F489387

General Info

Members Datasets Scaffolds Average Seq Length
1065 446 2130 443

Family's Representative Sequence

Representative Sequence 3300059626|Ga0587115_002282|Ga0587115_002282_247_1758
Length 503
Sequence MAFFRGLTAVSRLRSRVAQEASTLGGVRWLQMQSASDLDLKSQLQELIPEQQDRLKKLKSEHGKVQLGNINVDMVLGGMRGMIGMLWETSLLDPEEGIRFRGLSIPECQEVLPTAVKGGEPLPEGLLWLLLTGKVPTKEQVDTLSKELLARSSVPAHVYKAIDALPVTAHPMTQFTTGVMALQVESEFQKAYDKGLPKTKFWEPTYEDVLNLIARLPPVASYVYRRIFKDGKSIEADNSLDYAANFSHMLGFDDPKMLELMRLYITIHTYFFIHPCIYLCYISEELVLISDSYCDLGSCSDHEGGNVSAHTGHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVIEETGSDVTTDQLKDYVWKTLKSGKVVPGFGHGVLRKTDPRYSCQREFALKHLPEDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGLSEARYYTVLFGVSRSMGIGSQLIWDRALGLPLERPKSVTMEWLENYCKNKAA

Samples

Sample ID Description Type Environment
1 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
145 3300023553 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
146 3300023556 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
147 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
149 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
150 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
151 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
152 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
153 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
154 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
155 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
156 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
157 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
158 3300023682 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
159 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
160 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
162 3300023689 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
232 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
233 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
234 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
235 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
236 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
240 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031632 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
245 3300031634 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
246 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
247 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
248 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
249 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
250 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
251 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
252 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
253 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
254 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
255 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
258 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
259 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
260 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
261 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
274 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
275 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300041450 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT Metatranscriptome Rhizoplane
286 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
287 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
288 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
289 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
290 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
291 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
292 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
295 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
296 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
299 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
300 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
301 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
361 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
362 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
363 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
364 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
365 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
366 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
367 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
368 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
369 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
370 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
371 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
372 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
373 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
374 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
375 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
376 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
377 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
390 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
391 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
392 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
393 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
394 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
395 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
396 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
408 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 2738541278 Niastella sp. CF465 Isolate Unclassified
429 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
430 2818991444 Filimonas endophytica 3197 Isolate Unclassified
431 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
432 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
433 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
434 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
435 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
436 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
437 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
438 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
439 2914759650 Rhizosphaericola mali Isolate Rhizosphere
440 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
441 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
442 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
443 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
444 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
445 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
446 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.67
Metatranscriptomes 11.55
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 0.75
Rhizosphere 84.88
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587115_002282 3300059626 Eukaryota 1884
2 SwRhRL2b_contig_1662827 2162886007 Eukaryota 336031
3 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
4 JGI24740J21852_10001312 3300001979 Bacteria 11313
5 JGI24740J21852_10025233 3300001979 Bacteria 2006
6 JGI24739J22299_10000154 3300001989 Bacteria 22212
7 JGI24739J22299_10009514 3300001989 Bacteria 3621
8 JGI24744J21845_10011394 3300002077 Bacteria 1819
9 JGI25154J39366_1000004 3300002738 Bacteria 346460
10 Ga0006759J45824_1008941 3300003163 Eukaryota 1642
11 JGI25406J46586_10032623 3300003203 Bacteria 1933
12 JGI25153J46596_10000224 3300003215 Bacteria 48671
13 rootH2_10020011 3300003320 Bacteria 5961
14 rootH2_10059474 3300003320 Bacteria 6815
15 rootL2_10002073 3300003322 Bacteria 21415
16 rootL2_10022324 3300003322 Bacteria 3620
17 rootL2_10080770 3300003322 Bacteria 3691
18 rootL2_10159435 3300003322 Bacteria 4346
19 rootH1_10017832 3300003323 Bacteria 13579
20 rootH1_10132169 3300003323 Bacteria 6462
21 rootH1_10293201 3300003323 Bacteria 2289
22 JGI25160J50197_1002326 3300003354 Bacteria 8896
23 JGI25160J50197_1015175 3300003354 Bacteria 2541
24 Ga0006556J51387_1001902 3300003479 Eukaryota 1746
25 Ga0007417J51691_1006438 3300003544 Eukaryota 1856
26 Ga0006557J51388_1002740 3300003556 Eukaryota 1785
27 Ga0006558J51389_1002884 3300003558 Eukaryota 1842
28 Ga0006559J51393_1002205 3300003560 Eukaryota 1869
29 Ga0006553J51392_1001961 3300003561 Eukaryota 1946
30 Ga0006555J51386_1001801 3300003564 Eukaryota 1860
31 Ga0006560J51390_1001990 3300003565 Eukaryota 1779
32 Ga0006554J51385_1001999 3300003567 Eukaryota 1911
33 Ga0007410J51695_1014397 3300003574 Eukaryota 1839
34 Ga0007409J51694_1006724 3300003575 Eukaryota 1873
35 Ga0055526_1008813 3300003771 Bacteria 4961
36 Ga0055528_1000355 3300003790 Bacteria 37201
37 Ga0055530_10000425 3300003791 Bacteria 37501
38 Ga0055531_10000411 3300003794 Bacteria 41180
39 Ga0058863_11636828 3300004799 Eukaryota 1860
40 Ga0058863_11883630 3300004799 Eukaryota 2012
41 Ga0058861_10004224 3300004800 Eukaryota 1967
42 Ga0058861_10012567 3300004800 Eukaryota 1538
43 Ga0058860_10086452 3300004801 Eukaryota 1915
44 Ga0058862_12751224 3300004803 Eukaryota 1581
45 Ga0058862_12825977 3300004803 Eukaryota 1873
46 Ga0065165_1000148 3300005262 Bacteria 122640
47 Ga0065165_1016429 3300005262 Bacteria 2772
48 Ga0065703_1004179 3300005272 Eukaryota 3651
49 Ga0065704_10000184 3300005289 Eukaryota 889358
50 Ga0065704_10070159 3300005289 Bacteria 207348
51 Ga0065704_10078716 3300005289 Bacteria 4352
52 Ga0065712_10002337 3300005290 Bacteria 5053
53 Ga0065712_10073174 3300005290 Bacteria 4454
54 Ga0065712_10129514 3300005290 Bacteria 1567
55 Ga0065715_10136544 3300005293 Unclassified 1916
56 Ga0065707_10081733 3300005295 Eukaryota 57849
57 Ga0065707_10104464 3300005295 Bacteria 2684
58 Ga0070658_10035269 3300005327 Bacteria 4029
59 Ga0070658_10039863 3300005327 Bacteria 3790
60 Ga0070658_10068803 3300005327 Bacteria 2895
61 Ga0070658_10075337 3300005327 Bacteria 2768
62 Ga0070658_10079595 3300005327 Bacteria 2691
63 Ga0070676_10010728 3300005328 Bacteria 4972
64 Ga0070676_10028456 3300005328 Bacteria 3174
65 Ga0070683_100001238 3300005329 Bacteria 19432
66 Ga0070683_100001444 3300005329 Bacteria 18259
67 Ga0070683_100016015 3300005329 Bacteria 6598
68 Ga0070683_100016889 3300005329 Bacteria 6440
69 Ga0070683_100097695 3300005329 Bacteria 2763
70 Ga0070690_100003044 3300005330 Bacteria 9101
71 Ga0070690_100082032 3300005330 Bacteria 2111
72 Ga0070670_100043927 3300005331 Bacteria 3842
73 Ga0070670_100058211 3300005331 Bacteria 3317
74 Ga0070670_100071060 3300005331 Bacteria 2988
75 Ga0070670_100099943 3300005331 Bacteria 2496
76 Ga0070670_100108494 3300005331 Bacteria 2392
77 Ga0068869_100005880 3300005334 Bacteria 7748
78 Ga0068869_100011976 3300005334 Bacteria 5708
79 Ga0068869_100015556 3300005334 Bacteria 5108
80 Ga0070666_10000637 3300005335 Bacteria 21149
81 Ga0070666_10005840 3300005335 Bacteria 7559
82 Ga0070666_10011699 3300005335 Bacteria 5517
83 Ga0070666_10119571 3300005335 Unclassified 1826
84 Ga0070680_100007800 3300005336 Bacteria 8156
85 Ga0070680_100018238 3300005336 Bacteria 5543
86 Ga0070682_100000039 3300005337 Bacteria 144400
87 Ga0070682_100001382 3300005337 Bacteria 13697
88 Ga0068868_100020492 3300005338 Bacteria 4970
89 Ga0068868_100026625 3300005338 Bacteria 4409
90 Ga0068868_100050438 3300005338 Bacteria 3268
91 Ga0068868_100221104 3300005338 Unclassified 1585
92 Ga0070660_100070186 3300005339 Bacteria 2734
93 Ga0070660_100095441 3300005339 Bacteria 2350
94 Ga0070689_100009324 3300005340 Bacteria 6957
95 Ga0070689_100130708 3300005340 Bacteria 2013
96 Ga0070689_100163509 3300005340 Bacteria 1800
97 Ga0070691_10024246 3300005341 Bacteria 2819
98 Ga0070687_100036328 3300005343 Unclassified 2454
99 Ga0070661_100005250 3300005344 Bacteria 8917
100 Ga0070668_100007075 3300005347 Bacteria 8312
101 Ga0070668_100042795 3300005347 Bacteria 3471
102 Ga0070668_100128906 3300005347 Bacteria 2029
103 Ga0070669_100007234 3300005353 Bacteria 7966
104 Ga0070669_100155357 3300005353 Bacteria 1774
105 Ga0070669_100207736 3300005353 Bacteria 1543
106 Ga0070675_100002069 3300005354 Bacteria 14869
107 Ga0070675_100025237 3300005354 Bacteria 4764
108 Ga0070675_100031894 3300005354 Bacteria 4262
109 Ga0070675_100036599 3300005354 Bacteria 3995
110 Ga0070675_100042510 3300005354 Bacteria 3713
111 Ga0070675_100071319 3300005354 Bacteria 2881
112 Ga0070675_100080671 3300005354 Bacteria 2712
113 Ga0070671_100012510 3300005355 Bacteria 6834
114 Ga0070674_100031917 3300005356 Bacteria 3494
115 Ga0070674_100140115 3300005356 Bacteria 1814
116 Ga0070673_100039888 3300005364 Bacteria 3598
117 Ga0070673_100106028 3300005364 Bacteria 2323
118 Ga0070688_100004093 3300005365 Bacteria 7565
119 Ga0070688_100034193 3300005365 Bacteria 3076
120 Ga0070688_100047054 3300005365 Bacteria 2674
121 Ga0070659_100044535 3300005366 Bacteria 3474
122 Ga0070659_100076513 3300005366 Bacteria 2668
123 Ga0070659_100169298 3300005366 Bacteria 1789
124 Ga0070667_100001496 3300005367 Bacteria 20928
125 Ga0070667_100014740 3300005367 Bacteria 6458
126 Ga0070667_100046485 3300005367 Bacteria 3651
127 Ga0070667_100140788 3300005367 Bacteria 2112
128 Ga0070713_100082748 3300005436 Bacteria 2742
129 Ga0070700_100040804 3300005441 Bacteria 2843
130 Ga0070663_100048185 3300005455 Bacteria 3020
131 Ga0070678_100029174 3300005456 Bacteria 3775
132 Ga0070678_100031427 3300005456 Bacteria 3663
133 Ga0070662_100007468 3300005457 Bacteria 7086
134 Ga0070662_100020198 3300005457 Bacteria 4533
135 Ga0070681_10019192 3300005458 Bacteria 6843
136 Ga0070681_10022486 3300005458 Bacteria 6332
137 Ga0070681_10037397 3300005458 Bacteria 4872
138 Ga0070681_10043308 3300005458 Bacteria 4510
139 Ga0068867_100007411 3300005459 Bacteria 7758
140 Ga0068867_100009973 3300005459 Bacteria 6693
141 Ga0068867_100012400 3300005459 Bacteria 6029
142 Ga0068867_100061331 3300005459 Bacteria 2792
143 Ga0068867_100115120 3300005459 Bacteria 2071
144 Ga0070685_10010662 3300005466 Bacteria 4783
145 Ga0070685_10029590 3300005466 Bacteria 3044
146 Ga0070685_10099300 3300005466 Unclassified 1775
147 Ga0070698_100010157 3300005471 Bacteria 10057
148 Ga0070698_100013783 3300005471 Bacteria 8553
149 Ga0070698_100022097 3300005471 Bacteria 6661
150 Ga0070699_100243571 3300005518 Bacteria 1606
151 Ga0070679_100001941 3300005530 Bacteria 18576
152 Ga0070679_100004204 3300005530 Bacteria 13281
153 Ga0070679_100004852 3300005530 Bacteria 12407
154 Ga0070679_100006603 3300005530 Bacteria 10809
155 Ga0070679_100016816 3300005530 Bacteria 7069
156 Ga0070679_100173092 3300005530 Bacteria 2131
157 Ga0070684_100004827 3300005535 Bacteria 10298
158 Ga0070684_100026655 3300005535 Bacteria 4870
159 Ga0070684_100053228 3300005535 Bacteria 3522
160 Ga0070684_100066340 3300005535 Bacteria 3168
161 Ga0068853_100000276 3300005539 Bacteria 36211
162 Ga0068853_100010323 3300005539 Bacteria 7553
163 Ga0068853_100057243 3300005539 Bacteria 3364
164 Ga0068853_100068730 3300005539 Bacteria 3080
165 Ga0068853_100149047 3300005539 Bacteria 2105
166 Ga0070672_100000891 3300005543 Bacteria 17929
167 Ga0070672_100012051 3300005543 Bacteria 6051
168 Ga0070672_100015554 3300005543 Bacteria 5422
169 Ga0070672_100031872 3300005543 Bacteria 3972
170 Ga0070672_100053581 3300005543 Bacteria 3154
171 Ga0070672_100058944 3300005543 Unclassified 3019
172 Ga0070686_100023983 3300005544 Bacteria 3653
173 Ga0070686_100060414 3300005544 Bacteria 2446
174 Ga0070686_100086005 3300005544 Unclassified 2093
175 Ga0070665_100000001 3300005548 Bacteria 1083363
176 Ga0070665_100006717 3300005548 Bacteria 11692
177 Ga0070665_100008882 3300005548 Bacteria 10177
178 Ga0070665_100165554 3300005548 Bacteria 2213
179 Ga0068855_100001835 3300005563 Bacteria 26494
180 Ga0068855_100007690 3300005563 Bacteria 13018
181 Ga0068855_100077125 3300005563 Bacteria 3866
182 Ga0068855_100211089 3300005563 Bacteria 2181
183 Ga0068855_100241664 3300005563 Unclassified 2017
184 Ga0070664_100000321 3300005564 Bacteria 34876
185 Ga0070664_100022940 3300005564 Bacteria 5149
186 Ga0070664_100035604 3300005564 Bacteria 4179
187 Ga0070664_100057743 3300005564 Bacteria 3299
188 Ga0070664_100113391 3300005564 Bacteria 2368
189 Ga0070664_100116519 3300005564 Bacteria 2336
190 Ga0068857_100001139 3300005577 Bacteria 20729
191 Ga0068857_100003724 3300005577 Bacteria 12796
192 Ga0068857_100007529 3300005577 Bacteria 9369
193 Ga0068857_100040032 3300005577 Bacteria 4155
194 Ga0068857_100046729 3300005577 Bacteria 3842
195 Ga0068857_100067152 3300005577 Bacteria 3191
196 Ga0068857_100083434 3300005577 Bacteria 2855
197 Ga0068854_100063732 3300005578 Bacteria 2676
198 Ga0068854_100122710 3300005578 Bacteria 1975
199 Ga0068854_100126928 3300005578 Bacteria 1944
200 Ga0068856_100011104 3300005614 Bacteria 8745
201 Ga0068856_100014039 3300005614 Bacteria 7745
202 Ga0068856_100020619 3300005614 Bacteria 6404
203 Ga0068856_100030709 3300005614 Bacteria 5253
204 Ga0068856_100043776 3300005614 Bacteria 4404
205 Ga0068856_100081424 3300005614 Bacteria 3212
206 Ga0068856_100175544 3300005614 Bacteria 2155
207 Ga0068856_100224251 3300005614 Bacteria 1895
208 Ga0068852_100002151 3300005616 Bacteria 13528
209 Ga0068852_100006664 3300005616 Bacteria 8369
210 Ga0068852_100009018 3300005616 Bacteria 7382
211 Ga0068852_100012493 3300005616 Bacteria 6452
212 Ga0068852_100046206 3300005616 Bacteria 3709
213 Ga0068852_100059122 3300005616 Bacteria 3323
214 Ga0068852_100084705 3300005616 Bacteria 2822
215 Ga0068859_100000029 3300005617 Bacteria 178422
216 Ga0068859_100002114 3300005617 Bacteria 20233
217 Ga0068859_100008303 3300005617 Bacteria 10520
218 Ga0068859_100013957 3300005617 Bacteria 8057
219 Ga0068859_100041845 3300005617 Bacteria 4602
220 Ga0068859_100059969 3300005617 Bacteria 3834
221 Ga0068859_100120020 3300005617 Bacteria 2696
222 Ga0068859_100252668 3300005617 Bacteria 1853
223 Ga0068864_100004500 3300005618 Bacteria 11464
224 Ga0068864_100027276 3300005618 Bacteria 4822
225 Ga0068864_100031790 3300005618 Bacteria 4479
226 Ga0068864_100085759 3300005618 Bacteria 2769
227 Ga0068864_100095796 3300005618 Bacteria 2626
228 Ga0068864_100105231 3300005618 Bacteria 2508
229 Ga0068861_100003057 3300005719 Bacteria 11050
230 Ga0068861_100010966 3300005719 Bacteria 6298
231 Ga0068861_100069206 3300005719 Bacteria 2730
232 Ga0068861_100175543 3300005719 Bacteria 1779
233 Ga0068851_10000700 3300005834 Bacteria 14313
234 Ga0068851_10034762 3300005834 Bacteria 2516
235 Ga0068851_10070802 3300005834 Unclassified 1804
236 Ga0068863_100013276 3300005841 Bacteria 7948
237 Ga0068863_100024625 3300005841 Bacteria 5740
238 Ga0068863_100054921 3300005841 Bacteria 3773
239 Ga0068863_100133984 3300005841 Bacteria 2366
240 Ga0068863_100138099 3300005841 Bacteria 2329
241 Ga0068858_100022432 3300005842 Bacteria 5892
242 Ga0068858_100032010 3300005842 Bacteria 4885
243 Ga0068858_100121301 3300005842 Bacteria 2445
244 Ga0068860_100000004 3300005843 Bacteria 506126
245 Ga0068860_100000888 3300005843 Bacteria 33230
246 Ga0068860_100003442 3300005843 Bacteria 16284
247 Ga0068860_100011991 3300005843 Bacteria 8538
248 Ga0068860_100014813 3300005843 Bacteria 7627
249 Ga0068860_100029918 3300005843 Bacteria 5238
250 Ga0068860_100058702 3300005843 Bacteria 3658
251 Ga0068860_100058812 3300005843 Bacteria 3655
252 Ga0068860_100123470 3300005843 Bacteria 2481
253 Ga0068862_100098660 3300005844 Bacteria 2552
254 Ga0068862_100108486 3300005844 Bacteria 2435
255 Ga0068862_100148170 3300005844 Bacteria 2087
256 Ga0081539_10000037 3300005985 Bacteria 296160
257 Ga0075364_10018791 3300006051 Bacteria 4333
258 Ga0075366_10032815 3300006195 Bacteria 3057
259 Ga0075366_10033322 3300006195 Bacteria 3034
260 Ga0075366_10091755 3300006195 Bacteria 1819
261 Ga0097621_100002686 3300006237 Bacteria 12173
262 Ga0097621_100003597 3300006237 Bacteria 10709
263 Ga0097621_100007374 3300006237 Bacteria 7867
264 Ga0097621_100013550 3300006237 Bacteria 6078
265 Ga0097621_100026587 3300006237 Bacteria 4542
266 Ga0097621_100048389 3300006237 Bacteria 3449
267 Ga0097621_100066510 3300006237 Bacteria 2969
268 Ga0097621_100075505 3300006237 Bacteria 2794
269 Ga0068871_100000076 3300006358 Bacteria 55186
270 Ga0068871_100010710 3300006358 Bacteria 6705
271 Ga0068871_100014864 3300006358 Bacteria 5815
272 Ga0068871_100030731 3300006358 Bacteria 4233
273 Ga0075428_100016924 3300006844 Bacteria 8052
274 Ga0075428_100017350 3300006844 Bacteria 7956
275 Ga0075428_100048921 3300006844 Bacteria 4639
276 Ga0075428_100164787 3300006844 Bacteria 2405
277 Ga0075428_100365710 3300006844 Bacteria 1547
278 Ga0075430_100003812 3300006846 Bacteria 12690
279 Ga0075430_100051479 3300006846 Unclassified 3470
280 Ga0075431_100012623 3300006847 Bacteria 8529
281 Ga0075429_100000539 3300006880 Bacteria 28785
282 Ga0075429_100039248 3300006880 Bacteria 4121
283 Ga0068865_100016033 3300006881 Bacteria 4787
284 Ga0068865_100079134 3300006881 Bacteria 2353
285 Ga0068865_100092796 3300006881 Unclassified 2194
286 Ga0097620_100000029 3300006931 Bacteria 178422
287 Ga0097620_100002114 3300006931 Bacteria 20233
288 Ga0097620_100008303 3300006931 Bacteria 10520
289 Ga0097620_100013956 3300006931 Bacteria 8057
290 Ga0097620_100041849 3300006931 Bacteria 4602
291 Ga0097620_100059969 3300006931 Bacteria 3834
292 Ga0097620_100120019 3300006931 Bacteria 2696
293 Ga0097620_100252678 3300006931 Bacteria 1853
294 Ga0105240_10000131 3300009093 Bacteria 154386
295 Ga0105240_10002773 3300009093 Bacteria 27676
296 Ga0105240_10003397 3300009093 Bacteria 24765
297 Ga0105240_10003620 3300009093 Bacteria 23924
298 Ga0105240_10004711 3300009093 Bacteria 20598
299 Ga0105240_10006456 3300009093 Bacteria 17233
300 Ga0105240_10016334 3300009093 Bacteria 10053
301 Ga0105240_10028113 3300009093 Bacteria 7352
302 Ga0105240_10031577 3300009093 Bacteria 6865
303 Ga0105240_10042295 3300009093 Bacteria 5807
304 Ga0105240_10119331 3300009093 Bacteria 3177
305 Ga0111539_10002138 3300009094 Bacteria 26441
306 Ga0111539_10115534 3300009094 Bacteria 3147
307 Ga0105245_10060441 3300009098 Bacteria 3412
308 Ga0105247_10027268 3300009101 Bacteria 3454
309 Ga0105247_10057125 3300009101 Bacteria 2412
310 Ga0114129_10036098 3300009147 Bacteria 6982
311 Ga0105243_10193772 3300009148 Bacteria 1777
312 Ga0105241_10000764 3300009174 Bacteria 24479
313 Ga0105241_10001337 3300009174 Bacteria 18724
314 Ga0105241_10001925 3300009174 Bacteria 15714
315 Ga0105241_10034397 3300009174 Bacteria 3806
316 Ga0105242_10019613 3300009176 Bacteria 5299
317 Ga0105242_10059527 3300009176 Bacteria 3134
318 Ga0105242_10094281 3300009176 Bacteria 2525
319 Ga0105248_10026892 3300009177 Bacteria 6399
320 Ga0105237_10000377 3300009545 Bacteria 63580
321 Ga0105237_10002457 3300009545 Bacteria 23008
322 Ga0105237_10002932 3300009545 Bacteria 20656
323 Ga0105237_10008643 3300009545 Bacteria 11004
324 Ga0105237_10013544 3300009545 Bacteria 8546
325 Ga0105237_10013564 3300009545 Bacteria 8537
326 Ga0105237_10015625 3300009545 Bacteria 7890
327 Ga0105238_10025254 3300009551 Bacteria 6056
328 Ga0105238_10058072 3300009551 Bacteria 3879
329 Ga0105249_10001339 3300009553 Bacteria 21527
330 Ga0105249_10021951 3300009553 Bacteria 5717
331 Ga0105249_10042337 3300009553 Unclassified 4141
332 Ga0105249_10131482 3300009553 Bacteria 2390
333 Ga0105249_10367601 3300009553 Bacteria 1461
334 Ga0105239_10000029 3300010375 Bacteria 234749
335 Ga0105239_10000714 3300010375 Bacteria 47078
336 Ga0105239_10001999 3300010375 Bacteria 26499
337 Ga0105239_10002549 3300010375 Bacteria 23115
338 Ga0105239_10005380 3300010375 Bacteria 15037
339 Ga0105239_10005636 3300010375 Bacteria 14630
340 Ga0105239_10019534 3300010375 Bacteria 7479
341 Ga0105239_10022019 3300010375 Bacteria 7026
342 Ga0105239_10023622 3300010375 Bacteria 6770
343 Ga0105239_10041121 3300010375 Bacteria 5066
344 Ga0105239_10055909 3300010375 Bacteria 4329
345 Ga0105239_10157937 3300010375 Bacteria 2533
346 Ga0105239_10205821 3300010375 Bacteria 2205
347 Ga0105246_10006069 3300011119 Bacteria 7370
348 Ga0105246_10049467 3300011119 Bacteria 2879
349 Ga0105246_10112213 3300011119 Bacteria 2005
350 Ga0157373_10000350 3300013100 Bacteria 37264
351 Ga0157373_10009312 3300013100 Bacteria 7261
352 Ga0157373_10010190 3300013100 Bacteria 6922
353 Ga0157373_10013041 3300013100 Bacteria 6101
354 Ga0157373_10024322 3300013100 Bacteria 4388
355 Ga0157373_10036664 3300013100 Bacteria 3518
356 Ga0157371_10001416 3300013102 Bacteria 24929
357 Ga0157371_10002643 3300013102 Bacteria 16991
358 Ga0157371_10003115 3300013102 Bacteria 15333
359 Ga0157371_10003982 3300013102 Bacteria 13092
360 Ga0157371_10006222 3300013102 Bacteria 9896
361 Ga0157371_10009640 3300013102 Bacteria 7593
362 Ga0157371_10019168 3300013102 Bacteria 5049
363 Ga0157371_10035435 3300013102 Bacteria 3575
364 Ga0157370_10000478 3300013104 Bacteria 49942
365 Ga0157370_10000530 3300013104 Bacteria 47795
366 Ga0157370_10001941 3300013104 Bacteria 25465
367 Ga0157370_10003057 3300013104 Bacteria 19847
368 Ga0157370_10110923 3300013104 Bacteria 2564
369 Ga0157369_10036543 3300013105 Bacteria 5380
370 Ga0157369_10041768 3300013105 Bacteria 5005
371 Ga0157369_10044835 3300013105 Bacteria 4812
372 Ga0157369_10063839 3300013105 Bacteria 3967
373 Ga0157369_10179875 3300013105 Bacteria 2225
374 Ga0157374_10000001 3300013296 Bacteria 1077351
375 Ga0157374_10000719 3300013296 Bacteria 28944
376 Ga0157374_10002479 3300013296 Bacteria 15577
377 Ga0157374_10012275 3300013296 Bacteria 7451
378 Ga0157374_10053886 3300013296 Bacteria 3751
379 Ga0157374_10057778 3300013296 Unclassified 3624
380 Ga0157374_10139195 3300013296 Bacteria 2355
381 Ga0157378_10004321 3300013297 Bacteria 12507
382 Ga0157378_10012543 3300013297 Bacteria 7417
383 Ga0157378_10019488 3300013297 Bacteria 5964
384 Ga0157378_10026764 3300013297 Bacteria 5085
385 Ga0157378_10030980 3300013297 Bacteria 4723
386 Ga0163162_10002251 3300013306 Bacteria 18116
387 Ga0163162_10004108 3300013306 Bacteria 13968
388 Ga0163162_10008316 3300013306 Bacteria 10124
389 Ga0163162_10010477 3300013306 Bacteria 9014
390 Ga0163162_10011862 3300013306 Bacteria 8500
391 Ga0163162_10017201 3300013306 Bacteria 7075
392 Ga0163162_10020291 3300013306 Bacteria 6526
393 Ga0163162_10022959 3300013306 Bacteria 6153
394 Ga0163162_10092099 3300013306 Bacteria 3114
395 Ga0163162_10123303 3300013306 Bacteria 2696
396 Ga0163162_10170787 3300013306 Bacteria 2299
397 Ga0163162_10234754 3300013306 Bacteria 1965
398 Ga0157372_10000494 3300013307 Bacteria 43474
399 Ga0157372_10000535 3300013307 Bacteria 41817
400 Ga0157372_10002089 3300013307 Bacteria 21710
401 Ga0157372_10018796 3300013307 Bacteria 7434
402 Ga0157372_10028256 3300013307 Bacteria 6121
403 Ga0157372_10040251 3300013307 Bacteria 5161
404 Ga0157372_10051209 3300013307 Bacteria 4595
405 Ga0157372_10060015 3300013307 Bacteria 4255
406 Ga0157372_10074861 3300013307 Bacteria 3819
407 Ga0157372_10102209 3300013307 Bacteria 3273
408 Ga0157372_10103417 3300013307 Bacteria 3255
409 Ga0157372_10113493 3300013307 Bacteria 3105
410 Ga0157372_10180826 3300013307 Bacteria 2441
411 Ga0157372_10201609 3300013307 Bacteria 2305
412 Ga0157372_10317550 3300013307 Bacteria 1814
413 Ga0157375_10000754 3300013308 Bacteria 28363
414 Ga0157375_10062733 3300013308 Bacteria 3694
415 Ga0157375_10106071 3300013308 Bacteria 2901
416 Ga0157375_10227876 3300013308 Bacteria 2022
417 Ga0163163_10001404 3300014325 Bacteria 20324
418 Ga0163163_10002372 3300014325 Bacteria 15938
419 Ga0163163_10011499 3300014325 Bacteria 8034
420 Ga0163163_10014951 3300014325 Bacteria 7152
421 Ga0163163_10059223 3300014325 Bacteria 3787
422 Ga0163163_10079251 3300014325 Bacteria 3283
423 Ga0163163_10194588 3300014325 Bacteria 2076
424 Ga0157380_10000065 3300014326 Bacteria 60148
425 Ga0157380_10004489 3300014326 Bacteria 9673
426 Ga0157380_10004871 3300014326 Bacteria 9351
427 Ga0157380_10008145 3300014326 Bacteria 7468
428 Ga0157380_10059197 3300014326 Bacteria 3056
429 Ga0157380_10082005 3300014326 Bacteria 2639
430 Ga0157380_10117460 3300014326 Bacteria 2247
431 Ga0157377_10001833 3300014745 Bacteria 9267
432 Ga0157377_10005286 3300014745 Bacteria 6051
433 Ga0157377_10007983 3300014745 Bacteria 5141
434 Ga0157377_10018633 3300014745 Bacteria 3610
435 Ga0157377_10078099 3300014745 Bacteria 1929
436 Ga0157379_10012636 3300014968 Bacteria 7377
437 Ga0157379_10013980 3300014968 Bacteria 7034
438 Ga0157379_10030553 3300014968 Bacteria 4796
439 Ga0157379_10040673 3300014968 Bacteria 4150
440 Ga0157376_10003097 3300014969 Bacteria 11423
441 Ga0157376_10003487 3300014969 Bacteria 10843
442 Ga0157376_10006460 3300014969 Bacteria 8284
443 Ga0157376_10008586 3300014969 Bacteria 7381
444 Ga0157376_10009241 3300014969 Bacteria 7152
445 Ga0157376_10019752 3300014969 Bacteria 5199
446 Ga0157376_10034923 3300014969 Bacteria 4063
447 Ga0157376_10084377 3300014969 Bacteria 2735
448 Ga0182005_1000040 3300015265 Bacteria 151222
449 Ga0163161_10002671 3300017792 Bacteria 12674
450 Ga0197907_10001091 3300020069 Eukaryota 1980
451 Ga0206356_11044593 3300020070 Eukaryota 1898
452 Ga0206356_11188758 3300020070 Eukaryota 1748
453 Ga0206349_1124235 3300020075 Eukaryota 1794
454 Ga0206349_1476759 3300020075 Eukaryota 2134
455 Ga0206355_1306531 3300020076 Eukaryota 1992
456 Ga0206352_10358918 3300020078 Eukaryota 1877
457 Ga0206350_10994793 3300020080 Eukaryota 1921
458 Ga0206354_10690293 3300020081 Eukaryota 1799
459 Ga0206353_11975280 3300020082 Eukaryota 1847
460 Ga0213876_10001135 3300021384 Bacteria 16968
461 Ga0213876_10008319 3300021384 Bacteria 5613
462 Ga0224712_10032821 3300022467 Eukaryota 1895
463 Ga0224712_10051383 3300022467 Eukaryota 1605
464 Ga0256720_152123 3300023438 Eukaryota 1924
465 Ga0247524_101506 3300023553 Eukaryota 1956
466 Ga0247519_101388 3300023556 Eukaryota 2227
467 Ga0247521_101613 3300023557 Eukaryota 2082
468 Ga0247526_102217 3300023558 Eukaryota 1843
469 Ga0247529_101655 3300023559 Eukaryota 2028
470 Ga0247518_102078 3300023561 Eukaryota 2219
471 Ga0247516_103277 3300023562 Eukaryota 1837
472 Ga0247530_100778 3300023563 Eukaryota 2357
473 Ga0247515_102482 3300023564 Eukaryota 2003
474 Ga0247527_101226 3300023664 Eukaryota 1989
475 Ga0247531_102163 3300023666 Eukaryota 1806
476 Ga0247525_101521 3300023668 Eukaryota 2171
477 Ga0247528_100975 3300023680 Eukaryota 2087
478 Ga0247513_101520 3300023682 Eukaryota 2165
479 Ga0247523_101818 3300023684 Eukaryota 2026
480 Ga0247520_101842 3300023686 Eukaryota 1978
481 Ga0247522_101379 3300023688 Eukaryota 2248
482 Ga0247517_102772 3300023689 Eukaryota 1828
483 Ga0247512_102652 3300023690 Eukaryota 2010
484 Ga0209436_100835 3300025208 Bacteria 12448
485 Ga0209258_100075 3300025242 Bacteria 270751
486 Ga0209646_1000025 3300025246 Bacteria 406493
487 Ga0209026_1000312 3300025250 Bacteria 52141
488 Ga0209148_1000085 3300025254 Bacteria 265193
489 Ga0209673_1000197 3300025273 Bacteria 121313
490 Ga0209130_1000540 3300025284 Bacteria 38066
491 Ga0209564_1002016 3300025295 Bacteria 17679
492 Ga0209564_1006989 3300025295 Bacteria 5920
493 Ga0209758_1013571 3300025297 Bacteria 4426
494 Ga0209758_1026448 3300025297 Bacteria 2510
495 Ga0209050_1000204 3300025298 Bacteria 133087
496 Ga0207426_1000019 3300025302 Bacteria 558579
497 Ga0207426_1000057 3300025302 Bacteria 369548
498 Ga0207426_1000332 3300025302 Bacteria 89192
499 Ga0207426_1004122 3300025302 Bacteria 7296
500 Ga0209257_1000004 3300025304 Bacteria 1678347
501 Ga0207656_10000242 3300025321 Bacteria 19035
502 Ga0207656_10001795 3300025321 Bacteria 7142
503 Ga0207682_10010567 3300025893 Bacteria 3614
504 Ga0207710_10018469 3300025900 Bacteria 2966
505 Ga0207710_10042150 3300025900 Bacteria 2026
506 Ga0207688_10050268 3300025901 Bacteria 2333
507 Ga0207680_10000016 3300025903 Bacteria 134657
508 Ga0207680_10005281 3300025903 Bacteria 6165
509 Ga0207680_10006952 3300025903 Bacteria 5489
510 Ga0207680_10141803 3300025903 Bacteria 1594
511 Ga0207647_10010657 3300025904 Bacteria 6480
512 Ga0207647_10011240 3300025904 Bacteria 6285
513 Ga0207647_10028854 3300025904 Unclassified 3599
514 Ga0207645_10000245 3300025907 Bacteria 45135
515 Ga0207645_10014460 3300025907 Bacteria 5281
516 Ga0207645_10014729 3300025907 Bacteria 5221
517 Ga0207645_10022723 3300025907 Bacteria 4077
518 Ga0207643_10006102 3300025908 Bacteria 6442
519 Ga0207643_10010745 3300025908 Bacteria 4934
520 Ga0207705_10004089 3300025909 Bacteria 11073
521 Ga0207705_10028047 3300025909 Bacteria 4014
522 Ga0207705_10084391 3300025909 Unclassified 2319
523 Ga0207705_10094177 3300025909 Bacteria 2196
524 Ga0207654_10000299 3300025911 Bacteria 30090
525 Ga0207654_10002562 3300025911 Bacteria 9224
526 Ga0207654_10090731 3300025911 Bacteria 1862
527 Ga0207707_10000121 3300025912 Bacteria 80174
528 Ga0207707_10106885 3300025912 Bacteria 2446
529 Ga0207707_10245673 3300025912 Unclassified 1555
530 Ga0207695_10000057 3300025913 Bacteria 376090
531 Ga0207695_10000217 3300025913 Bacteria 155047
532 Ga0207695_10000266 3300025913 Bacteria 132163
533 Ga0207695_10000568 3300025913 Bacteria 75553
534 Ga0207695_10001216 3300025913 Bacteria 44107
535 Ga0207695_10009606 3300025913 Bacteria 11943
536 Ga0207695_10016181 3300025913 Bacteria 8744
537 Ga0207695_10018698 3300025913 Bacteria 8001
538 Ga0207695_10248067 3300025913 Bacteria 1680
539 Ga0207671_10000725 3300025914 Bacteria 41972
540 Ga0207671_10002783 3300025914 Bacteria 18250
541 Ga0207671_10004167 3300025914 Bacteria 13975
542 Ga0207671_10007745 3300025914 Bacteria 9252
543 Ga0207671_10035098 3300025914 Bacteria 3724
544 Ga0207671_10094283 3300025914 Bacteria 2259
545 Ga0207660_10000354 3300025917 Bacteria 29872
546 Ga0207660_10029342 3300025917 Bacteria 3772
547 Ga0207657_10004379 3300025919 Bacteria 14946
548 Ga0207657_10006314 3300025919 Bacteria 12314
549 Ga0207657_10068682 3300025919 Bacteria 3010
550 Ga0207649_10007338 3300025920 Bacteria 6001
551 Ga0207652_10000160 3300025921 Bacteria 72867
552 Ga0207652_10000561 3300025921 Bacteria 37514
553 Ga0207652_10002749 3300025921 Bacteria 14774
554 Ga0207652_10014959 3300025921 Bacteria 6294
555 Ga0207652_10056382 3300025921 Bacteria 3382
556 Ga0207652_10056556 3300025921 Bacteria 3377
557 Ga0207681_10003524 3300025923 Bacteria 9747
558 Ga0207681_10071596 3300025923 Unclassified 2419
559 Ga0207681_10191661 3300025923 Bacteria 1564
560 Ga0207650_10000628 3300025925 Bacteria 28146
561 Ga0207650_10052169 3300025925 Bacteria 3029
562 Ga0207650_10095151 3300025925 Bacteria 2283
563 Ga0207659_10026830 3300025926 Bacteria 3893
564 Ga0207659_10036380 3300025926 Bacteria 3410
565 Ga0207659_10122253 3300025926 Bacteria 1996
566 Ga0207659_10136427 3300025926 Bacteria 1900
567 Ga0207687_10033514 3300025927 Bacteria 3484
568 Ga0207644_10006635 3300025931 Bacteria 7540
569 Ga0207644_10133527 3300025931 Bacteria 1903
570 Ga0207644_10150454 3300025931 Bacteria 1801
571 Ga0207690_10069216 3300025932 Bacteria 2427
572 Ga0207690_10086335 3300025932 Bacteria 2205
573 Ga0207706_10003545 3300025933 Bacteria 14896
574 Ga0207706_10010731 3300025933 Bacteria 8370
575 Ga0207706_10014210 3300025933 Bacteria 7217
576 Ga0207706_10063617 3300025933 Bacteria 3248
577 Ga0207706_10074701 3300025933 Bacteria 2980
578 Ga0207706_10081989 3300025933 Bacteria 2835
579 Ga0207686_10002107 3300025934 Bacteria 10957
580 Ga0207686_10012076 3300025934 Bacteria 4744
581 Ga0207686_10063858 3300025934 Unclassified 2343
582 Ga0207670_10002060 3300025936 Bacteria 10516
583 Ga0207670_10024082 3300025936 Bacteria 3800
584 Ga0207670_10136263 3300025936 Bacteria 1805
585 Ga0207669_10030045 3300025937 Bacteria 3014
586 Ga0207704_10008934 3300025938 Bacteria 4815
587 Ga0207704_10047774 3300025938 Bacteria 2561
588 Ga0207704_10098056 3300025938 Bacteria 1946
589 Ga0207691_10001933 3300025940 Bacteria 20218
590 Ga0207691_10006183 3300025940 Bacteria 11570
591 Ga0207691_10019082 3300025940 Bacteria 6494
592 Ga0207691_10026632 3300025940 Bacteria 5425
593 Ga0207691_10037910 3300025940 Bacteria 4462
594 Ga0207691_10172527 3300025940 Bacteria 1893
595 Ga0207689_10000681 3300025942 Bacteria 32411
596 Ga0207689_10000983 3300025942 Bacteria 27312
597 Ga0207689_10006134 3300025942 Bacteria 10637
598 Ga0207689_10007631 3300025942 Bacteria 9472
599 Ga0207661_10000620 3300025944 Bacteria 22786
600 Ga0207661_10016604 3300025944 Bacteria 5434
601 Ga0207679_10000683 3300025945 Bacteria 22726
602 Ga0207679_10024422 3300025945 Bacteria 4144
603 Ga0207679_10026675 3300025945 Bacteria 3987
604 Ga0207679_10055592 3300025945 Bacteria 2918
605 Ga0207679_10060468 3300025945 Bacteria 2815
606 Ga0207667_10000246 3300025949 Bacteria 76379
607 Ga0207667_10000451 3300025949 Bacteria 55109
608 Ga0207667_10003666 3300025949 Bacteria 18932
609 Ga0207667_10017632 3300025949 Bacteria 8032
610 Ga0207667_10023624 3300025949 Bacteria 6767
611 Ga0207667_10029781 3300025949 Bacteria 5914
612 Ga0207667_10074991 3300025949 Bacteria 3513
613 Ga0207667_10131553 3300025949 Bacteria 2577
614 Ga0207667_10135292 3300025949 Bacteria 2538
615 Ga0207651_10003723 3300025960 Bacteria 7540
616 Ga0207651_10064820 3300025960 Bacteria 2559
617 Ga0207651_10075940 3300025960 Bacteria 2400
618 Ga0207712_10003055 3300025961 Bacteria 10674
619 Ga0207712_10035406 3300025961 Bacteria 3391
620 Ga0207712_10066056 3300025961 Bacteria 2585
621 Ga0207668_10004760 3300025972 Bacteria 7988
622 Ga0207668_10020320 3300025972 Bacteria 4217
623 Ga0207668_10038885 3300025972 Bacteria 3197
624 Ga0207668_10061973 3300025972 Bacteria 2632
625 Ga0207658_10005434 3300025986 Bacteria 8737
626 Ga0207658_10007307 3300025986 Bacteria 7534
627 Ga0207658_10065977 3300025986 Bacteria 2721
628 Ga0207658_10078329 3300025986 Bacteria 2525
629 Ga0207658_10090080 3300025986 Bacteria 2376
630 Ga0207658_10100505 3300025986 Bacteria 2264
631 Ga0207658_10166092 3300025986 Bacteria 1813
632 Ga0207677_10003111 3300026023 Bacteria 8760
633 Ga0207677_10014532 3300026023 Bacteria 4600
634 Ga0207677_10070347 3300026023 Bacteria 2466
635 Ga0207677_10076993 3300026023 Bacteria 2377
636 Ga0207677_10112542 3300026023 Bacteria 2030
637 Ga0207677_10202766 3300026023 Unclassified 1578
638 Ga0207703_10177854 3300026035 Bacteria 1876
639 Ga0207639_10047670 3300026041 Bacteria 3240
640 Ga0207639_10068205 3300026041 Bacteria 2771
641 Ga0207639_10117019 3300026041 Bacteria 2183
642 Ga0207639_10168152 3300026041 Bacteria 1854
643 Ga0207639_10177547 3300026041 Bacteria 1809
644 Ga0207639_10255744 3300026041 Bacteria 1529
645 Ga0207678_10026406 3300026067 Bacteria 5066
646 Ga0207708_10053534 3300026075 Bacteria 3075
647 Ga0207702_10014507 3300026078 Bacteria 6542
648 Ga0207702_10018329 3300026078 Bacteria 5790
649 Ga0207702_10023270 3300026078 Bacteria 5137
650 Ga0207702_10039046 3300026078 Bacteria 3977
651 Ga0207702_10047717 3300026078 Bacteria 3610
652 Ga0207702_10190488 3300026078 Bacteria 1894
653 Ga0207702_10200369 3300026078 Bacteria 1850
654 Ga0207641_10001043 3300026088 Bacteria 28025
655 Ga0207641_10007146 3300026088 Bacteria 9322
656 Ga0207641_10028096 3300026088 Bacteria 4646
657 Ga0207641_10158191 3300026088 Bacteria 2057
658 Ga0207648_10004405 3300026089 Bacteria 14463
659 Ga0207648_10004983 3300026089 Bacteria 13499
660 Ga0207648_10019657 3300026089 Bacteria 6096
661 Ga0207648_10020128 3300026089 Bacteria 6016
662 Ga0207648_10030590 3300026089 Bacteria 4766
663 Ga0207648_10032678 3300026089 Bacteria 4592
664 Ga0207648_10051997 3300026089 Unclassified 3581
665 Ga0207648_10122781 3300026089 Bacteria 2284
666 Ga0207648_10190187 3300026089 Bacteria 1819
667 Ga0207648_10201176 3300026089 Bacteria 1767
668 Ga0207676_10007718 3300026095 Bacteria 7648
669 Ga0207676_10016235 3300026095 Bacteria 5391
670 Ga0207676_10063144 3300026095 Bacteria 2941
671 Ga0207676_10076483 3300026095 Bacteria 2705
672 Ga0207676_10095372 3300026095 Bacteria 2453
673 Ga0207674_10004668 3300026116 Bacteria 16447
674 Ga0207674_10006324 3300026116 Bacteria 13953
675 Ga0207674_10021677 3300026116 Bacteria 6917
676 Ga0207674_10026972 3300026116 Bacteria 6090
677 Ga0207674_10029266 3300026116 Bacteria 5800
678 Ga0207674_10045517 3300026116 Bacteria 4513
679 Ga0207674_10080436 3300026116 Bacteria 3262
680 Ga0207674_10123916 3300026116 Bacteria 2550
681 Ga0207675_100001355 3300026118 Bacteria 24522
682 Ga0207675_100002256 3300026118 Bacteria 19155
683 Ga0207675_100279405 3300026118 Bacteria 1622
684 Ga0207683_10001367 3300026121 Bacteria 22059
685 Ga0207683_10011208 3300026121 Bacteria 7641
686 Ga0207683_10030595 3300026121 Bacteria 4665
687 Ga0207683_10071019 3300026121 Bacteria 3077
688 Ga0207683_10205954 3300026121 Bacteria 1789
689 Ga0207698_10001664 3300026142 Bacteria 12968
690 Ga0207698_10009221 3300026142 Bacteria 6277
691 Ga0207698_10033396 3300026142 Bacteria 3739
692 Ga0207698_10082831 3300026142 Bacteria 2594
693 Ga0207428_10035888 3300027907 Bacteria 4049
694 Ga0268266_10000065 3300028379 Bacteria 246498
695 Ga0268266_10004126 3300028379 Bacteria 14038
696 Ga0268266_10061568 3300028379 Bacteria 3237
697 Ga0268265_10082256 3300028380 Bacteria 2546
698 Ga0268265_10161776 3300028380 Bacteria 1902
699 Ga0268264_10000011 3300028381 Bacteria 580884
700 Ga0268264_10001194 3300028381 Bacteria 25099
701 Ga0268264_10009266 3300028381 Bacteria 8152
702 Ga0268264_10015628 3300028381 Bacteria 6219
703 Ga0268264_10029024 3300028381 Bacteria 4529
704 Ga0268264_10032221 3300028381 Bacteria 4300
705 Ga0268264_10220845 3300028381 Bacteria 1744
706 Ga0265334_10012539 3300028573 Bacteria 3560
707 Ga0265334_10013266 3300028573 Bacteria 3452
708 Ga0307517_10003653 3300028786 Bacteria 23914
709 Ga0307517_10081796 3300028786 Bacteria 2749
710 Ga0307515_10000001 3300028794 Bacteria 4259510
711 Ga0307515_10000107 3300028794 Bacteria 197046
712 Ga0311001_1014117 3300029277 Eukaryota 1873
713 Ga0311011_143046 3300029280 Eukaryota 1867
714 Ga0311003_168779 3300029282 Eukaryota 1929
715 Ga0307511_10000734 3300030521 Bacteria 34994
716 Ga0265331_10048543 3300031250 Bacteria 2040
717 Ga0265327_10000055 3300031251 Bacteria 247188
718 Ga0265327_10000837 3300031251 Bacteria 45956
719 Ga0265327_10002040 3300031251 Bacteria 22722
720 Ga0265327_10002148 3300031251 Bacteria 21753
721 Ga0265327_10002921 3300031251 Bacteria 17111
722 Ga0265327_10004316 3300031251 Bacteria 12681
723 Ga0265327_10021534 3300031251 Bacteria 3887
724 Ga0265327_10036998 3300031251 Bacteria 2677
725 Ga0265327_10038492 3300031251 Unclassified 2609
726 Ga0310116_101673 3300031591 Eukaryota 2140
727 Ga0310117_101718 3300031592 Eukaryota 2104
728 Ga0310107_103802 3300031615 Eukaryota 1923
729 Ga0307508_10001362 3300031616 Bacteria 27521
730 Ga0310102_100379 3300031632 Eukaryota 2163
731 Ga0310108_101564 3300031633 Eukaryota 2297
732 Ga0310106_100790 3300031634 Eukaryota 2041
733 Ga0310115_101550 3300031635 Eukaryota 2508
734 Ga0310113_101709 3300031636 Eukaryota 2178
735 Ga0310118_101225 3300031664 Eukaryota 1942
736 Ga0310105_102040 3300031666 Eukaryota 2173
737 Ga0310111_102280 3300031667 Eukaryota 2216
738 Ga0310114_101717 3300031678 Eukaryota 2030
739 Ga0310119_103144 3300031686 Eukaryota 1979
740 Ga0310101_103167 3300031690 Eukaryota 1942
741 Ga0316576_10112301 3300031727 Bacteria 2043
742 Ga0316578_10008900 3300031728 Bacteria 5134
743 Ga0307516_10002940 3300031730 Bacteria 22319
744 Ga0307516_10021081 3300031730 Bacteria 6718
745 Ga0316577_10016854 3300031733 Bacteria 4032
746 Ga0316044_101502 3300031810 Eukaryota 2576
747 Ga0316045_103574 3300031815 Eukaryota 1908
748 Ga0316042_103921 3300031816 Eukaryota 2107
749 Ga0316043_103537 3300031828 Eukaryota 2177
750 Ga0307409_100193773 3300031995 Bacteria 1812
751 Ga0307414_10064534 3300032004 Bacteria 2608
752 Ga0307414_10238559 3300032004 Bacteria 1504
753 Ga0316593_10004444 3300032168 Bacteria 3600
754 Ga0316593_10008297 3300032168 Eukaryota 2890
755 Ga0316593_10015071 3300032168 Bacteria 2319
756 Ga0316593_10031435 3300032168 Eukaryota 1729
757 Ga0307510_10006641 3300033180 Bacteria 13799
758 Ga0316586_1005568 3300033527 Unclassified 1777
759 Ga0316586_1005978 3300033527 Eukaryota 1732
760 Ga0316588_1003075 3300033528 Eukaryota 2994
761 Ga0316587_1006783 3300033529 Unclassified 1761
762 Ga0316596_1003878 3300033541 Bacteria 3312
763 Ga0316596_1017087 3300033541 Eukaryota 1822
764 Ga0316574_0042011 3300035398 Bacteria 2820
765 Ga0373924_0023239 3300035410 Bacteria 2430
766 Ga0373937_0035200 3300036401 Bacteria 4556
767 Ga0373937_0079296 3300036401 Bacteria 3035
768 Ga0310112_004665 3300036458 Eukaryota 1878
769 Ga0310109_001797 3300036534 Eukaryota 2263
770 Ga0310109_003343 3300036534 Eukaryota 1903
771 Ga0310110_003655 3300036535 Eukaryota 2119
772 Ga0310110_007110 3300036535 Eukaryota 1636
773 Ga0316584_0020865 3300036712 Bacteria 4757
774 Ga0316584_0078812 3300036712 Bacteria 2467
775 Ga0316584_0084594 3300036712 Bacteria 2376
776 Ga0373925_0192627 3300037068 Bacteria 1618
777 Ga0395899_0000025 3300037312 Bacteria 350927
778 Ga0395899_0004705 3300037312 Bacteria 10653
779 Ga0395899_0022148 3300037312 Bacteria 4818
780 Ga0395899_0125390 3300037312 Bacteria 1836
781 Ga0395900_0010127 3300037418 Bacteria 9641
782 Ga0395900_0024239 3300037418 Bacteria 6212
783 Ga0395900_0069958 3300037418 Bacteria 3608
784 Ga0395900_0094055 3300037418 Bacteria 3079
785 Ga0395900_0114073 3300037418 Bacteria 2773
786 Ga0395900_0122247 3300037418 Bacteria 2671
787 Ga0395900_0160006 3300037418 Bacteria 2297
788 Ga0395900_0208414 3300037418 Bacteria 1974
789 Ga0395898_0000738 3300037466 Bacteria 57155
790 Ga0395898_0024244 3300037466 Bacteria 6119
791 Ga0395905_0000011 3300037471 Bacteria 424563
792 Ga0395905_0000424 3300037471 Bacteria 58940
793 Ga0395905_0002077 3300037471 Bacteria 22806
794 Ga0395905_0058731 3300037471 Bacteria 3597
795 Ga0395905_0078678 3300037471 Unclassified 3090
796 Ga0395905_0174138 3300037471 Bacteria 2021
797 Ga0395901_0000701 3300038443 Bacteria 38257
798 Ga0395901_0002159 3300038443 Bacteria 20086
799 Ga0395901_0006937 3300038443 Bacteria 11445
800 Ga0395901_0164236 3300038443 Bacteria 2331
801 Ga0395901_0310372 3300038443 Eukaryota 1634
802 Ga0400489_30943 3300039093 Bacteria 1385
803 Ga0400489_46343 3300039093 Unclassified 1465
804 Ga0436365_0527492 3300039437 Bacteria 2241
805 Ga0436365_0645548 3300039437 Bacteria 4394
806 Ga0436365_0722843 3300039437 Bacteria 20827
807 Ga0436365_1777169 3300039437 Bacteria 24248
808 Ga0451796_21607 3300041450 Eukaryota 1851
809 Ga0451799_07084 3300041454 Eukaryota 1608
810 Ga0451805_012004 3300041461 Eukaryota 1948
811 Ga0451840_16749 3300041497 Eukaryota 1859
812 Ga0451844_11196 3300041500 Eukaryota 1706
813 Ga0451846_05625 3300041502 Eukaryota 1648
814 Ga0451850_03754 3300041506 Eukaryota 2008
815 Ga0451854_32005 3300041510 Eukaryota 1888
816 Ga0451853_2490003 3300041512 Bacteria 1707
817 Ga0452268_04908 3300041907 Eukaryota 1722
818 Ga0452271_09524 3300041916 Eukaryota 1972
819 Ga0439431_0000898 3300041997 Bacteria 6429
820 Ga0439445_0004707 3300042004 Bacteria 3096
821 Ga0439449_0002063 3300042007 Bacteria 7909
822 Ga0439457_000194 3300042014 Bacteria 16029
823 Ga0439457_017921 3300042014 Bacteria 1571
824 Ga0439462_0003569 3300042015 Bacteria 3743
825 Ga0439434_0050937 3300042435 Bacteria 1283
826 Ga0451577_0000433 3300042876 Bacteria 74789
827 Ga0451577_0000651 3300042876 Bacteria 55020
828 Ga0451577_0001245 3300042876 Bacteria 35250
829 Ga0451577_0009644 3300042876 Bacteria 9267
830 Ga0451577_0037169 3300042876 Bacteria 4383
831 Ga0451577_0100917 3300042876 Unclassified 2578
832 Ga0451577_0102594 3300042876 Bacteria 2556
833 Ga0451577_0175564 3300042876 Bacteria 1931
834 Ga0451577_0187558 3300042876 Bacteria 1865
835 Ga0451577_0215014 3300042876 Bacteria 1737
836 Ga0451577_0216186 3300042876 Bacteria 1732
837 Ga0451577_0254697 3300042876 Bacteria 1589
838 Ga0466969_0000235 3300044656 Bacteria 30219
839 Ga0466972_0000129 3300044658 Bacteria 63412
840 Ga0466972_0017374 3300044658 Bacteria 3601
841 Ga0453683_0000015 3300044673 Bacteria 346024
842 Ga0453683_0000055 3300044673 Bacteria 192588
843 Ga0453683_0000370 3300044673 Bacteria 53913
844 Ga0453683_0005928 3300044673 Bacteria 8435
845 Ga0453683_0077239 3300044673 Bacteria 2085
846 Ga0466966_0000280 3300044684 Bacteria 33412
847 Ga0453684_0000288 3300044712 Bacteria 216718
848 Ga0453684_0000527 3300044712 Bacteria 146072
849 Ga0453684_0001433 3300044712 Bacteria 68182
850 Ga0453684_0001448 3300044712 Bacteria 67464
851 Ga0453684_0002895 3300044712 Bacteria 40244
852 Ga0453684_0011070 3300044712 Bacteria 15229
853 Ga0453684_0011269 3300044712 Bacteria 15040
854 Ga0453684_0012598 3300044712 Bacteria 13911
855 Ga0453684_0028890 3300044712 Bacteria 7893
856 Ga0453684_0050914 3300044712 Bacteria 5439
857 Ga0453684_0055349 3300044712 Bacteria 5159
858 Ga0453684_0073633 3300044712 Bacteria 4305
859 Ga0453684_0163183 3300044712 Bacteria 2633
860 Ga0453684_0169504 3300044712 Bacteria 2574
861 Ga0453684_0289054 3300044712 Bacteria 1867
862 Ga0466971_0013802 3300044719 Bacteria 3552
863 Ga0466970_0001553 3300044765 Bacteria 11067
864 Ga0466957_0000047 3300044842 Bacteria 45485
865 Ga0466957_0003227 3300044842 Bacteria 8924
866 Ga0466959_0000015 3300045049 Bacteria 149242
867 Ga0451576_0000003 3300045051 Bacteria 1550573
868 Ga0451576_0000211 3300045051 Bacteria 146199
869 Ga0451576_0000689 3300045051 Bacteria 68784
870 Ga0451576_0000720 3300045051 Bacteria 66656
871 Ga0451576_0003461 3300045051 Bacteria 21644
872 Ga0451576_0007161 3300045051 Bacteria 13445
873 Ga0451576_0102824 3300045051 Bacteria 2972
874 Ga0495627_003275 3300046453 Bacteria 7250
875 Ga0495592_0031395 3300046454 Bacteria 4015
876 Ga0495638_0078741 3300046460 Bacteria 2005
877 Ga0495653_0059728 3300046463 Eukaryota 2892
878 Ga0495580_0022374 3300046472 Unclassified 4652
879 Ga0495606_0012333 3300046507 Bacteria 6868
880 Ga0495618_0011353 3300046514 Bacteria 5399
881 Ga0495628_0021332 3300046516 Bacteria 5331
882 Ga0495630_0017424 3300046517 Bacteria 5261
883 Ga0495648_0011939 3300046524 Bacteria 6515
884 Ga0495640_0030887 3300046533 Eukaryota 3830
885 Ga0495586_0073845 3300046535 Unclassified 1866
886 Ga0495633_0000017 3300046558 Bacteria 249973
887 Ga0495667_0039334 3300046559 Bacteria 3145
888 Ga0495668_0000191 3300046616 Bacteria 90923
889 Ga0495668_0000227 3300046616 Bacteria 81234
890 Ga0495668_0001856 3300046616 Bacteria 18993
891 Ga0495668_0020328 3300046616 Bacteria 3820
892 Ga0495611_0000021 3300046648 Bacteria 123657
893 Ga0495625_0026632 3300046660 Bacteria 4367
894 Ga0495625_0151307 3300046660 Bacteria 1560
895 Ga0495658_0117179 3300046683 Bacteria 1607
896 Ga0495613_0000219 3300046689 Eukaryota 55845
897 Ga0495670_0039078 3300046691 Bacteria 2367
898 Ga0495636_0000008 3300047318 Bacteria 102958
899 Ga0495672_0010692 3300047320 Bacteria 6517
900 Ga0495672_0077034 3300047320 Bacteria 1871
901 Ga0495672_0084345 3300047320 Bacteria 1762
902 Ga0495672_0091007 3300047320 Bacteria 1675
903 Ga0495687_000001 3300047443 Bacteria 1215582
904 Ga0495684_0051204 3300047471 Eukaryota 3152
905 Ga0495686_0000094 3300047472 Bacteria 187720
906 Ga0495686_0000981 3300047472 Bacteria 34933
907 Ga0495686_0034390 3300047472 Bacteria 3265
908 Ga0496108_0160946 3300048911 Bacteria 1940
909 Ga0496109_0175023 3300048912 Bacteria 2014
910 Ga0496109_0180913 3300048912 Bacteria 1980
911 Ga0496111_0079053 3300048914 Bacteria 2399
912 Ga0496114_0002781 3300048917 Bacteria 13391
913 Ga0496121_0000010 3300048924 Bacteria 793488
914 Ga0496125_0113352 3300048928 Eukaryota 1956
915 Ga0496126_0104265 3300048929 Bacteria 2477
916 Ga0501309_003473 3300049129 Eukaryota 1787
917 Ga0501305_004091 3300049161 Eukaryota 1695
918 Ga0501031_0062697 3300049568 Bacteria 2422
919 Ga0501032_0008278 3300049569 Bacteria 7578
920 Ga0501032_0033612 3300049569 Bacteria 3513
921 Ga0501034_0000400 3300049571 Bacteria 73231
922 Ga0501034_0002020 3300049571 Bacteria 25539
923 Ga0501034_0003274 3300049571 Bacteria 18491
924 Ga0501034_0018272 3300049571 Bacteria 7191
925 Ga0501034_0056204 3300049571 Bacteria 3961
926 Ga0501034_0058086 3300049571 Bacteria 3888
927 Ga0501034_0060026 3300049571 Bacteria 3820
928 Ga0501034_0317360 3300049571 Bacteria 1492
929 Ga0501036_0014453 3300049572 Bacteria 6577
930 Ga0501036_0082726 3300049572 Bacteria 2713
931 Ga0501036_0125704 3300049572 Bacteria 2165
932 Ga0501036_0145007 3300049572 Bacteria 2003
933 Ga0501037_0009762 3300049573 Bacteria 7048
934 Ga0501038_0049949 3300049574 Bacteria 3615
935 Ga0501038_0192564 3300049574 Bacteria 1640
936 Ga0501039_0029048 3300049575 Bacteria 4258
937 Ga0501043_0041368 3300049579 Bacteria 3621
938 Ga0501043_0051224 3300049579 Bacteria 3244
939 Ga0501043_0079529 3300049579 Bacteria 2576
940 Ga0501043_0083676 3300049579 Bacteria 2508
941 Ga0501046_0028556 3300049580 Bacteria 4542
942 Ga0501046_0212684 3300049580 Bacteria 1435
943 Ga0501047_0033258 3300049581 Bacteria 4977
944 Ga0501047_0051131 3300049581 Bacteria 3991
945 Ga0501047_0168208 3300049581 Bacteria 2062
946 Ga0501048_0074370 3300049582 Bacteria 2397
947 Ga0501070_0107975 3300049586 Bacteria 2300
948 Ga0501074_0012038 3300049590 Bacteria 6283
949 Ga0501198_001390 3300049649 Bacteria 3147
950 Ga0501201_000556 3300049651 Bacteria 3478
951 Ga0501202_013013 3300049652 Bacteria 1578
952 Ga0501206_000657 3300049653 Bacteria 4182
953 Ga0501207_000568 3300049654 Bacteria 4230
954 Ga0501217_001767 3300049661 Bacteria 4126
955 Ga0501222_002907 3300049662 Bacteria 2363
956 Ga0501223_001352 3300049663 Bacteria 5680
957 Ga0501243_001338 3300049675 Bacteria 3514
958 Ga0501259_001263 3300049688 Bacteria 4229
959 Ga0501259_004609 3300049688 Bacteria 2190
960 Ga0501219_000154 3300049703 Bacteria 12438
961 Ga0501221_001292 3300049704 Bacteria 4135
962 Ga0501225_0000705 3300049705 Bacteria 10480
963 Ga0501225_0004141 3300049705 Bacteria 4336
964 Ga0501225_0013263 3300049705 Bacteria 2309
965 Ga0501079_0140382 3300049741 Bacteria 1882
966 Ga0501080_0070949 3300049742 Bacteria 3240
967 Ga0501080_0375209 3300049742 Bacteria 1282
968 Ga0501241_000089 3300049758 Bacteria 19792
969 Ga0501266_002636 3300049763 Bacteria 2250
970 Ga0501283_001644 3300049779 Bacteria 2912
971 Ga0501035_0007882 3300049822 Bacteria 9950
972 Ga0501035_0034348 3300049822 Bacteria 4608
973 Ga0501035_0036432 3300049822 Bacteria 4458
974 Ga0501035_0188004 3300049822 Unclassified 1777
975 Ga0501035_0244238 3300049822 Bacteria 1526
976 Ga0501044_0009652 3300049823 Bacteria 10499
977 Ga0501044_0012704 3300049823 Bacteria 9120
978 Ga0501044_0037532 3300049823 Bacteria 5064
979 Ga0501044_0087996 3300049823 Bacteria 3136
980 Ga0501044_0181350 3300049823 Bacteria 2072
981 Ga0501044_0319162 3300049823 Bacteria 1478
982 Ga0501284_00104 3300050005 Bacteria 17195
983 nmdc:mga0k408_13738_c1 3300050493 Bacteria 4447
984 nmdc:mga05p37_3235_c1 3300050507 Bacteria 18970
985 nmdc:mga09592_106306_c1 3300050508 Bacteria 2407
986 nmdc:mga09592_1546_c1 3300050508 Bacteria 18488
987 nmdc:mga0qj67_14639_c1 3300050509 Bacteria 5931
988 nmdc:mga0qj67_45337_c1 3300050509 Unclassified 3469
989 nmdc:mga06r32_20657_c1 3300050510 Bacteria 6065
990 nmdc:mga06r32_4303_c1 3300050510 Bacteria 12745
991 nmdc:mga08y16_13230_c1 3300050511 Bacteria 8678
992 nmdc:mga0n895_93045_c2 3300050512 Bacteria 2065
993 Ga0500578_0000362 3300053086 Bacteria 55748
994 Ga0500578_0015601 3300053086 Bacteria 4880
995 Ga0500644_0000233 3300053088 Bacteria 31422
996 Ga0500581_064306 3300053089 Bacteria 1854
997 Ga0500646_0025164 3300053090 Bacteria 1606
998 Ga0500583_0000053 3300053092 Bacteria 74724
999 Ga0500583_0003049 3300053092 Bacteria 5178
1000 Ga0500562_000025 3300053108 Bacteria 105616
1001 Ga0500569_001850 3300053109 Bacteria 4073
1002 Ga0500594_0020966 3300053118 Bacteria 1635
1003 Ga0500607_055459 3300053121 Bacteria 2095
1004 Ga0500642_0000960 3300053130 Bacteria 8311
1005 Ga0500642_0013043 3300053130 Bacteria 3039
1006 Ga0500652_003510 3300053131 Bacteria 4758
1007 Ga0500652_053905 3300053131 Bacteria 1646
1008 Ga0500568_0000593 3300053139 Bacteria 26321
1009 Ga0500568_0034432 3300053139 Bacteria 2072
1010 Ga0500588_0006338 3300053146 Bacteria 2676
1011 Ga0500588_0038620 3300053146 Bacteria 1425
1012 Ga0500604_0003300 3300053151 Bacteria 4344
1013 Ga0500616_0004500 3300053153 Bacteria 9903
1014 Ga0500616_0012441 3300053153 Bacteria 4978
1015 Ga0500622_0000319 3300053156 Bacteria 48315
1016 Ga0500622_0000917 3300053156 Bacteria 25097
1017 Ga0500622_0016530 3300053156 Bacteria 3942
1018 Ga0500636_0026955 3300053177 Bacteria 3393
1019 Ga0500611_000061 3300053727 Bacteria 45387
1020 Ga0501084_0010875 3300054114 Bacteria 7537
1021 Ga0501084_0020074 3300054114 Bacteria 5572
1022 Ga0500661_001516 3300055283 Bacteria 4368
1023 Ga0587070_006321 3300059491 Eukaryota 1594
1024 Ga0587073_0003063 3300059492 Eukaryota 2245
1025 Ga0587077_005091 3300059493 Eukaryota 1775
1026 Ga0587080_001676 3300059503 Eukaryota 2461
1027 Ga0587080_008247 3300059503 Eukaryota 1486
1028 Ga0587082_004058 3300059504 Eukaryota 1808
1029 Ga0587083_0004724 3300059505 Eukaryota 1917
1030 Ga0587083_0010177 3300059505 Eukaryota 1518
1031 Ga0587088_007944 3300059508 Eukaryota 1485
1032 Ga0587089_003294 3300059509 Eukaryota 1709
1033 Ga0587091_004506 3300059511 Eukaryota 1835
1034 Ga0587091_009086 3300059511 Eukaryota 1488
1035 Ga0587098_001772 3300059604 Eukaryota 1721
1036 Ga0587109_010290 3300059624 Eukaryota 1490
1037 Ga0587128_003514 3300059630 Eukaryota 1745
1038 Ga0587128_004960 3300059630 Eukaryota 1570
1039 Ga0587068_004206 3300059641 Eukaryota 1890
1040 Ga0587072_003720 3300059643 Eukaryota 2166
1041 Ga0587078_002717 3300059646 Eukaryota 1733
1042 Ga0587079_005858 3300059647 Eukaryota 1760
1043 Ga0587102_002131 3300059649 Eukaryota 1494
1044 Ga0587071_003078 3300060344 Eukaryota 2348
1045 Ga0587111_0002972 3300060346 Eukaryota 2349
1046 Ga0501082_0198686 3300060353 Bacteria 1744
1047 2738724428 2738541278 Bacteria 9755573
1048 2819572031 2818991442 Bacteria 8318214
1049 2819586395 2818991444 Bacteria 6968812
1050 2819677801 2818991460 Bacteria 7595395
1051 2821141724 2821136567 Bacteria 8080116
1052 2881957752 2881955468 Bacteria 3545609
1053 2883073140 2883068021 Bacteria 6192739
1054 2884797751 2884791551 Bacteria 8511252
1055 2896087441 2896085136 Bacteria 6129793
1056 2896114791 2896109856 Bacteria 7140722
1057 2904469861 2904467357 Bacteria 8057758
1058 2914763015 2914759650 Bacteria 4701441
1059 2929155194 2929154850 Bacteria 6753285
1060 2929183199 2929177148 Bacteria 7883697
1061 2929245332 2929239360 Bacteria 7745570
1062 2929927581 2929921140 Bacteria 8649150
1063 2945979160 2945977869 Bacteria 7777518
1064 2946014974 2946013367 Bacteria 7766675
1065 8003151429 8003151029 Bacteria 8187759
1066 Ga0587115_002282
1067 SwRhRL2b_contig_1662827
1068 SwRhRL2b_contig_1886170
1069 JGI24740J21852_10001312
1070 JGI24740J21852_10025233
1071 JGI24739J22299_10000154
1072 JGI24739J22299_10009514
1073 JGI24744J21845_10011394
1074 JGI25154J39366_1000004
1075 Ga0006759J45824_1008941
1076 JGI25406J46586_10032623
1077 JGI25153J46596_10000224
1078 rootH2_10020011
1079 rootH2_10059474
1080 rootL2_10002073
1081 rootL2_10022324
1082 rootL2_10080770
1083 rootL2_10159435
1084 rootH1_10017832
1085 rootH1_10132169
1086 rootH1_10293201
1087 JGI25160J50197_1002326
1088 JGI25160J50197_1015175
1089 Ga0006556J51387_1001902
1090 Ga0007417J51691_1006438
1091 Ga0006557J51388_1002740
1092 Ga0006558J51389_1002884
1093 Ga0006559J51393_1002205
1094 Ga0006553J51392_1001961
1095 Ga0006555J51386_1001801
1096 Ga0006560J51390_1001990
1097 Ga0006554J51385_1001999
1098 Ga0007410J51695_1014397
1099 Ga0007409J51694_1006724
1100 Ga0055526_1008813
1101 Ga0055528_1000355
1102 Ga0055530_10000425
1103 Ga0055531_10000411
1104 Ga0058863_11636828
1105 Ga0058863_11883630
1106 Ga0058861_10004224
1107 Ga0058861_10012567
1108 Ga0058860_10086452
1109 Ga0058862_12751224
1110 Ga0058862_12825977
1111 Ga0065165_1000148
1112 Ga0065165_1016429
1113 Ga0065703_1004179
1114 Ga0065704_10000184
1115 Ga0065704_10070159
1116 Ga0065704_10078716
1117 Ga0065712_10002337
1118 Ga0065712_10073174
1119 Ga0065712_10129514
1120 Ga0065715_10136544
1121 Ga0065707_10081733
1122 Ga0065707_10104464
1123 Ga0070658_10035269
1124 Ga0070658_10039863
1125 Ga0070658_10068803
1126 Ga0070658_10075337
1127 Ga0070658_10079595
1128 Ga0070676_10010728
1129 Ga0070676_10028456
1130 Ga0070683_100001238
1131 Ga0070683_100001444
1132 Ga0070683_100016015
1133 Ga0070683_100016889
1134 Ga0070683_100097695
1135 Ga0070690_100003044
1136 Ga0070690_100082032
1137 Ga0070670_100043927
1138 Ga0070670_100058211
1139 Ga0070670_100071060
1140 Ga0070670_100099943
1141 Ga0070670_100108494
1142 Ga0068869_100005880
1143 Ga0068869_100011976
1144 Ga0068869_100015556
1145 Ga0070666_10000637
1146 Ga0070666_10005840
1147 Ga0070666_10011699
1148 Ga0070666_10119571
1149 Ga0070680_100007800
1150 Ga0070680_100018238
1151 Ga0070682_100000039
1152 Ga0070682_100001382
1153 Ga0068868_100020492
1154 Ga0068868_100026625
1155 Ga0068868_100050438
1156 Ga0068868_100221104
1157 Ga0070660_100070186
1158 Ga0070660_100095441
1159 Ga0070689_100009324
1160 Ga0070689_100130708
1161 Ga0070689_100163509
1162 Ga0070691_10024246
1163 Ga0070687_100036328
1164 Ga0070661_100005250
1165 Ga0070668_100007075
1166 Ga0070668_100042795
1167 Ga0070668_100128906
1168 Ga0070669_100007234
1169 Ga0070669_100155357
1170 Ga0070669_100207736
1171 Ga0070675_100002069
1172 Ga0070675_100025237
1173 Ga0070675_100031894
1174 Ga0070675_100036599
1175 Ga0070675_100042510
1176 Ga0070675_100071319
1177 Ga0070675_100080671
1178 Ga0070671_100012510
1179 Ga0070674_100031917
1180 Ga0070674_100140115
1181 Ga0070673_100039888
1182 Ga0070673_100106028
1183 Ga0070688_100004093
1184 Ga0070688_100034193
1185 Ga0070688_100047054
1186 Ga0070659_100044535
1187 Ga0070659_100076513
1188 Ga0070659_100169298
1189 Ga0070667_100001496
1190 Ga0070667_100014740
1191 Ga0070667_100046485
1192 Ga0070667_100140788
1193 Ga0070713_100082748
1194 Ga0070700_100040804
1195 Ga0070663_100048185
1196 Ga0070678_100029174
1197 Ga0070678_100031427
1198 Ga0070662_100007468
1199 Ga0070662_100020198
1200 Ga0070681_10019192
1201 Ga0070681_10022486
1202 Ga0070681_10037397
1203 Ga0070681_10043308
1204 Ga0068867_100007411
1205 Ga0068867_100009973
1206 Ga0068867_100012400
1207 Ga0068867_100061331
1208 Ga0068867_100115120
1209 Ga0070685_10010662
1210 Ga0070685_10029590
1211 Ga0070685_10099300
1212 Ga0070698_100010157
1213 Ga0070698_100013783
1214 Ga0070698_100022097
1215 Ga0070699_100243571
1216 Ga0070679_100001941
1217 Ga0070679_100004204
1218 Ga0070679_100004852
1219 Ga0070679_100006603
1220 Ga0070679_100016816
1221 Ga0070679_100173092
1222 Ga0070684_100004827
1223 Ga0070684_100026655
1224 Ga0070684_100053228
1225 Ga0070684_100066340
1226 Ga0068853_100000276
1227 Ga0068853_100010323
1228 Ga0068853_100057243
1229 Ga0068853_100068730
1230 Ga0068853_100149047
1231 Ga0070672_100000891
1232 Ga0070672_100012051
1233 Ga0070672_100015554
1234 Ga0070672_100031872
1235 Ga0070672_100053581
1236 Ga0070672_100058944
1237 Ga0070686_100023983
1238 Ga0070686_100060414
1239 Ga0070686_100086005
1240 Ga0070665_100000001
1241 Ga0070665_100006717
1242 Ga0070665_100008882
1243 Ga0070665_100165554
1244 Ga0068855_100001835
1245 Ga0068855_100007690
1246 Ga0068855_100077125
1247 Ga0068855_100211089
1248 Ga0068855_100241664
1249 Ga0070664_100000321
1250 Ga0070664_100022940
1251 Ga0070664_100035604
1252 Ga0070664_100057743
1253 Ga0070664_100113391
1254 Ga0070664_100116519
1255 Ga0068857_100001139
1256 Ga0068857_100003724
1257 Ga0068857_100007529
1258 Ga0068857_100040032
1259 Ga0068857_100046729
1260 Ga0068857_100067152
1261 Ga0068857_100083434
1262 Ga0068854_100063732
1263 Ga0068854_100122710
1264 Ga0068854_100126928
1265 Ga0068856_100011104
1266 Ga0068856_100014039
1267 Ga0068856_100020619
1268 Ga0068856_100030709
1269 Ga0068856_100043776
1270 Ga0068856_100081424
1271 Ga0068856_100175544
1272 Ga0068856_100224251
1273 Ga0068852_100002151
1274 Ga0068852_100006664
1275 Ga0068852_100009018
1276 Ga0068852_100012493
1277 Ga0068852_100046206
1278 Ga0068852_100059122
1279 Ga0068852_100084705
1280 Ga0068859_100000029
1281 Ga0068859_100002114
1282 Ga0068859_100008303
1283 Ga0068859_100013957
1284 Ga0068859_100041845
1285 Ga0068859_100059969
1286 Ga0068859_100120020
1287 Ga0068859_100252668
1288 Ga0068864_100004500
1289 Ga0068864_100027276
1290 Ga0068864_100031790
1291 Ga0068864_100085759
1292 Ga0068864_100095796
1293 Ga0068864_100105231
1294 Ga0068861_100003057
1295 Ga0068861_100010966
1296 Ga0068861_100069206
1297 Ga0068861_100175543
1298 Ga0068851_10000700
1299 Ga0068851_10034762
1300 Ga0068851_10070802
1301 Ga0068863_100013276
1302 Ga0068863_100024625
1303 Ga0068863_100054921
1304 Ga0068863_100133984
1305 Ga0068863_100138099
1306 Ga0068858_100022432
1307 Ga0068858_100032010
1308 Ga0068858_100121301
1309 Ga0068860_100000004
1310 Ga0068860_100000888
1311 Ga0068860_100003442
1312 Ga0068860_100011991
1313 Ga0068860_100014813
1314 Ga0068860_100029918
1315 Ga0068860_100058702
1316 Ga0068860_100058812
1317 Ga0068860_100123470
1318 Ga0068862_100098660
1319 Ga0068862_100108486
1320 Ga0068862_100148170
1321 Ga0081539_10000037
1322 Ga0075364_10018791
1323 Ga0075366_10032815
1324 Ga0075366_10033322
1325 Ga0075366_10091755
1326 Ga0097621_100002686
1327 Ga0097621_100003597
1328 Ga0097621_100007374
1329 Ga0097621_100013550
1330 Ga0097621_100026587
1331 Ga0097621_100048389
1332 Ga0097621_100066510
1333 Ga0097621_100075505
1334 Ga0068871_100000076
1335 Ga0068871_100010710
1336 Ga0068871_100014864
1337 Ga0068871_100030731
1338 Ga0075428_100016924
1339 Ga0075428_100017350
1340 Ga0075428_100048921
1341 Ga0075428_100164787
1342 Ga0075428_100365710
1343 Ga0075430_100003812
1344 Ga0075430_100051479
1345 Ga0075431_100012623
1346 Ga0075429_100000539
1347 Ga0075429_100039248
1348 Ga0068865_100016033
1349 Ga0068865_100079134
1350 Ga0068865_100092796
1351 Ga0097620_100000029
1352 Ga0097620_100002114
1353 Ga0097620_100008303
1354 Ga0097620_100013956
1355 Ga0097620_100041849
1356 Ga0097620_100059969
1357 Ga0097620_100120019
1358 Ga0097620_100252678
1359 Ga0105240_10000131
1360 Ga0105240_10002773
1361 Ga0105240_10003397
1362 Ga0105240_10003620
1363 Ga0105240_10004711
1364 Ga0105240_10006456
1365 Ga0105240_10016334
1366 Ga0105240_10028113
1367 Ga0105240_10031577
1368 Ga0105240_10042295
1369 Ga0105240_10119331
1370 Ga0111539_10002138
1371 Ga0111539_10115534
1372 Ga0105245_10060441
1373 Ga0105247_10027268
1374 Ga0105247_10057125
1375 Ga0114129_10036098
1376 Ga0105243_10193772
1377 Ga0105241_10000764
1378 Ga0105241_10001337
1379 Ga0105241_10001925
1380 Ga0105241_10034397
1381 Ga0105242_10019613
1382 Ga0105242_10059527
1383 Ga0105242_10094281
1384 Ga0105248_10026892
1385 Ga0105237_10000377
1386 Ga0105237_10002457
1387 Ga0105237_10002932
1388 Ga0105237_10008643
1389 Ga0105237_10013544
1390 Ga0105237_10013564
1391 Ga0105237_10015625
1392 Ga0105238_10025254
1393 Ga0105238_10058072
1394 Ga0105249_10001339
1395 Ga0105249_10021951
1396 Ga0105249_10042337
1397 Ga0105249_10131482
1398 Ga0105249_10367601
1399 Ga0105239_10000029
1400 Ga0105239_10000714
1401 Ga0105239_10001999
1402 Ga0105239_10002549
1403 Ga0105239_10005380
1404 Ga0105239_10005636
1405 Ga0105239_10019534
1406 Ga0105239_10022019
1407 Ga0105239_10023622
1408 Ga0105239_10041121
1409 Ga0105239_10055909
1410 Ga0105239_10157937
1411 Ga0105239_10205821
1412 Ga0105246_10006069
1413 Ga0105246_10049467
1414 Ga0105246_10112213
1415 Ga0157373_10000350
1416 Ga0157373_10009312
1417 Ga0157373_10010190
1418 Ga0157373_10013041
1419 Ga0157373_10024322
1420 Ga0157373_10036664
1421 Ga0157371_10001416
1422 Ga0157371_10002643
1423 Ga0157371_10003115
1424 Ga0157371_10003982
1425 Ga0157371_10006222
1426 Ga0157371_10009640
1427 Ga0157371_10019168
1428 Ga0157371_10035435
1429 Ga0157370_10000478
1430 Ga0157370_10000530
1431 Ga0157370_10001941
1432 Ga0157370_10003057
1433 Ga0157370_10110923
1434 Ga0157369_10036543
1435 Ga0157369_10041768
1436 Ga0157369_10044835
1437 Ga0157369_10063839
1438 Ga0157369_10179875
1439 Ga0157374_10000001
1440 Ga0157374_10000719
1441 Ga0157374_10002479
1442 Ga0157374_10012275
1443 Ga0157374_10053886
1444 Ga0157374_10057778
1445 Ga0157374_10139195
1446 Ga0157378_10004321
1447 Ga0157378_10012543
1448 Ga0157378_10019488
1449 Ga0157378_10026764
1450 Ga0157378_10030980
1451 Ga0163162_10002251
1452 Ga0163162_10004108
1453 Ga0163162_10008316
1454 Ga0163162_10010477
1455 Ga0163162_10011862
1456 Ga0163162_10017201
1457 Ga0163162_10020291
1458 Ga0163162_10022959
1459 Ga0163162_10092099
1460 Ga0163162_10123303
1461 Ga0163162_10170787
1462 Ga0163162_10234754
1463 Ga0157372_10000494
1464 Ga0157372_10000535
1465 Ga0157372_10002089
1466 Ga0157372_10018796
1467 Ga0157372_10028256
1468 Ga0157372_10040251
1469 Ga0157372_10051209
1470 Ga0157372_10060015
1471 Ga0157372_10074861
1472 Ga0157372_10102209
1473 Ga0157372_10103417
1474 Ga0157372_10113493
1475 Ga0157372_10180826
1476 Ga0157372_10201609
1477 Ga0157372_10317550
1478 Ga0157375_10000754
1479 Ga0157375_10062733
1480 Ga0157375_10106071
1481 Ga0157375_10227876
1482 Ga0163163_10001404
1483 Ga0163163_10002372
1484 Ga0163163_10011499
1485 Ga0163163_10014951
1486 Ga0163163_10059223
1487 Ga0163163_10079251
1488 Ga0163163_10194588
1489 Ga0157380_10000065
1490 Ga0157380_10004489
1491 Ga0157380_10004871
1492 Ga0157380_10008145
1493 Ga0157380_10059197
1494 Ga0157380_10082005
1495 Ga0157380_10117460
1496 Ga0157377_10001833
1497 Ga0157377_10005286
1498 Ga0157377_10007983
1499 Ga0157377_10018633
1500 Ga0157377_10078099
1501 Ga0157379_10012636
1502 Ga0157379_10013980
1503 Ga0157379_10030553
1504 Ga0157379_10040673
1505 Ga0157376_10003097
1506 Ga0157376_10003487
1507 Ga0157376_10006460
1508 Ga0157376_10008586
1509 Ga0157376_10009241
1510 Ga0157376_10019752
1511 Ga0157376_10034923
1512 Ga0157376_10084377
1513 Ga0182005_1000040
1514 Ga0163161_10002671
1515 Ga0197907_10001091
1516 Ga0206356_11044593
1517 Ga0206356_11188758
1518 Ga0206349_1124235
1519 Ga0206349_1476759
1520 Ga0206355_1306531
1521 Ga0206352_10358918
1522 Ga0206350_10994793
1523 Ga0206354_10690293
1524 Ga0206353_11975280
1525 Ga0213876_10001135
1526 Ga0213876_10008319
1527 Ga0224712_10032821
1528 Ga0224712_10051383
1529 Ga0256720_152123
1530 Ga0247524_101506
1531 Ga0247519_101388
1532 Ga0247521_101613
1533 Ga0247526_102217
1534 Ga0247529_101655
1535 Ga0247518_102078
1536 Ga0247516_103277
1537 Ga0247530_100778
1538 Ga0247515_102482
1539 Ga0247527_101226
1540 Ga0247531_102163
1541 Ga0247525_101521
1542 Ga0247528_100975
1543 Ga0247513_101520
1544 Ga0247523_101818
1545 Ga0247520_101842
1546 Ga0247522_101379
1547 Ga0247517_102772
1548 Ga0247512_102652
1549 Ga0209436_100835
1550 Ga0209258_100075
1551 Ga0209646_1000025
1552 Ga0209026_1000312
1553 Ga0209148_1000085
1554 Ga0209673_1000197
1555 Ga0209130_1000540
1556 Ga0209564_1002016
1557 Ga0209564_1006989
1558 Ga0209758_1013571
1559 Ga0209758_1026448
1560 Ga0209050_1000204
1561 Ga0207426_1000019
1562 Ga0207426_1000057
1563 Ga0207426_1000332
1564 Ga0207426_1004122
1565 Ga0209257_1000004
1566 Ga0207656_10000242
1567 Ga0207656_10001795
1568 Ga0207682_10010567
1569 Ga0207710_10018469
1570 Ga0207710_10042150
1571 Ga0207688_10050268
1572 Ga0207680_10000016
1573 Ga0207680_10005281
1574 Ga0207680_10006952
1575 Ga0207680_10141803
1576 Ga0207647_10010657
1577 Ga0207647_10011240
1578 Ga0207647_10028854
1579 Ga0207645_10000245
1580 Ga0207645_10014460
1581 Ga0207645_10014729
1582 Ga0207645_10022723
1583 Ga0207643_10006102
1584 Ga0207643_10010745
1585 Ga0207705_10004089
1586 Ga0207705_10028047
1587 Ga0207705_10084391
1588 Ga0207705_10094177
1589 Ga0207654_10000299
1590 Ga0207654_10002562
1591 Ga0207654_10090731
1592 Ga0207707_10000121
1593 Ga0207707_10106885
1594 Ga0207707_10245673
1595 Ga0207695_10000057
1596 Ga0207695_10000217
1597 Ga0207695_10000266
1598 Ga0207695_10000568
1599 Ga0207695_10001216
1600 Ga0207695_10009606
1601 Ga0207695_10016181
1602 Ga0207695_10018698
1603 Ga0207695_10248067
1604 Ga0207671_10000725
1605 Ga0207671_10002783
1606 Ga0207671_10004167
1607 Ga0207671_10007745
1608 Ga0207671_10035098
1609 Ga0207671_10094283
1610 Ga0207660_10000354
1611 Ga0207660_10029342
1612 Ga0207657_10004379
1613 Ga0207657_10006314
1614 Ga0207657_10068682
1615 Ga0207649_10007338
1616 Ga0207652_10000160
1617 Ga0207652_10000561
1618 Ga0207652_10002749
1619 Ga0207652_10014959
1620 Ga0207652_10056382
1621 Ga0207652_10056556
1622 Ga0207681_10003524
1623 Ga0207681_10071596
1624 Ga0207681_10191661
1625 Ga0207650_10000628
1626 Ga0207650_10052169
1627 Ga0207650_10095151
1628 Ga0207659_10026830
1629 Ga0207659_10036380
1630 Ga0207659_10122253
1631 Ga0207659_10136427
1632 Ga0207687_10033514
1633 Ga0207644_10006635
1634 Ga0207644_10133527
1635 Ga0207644_10150454
1636 Ga0207690_10069216
1637 Ga0207690_10086335
1638 Ga0207706_10003545
1639 Ga0207706_10010731
1640 Ga0207706_10014210
1641 Ga0207706_10063617
1642 Ga0207706_10074701
1643 Ga0207706_10081989
1644 Ga0207686_10002107
1645 Ga0207686_10012076
1646 Ga0207686_10063858
1647 Ga0207670_10002060
1648 Ga0207670_10024082
1649 Ga0207670_10136263
1650 Ga0207669_10030045
1651 Ga0207704_10008934
1652 Ga0207704_10047774
1653 Ga0207704_10098056
1654 Ga0207691_10001933
1655 Ga0207691_10006183
1656 Ga0207691_10019082
1657 Ga0207691_10026632
1658 Ga0207691_10037910
1659 Ga0207691_10172527
1660 Ga0207689_10000681
1661 Ga0207689_10000983
1662 Ga0207689_10006134
1663 Ga0207689_10007631
1664 Ga0207661_10000620
1665 Ga0207661_10016604
1666 Ga0207679_10000683
1667 Ga0207679_10024422
1668 Ga0207679_10026675
1669 Ga0207679_10055592
1670 Ga0207679_10060468
1671 Ga0207667_10000246
1672 Ga0207667_10000451
1673 Ga0207667_10003666
1674 Ga0207667_10017632
1675 Ga0207667_10023624
1676 Ga0207667_10029781
1677 Ga0207667_10074991
1678 Ga0207667_10131553
1679 Ga0207667_10135292
1680 Ga0207651_10003723
1681 Ga0207651_10064820
1682 Ga0207651_10075940
1683 Ga0207712_10003055
1684 Ga0207712_10035406
1685 Ga0207712_10066056
1686 Ga0207668_10004760
1687 Ga0207668_10020320
1688 Ga0207668_10038885
1689 Ga0207668_10061973
1690 Ga0207658_10005434
1691 Ga0207658_10007307
1692 Ga0207658_10065977
1693 Ga0207658_10078329
1694 Ga0207658_10090080
1695 Ga0207658_10100505
1696 Ga0207658_10166092
1697 Ga0207677_10003111
1698 Ga0207677_10014532
1699 Ga0207677_10070347
1700 Ga0207677_10076993
1701 Ga0207677_10112542
1702 Ga0207677_10202766
1703 Ga0207703_10177854
1704 Ga0207639_10047670
1705 Ga0207639_10068205
1706 Ga0207639_10117019
1707 Ga0207639_10168152
1708 Ga0207639_10177547
1709 Ga0207639_10255744
1710 Ga0207678_10026406
1711 Ga0207708_10053534
1712 Ga0207702_10014507
1713 Ga0207702_10018329
1714 Ga0207702_10023270
1715 Ga0207702_10039046
1716 Ga0207702_10047717
1717 Ga0207702_10190488
1718 Ga0207702_10200369
1719 Ga0207641_10001043
1720 Ga0207641_10007146
1721 Ga0207641_10028096
1722 Ga0207641_10158191
1723 Ga0207648_10004405
1724 Ga0207648_10004983
1725 Ga0207648_10019657
1726 Ga0207648_10020128
1727 Ga0207648_10030590
1728 Ga0207648_10032678
1729 Ga0207648_10051997
1730 Ga0207648_10122781
1731 Ga0207648_10190187
1732 Ga0207648_10201176
1733 Ga0207676_10007718
1734 Ga0207676_10016235
1735 Ga0207676_10063144
1736 Ga0207676_10076483
1737 Ga0207676_10095372
1738 Ga0207674_10004668
1739 Ga0207674_10006324
1740 Ga0207674_10021677
1741 Ga0207674_10026972
1742 Ga0207674_10029266
1743 Ga0207674_10045517
1744 Ga0207674_10080436
1745 Ga0207674_10123916
1746 Ga0207675_100001355
1747 Ga0207675_100002256
1748 Ga0207675_100279405
1749 Ga0207683_10001367
1750 Ga0207683_10011208
1751 Ga0207683_10030595
1752 Ga0207683_10071019
1753 Ga0207683_10205954
1754 Ga0207698_10001664
1755 Ga0207698_10009221
1756 Ga0207698_10033396
1757 Ga0207698_10082831
1758 Ga0207428_10035888
1759 Ga0268266_10000065
1760 Ga0268266_10004126
1761 Ga0268266_10061568
1762 Ga0268265_10082256
1763 Ga0268265_10161776
1764 Ga0268264_10000011
1765 Ga0268264_10001194
1766 Ga0268264_10009266
1767 Ga0268264_10015628
1768 Ga0268264_10029024
1769 Ga0268264_10032221
1770 Ga0268264_10220845
1771 Ga0265334_10012539
1772 Ga0265334_10013266
1773 Ga0307517_10003653
1774 Ga0307517_10081796
1775 Ga0307515_10000001
1776 Ga0307515_10000107
1777 Ga0311001_1014117
1778 Ga0311011_143046
1779 Ga0311003_168779
1780 Ga0307511_10000734
1781 Ga0265331_10048543
1782 Ga0265327_10000055
1783 Ga0265327_10000837
1784 Ga0265327_10002040
1785 Ga0265327_10002148
1786 Ga0265327_10002921
1787 Ga0265327_10004316
1788 Ga0265327_10021534
1789 Ga0265327_10036998
1790 Ga0265327_10038492
1791 Ga0310116_101673
1792 Ga0310117_101718
1793 Ga0310107_103802
1794 Ga0307508_10001362
1795 Ga0310102_100379
1796 Ga0310108_101564
1797 Ga0310106_100790
1798 Ga0310115_101550
1799 Ga0310113_101709
1800 Ga0310118_101225
1801 Ga0310105_102040
1802 Ga0310111_102280
1803 Ga0310114_101717
1804 Ga0310119_103144
1805 Ga0310101_103167
1806 Ga0316576_10112301
1807 Ga0316578_10008900
1808 Ga0307516_10002940
1809 Ga0307516_10021081
1810 Ga0316577_10016854
1811 Ga0316044_101502
1812 Ga0316045_103574
1813 Ga0316042_103921
1814 Ga0316043_103537
1815 Ga0307409_100193773
1816 Ga0307414_10064534
1817 Ga0307414_10238559
1818 Ga0316593_10004444
1819 Ga0316593_10008297
1820 Ga0316593_10015071
1821 Ga0316593_10031435
1822 Ga0307510_10006641
1823 Ga0316586_1005568
1824 Ga0316586_1005978
1825 Ga0316588_1003075
1826 Ga0316587_1006783
1827 Ga0316596_1003878
1828 Ga0316596_1017087
1829 Ga0316574_0042011
1830 Ga0373924_0023239
1831 Ga0373937_0035200
1832 Ga0373937_0079296
1833 Ga0310112_004665
1834 Ga0310109_001797
1835 Ga0310109_003343
1836 Ga0310110_003655
1837 Ga0310110_007110
1838 Ga0316584_0020865
1839 Ga0316584_0078812
1840 Ga0316584_0084594
1841 Ga0373925_0192627
1842 Ga0395899_0000025
1843 Ga0395899_0004705
1844 Ga0395899_0022148
1845 Ga0395899_0125390
1846 Ga0395900_0010127
1847 Ga0395900_0024239
1848 Ga0395900_0069958
1849 Ga0395900_0094055
1850 Ga0395900_0114073
1851 Ga0395900_0122247
1852 Ga0395900_0160006
1853 Ga0395900_0208414
1854 Ga0395898_0000738
1855 Ga0395898_0024244
1856 Ga0395905_0000011
1857 Ga0395905_0000424
1858 Ga0395905_0002077
1859 Ga0395905_0058731
1860 Ga0395905_0078678
1861 Ga0395905_0174138
1862 Ga0395901_0000701
1863 Ga0395901_0002159
1864 Ga0395901_0006937
1865 Ga0395901_0164236
1866 Ga0395901_0310372
1867 Ga0400489_30943
1868 Ga0400489_46343
1869 Ga0436365_0527492
1870 Ga0436365_0645548
1871 Ga0436365_0722843
1872 Ga0436365_1777169
1873 Ga0451796_21607
1874 Ga0451799_07084
1875 Ga0451805_012004
1876 Ga0451840_16749
1877 Ga0451844_11196
1878 Ga0451846_05625
1879 Ga0451850_03754
1880 Ga0451854_32005
1881 Ga0451853_2490003
1882 Ga0452268_04908
1883 Ga0452271_09524
1884 Ga0439431_0000898
1885 Ga0439445_0004707
1886 Ga0439449_0002063
1887 Ga0439457_000194
1888 Ga0439457_017921
1889 Ga0439462_0003569
1890 Ga0439434_0050937
1891 Ga0451577_0000433
1892 Ga0451577_0000651
1893 Ga0451577_0001245
1894 Ga0451577_0009644
1895 Ga0451577_0037169
1896 Ga0451577_0100917
1897 Ga0451577_0102594
1898 Ga0451577_0175564
1899 Ga0451577_0187558
1900 Ga0451577_0215014
1901 Ga0451577_0216186
1902 Ga0451577_0254697
1903 Ga0466969_0000235
1904 Ga0466972_0000129
1905 Ga0466972_0017374
1906 Ga0453683_0000015
1907 Ga0453683_0000055
1908 Ga0453683_0000370
1909 Ga0453683_0005928
1910 Ga0453683_0077239
1911 Ga0466966_0000280
1912 Ga0453684_0000288
1913 Ga0453684_0000527
1914 Ga0453684_0001433
1915 Ga0453684_0001448
1916 Ga0453684_0002895
1917 Ga0453684_0011070
1918 Ga0453684_0011269
1919 Ga0453684_0012598
1920 Ga0453684_0028890
1921 Ga0453684_0050914
1922 Ga0453684_0055349
1923 Ga0453684_0073633
1924 Ga0453684_0163183
1925 Ga0453684_0169504
1926 Ga0453684_0289054
1927 Ga0466971_0013802
1928 Ga0466970_0001553
1929 Ga0466957_0000047
1930 Ga0466957_0003227
1931 Ga0466959_0000015
1932 Ga0451576_0000003
1933 Ga0451576_0000211
1934 Ga0451576_0000689
1935 Ga0451576_0000720
1936 Ga0451576_0003461
1937 Ga0451576_0007161
1938 Ga0451576_0102824
1939 Ga0495627_003275
1940 Ga0495592_0031395
1941 Ga0495638_0078741
1942 Ga0495653_0059728
1943 Ga0495580_0022374
1944 Ga0495606_0012333
1945 Ga0495618_0011353
1946 Ga0495628_0021332
1947 Ga0495630_0017424
1948 Ga0495648_0011939
1949 Ga0495640_0030887
1950 Ga0495586_0073845
1951 Ga0495633_0000017
1952 Ga0495667_0039334
1953 Ga0495668_0000191
1954 Ga0495668_0000227
1955 Ga0495668_0001856
1956 Ga0495668_0020328
1957 Ga0495611_0000021
1958 Ga0495625_0026632
1959 Ga0495625_0151307
1960 Ga0495658_0117179
1961 Ga0495613_0000219
1962 Ga0495670_0039078
1963 Ga0495636_0000008
1964 Ga0495672_0010692
1965 Ga0495672_0077034
1966 Ga0495672_0084345
1967 Ga0495672_0091007
1968 Ga0495687_000001
1969 Ga0495684_0051204
1970 Ga0495686_0000094
1971 Ga0495686_0000981
1972 Ga0495686_0034390
1973 Ga0496108_0160946
1974 Ga0496109_0175023
1975 Ga0496109_0180913
1976 Ga0496111_0079053
1977 Ga0496114_0002781
1978 Ga0496121_0000010
1979 Ga0496125_0113352
1980 Ga0496126_0104265
1981 Ga0501309_003473
1982 Ga0501305_004091
1983 Ga0501031_0062697
1984 Ga0501032_0008278
1985 Ga0501032_0033612
1986 Ga0501034_0000400
1987 Ga0501034_0002020
1988 Ga0501034_0003274
1989 Ga0501034_0018272
1990 Ga0501034_0056204
1991 Ga0501034_0058086
1992 Ga0501034_0060026
1993 Ga0501034_0317360
1994 Ga0501036_0014453
1995 Ga0501036_0082726
1996 Ga0501036_0125704
1997 Ga0501036_0145007
1998 Ga0501037_0009762
1999 Ga0501038_0049949
2000 Ga0501038_0192564
2001 Ga0501039_0029048
2002 Ga0501043_0041368
2003 Ga0501043_0051224
2004 Ga0501043_0079529
2005 Ga0501043_0083676
2006 Ga0501046_0028556
2007 Ga0501046_0212684
2008 Ga0501047_0033258
2009 Ga0501047_0051131
2010 Ga0501047_0168208
2011 Ga0501048_0074370
2012 Ga0501070_0107975
2013 Ga0501074_0012038
2014 Ga0501198_001390
2015 Ga0501201_000556
2016 Ga0501202_013013
2017 Ga0501206_000657
2018 Ga0501207_000568
2019 Ga0501217_001767
2020 Ga0501222_002907
2021 Ga0501223_001352
2022 Ga0501243_001338
2023 Ga0501259_001263
2024 Ga0501259_004609
2025 Ga0501219_000154
2026 Ga0501221_001292
2027 Ga0501225_0000705
2028 Ga0501225_0004141
2029 Ga0501225_0013263
2030 Ga0501079_0140382
2031 Ga0501080_0070949
2032 Ga0501080_0375209
2033 Ga0501241_000089
2034 Ga0501266_002636
2035 Ga0501283_001644
2036 Ga0501035_0007882
2037 Ga0501035_0034348
2038 Ga0501035_0036432
2039 Ga0501035_0188004
2040 Ga0501035_0244238
2041 Ga0501044_0009652
2042 Ga0501044_0012704
2043 Ga0501044_0037532
2044 Ga0501044_0087996
2045 Ga0501044_0181350
2046 Ga0501044_0319162
2047 Ga0501284_00104
2048 nmdc:mga0k408_13738_c1
2049 nmdc:mga05p37_3235_c1
2050 nmdc:mga09592_106306_c1
2051 nmdc:mga09592_1546_c1
2052 nmdc:mga0qj67_14639_c1
2053 nmdc:mga0qj67_45337_c1
2054 nmdc:mga06r32_20657_c1
2055 nmdc:mga06r32_4303_c1
2056 nmdc:mga08y16_13230_c1
2057 nmdc:mga0n895_93045_c2
2058 Ga0500578_0000362
2059 Ga0500578_0015601
2060 Ga0500644_0000233
2061 Ga0500581_064306
2062 Ga0500646_0025164
2063 Ga0500583_0000053
2064 Ga0500583_0003049
2065 Ga0500562_000025
2066 Ga0500569_001850
2067 Ga0500594_0020966
2068 Ga0500607_055459
2069 Ga0500642_0000960
2070 Ga0500642_0013043
2071 Ga0500652_003510
2072 Ga0500652_053905
2073 Ga0500568_0000593
2074 Ga0500568_0034432
2075 Ga0500588_0006338
2076 Ga0500588_0038620
2077 Ga0500604_0003300
2078 Ga0500616_0004500
2079 Ga0500616_0012441
2080 Ga0500622_0000319
2081 Ga0500622_0000917
2082 Ga0500622_0016530
2083 Ga0500636_0026955
2084 Ga0500611_000061
2085 Ga0501084_0010875
2086 Ga0501084_0020074
2087 Ga0500661_001516
2088 Ga0587070_006321
2089 Ga0587073_0003063
2090 Ga0587077_005091
2091 Ga0587080_001676
2092 Ga0587080_008247
2093 Ga0587082_004058
2094 Ga0587083_0004724
2095 Ga0587083_0010177
2096 Ga0587088_007944
2097 Ga0587089_003294
2098 Ga0587091_004506
2099 Ga0587091_009086
2100 Ga0587098_001772
2101 Ga0587109_010290
2102 Ga0587128_003514
2103 Ga0587128_004960
2104 Ga0587068_004206
2105 Ga0587072_003720
2106 Ga0587078_002717
2107 Ga0587079_005858
2108 Ga0587102_002131
2109 Ga0587071_003078
2110 Ga0587111_0002972
2111 Ga0501082_0198686
2112 2738724428
2113 2819572031
2114 2819586395
2115 2819677801
2116 2821141724
2117 2881957752
2118 2883073140
2119 2884797751
2120 2896087441
2121 2896114791
2122 2904469861
2123 2914763015
2124 2929155194
2125 2929183199
2126 2929245332
2127 2929927581
2128 2945979160
2129 2946014974
2130 8003151429

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

287

487

0.94

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

78

269

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6csc-assembly1.cif.gz_A chicken citrate synthase complex with trifluoroacetonyl-coa and citrate 0.9769 2 426
8gqz-assembly1.cif.gz_B crystal structure of mitochondrial citrate synthase (cit1) from saccharomyces cerevisiae 0.9748 2 430
2cts-assembly1.cif.gz_A-2 crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution 0.971 4 427
5uqs-assembly1.cif.gz_C crystal structure of citrate synthase from sus scrofa 0.9708 2 426
8gqz-assembly1.cif.gz_B crystal structure of mitochondrial citrate synthase (cit1) from saccharomyces cerevisiae 0.9704 2 430
ID Description Score Start End Superfamily
1al6A01 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.969 4 426 1.10.580.10
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9679 269 381 1.10.580.10
5cscA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.9635 269 380 1.10.230.10
af_A4HXU4_300_422_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9632 269 381 1.10.580.10
1cscA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.9535 269 381 1.10.230.10
ID Description Score Start End GO Terms
AF-F8VRI6-F1-model_v4 Citrate synthase 0.9928 40 177 GO:0005739
GO:0046912
AF-A0A851UWE9-F1-model_v4 Citrate synthase 0.9904 56 266 GO:0004108
GO:0005759
GO:0005975
GO:0006099
AF-A0A6P1B313-F1-model_v4 deleted 0.9896 288 390
AF-A0A7K6Q6C9-F1-model_v4 Citrate synthase 0.9895 77 266 GO:0004108
GO:0005759
GO:0005975
GO:0006099
AF-A0A7S3FQ18-F1-model_v4 Citrate synthase 0.9895 280 377 GO:0004108
GO:0005759
GO:0005975
GO:0006099

Map