F1-model_v4 deleted 0.9765 1 131

Map