F489387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1065 | 446 | 2130 | 443 |
Family's Representative Sequence
| Representative Sequence | 3300059626|Ga0587115_002282|Ga0587115_002282_247_1758 |
| Length | 503 |
| Sequence | MAFFRGLTAVSRLRSRVAQEASTLGGVRWLQMQSASDLDLKSQLQELIPEQQDRLKKLKSEHGKVQLGNINVDMVLGGMRGMIGMLWETSLLDPEEGIRFRGLSIPECQEVLPTAVKGGEPLPEGLLWLLLTGKVPTKEQVDTLSKELLARSSVPAHVYKAIDALPVTAHPMTQFTTGVMALQVESEFQKAYDKGLPKTKFWEPTYEDVLNLIARLPPVASYVYRRIFKDGKSIEADNSLDYAANFSHMLGFDDPKMLELMRLYITIHTYFFIHPCIYLCYISEELVLISDSYCDLGSCSDHEGGNVSAHTGHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVIEETGSDVTTDQLKDYVWKTLKSGKVVPGFGHGVLRKTDPRYSCQREFALKHLPEDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGLSEARYYTVLFGVSRSMGIGSQLIWDRALGLPLERPKSVTMEWLENYCKNKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003556 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003560 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003561 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003564 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 32 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 145 | 3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 146 | 3300023556 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 147 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 148 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 149 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 150 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 151 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 152 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 153 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 154 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 155 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 156 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 157 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 158 | 3300023682 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 159 | 3300023684 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 160 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 161 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 162 | 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 232 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 233 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 234 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 235 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 236 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 240 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 241 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031632 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 244 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 245 | 3300031634 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 246 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 247 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 248 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 249 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 250 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 251 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 252 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 253 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 254 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 255 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 256 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 257 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 259 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 260 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 261 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 264 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 266 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 274 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 275 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300041450 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT | Metatranscriptome | Rhizoplane |
| 286 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 287 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 288 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 289 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 290 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 291 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 292 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 295 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 296 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 297 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 298 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 299 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 300 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 301 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 363 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 364 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 365 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 366 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 367 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 369 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 371 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 372 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 377 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 392 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 393 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 394 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 395 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 397 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 398 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 401 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 406 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 408 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 429 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 430 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 431 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 432 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 433 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 434 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 435 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 436 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 437 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 438 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 439 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 440 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 441 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 442 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 443 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 444 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 445 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 446 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.67 |
| Metatranscriptomes | 11.55 |
| Isolates | 1.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 84.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587115_002282 | 3300059626 | Eukaryota | 1884 |
| 2 | SwRhRL2b_contig_1662827 | 2162886007 | Eukaryota | 336031 |
| 3 | SwRhRL2b_contig_1886170 | 2162886007 | Bacteria | 206362 |
| 4 | JGI24740J21852_10001312 | 3300001979 | Bacteria | 11313 |
| 5 | JGI24740J21852_10025233 | 3300001979 | Bacteria | 2006 |
| 6 | JGI24739J22299_10000154 | 3300001989 | Bacteria | 22212 |
| 7 | JGI24739J22299_10009514 | 3300001989 | Bacteria | 3621 |
| 8 | JGI24744J21845_10011394 | 3300002077 | Bacteria | 1819 |
| 9 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 10 | Ga0006759J45824_1008941 | 3300003163 | Eukaryota | 1642 |
| 11 | JGI25406J46586_10032623 | 3300003203 | Bacteria | 1933 |
| 12 | JGI25153J46596_10000224 | 3300003215 | Bacteria | 48671 |
| 13 | rootH2_10020011 | 3300003320 | Bacteria | 5961 |
| 14 | rootH2_10059474 | 3300003320 | Bacteria | 6815 |
| 15 | rootL2_10002073 | 3300003322 | Bacteria | 21415 |
| 16 | rootL2_10022324 | 3300003322 | Bacteria | 3620 |
| 17 | rootL2_10080770 | 3300003322 | Bacteria | 3691 |
| 18 | rootL2_10159435 | 3300003322 | Bacteria | 4346 |
| 19 | rootH1_10017832 | 3300003323 | Bacteria | 13579 |
| 20 | rootH1_10132169 | 3300003323 | Bacteria | 6462 |
| 21 | rootH1_10293201 | 3300003323 | Bacteria | 2289 |
| 22 | JGI25160J50197_1002326 | 3300003354 | Bacteria | 8896 |
| 23 | JGI25160J50197_1015175 | 3300003354 | Bacteria | 2541 |
| 24 | Ga0006556J51387_1001902 | 3300003479 | Eukaryota | 1746 |
| 25 | Ga0007417J51691_1006438 | 3300003544 | Eukaryota | 1856 |
| 26 | Ga0006557J51388_1002740 | 3300003556 | Eukaryota | 1785 |
| 27 | Ga0006558J51389_1002884 | 3300003558 | Eukaryota | 1842 |
| 28 | Ga0006559J51393_1002205 | 3300003560 | Eukaryota | 1869 |
| 29 | Ga0006553J51392_1001961 | 3300003561 | Eukaryota | 1946 |
| 30 | Ga0006555J51386_1001801 | 3300003564 | Eukaryota | 1860 |
| 31 | Ga0006560J51390_1001990 | 3300003565 | Eukaryota | 1779 |
| 32 | Ga0006554J51385_1001999 | 3300003567 | Eukaryota | 1911 |
| 33 | Ga0007410J51695_1014397 | 3300003574 | Eukaryota | 1839 |
| 34 | Ga0007409J51694_1006724 | 3300003575 | Eukaryota | 1873 |
| 35 | Ga0055526_1008813 | 3300003771 | Bacteria | 4961 |
| 36 | Ga0055528_1000355 | 3300003790 | Bacteria | 37201 |
| 37 | Ga0055530_10000425 | 3300003791 | Bacteria | 37501 |
| 38 | Ga0055531_10000411 | 3300003794 | Bacteria | 41180 |
| 39 | Ga0058863_11636828 | 3300004799 | Eukaryota | 1860 |
| 40 | Ga0058863_11883630 | 3300004799 | Eukaryota | 2012 |
| 41 | Ga0058861_10004224 | 3300004800 | Eukaryota | 1967 |
| 42 | Ga0058861_10012567 | 3300004800 | Eukaryota | 1538 |
| 43 | Ga0058860_10086452 | 3300004801 | Eukaryota | 1915 |
| 44 | Ga0058862_12751224 | 3300004803 | Eukaryota | 1581 |
| 45 | Ga0058862_12825977 | 3300004803 | Eukaryota | 1873 |
| 46 | Ga0065165_1000148 | 3300005262 | Bacteria | 122640 |
| 47 | Ga0065165_1016429 | 3300005262 | Bacteria | 2772 |
| 48 | Ga0065703_1004179 | 3300005272 | Eukaryota | 3651 |
| 49 | Ga0065704_10000184 | 3300005289 | Eukaryota | 889358 |
| 50 | Ga0065704_10070159 | 3300005289 | Bacteria | 207348 |
| 51 | Ga0065704_10078716 | 3300005289 | Bacteria | 4352 |
| 52 | Ga0065712_10002337 | 3300005290 | Bacteria | 5053 |
| 53 | Ga0065712_10073174 | 3300005290 | Bacteria | 4454 |
| 54 | Ga0065712_10129514 | 3300005290 | Bacteria | 1567 |
| 55 | Ga0065715_10136544 | 3300005293 | Unclassified | 1916 |
| 56 | Ga0065707_10081733 | 3300005295 | Eukaryota | 57849 |
| 57 | Ga0065707_10104464 | 3300005295 | Bacteria | 2684 |
| 58 | Ga0070658_10035269 | 3300005327 | Bacteria | 4029 |
| 59 | Ga0070658_10039863 | 3300005327 | Bacteria | 3790 |
| 60 | Ga0070658_10068803 | 3300005327 | Bacteria | 2895 |
| 61 | Ga0070658_10075337 | 3300005327 | Bacteria | 2768 |
| 62 | Ga0070658_10079595 | 3300005327 | Bacteria | 2691 |
| 63 | Ga0070676_10010728 | 3300005328 | Bacteria | 4972 |
| 64 | Ga0070676_10028456 | 3300005328 | Bacteria | 3174 |
| 65 | Ga0070683_100001238 | 3300005329 | Bacteria | 19432 |
| 66 | Ga0070683_100001444 | 3300005329 | Bacteria | 18259 |
| 67 | Ga0070683_100016015 | 3300005329 | Bacteria | 6598 |
| 68 | Ga0070683_100016889 | 3300005329 | Bacteria | 6440 |
| 69 | Ga0070683_100097695 | 3300005329 | Bacteria | 2763 |
| 70 | Ga0070690_100003044 | 3300005330 | Bacteria | 9101 |
| 71 | Ga0070690_100082032 | 3300005330 | Bacteria | 2111 |
| 72 | Ga0070670_100043927 | 3300005331 | Bacteria | 3842 |
| 73 | Ga0070670_100058211 | 3300005331 | Bacteria | 3317 |
| 74 | Ga0070670_100071060 | 3300005331 | Bacteria | 2988 |
| 75 | Ga0070670_100099943 | 3300005331 | Bacteria | 2496 |
| 76 | Ga0070670_100108494 | 3300005331 | Bacteria | 2392 |
| 77 | Ga0068869_100005880 | 3300005334 | Bacteria | 7748 |
| 78 | Ga0068869_100011976 | 3300005334 | Bacteria | 5708 |
| 79 | Ga0068869_100015556 | 3300005334 | Bacteria | 5108 |
| 80 | Ga0070666_10000637 | 3300005335 | Bacteria | 21149 |
| 81 | Ga0070666_10005840 | 3300005335 | Bacteria | 7559 |
| 82 | Ga0070666_10011699 | 3300005335 | Bacteria | 5517 |
| 83 | Ga0070666_10119571 | 3300005335 | Unclassified | 1826 |
| 84 | Ga0070680_100007800 | 3300005336 | Bacteria | 8156 |
| 85 | Ga0070680_100018238 | 3300005336 | Bacteria | 5543 |
| 86 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 87 | Ga0070682_100001382 | 3300005337 | Bacteria | 13697 |
| 88 | Ga0068868_100020492 | 3300005338 | Bacteria | 4970 |
| 89 | Ga0068868_100026625 | 3300005338 | Bacteria | 4409 |
| 90 | Ga0068868_100050438 | 3300005338 | Bacteria | 3268 |
| 91 | Ga0068868_100221104 | 3300005338 | Unclassified | 1585 |
| 92 | Ga0070660_100070186 | 3300005339 | Bacteria | 2734 |
| 93 | Ga0070660_100095441 | 3300005339 | Bacteria | 2350 |
| 94 | Ga0070689_100009324 | 3300005340 | Bacteria | 6957 |
| 95 | Ga0070689_100130708 | 3300005340 | Bacteria | 2013 |
| 96 | Ga0070689_100163509 | 3300005340 | Bacteria | 1800 |
| 97 | Ga0070691_10024246 | 3300005341 | Bacteria | 2819 |
| 98 | Ga0070687_100036328 | 3300005343 | Unclassified | 2454 |
| 99 | Ga0070661_100005250 | 3300005344 | Bacteria | 8917 |
| 100 | Ga0070668_100007075 | 3300005347 | Bacteria | 8312 |
| 101 | Ga0070668_100042795 | 3300005347 | Bacteria | 3471 |
| 102 | Ga0070668_100128906 | 3300005347 | Bacteria | 2029 |
| 103 | Ga0070669_100007234 | 3300005353 | Bacteria | 7966 |
| 104 | Ga0070669_100155357 | 3300005353 | Bacteria | 1774 |
| 105 | Ga0070669_100207736 | 3300005353 | Bacteria | 1543 |
| 106 | Ga0070675_100002069 | 3300005354 | Bacteria | 14869 |
| 107 | Ga0070675_100025237 | 3300005354 | Bacteria | 4764 |
| 108 | Ga0070675_100031894 | 3300005354 | Bacteria | 4262 |
| 109 | Ga0070675_100036599 | 3300005354 | Bacteria | 3995 |
| 110 | Ga0070675_100042510 | 3300005354 | Bacteria | 3713 |
| 111 | Ga0070675_100071319 | 3300005354 | Bacteria | 2881 |
| 112 | Ga0070675_100080671 | 3300005354 | Bacteria | 2712 |
| 113 | Ga0070671_100012510 | 3300005355 | Bacteria | 6834 |
| 114 | Ga0070674_100031917 | 3300005356 | Bacteria | 3494 |
| 115 | Ga0070674_100140115 | 3300005356 | Bacteria | 1814 |
| 116 | Ga0070673_100039888 | 3300005364 | Bacteria | 3598 |
| 117 | Ga0070673_100106028 | 3300005364 | Bacteria | 2323 |
| 118 | Ga0070688_100004093 | 3300005365 | Bacteria | 7565 |
| 119 | Ga0070688_100034193 | 3300005365 | Bacteria | 3076 |
| 120 | Ga0070688_100047054 | 3300005365 | Bacteria | 2674 |
| 121 | Ga0070659_100044535 | 3300005366 | Bacteria | 3474 |
| 122 | Ga0070659_100076513 | 3300005366 | Bacteria | 2668 |
| 123 | Ga0070659_100169298 | 3300005366 | Bacteria | 1789 |
| 124 | Ga0070667_100001496 | 3300005367 | Bacteria | 20928 |
| 125 | Ga0070667_100014740 | 3300005367 | Bacteria | 6458 |
| 126 | Ga0070667_100046485 | 3300005367 | Bacteria | 3651 |
| 127 | Ga0070667_100140788 | 3300005367 | Bacteria | 2112 |
| 128 | Ga0070713_100082748 | 3300005436 | Bacteria | 2742 |
| 129 | Ga0070700_100040804 | 3300005441 | Bacteria | 2843 |
| 130 | Ga0070663_100048185 | 3300005455 | Bacteria | 3020 |
| 131 | Ga0070678_100029174 | 3300005456 | Bacteria | 3775 |
| 132 | Ga0070678_100031427 | 3300005456 | Bacteria | 3663 |
| 133 | Ga0070662_100007468 | 3300005457 | Bacteria | 7086 |
| 134 | Ga0070662_100020198 | 3300005457 | Bacteria | 4533 |
| 135 | Ga0070681_10019192 | 3300005458 | Bacteria | 6843 |
| 136 | Ga0070681_10022486 | 3300005458 | Bacteria | 6332 |
| 137 | Ga0070681_10037397 | 3300005458 | Bacteria | 4872 |
| 138 | Ga0070681_10043308 | 3300005458 | Bacteria | 4510 |
| 139 | Ga0068867_100007411 | 3300005459 | Bacteria | 7758 |
| 140 | Ga0068867_100009973 | 3300005459 | Bacteria | 6693 |
| 141 | Ga0068867_100012400 | 3300005459 | Bacteria | 6029 |
| 142 | Ga0068867_100061331 | 3300005459 | Bacteria | 2792 |
| 143 | Ga0068867_100115120 | 3300005459 | Bacteria | 2071 |
| 144 | Ga0070685_10010662 | 3300005466 | Bacteria | 4783 |
| 145 | Ga0070685_10029590 | 3300005466 | Bacteria | 3044 |
| 146 | Ga0070685_10099300 | 3300005466 | Unclassified | 1775 |
| 147 | Ga0070698_100010157 | 3300005471 | Bacteria | 10057 |
| 148 | Ga0070698_100013783 | 3300005471 | Bacteria | 8553 |
| 149 | Ga0070698_100022097 | 3300005471 | Bacteria | 6661 |
| 150 | Ga0070699_100243571 | 3300005518 | Bacteria | 1606 |
| 151 | Ga0070679_100001941 | 3300005530 | Bacteria | 18576 |
| 152 | Ga0070679_100004204 | 3300005530 | Bacteria | 13281 |
| 153 | Ga0070679_100004852 | 3300005530 | Bacteria | 12407 |
| 154 | Ga0070679_100006603 | 3300005530 | Bacteria | 10809 |
| 155 | Ga0070679_100016816 | 3300005530 | Bacteria | 7069 |
| 156 | Ga0070679_100173092 | 3300005530 | Bacteria | 2131 |
| 157 | Ga0070684_100004827 | 3300005535 | Bacteria | 10298 |
| 158 | Ga0070684_100026655 | 3300005535 | Bacteria | 4870 |
| 159 | Ga0070684_100053228 | 3300005535 | Bacteria | 3522 |
| 160 | Ga0070684_100066340 | 3300005535 | Bacteria | 3168 |
| 161 | Ga0068853_100000276 | 3300005539 | Bacteria | 36211 |
| 162 | Ga0068853_100010323 | 3300005539 | Bacteria | 7553 |
| 163 | Ga0068853_100057243 | 3300005539 | Bacteria | 3364 |
| 164 | Ga0068853_100068730 | 3300005539 | Bacteria | 3080 |
| 165 | Ga0068853_100149047 | 3300005539 | Bacteria | 2105 |
| 166 | Ga0070672_100000891 | 3300005543 | Bacteria | 17929 |
| 167 | Ga0070672_100012051 | 3300005543 | Bacteria | 6051 |
| 168 | Ga0070672_100015554 | 3300005543 | Bacteria | 5422 |
| 169 | Ga0070672_100031872 | 3300005543 | Bacteria | 3972 |
| 170 | Ga0070672_100053581 | 3300005543 | Bacteria | 3154 |
| 171 | Ga0070672_100058944 | 3300005543 | Unclassified | 3019 |
| 172 | Ga0070686_100023983 | 3300005544 | Bacteria | 3653 |
| 173 | Ga0070686_100060414 | 3300005544 | Bacteria | 2446 |
| 174 | Ga0070686_100086005 | 3300005544 | Unclassified | 2093 |
| 175 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 176 | Ga0070665_100006717 | 3300005548 | Bacteria | 11692 |
| 177 | Ga0070665_100008882 | 3300005548 | Bacteria | 10177 |
| 178 | Ga0070665_100165554 | 3300005548 | Bacteria | 2213 |
| 179 | Ga0068855_100001835 | 3300005563 | Bacteria | 26494 |
| 180 | Ga0068855_100007690 | 3300005563 | Bacteria | 13018 |
| 181 | Ga0068855_100077125 | 3300005563 | Bacteria | 3866 |
| 182 | Ga0068855_100211089 | 3300005563 | Bacteria | 2181 |
| 183 | Ga0068855_100241664 | 3300005563 | Unclassified | 2017 |
| 184 | Ga0070664_100000321 | 3300005564 | Bacteria | 34876 |
| 185 | Ga0070664_100022940 | 3300005564 | Bacteria | 5149 |
| 186 | Ga0070664_100035604 | 3300005564 | Bacteria | 4179 |
| 187 | Ga0070664_100057743 | 3300005564 | Bacteria | 3299 |
| 188 | Ga0070664_100113391 | 3300005564 | Bacteria | 2368 |
| 189 | Ga0070664_100116519 | 3300005564 | Bacteria | 2336 |
| 190 | Ga0068857_100001139 | 3300005577 | Bacteria | 20729 |
| 191 | Ga0068857_100003724 | 3300005577 | Bacteria | 12796 |
| 192 | Ga0068857_100007529 | 3300005577 | Bacteria | 9369 |
| 193 | Ga0068857_100040032 | 3300005577 | Bacteria | 4155 |
| 194 | Ga0068857_100046729 | 3300005577 | Bacteria | 3842 |
| 195 | Ga0068857_100067152 | 3300005577 | Bacteria | 3191 |
| 196 | Ga0068857_100083434 | 3300005577 | Bacteria | 2855 |
| 197 | Ga0068854_100063732 | 3300005578 | Bacteria | 2676 |
| 198 | Ga0068854_100122710 | 3300005578 | Bacteria | 1975 |
| 199 | Ga0068854_100126928 | 3300005578 | Bacteria | 1944 |
| 200 | Ga0068856_100011104 | 3300005614 | Bacteria | 8745 |
| 201 | Ga0068856_100014039 | 3300005614 | Bacteria | 7745 |
| 202 | Ga0068856_100020619 | 3300005614 | Bacteria | 6404 |
| 203 | Ga0068856_100030709 | 3300005614 | Bacteria | 5253 |
| 204 | Ga0068856_100043776 | 3300005614 | Bacteria | 4404 |
| 205 | Ga0068856_100081424 | 3300005614 | Bacteria | 3212 |
| 206 | Ga0068856_100175544 | 3300005614 | Bacteria | 2155 |
| 207 | Ga0068856_100224251 | 3300005614 | Bacteria | 1895 |
| 208 | Ga0068852_100002151 | 3300005616 | Bacteria | 13528 |
| 209 | Ga0068852_100006664 | 3300005616 | Bacteria | 8369 |
| 210 | Ga0068852_100009018 | 3300005616 | Bacteria | 7382 |
| 211 | Ga0068852_100012493 | 3300005616 | Bacteria | 6452 |
| 212 | Ga0068852_100046206 | 3300005616 | Bacteria | 3709 |
| 213 | Ga0068852_100059122 | 3300005616 | Bacteria | 3323 |
| 214 | Ga0068852_100084705 | 3300005616 | Bacteria | 2822 |
| 215 | Ga0068859_100000029 | 3300005617 | Bacteria | 178422 |
| 216 | Ga0068859_100002114 | 3300005617 | Bacteria | 20233 |
| 217 | Ga0068859_100008303 | 3300005617 | Bacteria | 10520 |
| 218 | Ga0068859_100013957 | 3300005617 | Bacteria | 8057 |
| 219 | Ga0068859_100041845 | 3300005617 | Bacteria | 4602 |
| 220 | Ga0068859_100059969 | 3300005617 | Bacteria | 3834 |
| 221 | Ga0068859_100120020 | 3300005617 | Bacteria | 2696 |
| 222 | Ga0068859_100252668 | 3300005617 | Bacteria | 1853 |
| 223 | Ga0068864_100004500 | 3300005618 | Bacteria | 11464 |
| 224 | Ga0068864_100027276 | 3300005618 | Bacteria | 4822 |
| 225 | Ga0068864_100031790 | 3300005618 | Bacteria | 4479 |
| 226 | Ga0068864_100085759 | 3300005618 | Bacteria | 2769 |
| 227 | Ga0068864_100095796 | 3300005618 | Bacteria | 2626 |
| 228 | Ga0068864_100105231 | 3300005618 | Bacteria | 2508 |
| 229 | Ga0068861_100003057 | 3300005719 | Bacteria | 11050 |
| 230 | Ga0068861_100010966 | 3300005719 | Bacteria | 6298 |
| 231 | Ga0068861_100069206 | 3300005719 | Bacteria | 2730 |
| 232 | Ga0068861_100175543 | 3300005719 | Bacteria | 1779 |
| 233 | Ga0068851_10000700 | 3300005834 | Bacteria | 14313 |
| 234 | Ga0068851_10034762 | 3300005834 | Bacteria | 2516 |
| 235 | Ga0068851_10070802 | 3300005834 | Unclassified | 1804 |
| 236 | Ga0068863_100013276 | 3300005841 | Bacteria | 7948 |
| 237 | Ga0068863_100024625 | 3300005841 | Bacteria | 5740 |
| 238 | Ga0068863_100054921 | 3300005841 | Bacteria | 3773 |
| 239 | Ga0068863_100133984 | 3300005841 | Bacteria | 2366 |
| 240 | Ga0068863_100138099 | 3300005841 | Bacteria | 2329 |
| 241 | Ga0068858_100022432 | 3300005842 | Bacteria | 5892 |
| 242 | Ga0068858_100032010 | 3300005842 | Bacteria | 4885 |
| 243 | Ga0068858_100121301 | 3300005842 | Bacteria | 2445 |
| 244 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 245 | Ga0068860_100000888 | 3300005843 | Bacteria | 33230 |
| 246 | Ga0068860_100003442 | 3300005843 | Bacteria | 16284 |
| 247 | Ga0068860_100011991 | 3300005843 | Bacteria | 8538 |
| 248 | Ga0068860_100014813 | 3300005843 | Bacteria | 7627 |
| 249 | Ga0068860_100029918 | 3300005843 | Bacteria | 5238 |
| 250 | Ga0068860_100058702 | 3300005843 | Bacteria | 3658 |
| 251 | Ga0068860_100058812 | 3300005843 | Bacteria | 3655 |
| 252 | Ga0068860_100123470 | 3300005843 | Bacteria | 2481 |
| 253 | Ga0068862_100098660 | 3300005844 | Bacteria | 2552 |
| 254 | Ga0068862_100108486 | 3300005844 | Bacteria | 2435 |
| 255 | Ga0068862_100148170 | 3300005844 | Bacteria | 2087 |
| 256 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 257 | Ga0075364_10018791 | 3300006051 | Bacteria | 4333 |
| 258 | Ga0075366_10032815 | 3300006195 | Bacteria | 3057 |
| 259 | Ga0075366_10033322 | 3300006195 | Bacteria | 3034 |
| 260 | Ga0075366_10091755 | 3300006195 | Bacteria | 1819 |
| 261 | Ga0097621_100002686 | 3300006237 | Bacteria | 12173 |
| 262 | Ga0097621_100003597 | 3300006237 | Bacteria | 10709 |
| 263 | Ga0097621_100007374 | 3300006237 | Bacteria | 7867 |
| 264 | Ga0097621_100013550 | 3300006237 | Bacteria | 6078 |
| 265 | Ga0097621_100026587 | 3300006237 | Bacteria | 4542 |
| 266 | Ga0097621_100048389 | 3300006237 | Bacteria | 3449 |
| 267 | Ga0097621_100066510 | 3300006237 | Bacteria | 2969 |
| 268 | Ga0097621_100075505 | 3300006237 | Bacteria | 2794 |
| 269 | Ga0068871_100000076 | 3300006358 | Bacteria | 55186 |
| 270 | Ga0068871_100010710 | 3300006358 | Bacteria | 6705 |
| 271 | Ga0068871_100014864 | 3300006358 | Bacteria | 5815 |
| 272 | Ga0068871_100030731 | 3300006358 | Bacteria | 4233 |
| 273 | Ga0075428_100016924 | 3300006844 | Bacteria | 8052 |
| 274 | Ga0075428_100017350 | 3300006844 | Bacteria | 7956 |
| 275 | Ga0075428_100048921 | 3300006844 | Bacteria | 4639 |
| 276 | Ga0075428_100164787 | 3300006844 | Bacteria | 2405 |
| 277 | Ga0075428_100365710 | 3300006844 | Bacteria | 1547 |
| 278 | Ga0075430_100003812 | 3300006846 | Bacteria | 12690 |
| 279 | Ga0075430_100051479 | 3300006846 | Unclassified | 3470 |
| 280 | Ga0075431_100012623 | 3300006847 | Bacteria | 8529 |
| 281 | Ga0075429_100000539 | 3300006880 | Bacteria | 28785 |
| 282 | Ga0075429_100039248 | 3300006880 | Bacteria | 4121 |
| 283 | Ga0068865_100016033 | 3300006881 | Bacteria | 4787 |
| 284 | Ga0068865_100079134 | 3300006881 | Bacteria | 2353 |
| 285 | Ga0068865_100092796 | 3300006881 | Unclassified | 2194 |
| 286 | Ga0097620_100000029 | 3300006931 | Bacteria | 178422 |
| 287 | Ga0097620_100002114 | 3300006931 | Bacteria | 20233 |
| 288 | Ga0097620_100008303 | 3300006931 | Bacteria | 10520 |
| 289 | Ga0097620_100013956 | 3300006931 | Bacteria | 8057 |
| 290 | Ga0097620_100041849 | 3300006931 | Bacteria | 4602 |
| 291 | Ga0097620_100059969 | 3300006931 | Bacteria | 3834 |
| 292 | Ga0097620_100120019 | 3300006931 | Bacteria | 2696 |
| 293 | Ga0097620_100252678 | 3300006931 | Bacteria | 1853 |
| 294 | Ga0105240_10000131 | 3300009093 | Bacteria | 154386 |
| 295 | Ga0105240_10002773 | 3300009093 | Bacteria | 27676 |
| 296 | Ga0105240_10003397 | 3300009093 | Bacteria | 24765 |
| 297 | Ga0105240_10003620 | 3300009093 | Bacteria | 23924 |
| 298 | Ga0105240_10004711 | 3300009093 | Bacteria | 20598 |
| 299 | Ga0105240_10006456 | 3300009093 | Bacteria | 17233 |
| 300 | Ga0105240_10016334 | 3300009093 | Bacteria | 10053 |
| 301 | Ga0105240_10028113 | 3300009093 | Bacteria | 7352 |
| 302 | Ga0105240_10031577 | 3300009093 | Bacteria | 6865 |
| 303 | Ga0105240_10042295 | 3300009093 | Bacteria | 5807 |
| 304 | Ga0105240_10119331 | 3300009093 | Bacteria | 3177 |
| 305 | Ga0111539_10002138 | 3300009094 | Bacteria | 26441 |
| 306 | Ga0111539_10115534 | 3300009094 | Bacteria | 3147 |
| 307 | Ga0105245_10060441 | 3300009098 | Bacteria | 3412 |
| 308 | Ga0105247_10027268 | 3300009101 | Bacteria | 3454 |
| 309 | Ga0105247_10057125 | 3300009101 | Bacteria | 2412 |
| 310 | Ga0114129_10036098 | 3300009147 | Bacteria | 6982 |
| 311 | Ga0105243_10193772 | 3300009148 | Bacteria | 1777 |
| 312 | Ga0105241_10000764 | 3300009174 | Bacteria | 24479 |
| 313 | Ga0105241_10001337 | 3300009174 | Bacteria | 18724 |
| 314 | Ga0105241_10001925 | 3300009174 | Bacteria | 15714 |
| 315 | Ga0105241_10034397 | 3300009174 | Bacteria | 3806 |
| 316 | Ga0105242_10019613 | 3300009176 | Bacteria | 5299 |
| 317 | Ga0105242_10059527 | 3300009176 | Bacteria | 3134 |
| 318 | Ga0105242_10094281 | 3300009176 | Bacteria | 2525 |
| 319 | Ga0105248_10026892 | 3300009177 | Bacteria | 6399 |
| 320 | Ga0105237_10000377 | 3300009545 | Bacteria | 63580 |
| 321 | Ga0105237_10002457 | 3300009545 | Bacteria | 23008 |
| 322 | Ga0105237_10002932 | 3300009545 | Bacteria | 20656 |
| 323 | Ga0105237_10008643 | 3300009545 | Bacteria | 11004 |
| 324 | Ga0105237_10013544 | 3300009545 | Bacteria | 8546 |
| 325 | Ga0105237_10013564 | 3300009545 | Bacteria | 8537 |
| 326 | Ga0105237_10015625 | 3300009545 | Bacteria | 7890 |
| 327 | Ga0105238_10025254 | 3300009551 | Bacteria | 6056 |
| 328 | Ga0105238_10058072 | 3300009551 | Bacteria | 3879 |
| 329 | Ga0105249_10001339 | 3300009553 | Bacteria | 21527 |
| 330 | Ga0105249_10021951 | 3300009553 | Bacteria | 5717 |
| 331 | Ga0105249_10042337 | 3300009553 | Unclassified | 4141 |
| 332 | Ga0105249_10131482 | 3300009553 | Bacteria | 2390 |
| 333 | Ga0105249_10367601 | 3300009553 | Bacteria | 1461 |
| 334 | Ga0105239_10000029 | 3300010375 | Bacteria | 234749 |
| 335 | Ga0105239_10000714 | 3300010375 | Bacteria | 47078 |
| 336 | Ga0105239_10001999 | 3300010375 | Bacteria | 26499 |
| 337 | Ga0105239_10002549 | 3300010375 | Bacteria | 23115 |
| 338 | Ga0105239_10005380 | 3300010375 | Bacteria | 15037 |
| 339 | Ga0105239_10005636 | 3300010375 | Bacteria | 14630 |
| 340 | Ga0105239_10019534 | 3300010375 | Bacteria | 7479 |
| 341 | Ga0105239_10022019 | 3300010375 | Bacteria | 7026 |
| 342 | Ga0105239_10023622 | 3300010375 | Bacteria | 6770 |
| 343 | Ga0105239_10041121 | 3300010375 | Bacteria | 5066 |
| 344 | Ga0105239_10055909 | 3300010375 | Bacteria | 4329 |
| 345 | Ga0105239_10157937 | 3300010375 | Bacteria | 2533 |
| 346 | Ga0105239_10205821 | 3300010375 | Bacteria | 2205 |
| 347 | Ga0105246_10006069 | 3300011119 | Bacteria | 7370 |
| 348 | Ga0105246_10049467 | 3300011119 | Bacteria | 2879 |
| 349 | Ga0105246_10112213 | 3300011119 | Bacteria | 2005 |
| 350 | Ga0157373_10000350 | 3300013100 | Bacteria | 37264 |
| 351 | Ga0157373_10009312 | 3300013100 | Bacteria | 7261 |
| 352 | Ga0157373_10010190 | 3300013100 | Bacteria | 6922 |
| 353 | Ga0157373_10013041 | 3300013100 | Bacteria | 6101 |
| 354 | Ga0157373_10024322 | 3300013100 | Bacteria | 4388 |
| 355 | Ga0157373_10036664 | 3300013100 | Bacteria | 3518 |
| 356 | Ga0157371_10001416 | 3300013102 | Bacteria | 24929 |
| 357 | Ga0157371_10002643 | 3300013102 | Bacteria | 16991 |
| 358 | Ga0157371_10003115 | 3300013102 | Bacteria | 15333 |
| 359 | Ga0157371_10003982 | 3300013102 | Bacteria | 13092 |
| 360 | Ga0157371_10006222 | 3300013102 | Bacteria | 9896 |
| 361 | Ga0157371_10009640 | 3300013102 | Bacteria | 7593 |
| 362 | Ga0157371_10019168 | 3300013102 | Bacteria | 5049 |
| 363 | Ga0157371_10035435 | 3300013102 | Bacteria | 3575 |
| 364 | Ga0157370_10000478 | 3300013104 | Bacteria | 49942 |
| 365 | Ga0157370_10000530 | 3300013104 | Bacteria | 47795 |
| 366 | Ga0157370_10001941 | 3300013104 | Bacteria | 25465 |
| 367 | Ga0157370_10003057 | 3300013104 | Bacteria | 19847 |
| 368 | Ga0157370_10110923 | 3300013104 | Bacteria | 2564 |
| 369 | Ga0157369_10036543 | 3300013105 | Bacteria | 5380 |
| 370 | Ga0157369_10041768 | 3300013105 | Bacteria | 5005 |
| 371 | Ga0157369_10044835 | 3300013105 | Bacteria | 4812 |
| 372 | Ga0157369_10063839 | 3300013105 | Bacteria | 3967 |
| 373 | Ga0157369_10179875 | 3300013105 | Bacteria | 2225 |
| 374 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 375 | Ga0157374_10000719 | 3300013296 | Bacteria | 28944 |
| 376 | Ga0157374_10002479 | 3300013296 | Bacteria | 15577 |
| 377 | Ga0157374_10012275 | 3300013296 | Bacteria | 7451 |
| 378 | Ga0157374_10053886 | 3300013296 | Bacteria | 3751 |
| 379 | Ga0157374_10057778 | 3300013296 | Unclassified | 3624 |
| 380 | Ga0157374_10139195 | 3300013296 | Bacteria | 2355 |
| 381 | Ga0157378_10004321 | 3300013297 | Bacteria | 12507 |
| 382 | Ga0157378_10012543 | 3300013297 | Bacteria | 7417 |
| 383 | Ga0157378_10019488 | 3300013297 | Bacteria | 5964 |
| 384 | Ga0157378_10026764 | 3300013297 | Bacteria | 5085 |
| 385 | Ga0157378_10030980 | 3300013297 | Bacteria | 4723 |
| 386 | Ga0163162_10002251 | 3300013306 | Bacteria | 18116 |
| 387 | Ga0163162_10004108 | 3300013306 | Bacteria | 13968 |
| 388 | Ga0163162_10008316 | 3300013306 | Bacteria | 10124 |
| 389 | Ga0163162_10010477 | 3300013306 | Bacteria | 9014 |
| 390 | Ga0163162_10011862 | 3300013306 | Bacteria | 8500 |
| 391 | Ga0163162_10017201 | 3300013306 | Bacteria | 7075 |
| 392 | Ga0163162_10020291 | 3300013306 | Bacteria | 6526 |
| 393 | Ga0163162_10022959 | 3300013306 | Bacteria | 6153 |
| 394 | Ga0163162_10092099 | 3300013306 | Bacteria | 3114 |
| 395 | Ga0163162_10123303 | 3300013306 | Bacteria | 2696 |
| 396 | Ga0163162_10170787 | 3300013306 | Bacteria | 2299 |
| 397 | Ga0163162_10234754 | 3300013306 | Bacteria | 1965 |
| 398 | Ga0157372_10000494 | 3300013307 | Bacteria | 43474 |
| 399 | Ga0157372_10000535 | 3300013307 | Bacteria | 41817 |
| 400 | Ga0157372_10002089 | 3300013307 | Bacteria | 21710 |
| 401 | Ga0157372_10018796 | 3300013307 | Bacteria | 7434 |
| 402 | Ga0157372_10028256 | 3300013307 | Bacteria | 6121 |
| 403 | Ga0157372_10040251 | 3300013307 | Bacteria | 5161 |
| 404 | Ga0157372_10051209 | 3300013307 | Bacteria | 4595 |
| 405 | Ga0157372_10060015 | 3300013307 | Bacteria | 4255 |
| 406 | Ga0157372_10074861 | 3300013307 | Bacteria | 3819 |
| 407 | Ga0157372_10102209 | 3300013307 | Bacteria | 3273 |
| 408 | Ga0157372_10103417 | 3300013307 | Bacteria | 3255 |
| 409 | Ga0157372_10113493 | 3300013307 | Bacteria | 3105 |
| 410 | Ga0157372_10180826 | 3300013307 | Bacteria | 2441 |
| 411 | Ga0157372_10201609 | 3300013307 | Bacteria | 2305 |
| 412 | Ga0157372_10317550 | 3300013307 | Bacteria | 1814 |
| 413 | Ga0157375_10000754 | 3300013308 | Bacteria | 28363 |
| 414 | Ga0157375_10062733 | 3300013308 | Bacteria | 3694 |
| 415 | Ga0157375_10106071 | 3300013308 | Bacteria | 2901 |
| 416 | Ga0157375_10227876 | 3300013308 | Bacteria | 2022 |
| 417 | Ga0163163_10001404 | 3300014325 | Bacteria | 20324 |
| 418 | Ga0163163_10002372 | 3300014325 | Bacteria | 15938 |
| 419 | Ga0163163_10011499 | 3300014325 | Bacteria | 8034 |
| 420 | Ga0163163_10014951 | 3300014325 | Bacteria | 7152 |
| 421 | Ga0163163_10059223 | 3300014325 | Bacteria | 3787 |
| 422 | Ga0163163_10079251 | 3300014325 | Bacteria | 3283 |
| 423 | Ga0163163_10194588 | 3300014325 | Bacteria | 2076 |
| 424 | Ga0157380_10000065 | 3300014326 | Bacteria | 60148 |
| 425 | Ga0157380_10004489 | 3300014326 | Bacteria | 9673 |
| 426 | Ga0157380_10004871 | 3300014326 | Bacteria | 9351 |
| 427 | Ga0157380_10008145 | 3300014326 | Bacteria | 7468 |
| 428 | Ga0157380_10059197 | 3300014326 | Bacteria | 3056 |
| 429 | Ga0157380_10082005 | 3300014326 | Bacteria | 2639 |
| 430 | Ga0157380_10117460 | 3300014326 | Bacteria | 2247 |
| 431 | Ga0157377_10001833 | 3300014745 | Bacteria | 9267 |
| 432 | Ga0157377_10005286 | 3300014745 | Bacteria | 6051 |
| 433 | Ga0157377_10007983 | 3300014745 | Bacteria | 5141 |
| 434 | Ga0157377_10018633 | 3300014745 | Bacteria | 3610 |
| 435 | Ga0157377_10078099 | 3300014745 | Bacteria | 1929 |
| 436 | Ga0157379_10012636 | 3300014968 | Bacteria | 7377 |
| 437 | Ga0157379_10013980 | 3300014968 | Bacteria | 7034 |
| 438 | Ga0157379_10030553 | 3300014968 | Bacteria | 4796 |
| 439 | Ga0157379_10040673 | 3300014968 | Bacteria | 4150 |
| 440 | Ga0157376_10003097 | 3300014969 | Bacteria | 11423 |
| 441 | Ga0157376_10003487 | 3300014969 | Bacteria | 10843 |
| 442 | Ga0157376_10006460 | 3300014969 | Bacteria | 8284 |
| 443 | Ga0157376_10008586 | 3300014969 | Bacteria | 7381 |
| 444 | Ga0157376_10009241 | 3300014969 | Bacteria | 7152 |
| 445 | Ga0157376_10019752 | 3300014969 | Bacteria | 5199 |
| 446 | Ga0157376_10034923 | 3300014969 | Bacteria | 4063 |
| 447 | Ga0157376_10084377 | 3300014969 | Bacteria | 2735 |
| 448 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 449 | Ga0163161_10002671 | 3300017792 | Bacteria | 12674 |
| 450 | Ga0197907_10001091 | 3300020069 | Eukaryota | 1980 |
| 451 | Ga0206356_11044593 | 3300020070 | Eukaryota | 1898 |
| 452 | Ga0206356_11188758 | 3300020070 | Eukaryota | 1748 |
| 453 | Ga0206349_1124235 | 3300020075 | Eukaryota | 1794 |
| 454 | Ga0206349_1476759 | 3300020075 | Eukaryota | 2134 |
| 455 | Ga0206355_1306531 | 3300020076 | Eukaryota | 1992 |
| 456 | Ga0206352_10358918 | 3300020078 | Eukaryota | 1877 |
| 457 | Ga0206350_10994793 | 3300020080 | Eukaryota | 1921 |
| 458 | Ga0206354_10690293 | 3300020081 | Eukaryota | 1799 |
| 459 | Ga0206353_11975280 | 3300020082 | Eukaryota | 1847 |
| 460 | Ga0213876_10001135 | 3300021384 | Bacteria | 16968 |
| 461 | Ga0213876_10008319 | 3300021384 | Bacteria | 5613 |
| 462 | Ga0224712_10032821 | 3300022467 | Eukaryota | 1895 |
| 463 | Ga0224712_10051383 | 3300022467 | Eukaryota | 1605 |
| 464 | Ga0256720_152123 | 3300023438 | Eukaryota | 1924 |
| 465 | Ga0247524_101506 | 3300023553 | Eukaryota | 1956 |
| 466 | Ga0247519_101388 | 3300023556 | Eukaryota | 2227 |
| 467 | Ga0247521_101613 | 3300023557 | Eukaryota | 2082 |
| 468 | Ga0247526_102217 | 3300023558 | Eukaryota | 1843 |
| 469 | Ga0247529_101655 | 3300023559 | Eukaryota | 2028 |
| 470 | Ga0247518_102078 | 3300023561 | Eukaryota | 2219 |
| 471 | Ga0247516_103277 | 3300023562 | Eukaryota | 1837 |
| 472 | Ga0247530_100778 | 3300023563 | Eukaryota | 2357 |
| 473 | Ga0247515_102482 | 3300023564 | Eukaryota | 2003 |
| 474 | Ga0247527_101226 | 3300023664 | Eukaryota | 1989 |
| 475 | Ga0247531_102163 | 3300023666 | Eukaryota | 1806 |
| 476 | Ga0247525_101521 | 3300023668 | Eukaryota | 2171 |
| 477 | Ga0247528_100975 | 3300023680 | Eukaryota | 2087 |
| 478 | Ga0247513_101520 | 3300023682 | Eukaryota | 2165 |
| 479 | Ga0247523_101818 | 3300023684 | Eukaryota | 2026 |
| 480 | Ga0247520_101842 | 3300023686 | Eukaryota | 1978 |
| 481 | Ga0247522_101379 | 3300023688 | Eukaryota | 2248 |
| 482 | Ga0247517_102772 | 3300023689 | Eukaryota | 1828 |
| 483 | Ga0247512_102652 | 3300023690 | Eukaryota | 2010 |
| 484 | Ga0209436_100835 | 3300025208 | Bacteria | 12448 |
| 485 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 486 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 487 | Ga0209026_1000312 | 3300025250 | Bacteria | 52141 |
| 488 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 489 | Ga0209673_1000197 | 3300025273 | Bacteria | 121313 |
| 490 | Ga0209130_1000540 | 3300025284 | Bacteria | 38066 |
| 491 | Ga0209564_1002016 | 3300025295 | Bacteria | 17679 |
| 492 | Ga0209564_1006989 | 3300025295 | Bacteria | 5920 |
| 493 | Ga0209758_1013571 | 3300025297 | Bacteria | 4426 |
| 494 | Ga0209758_1026448 | 3300025297 | Bacteria | 2510 |
| 495 | Ga0209050_1000204 | 3300025298 | Bacteria | 133087 |
| 496 | Ga0207426_1000019 | 3300025302 | Bacteria | 558579 |
| 497 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 498 | Ga0207426_1000332 | 3300025302 | Bacteria | 89192 |
| 499 | Ga0207426_1004122 | 3300025302 | Bacteria | 7296 |
| 500 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 501 | Ga0207656_10000242 | 3300025321 | Bacteria | 19035 |
| 502 | Ga0207656_10001795 | 3300025321 | Bacteria | 7142 |
| 503 | Ga0207682_10010567 | 3300025893 | Bacteria | 3614 |
| 504 | Ga0207710_10018469 | 3300025900 | Bacteria | 2966 |
| 505 | Ga0207710_10042150 | 3300025900 | Bacteria | 2026 |
| 506 | Ga0207688_10050268 | 3300025901 | Bacteria | 2333 |
| 507 | Ga0207680_10000016 | 3300025903 | Bacteria | 134657 |
| 508 | Ga0207680_10005281 | 3300025903 | Bacteria | 6165 |
| 509 | Ga0207680_10006952 | 3300025903 | Bacteria | 5489 |
| 510 | Ga0207680_10141803 | 3300025903 | Bacteria | 1594 |
| 511 | Ga0207647_10010657 | 3300025904 | Bacteria | 6480 |
| 512 | Ga0207647_10011240 | 3300025904 | Bacteria | 6285 |
| 513 | Ga0207647_10028854 | 3300025904 | Unclassified | 3599 |
| 514 | Ga0207645_10000245 | 3300025907 | Bacteria | 45135 |
| 515 | Ga0207645_10014460 | 3300025907 | Bacteria | 5281 |
| 516 | Ga0207645_10014729 | 3300025907 | Bacteria | 5221 |
| 517 | Ga0207645_10022723 | 3300025907 | Bacteria | 4077 |
| 518 | Ga0207643_10006102 | 3300025908 | Bacteria | 6442 |
| 519 | Ga0207643_10010745 | 3300025908 | Bacteria | 4934 |
| 520 | Ga0207705_10004089 | 3300025909 | Bacteria | 11073 |
| 521 | Ga0207705_10028047 | 3300025909 | Bacteria | 4014 |
| 522 | Ga0207705_10084391 | 3300025909 | Unclassified | 2319 |
| 523 | Ga0207705_10094177 | 3300025909 | Bacteria | 2196 |
| 524 | Ga0207654_10000299 | 3300025911 | Bacteria | 30090 |
| 525 | Ga0207654_10002562 | 3300025911 | Bacteria | 9224 |
| 526 | Ga0207654_10090731 | 3300025911 | Bacteria | 1862 |
| 527 | Ga0207707_10000121 | 3300025912 | Bacteria | 80174 |
| 528 | Ga0207707_10106885 | 3300025912 | Bacteria | 2446 |
| 529 | Ga0207707_10245673 | 3300025912 | Unclassified | 1555 |
| 530 | Ga0207695_10000057 | 3300025913 | Bacteria | 376090 |
| 531 | Ga0207695_10000217 | 3300025913 | Bacteria | 155047 |
| 532 | Ga0207695_10000266 | 3300025913 | Bacteria | 132163 |
| 533 | Ga0207695_10000568 | 3300025913 | Bacteria | 75553 |
| 534 | Ga0207695_10001216 | 3300025913 | Bacteria | 44107 |
| 535 | Ga0207695_10009606 | 3300025913 | Bacteria | 11943 |
| 536 | Ga0207695_10016181 | 3300025913 | Bacteria | 8744 |
| 537 | Ga0207695_10018698 | 3300025913 | Bacteria | 8001 |
| 538 | Ga0207695_10248067 | 3300025913 | Bacteria | 1680 |
| 539 | Ga0207671_10000725 | 3300025914 | Bacteria | 41972 |
| 540 | Ga0207671_10002783 | 3300025914 | Bacteria | 18250 |
| 541 | Ga0207671_10004167 | 3300025914 | Bacteria | 13975 |
| 542 | Ga0207671_10007745 | 3300025914 | Bacteria | 9252 |
| 543 | Ga0207671_10035098 | 3300025914 | Bacteria | 3724 |
| 544 | Ga0207671_10094283 | 3300025914 | Bacteria | 2259 |
| 545 | Ga0207660_10000354 | 3300025917 | Bacteria | 29872 |
| 546 | Ga0207660_10029342 | 3300025917 | Bacteria | 3772 |
| 547 | Ga0207657_10004379 | 3300025919 | Bacteria | 14946 |
| 548 | Ga0207657_10006314 | 3300025919 | Bacteria | 12314 |
| 549 | Ga0207657_10068682 | 3300025919 | Bacteria | 3010 |
| 550 | Ga0207649_10007338 | 3300025920 | Bacteria | 6001 |
| 551 | Ga0207652_10000160 | 3300025921 | Bacteria | 72867 |
| 552 | Ga0207652_10000561 | 3300025921 | Bacteria | 37514 |
| 553 | Ga0207652_10002749 | 3300025921 | Bacteria | 14774 |
| 554 | Ga0207652_10014959 | 3300025921 | Bacteria | 6294 |
| 555 | Ga0207652_10056382 | 3300025921 | Bacteria | 3382 |
| 556 | Ga0207652_10056556 | 3300025921 | Bacteria | 3377 |
| 557 | Ga0207681_10003524 | 3300025923 | Bacteria | 9747 |
| 558 | Ga0207681_10071596 | 3300025923 | Unclassified | 2419 |
| 559 | Ga0207681_10191661 | 3300025923 | Bacteria | 1564 |
| 560 | Ga0207650_10000628 | 3300025925 | Bacteria | 28146 |
| 561 | Ga0207650_10052169 | 3300025925 | Bacteria | 3029 |
| 562 | Ga0207650_10095151 | 3300025925 | Bacteria | 2283 |
| 563 | Ga0207659_10026830 | 3300025926 | Bacteria | 3893 |
| 564 | Ga0207659_10036380 | 3300025926 | Bacteria | 3410 |
| 565 | Ga0207659_10122253 | 3300025926 | Bacteria | 1996 |
| 566 | Ga0207659_10136427 | 3300025926 | Bacteria | 1900 |
| 567 | Ga0207687_10033514 | 3300025927 | Bacteria | 3484 |
| 568 | Ga0207644_10006635 | 3300025931 | Bacteria | 7540 |
| 569 | Ga0207644_10133527 | 3300025931 | Bacteria | 1903 |
| 570 | Ga0207644_10150454 | 3300025931 | Bacteria | 1801 |
| 571 | Ga0207690_10069216 | 3300025932 | Bacteria | 2427 |
| 572 | Ga0207690_10086335 | 3300025932 | Bacteria | 2205 |
| 573 | Ga0207706_10003545 | 3300025933 | Bacteria | 14896 |
| 574 | Ga0207706_10010731 | 3300025933 | Bacteria | 8370 |
| 575 | Ga0207706_10014210 | 3300025933 | Bacteria | 7217 |
| 576 | Ga0207706_10063617 | 3300025933 | Bacteria | 3248 |
| 577 | Ga0207706_10074701 | 3300025933 | Bacteria | 2980 |
| 578 | Ga0207706_10081989 | 3300025933 | Bacteria | 2835 |
| 579 | Ga0207686_10002107 | 3300025934 | Bacteria | 10957 |
| 580 | Ga0207686_10012076 | 3300025934 | Bacteria | 4744 |
| 581 | Ga0207686_10063858 | 3300025934 | Unclassified | 2343 |
| 582 | Ga0207670_10002060 | 3300025936 | Bacteria | 10516 |
| 583 | Ga0207670_10024082 | 3300025936 | Bacteria | 3800 |
| 584 | Ga0207670_10136263 | 3300025936 | Bacteria | 1805 |
| 585 | Ga0207669_10030045 | 3300025937 | Bacteria | 3014 |
| 586 | Ga0207704_10008934 | 3300025938 | Bacteria | 4815 |
| 587 | Ga0207704_10047774 | 3300025938 | Bacteria | 2561 |
| 588 | Ga0207704_10098056 | 3300025938 | Bacteria | 1946 |
| 589 | Ga0207691_10001933 | 3300025940 | Bacteria | 20218 |
| 590 | Ga0207691_10006183 | 3300025940 | Bacteria | 11570 |
| 591 | Ga0207691_10019082 | 3300025940 | Bacteria | 6494 |
| 592 | Ga0207691_10026632 | 3300025940 | Bacteria | 5425 |
| 593 | Ga0207691_10037910 | 3300025940 | Bacteria | 4462 |
| 594 | Ga0207691_10172527 | 3300025940 | Bacteria | 1893 |
| 595 | Ga0207689_10000681 | 3300025942 | Bacteria | 32411 |
| 596 | Ga0207689_10000983 | 3300025942 | Bacteria | 27312 |
| 597 | Ga0207689_10006134 | 3300025942 | Bacteria | 10637 |
| 598 | Ga0207689_10007631 | 3300025942 | Bacteria | 9472 |
| 599 | Ga0207661_10000620 | 3300025944 | Bacteria | 22786 |
| 600 | Ga0207661_10016604 | 3300025944 | Bacteria | 5434 |
| 601 | Ga0207679_10000683 | 3300025945 | Bacteria | 22726 |
| 602 | Ga0207679_10024422 | 3300025945 | Bacteria | 4144 |
| 603 | Ga0207679_10026675 | 3300025945 | Bacteria | 3987 |
| 604 | Ga0207679_10055592 | 3300025945 | Bacteria | 2918 |
| 605 | Ga0207679_10060468 | 3300025945 | Bacteria | 2815 |
| 606 | Ga0207667_10000246 | 3300025949 | Bacteria | 76379 |
| 607 | Ga0207667_10000451 | 3300025949 | Bacteria | 55109 |
| 608 | Ga0207667_10003666 | 3300025949 | Bacteria | 18932 |
| 609 | Ga0207667_10017632 | 3300025949 | Bacteria | 8032 |
| 610 | Ga0207667_10023624 | 3300025949 | Bacteria | 6767 |
| 611 | Ga0207667_10029781 | 3300025949 | Bacteria | 5914 |
| 612 | Ga0207667_10074991 | 3300025949 | Bacteria | 3513 |
| 613 | Ga0207667_10131553 | 3300025949 | Bacteria | 2577 |
| 614 | Ga0207667_10135292 | 3300025949 | Bacteria | 2538 |
| 615 | Ga0207651_10003723 | 3300025960 | Bacteria | 7540 |
| 616 | Ga0207651_10064820 | 3300025960 | Bacteria | 2559 |
| 617 | Ga0207651_10075940 | 3300025960 | Bacteria | 2400 |
| 618 | Ga0207712_10003055 | 3300025961 | Bacteria | 10674 |
| 619 | Ga0207712_10035406 | 3300025961 | Bacteria | 3391 |
| 620 | Ga0207712_10066056 | 3300025961 | Bacteria | 2585 |
| 621 | Ga0207668_10004760 | 3300025972 | Bacteria | 7988 |
| 622 | Ga0207668_10020320 | 3300025972 | Bacteria | 4217 |
| 623 | Ga0207668_10038885 | 3300025972 | Bacteria | 3197 |
| 624 | Ga0207668_10061973 | 3300025972 | Bacteria | 2632 |
| 625 | Ga0207658_10005434 | 3300025986 | Bacteria | 8737 |
| 626 | Ga0207658_10007307 | 3300025986 | Bacteria | 7534 |
| 627 | Ga0207658_10065977 | 3300025986 | Bacteria | 2721 |
| 628 | Ga0207658_10078329 | 3300025986 | Bacteria | 2525 |
| 629 | Ga0207658_10090080 | 3300025986 | Bacteria | 2376 |
| 630 | Ga0207658_10100505 | 3300025986 | Bacteria | 2264 |
| 631 | Ga0207658_10166092 | 3300025986 | Bacteria | 1813 |
| 632 | Ga0207677_10003111 | 3300026023 | Bacteria | 8760 |
| 633 | Ga0207677_10014532 | 3300026023 | Bacteria | 4600 |
| 634 | Ga0207677_10070347 | 3300026023 | Bacteria | 2466 |
| 635 | Ga0207677_10076993 | 3300026023 | Bacteria | 2377 |
| 636 | Ga0207677_10112542 | 3300026023 | Bacteria | 2030 |
| 637 | Ga0207677_10202766 | 3300026023 | Unclassified | 1578 |
| 638 | Ga0207703_10177854 | 3300026035 | Bacteria | 1876 |
| 639 | Ga0207639_10047670 | 3300026041 | Bacteria | 3240 |
| 640 | Ga0207639_10068205 | 3300026041 | Bacteria | 2771 |
| 641 | Ga0207639_10117019 | 3300026041 | Bacteria | 2183 |
| 642 | Ga0207639_10168152 | 3300026041 | Bacteria | 1854 |
| 643 | Ga0207639_10177547 | 3300026041 | Bacteria | 1809 |
| 644 | Ga0207639_10255744 | 3300026041 | Bacteria | 1529 |
| 645 | Ga0207678_10026406 | 3300026067 | Bacteria | 5066 |
| 646 | Ga0207708_10053534 | 3300026075 | Bacteria | 3075 |
| 647 | Ga0207702_10014507 | 3300026078 | Bacteria | 6542 |
| 648 | Ga0207702_10018329 | 3300026078 | Bacteria | 5790 |
| 649 | Ga0207702_10023270 | 3300026078 | Bacteria | 5137 |
| 650 | Ga0207702_10039046 | 3300026078 | Bacteria | 3977 |
| 651 | Ga0207702_10047717 | 3300026078 | Bacteria | 3610 |
| 652 | Ga0207702_10190488 | 3300026078 | Bacteria | 1894 |
| 653 | Ga0207702_10200369 | 3300026078 | Bacteria | 1850 |
| 654 | Ga0207641_10001043 | 3300026088 | Bacteria | 28025 |
| 655 | Ga0207641_10007146 | 3300026088 | Bacteria | 9322 |
| 656 | Ga0207641_10028096 | 3300026088 | Bacteria | 4646 |
| 657 | Ga0207641_10158191 | 3300026088 | Bacteria | 2057 |
| 658 | Ga0207648_10004405 | 3300026089 | Bacteria | 14463 |
| 659 | Ga0207648_10004983 | 3300026089 | Bacteria | 13499 |
| 660 | Ga0207648_10019657 | 3300026089 | Bacteria | 6096 |
| 661 | Ga0207648_10020128 | 3300026089 | Bacteria | 6016 |
| 662 | Ga0207648_10030590 | 3300026089 | Bacteria | 4766 |
| 663 | Ga0207648_10032678 | 3300026089 | Bacteria | 4592 |
| 664 | Ga0207648_10051997 | 3300026089 | Unclassified | 3581 |
| 665 | Ga0207648_10122781 | 3300026089 | Bacteria | 2284 |
| 666 | Ga0207648_10190187 | 3300026089 | Bacteria | 1819 |
| 667 | Ga0207648_10201176 | 3300026089 | Bacteria | 1767 |
| 668 | Ga0207676_10007718 | 3300026095 | Bacteria | 7648 |
| 669 | Ga0207676_10016235 | 3300026095 | Bacteria | 5391 |
| 670 | Ga0207676_10063144 | 3300026095 | Bacteria | 2941 |
| 671 | Ga0207676_10076483 | 3300026095 | Bacteria | 2705 |
| 672 | Ga0207676_10095372 | 3300026095 | Bacteria | 2453 |
| 673 | Ga0207674_10004668 | 3300026116 | Bacteria | 16447 |
| 674 | Ga0207674_10006324 | 3300026116 | Bacteria | 13953 |
| 675 | Ga0207674_10021677 | 3300026116 | Bacteria | 6917 |
| 676 | Ga0207674_10026972 | 3300026116 | Bacteria | 6090 |
| 677 | Ga0207674_10029266 | 3300026116 | Bacteria | 5800 |
| 678 | Ga0207674_10045517 | 3300026116 | Bacteria | 4513 |
| 679 | Ga0207674_10080436 | 3300026116 | Bacteria | 3262 |
| 680 | Ga0207674_10123916 | 3300026116 | Bacteria | 2550 |
| 681 | Ga0207675_100001355 | 3300026118 | Bacteria | 24522 |
| 682 | Ga0207675_100002256 | 3300026118 | Bacteria | 19155 |
| 683 | Ga0207675_100279405 | 3300026118 | Bacteria | 1622 |
| 684 | Ga0207683_10001367 | 3300026121 | Bacteria | 22059 |
| 685 | Ga0207683_10011208 | 3300026121 | Bacteria | 7641 |
| 686 | Ga0207683_10030595 | 3300026121 | Bacteria | 4665 |
| 687 | Ga0207683_10071019 | 3300026121 | Bacteria | 3077 |
| 688 | Ga0207683_10205954 | 3300026121 | Bacteria | 1789 |
| 689 | Ga0207698_10001664 | 3300026142 | Bacteria | 12968 |
| 690 | Ga0207698_10009221 | 3300026142 | Bacteria | 6277 |
| 691 | Ga0207698_10033396 | 3300026142 | Bacteria | 3739 |
| 692 | Ga0207698_10082831 | 3300026142 | Bacteria | 2594 |
| 693 | Ga0207428_10035888 | 3300027907 | Bacteria | 4049 |
| 694 | Ga0268266_10000065 | 3300028379 | Bacteria | 246498 |
| 695 | Ga0268266_10004126 | 3300028379 | Bacteria | 14038 |
| 696 | Ga0268266_10061568 | 3300028379 | Bacteria | 3237 |
| 697 | Ga0268265_10082256 | 3300028380 | Bacteria | 2546 |
| 698 | Ga0268265_10161776 | 3300028380 | Bacteria | 1902 |
| 699 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 700 | Ga0268264_10001194 | 3300028381 | Bacteria | 25099 |
| 701 | Ga0268264_10009266 | 3300028381 | Bacteria | 8152 |
| 702 | Ga0268264_10015628 | 3300028381 | Bacteria | 6219 |
| 703 | Ga0268264_10029024 | 3300028381 | Bacteria | 4529 |
| 704 | Ga0268264_10032221 | 3300028381 | Bacteria | 4300 |
| 705 | Ga0268264_10220845 | 3300028381 | Bacteria | 1744 |
| 706 | Ga0265334_10012539 | 3300028573 | Bacteria | 3560 |
| 707 | Ga0265334_10013266 | 3300028573 | Bacteria | 3452 |
| 708 | Ga0307517_10003653 | 3300028786 | Bacteria | 23914 |
| 709 | Ga0307517_10081796 | 3300028786 | Bacteria | 2749 |
| 710 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 711 | Ga0307515_10000107 | 3300028794 | Bacteria | 197046 |
| 712 | Ga0311001_1014117 | 3300029277 | Eukaryota | 1873 |
| 713 | Ga0311011_143046 | 3300029280 | Eukaryota | 1867 |
| 714 | Ga0311003_168779 | 3300029282 | Eukaryota | 1929 |
| 715 | Ga0307511_10000734 | 3300030521 | Bacteria | 34994 |
| 716 | Ga0265331_10048543 | 3300031250 | Bacteria | 2040 |
| 717 | Ga0265327_10000055 | 3300031251 | Bacteria | 247188 |
| 718 | Ga0265327_10000837 | 3300031251 | Bacteria | 45956 |
| 719 | Ga0265327_10002040 | 3300031251 | Bacteria | 22722 |
| 720 | Ga0265327_10002148 | 3300031251 | Bacteria | 21753 |
| 721 | Ga0265327_10002921 | 3300031251 | Bacteria | 17111 |
| 722 | Ga0265327_10004316 | 3300031251 | Bacteria | 12681 |
| 723 | Ga0265327_10021534 | 3300031251 | Bacteria | 3887 |
| 724 | Ga0265327_10036998 | 3300031251 | Bacteria | 2677 |
| 725 | Ga0265327_10038492 | 3300031251 | Unclassified | 2609 |
| 726 | Ga0310116_101673 | 3300031591 | Eukaryota | 2140 |
| 727 | Ga0310117_101718 | 3300031592 | Eukaryota | 2104 |
| 728 | Ga0310107_103802 | 3300031615 | Eukaryota | 1923 |
| 729 | Ga0307508_10001362 | 3300031616 | Bacteria | 27521 |
| 730 | Ga0310102_100379 | 3300031632 | Eukaryota | 2163 |
| 731 | Ga0310108_101564 | 3300031633 | Eukaryota | 2297 |
| 732 | Ga0310106_100790 | 3300031634 | Eukaryota | 2041 |
| 733 | Ga0310115_101550 | 3300031635 | Eukaryota | 2508 |
| 734 | Ga0310113_101709 | 3300031636 | Eukaryota | 2178 |
| 735 | Ga0310118_101225 | 3300031664 | Eukaryota | 1942 |
| 736 | Ga0310105_102040 | 3300031666 | Eukaryota | 2173 |
| 737 | Ga0310111_102280 | 3300031667 | Eukaryota | 2216 |
| 738 | Ga0310114_101717 | 3300031678 | Eukaryota | 2030 |
| 739 | Ga0310119_103144 | 3300031686 | Eukaryota | 1979 |
| 740 | Ga0310101_103167 | 3300031690 | Eukaryota | 1942 |
| 741 | Ga0316576_10112301 | 3300031727 | Bacteria | 2043 |
| 742 | Ga0316578_10008900 | 3300031728 | Bacteria | 5134 |
| 743 | Ga0307516_10002940 | 3300031730 | Bacteria | 22319 |
| 744 | Ga0307516_10021081 | 3300031730 | Bacteria | 6718 |
| 745 | Ga0316577_10016854 | 3300031733 | Bacteria | 4032 |
| 746 | Ga0316044_101502 | 3300031810 | Eukaryota | 2576 |
| 747 | Ga0316045_103574 | 3300031815 | Eukaryota | 1908 |
| 748 | Ga0316042_103921 | 3300031816 | Eukaryota | 2107 |
| 749 | Ga0316043_103537 | 3300031828 | Eukaryota | 2177 |
| 750 | Ga0307409_100193773 | 3300031995 | Bacteria | 1812 |
| 751 | Ga0307414_10064534 | 3300032004 | Bacteria | 2608 |
| 752 | Ga0307414_10238559 | 3300032004 | Bacteria | 1504 |
| 753 | Ga0316593_10004444 | 3300032168 | Bacteria | 3600 |
| 754 | Ga0316593_10008297 | 3300032168 | Eukaryota | 2890 |
| 755 | Ga0316593_10015071 | 3300032168 | Bacteria | 2319 |
| 756 | Ga0316593_10031435 | 3300032168 | Eukaryota | 1729 |
| 757 | Ga0307510_10006641 | 3300033180 | Bacteria | 13799 |
| 758 | Ga0316586_1005568 | 3300033527 | Unclassified | 1777 |
| 759 | Ga0316586_1005978 | 3300033527 | Eukaryota | 1732 |
| 760 | Ga0316588_1003075 | 3300033528 | Eukaryota | 2994 |
| 761 | Ga0316587_1006783 | 3300033529 | Unclassified | 1761 |
| 762 | Ga0316596_1003878 | 3300033541 | Bacteria | 3312 |
| 763 | Ga0316596_1017087 | 3300033541 | Eukaryota | 1822 |
| 764 | Ga0316574_0042011 | 3300035398 | Bacteria | 2820 |
| 765 | Ga0373924_0023239 | 3300035410 | Bacteria | 2430 |
| 766 | Ga0373937_0035200 | 3300036401 | Bacteria | 4556 |
| 767 | Ga0373937_0079296 | 3300036401 | Bacteria | 3035 |
| 768 | Ga0310112_004665 | 3300036458 | Eukaryota | 1878 |
| 769 | Ga0310109_001797 | 3300036534 | Eukaryota | 2263 |
| 770 | Ga0310109_003343 | 3300036534 | Eukaryota | 1903 |
| 771 | Ga0310110_003655 | 3300036535 | Eukaryota | 2119 |
| 772 | Ga0310110_007110 | 3300036535 | Eukaryota | 1636 |
| 773 | Ga0316584_0020865 | 3300036712 | Bacteria | 4757 |
| 774 | Ga0316584_0078812 | 3300036712 | Bacteria | 2467 |
| 775 | Ga0316584_0084594 | 3300036712 | Bacteria | 2376 |
| 776 | Ga0373925_0192627 | 3300037068 | Bacteria | 1618 |
| 777 | Ga0395899_0000025 | 3300037312 | Bacteria | 350927 |
| 778 | Ga0395899_0004705 | 3300037312 | Bacteria | 10653 |
| 779 | Ga0395899_0022148 | 3300037312 | Bacteria | 4818 |
| 780 | Ga0395899_0125390 | 3300037312 | Bacteria | 1836 |
| 781 | Ga0395900_0010127 | 3300037418 | Bacteria | 9641 |
| 782 | Ga0395900_0024239 | 3300037418 | Bacteria | 6212 |
| 783 | Ga0395900_0069958 | 3300037418 | Bacteria | 3608 |
| 784 | Ga0395900_0094055 | 3300037418 | Bacteria | 3079 |
| 785 | Ga0395900_0114073 | 3300037418 | Bacteria | 2773 |
| 786 | Ga0395900_0122247 | 3300037418 | Bacteria | 2671 |
| 787 | Ga0395900_0160006 | 3300037418 | Bacteria | 2297 |
| 788 | Ga0395900_0208414 | 3300037418 | Bacteria | 1974 |
| 789 | Ga0395898_0000738 | 3300037466 | Bacteria | 57155 |
| 790 | Ga0395898_0024244 | 3300037466 | Bacteria | 6119 |
| 791 | Ga0395905_0000011 | 3300037471 | Bacteria | 424563 |
| 792 | Ga0395905_0000424 | 3300037471 | Bacteria | 58940 |
| 793 | Ga0395905_0002077 | 3300037471 | Bacteria | 22806 |
| 794 | Ga0395905_0058731 | 3300037471 | Bacteria | 3597 |
| 795 | Ga0395905_0078678 | 3300037471 | Unclassified | 3090 |
| 796 | Ga0395905_0174138 | 3300037471 | Bacteria | 2021 |
| 797 | Ga0395901_0000701 | 3300038443 | Bacteria | 38257 |
| 798 | Ga0395901_0002159 | 3300038443 | Bacteria | 20086 |
| 799 | Ga0395901_0006937 | 3300038443 | Bacteria | 11445 |
| 800 | Ga0395901_0164236 | 3300038443 | Bacteria | 2331 |
| 801 | Ga0395901_0310372 | 3300038443 | Eukaryota | 1634 |
| 802 | Ga0400489_30943 | 3300039093 | Bacteria | 1385 |
| 803 | Ga0400489_46343 | 3300039093 | Unclassified | 1465 |
| 804 | Ga0436365_0527492 | 3300039437 | Bacteria | 2241 |
| 805 | Ga0436365_0645548 | 3300039437 | Bacteria | 4394 |
| 806 | Ga0436365_0722843 | 3300039437 | Bacteria | 20827 |
| 807 | Ga0436365_1777169 | 3300039437 | Bacteria | 24248 |
| 808 | Ga0451796_21607 | 3300041450 | Eukaryota | 1851 |
| 809 | Ga0451799_07084 | 3300041454 | Eukaryota | 1608 |
| 810 | Ga0451805_012004 | 3300041461 | Eukaryota | 1948 |
| 811 | Ga0451840_16749 | 3300041497 | Eukaryota | 1859 |
| 812 | Ga0451844_11196 | 3300041500 | Eukaryota | 1706 |
| 813 | Ga0451846_05625 | 3300041502 | Eukaryota | 1648 |
| 814 | Ga0451850_03754 | 3300041506 | Eukaryota | 2008 |
| 815 | Ga0451854_32005 | 3300041510 | Eukaryota | 1888 |
| 816 | Ga0451853_2490003 | 3300041512 | Bacteria | 1707 |
| 817 | Ga0452268_04908 | 3300041907 | Eukaryota | 1722 |
| 818 | Ga0452271_09524 | 3300041916 | Eukaryota | 1972 |
| 819 | Ga0439431_0000898 | 3300041997 | Bacteria | 6429 |
| 820 | Ga0439445_0004707 | 3300042004 | Bacteria | 3096 |
| 821 | Ga0439449_0002063 | 3300042007 | Bacteria | 7909 |
| 822 | Ga0439457_000194 | 3300042014 | Bacteria | 16029 |
| 823 | Ga0439457_017921 | 3300042014 | Bacteria | 1571 |
| 824 | Ga0439462_0003569 | 3300042015 | Bacteria | 3743 |
| 825 | Ga0439434_0050937 | 3300042435 | Bacteria | 1283 |
| 826 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 827 | Ga0451577_0000651 | 3300042876 | Bacteria | 55020 |
| 828 | Ga0451577_0001245 | 3300042876 | Bacteria | 35250 |
| 829 | Ga0451577_0009644 | 3300042876 | Bacteria | 9267 |
| 830 | Ga0451577_0037169 | 3300042876 | Bacteria | 4383 |
| 831 | Ga0451577_0100917 | 3300042876 | Unclassified | 2578 |
| 832 | Ga0451577_0102594 | 3300042876 | Bacteria | 2556 |
| 833 | Ga0451577_0175564 | 3300042876 | Bacteria | 1931 |
| 834 | Ga0451577_0187558 | 3300042876 | Bacteria | 1865 |
| 835 | Ga0451577_0215014 | 3300042876 | Bacteria | 1737 |
| 836 | Ga0451577_0216186 | 3300042876 | Bacteria | 1732 |
| 837 | Ga0451577_0254697 | 3300042876 | Bacteria | 1589 |
| 838 | Ga0466969_0000235 | 3300044656 | Bacteria | 30219 |
| 839 | Ga0466972_0000129 | 3300044658 | Bacteria | 63412 |
| 840 | Ga0466972_0017374 | 3300044658 | Bacteria | 3601 |
| 841 | Ga0453683_0000015 | 3300044673 | Bacteria | 346024 |
| 842 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 843 | Ga0453683_0000370 | 3300044673 | Bacteria | 53913 |
| 844 | Ga0453683_0005928 | 3300044673 | Bacteria | 8435 |
| 845 | Ga0453683_0077239 | 3300044673 | Bacteria | 2085 |
| 846 | Ga0466966_0000280 | 3300044684 | Bacteria | 33412 |
| 847 | Ga0453684_0000288 | 3300044712 | Bacteria | 216718 |
| 848 | Ga0453684_0000527 | 3300044712 | Bacteria | 146072 |
| 849 | Ga0453684_0001433 | 3300044712 | Bacteria | 68182 |
| 850 | Ga0453684_0001448 | 3300044712 | Bacteria | 67464 |
| 851 | Ga0453684_0002895 | 3300044712 | Bacteria | 40244 |
| 852 | Ga0453684_0011070 | 3300044712 | Bacteria | 15229 |
| 853 | Ga0453684_0011269 | 3300044712 | Bacteria | 15040 |
| 854 | Ga0453684_0012598 | 3300044712 | Bacteria | 13911 |
| 855 | Ga0453684_0028890 | 3300044712 | Bacteria | 7893 |
| 856 | Ga0453684_0050914 | 3300044712 | Bacteria | 5439 |
| 857 | Ga0453684_0055349 | 3300044712 | Bacteria | 5159 |
| 858 | Ga0453684_0073633 | 3300044712 | Bacteria | 4305 |
| 859 | Ga0453684_0163183 | 3300044712 | Bacteria | 2633 |
| 860 | Ga0453684_0169504 | 3300044712 | Bacteria | 2574 |
| 861 | Ga0453684_0289054 | 3300044712 | Bacteria | 1867 |
| 862 | Ga0466971_0013802 | 3300044719 | Bacteria | 3552 |
| 863 | Ga0466970_0001553 | 3300044765 | Bacteria | 11067 |
| 864 | Ga0466957_0000047 | 3300044842 | Bacteria | 45485 |
| 865 | Ga0466957_0003227 | 3300044842 | Bacteria | 8924 |
| 866 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 867 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 868 | Ga0451576_0000211 | 3300045051 | Bacteria | 146199 |
| 869 | Ga0451576_0000689 | 3300045051 | Bacteria | 68784 |
| 870 | Ga0451576_0000720 | 3300045051 | Bacteria | 66656 |
| 871 | Ga0451576_0003461 | 3300045051 | Bacteria | 21644 |
| 872 | Ga0451576_0007161 | 3300045051 | Bacteria | 13445 |
| 873 | Ga0451576_0102824 | 3300045051 | Bacteria | 2972 |
| 874 | Ga0495627_003275 | 3300046453 | Bacteria | 7250 |
| 875 | Ga0495592_0031395 | 3300046454 | Bacteria | 4015 |
| 876 | Ga0495638_0078741 | 3300046460 | Bacteria | 2005 |
| 877 | Ga0495653_0059728 | 3300046463 | Eukaryota | 2892 |
| 878 | Ga0495580_0022374 | 3300046472 | Unclassified | 4652 |
| 879 | Ga0495606_0012333 | 3300046507 | Bacteria | 6868 |
| 880 | Ga0495618_0011353 | 3300046514 | Bacteria | 5399 |
| 881 | Ga0495628_0021332 | 3300046516 | Bacteria | 5331 |
| 882 | Ga0495630_0017424 | 3300046517 | Bacteria | 5261 |
| 883 | Ga0495648_0011939 | 3300046524 | Bacteria | 6515 |
| 884 | Ga0495640_0030887 | 3300046533 | Eukaryota | 3830 |
| 885 | Ga0495586_0073845 | 3300046535 | Unclassified | 1866 |
| 886 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 887 | Ga0495667_0039334 | 3300046559 | Bacteria | 3145 |
| 888 | Ga0495668_0000191 | 3300046616 | Bacteria | 90923 |
| 889 | Ga0495668_0000227 | 3300046616 | Bacteria | 81234 |
| 890 | Ga0495668_0001856 | 3300046616 | Bacteria | 18993 |
| 891 | Ga0495668_0020328 | 3300046616 | Bacteria | 3820 |
| 892 | Ga0495611_0000021 | 3300046648 | Bacteria | 123657 |
| 893 | Ga0495625_0026632 | 3300046660 | Bacteria | 4367 |
| 894 | Ga0495625_0151307 | 3300046660 | Bacteria | 1560 |
| 895 | Ga0495658_0117179 | 3300046683 | Bacteria | 1607 |
| 896 | Ga0495613_0000219 | 3300046689 | Eukaryota | 55845 |
| 897 | Ga0495670_0039078 | 3300046691 | Bacteria | 2367 |
| 898 | Ga0495636_0000008 | 3300047318 | Bacteria | 102958 |
| 899 | Ga0495672_0010692 | 3300047320 | Bacteria | 6517 |
| 900 | Ga0495672_0077034 | 3300047320 | Bacteria | 1871 |
| 901 | Ga0495672_0084345 | 3300047320 | Bacteria | 1762 |
| 902 | Ga0495672_0091007 | 3300047320 | Bacteria | 1675 |
| 903 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 904 | Ga0495684_0051204 | 3300047471 | Eukaryota | 3152 |
| 905 | Ga0495686_0000094 | 3300047472 | Bacteria | 187720 |
| 906 | Ga0495686_0000981 | 3300047472 | Bacteria | 34933 |
| 907 | Ga0495686_0034390 | 3300047472 | Bacteria | 3265 |
| 908 | Ga0496108_0160946 | 3300048911 | Bacteria | 1940 |
| 909 | Ga0496109_0175023 | 3300048912 | Bacteria | 2014 |
| 910 | Ga0496109_0180913 | 3300048912 | Bacteria | 1980 |
| 911 | Ga0496111_0079053 | 3300048914 | Bacteria | 2399 |
| 912 | Ga0496114_0002781 | 3300048917 | Bacteria | 13391 |
| 913 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 914 | Ga0496125_0113352 | 3300048928 | Eukaryota | 1956 |
| 915 | Ga0496126_0104265 | 3300048929 | Bacteria | 2477 |
| 916 | Ga0501309_003473 | 3300049129 | Eukaryota | 1787 |
| 917 | Ga0501305_004091 | 3300049161 | Eukaryota | 1695 |
| 918 | Ga0501031_0062697 | 3300049568 | Bacteria | 2422 |
| 919 | Ga0501032_0008278 | 3300049569 | Bacteria | 7578 |
| 920 | Ga0501032_0033612 | 3300049569 | Bacteria | 3513 |
| 921 | Ga0501034_0000400 | 3300049571 | Bacteria | 73231 |
| 922 | Ga0501034_0002020 | 3300049571 | Bacteria | 25539 |
| 923 | Ga0501034_0003274 | 3300049571 | Bacteria | 18491 |
| 924 | Ga0501034_0018272 | 3300049571 | Bacteria | 7191 |
| 925 | Ga0501034_0056204 | 3300049571 | Bacteria | 3961 |
| 926 | Ga0501034_0058086 | 3300049571 | Bacteria | 3888 |
| 927 | Ga0501034_0060026 | 3300049571 | Bacteria | 3820 |
| 928 | Ga0501034_0317360 | 3300049571 | Bacteria | 1492 |
| 929 | Ga0501036_0014453 | 3300049572 | Bacteria | 6577 |
| 930 | Ga0501036_0082726 | 3300049572 | Bacteria | 2713 |
| 931 | Ga0501036_0125704 | 3300049572 | Bacteria | 2165 |
| 932 | Ga0501036_0145007 | 3300049572 | Bacteria | 2003 |
| 933 | Ga0501037_0009762 | 3300049573 | Bacteria | 7048 |
| 934 | Ga0501038_0049949 | 3300049574 | Bacteria | 3615 |
| 935 | Ga0501038_0192564 | 3300049574 | Bacteria | 1640 |
| 936 | Ga0501039_0029048 | 3300049575 | Bacteria | 4258 |
| 937 | Ga0501043_0041368 | 3300049579 | Bacteria | 3621 |
| 938 | Ga0501043_0051224 | 3300049579 | Bacteria | 3244 |
| 939 | Ga0501043_0079529 | 3300049579 | Bacteria | 2576 |
| 940 | Ga0501043_0083676 | 3300049579 | Bacteria | 2508 |
| 941 | Ga0501046_0028556 | 3300049580 | Bacteria | 4542 |
| 942 | Ga0501046_0212684 | 3300049580 | Bacteria | 1435 |
| 943 | Ga0501047_0033258 | 3300049581 | Bacteria | 4977 |
| 944 | Ga0501047_0051131 | 3300049581 | Bacteria | 3991 |
| 945 | Ga0501047_0168208 | 3300049581 | Bacteria | 2062 |
| 946 | Ga0501048_0074370 | 3300049582 | Bacteria | 2397 |
| 947 | Ga0501070_0107975 | 3300049586 | Bacteria | 2300 |
| 948 | Ga0501074_0012038 | 3300049590 | Bacteria | 6283 |
| 949 | Ga0501198_001390 | 3300049649 | Bacteria | 3147 |
| 950 | Ga0501201_000556 | 3300049651 | Bacteria | 3478 |
| 951 | Ga0501202_013013 | 3300049652 | Bacteria | 1578 |
| 952 | Ga0501206_000657 | 3300049653 | Bacteria | 4182 |
| 953 | Ga0501207_000568 | 3300049654 | Bacteria | 4230 |
| 954 | Ga0501217_001767 | 3300049661 | Bacteria | 4126 |
| 955 | Ga0501222_002907 | 3300049662 | Bacteria | 2363 |
| 956 | Ga0501223_001352 | 3300049663 | Bacteria | 5680 |
| 957 | Ga0501243_001338 | 3300049675 | Bacteria | 3514 |
| 958 | Ga0501259_001263 | 3300049688 | Bacteria | 4229 |
| 959 | Ga0501259_004609 | 3300049688 | Bacteria | 2190 |
| 960 | Ga0501219_000154 | 3300049703 | Bacteria | 12438 |
| 961 | Ga0501221_001292 | 3300049704 | Bacteria | 4135 |
| 962 | Ga0501225_0000705 | 3300049705 | Bacteria | 10480 |
| 963 | Ga0501225_0004141 | 3300049705 | Bacteria | 4336 |
| 964 | Ga0501225_0013263 | 3300049705 | Bacteria | 2309 |
| 965 | Ga0501079_0140382 | 3300049741 | Bacteria | 1882 |
| 966 | Ga0501080_0070949 | 3300049742 | Bacteria | 3240 |
| 967 | Ga0501080_0375209 | 3300049742 | Bacteria | 1282 |
| 968 | Ga0501241_000089 | 3300049758 | Bacteria | 19792 |
| 969 | Ga0501266_002636 | 3300049763 | Bacteria | 2250 |
| 970 | Ga0501283_001644 | 3300049779 | Bacteria | 2912 |
| 971 | Ga0501035_0007882 | 3300049822 | Bacteria | 9950 |
| 972 | Ga0501035_0034348 | 3300049822 | Bacteria | 4608 |
| 973 | Ga0501035_0036432 | 3300049822 | Bacteria | 4458 |
| 974 | Ga0501035_0188004 | 3300049822 | Unclassified | 1777 |
| 975 | Ga0501035_0244238 | 3300049822 | Bacteria | 1526 |
| 976 | Ga0501044_0009652 | 3300049823 | Bacteria | 10499 |
| 977 | Ga0501044_0012704 | 3300049823 | Bacteria | 9120 |
| 978 | Ga0501044_0037532 | 3300049823 | Bacteria | 5064 |
| 979 | Ga0501044_0087996 | 3300049823 | Bacteria | 3136 |
| 980 | Ga0501044_0181350 | 3300049823 | Bacteria | 2072 |
| 981 | Ga0501044_0319162 | 3300049823 | Bacteria | 1478 |
| 982 | Ga0501284_00104 | 3300050005 | Bacteria | 17195 |
| 983 | nmdc:mga0k408_13738_c1 | 3300050493 | Bacteria | 4447 |
| 984 | nmdc:mga05p37_3235_c1 | 3300050507 | Bacteria | 18970 |
| 985 | nmdc:mga09592_106306_c1 | 3300050508 | Bacteria | 2407 |
| 986 | nmdc:mga09592_1546_c1 | 3300050508 | Bacteria | 18488 |
| 987 | nmdc:mga0qj67_14639_c1 | 3300050509 | Bacteria | 5931 |
| 988 | nmdc:mga0qj67_45337_c1 | 3300050509 | Unclassified | 3469 |
| 989 | nmdc:mga06r32_20657_c1 | 3300050510 | Bacteria | 6065 |
| 990 | nmdc:mga06r32_4303_c1 | 3300050510 | Bacteria | 12745 |
| 991 | nmdc:mga08y16_13230_c1 | 3300050511 | Bacteria | 8678 |
| 992 | nmdc:mga0n895_93045_c2 | 3300050512 | Bacteria | 2065 |
| 993 | Ga0500578_0000362 | 3300053086 | Bacteria | 55748 |
| 994 | Ga0500578_0015601 | 3300053086 | Bacteria | 4880 |
| 995 | Ga0500644_0000233 | 3300053088 | Bacteria | 31422 |
| 996 | Ga0500581_064306 | 3300053089 | Bacteria | 1854 |
| 997 | Ga0500646_0025164 | 3300053090 | Bacteria | 1606 |
| 998 | Ga0500583_0000053 | 3300053092 | Bacteria | 74724 |
| 999 | Ga0500583_0003049 | 3300053092 | Bacteria | 5178 |
| 1000 | Ga0500562_000025 | 3300053108 | Bacteria | 105616 |
| 1001 | Ga0500569_001850 | 3300053109 | Bacteria | 4073 |
| 1002 | Ga0500594_0020966 | 3300053118 | Bacteria | 1635 |
| 1003 | Ga0500607_055459 | 3300053121 | Bacteria | 2095 |
| 1004 | Ga0500642_0000960 | 3300053130 | Bacteria | 8311 |
| 1005 | Ga0500642_0013043 | 3300053130 | Bacteria | 3039 |
| 1006 | Ga0500652_003510 | 3300053131 | Bacteria | 4758 |
| 1007 | Ga0500652_053905 | 3300053131 | Bacteria | 1646 |
| 1008 | Ga0500568_0000593 | 3300053139 | Bacteria | 26321 |
| 1009 | Ga0500568_0034432 | 3300053139 | Bacteria | 2072 |
| 1010 | Ga0500588_0006338 | 3300053146 | Bacteria | 2676 |
| 1011 | Ga0500588_0038620 | 3300053146 | Bacteria | 1425 |
| 1012 | Ga0500604_0003300 | 3300053151 | Bacteria | 4344 |
| 1013 | Ga0500616_0004500 | 3300053153 | Bacteria | 9903 |
| 1014 | Ga0500616_0012441 | 3300053153 | Bacteria | 4978 |
| 1015 | Ga0500622_0000319 | 3300053156 | Bacteria | 48315 |
| 1016 | Ga0500622_0000917 | 3300053156 | Bacteria | 25097 |
| 1017 | Ga0500622_0016530 | 3300053156 | Bacteria | 3942 |
| 1018 | Ga0500636_0026955 | 3300053177 | Bacteria | 3393 |
| 1019 | Ga0500611_000061 | 3300053727 | Bacteria | 45387 |
| 1020 | Ga0501084_0010875 | 3300054114 | Bacteria | 7537 |
| 1021 | Ga0501084_0020074 | 3300054114 | Bacteria | 5572 |
| 1022 | Ga0500661_001516 | 3300055283 | Bacteria | 4368 |
| 1023 | Ga0587070_006321 | 3300059491 | Eukaryota | 1594 |
| 1024 | Ga0587073_0003063 | 3300059492 | Eukaryota | 2245 |
| 1025 | Ga0587077_005091 | 3300059493 | Eukaryota | 1775 |
| 1026 | Ga0587080_001676 | 3300059503 | Eukaryota | 2461 |
| 1027 | Ga0587080_008247 | 3300059503 | Eukaryota | 1486 |
| 1028 | Ga0587082_004058 | 3300059504 | Eukaryota | 1808 |
| 1029 | Ga0587083_0004724 | 3300059505 | Eukaryota | 1917 |
| 1030 | Ga0587083_0010177 | 3300059505 | Eukaryota | 1518 |
| 1031 | Ga0587088_007944 | 3300059508 | Eukaryota | 1485 |
| 1032 | Ga0587089_003294 | 3300059509 | Eukaryota | 1709 |
| 1033 | Ga0587091_004506 | 3300059511 | Eukaryota | 1835 |
| 1034 | Ga0587091_009086 | 3300059511 | Eukaryota | 1488 |
| 1035 | Ga0587098_001772 | 3300059604 | Eukaryota | 1721 |
| 1036 | Ga0587109_010290 | 3300059624 | Eukaryota | 1490 |
| 1037 | Ga0587128_003514 | 3300059630 | Eukaryota | 1745 |
| 1038 | Ga0587128_004960 | 3300059630 | Eukaryota | 1570 |
| 1039 | Ga0587068_004206 | 3300059641 | Eukaryota | 1890 |
| 1040 | Ga0587072_003720 | 3300059643 | Eukaryota | 2166 |
| 1041 | Ga0587078_002717 | 3300059646 | Eukaryota | 1733 |
| 1042 | Ga0587079_005858 | 3300059647 | Eukaryota | 1760 |
| 1043 | Ga0587102_002131 | 3300059649 | Eukaryota | 1494 |
| 1044 | Ga0587071_003078 | 3300060344 | Eukaryota | 2348 |
| 1045 | Ga0587111_0002972 | 3300060346 | Eukaryota | 2349 |
| 1046 | Ga0501082_0198686 | 3300060353 | Bacteria | 1744 |
| 1047 | 2738724428 | 2738541278 | Bacteria | 9755573 |
| 1048 | 2819572031 | 2818991442 | Bacteria | 8318214 |
| 1049 | 2819586395 | 2818991444 | Bacteria | 6968812 |
| 1050 | 2819677801 | 2818991460 | Bacteria | 7595395 |
| 1051 | 2821141724 | 2821136567 | Bacteria | 8080116 |
| 1052 | 2881957752 | 2881955468 | Bacteria | 3545609 |
| 1053 | 2883073140 | 2883068021 | Bacteria | 6192739 |
| 1054 | 2884797751 | 2884791551 | Bacteria | 8511252 |
| 1055 | 2896087441 | 2896085136 | Bacteria | 6129793 |
| 1056 | 2896114791 | 2896109856 | Bacteria | 7140722 |
| 1057 | 2904469861 | 2904467357 | Bacteria | 8057758 |
| 1058 | 2914763015 | 2914759650 | Bacteria | 4701441 |
| 1059 | 2929155194 | 2929154850 | Bacteria | 6753285 |
| 1060 | 2929183199 | 2929177148 | Bacteria | 7883697 |
| 1061 | 2929245332 | 2929239360 | Bacteria | 7745570 |
| 1062 | 2929927581 | 2929921140 | Bacteria | 8649150 |
| 1063 | 2945979160 | 2945977869 | Bacteria | 7777518 |
| 1064 | 2946014974 | 2946013367 | Bacteria | 7766675 |
| 1065 | 8003151429 | 8003151029 | Bacteria | 8187759 |
| 1066 | Ga0587115_002282 | |||
| 1067 | SwRhRL2b_contig_1662827 | |||
| 1068 | SwRhRL2b_contig_1886170 | |||
| 1069 | JGI24740J21852_10001312 | |||
| 1070 | JGI24740J21852_10025233 | |||
| 1071 | JGI24739J22299_10000154 | |||
| 1072 | JGI24739J22299_10009514 | |||
| 1073 | JGI24744J21845_10011394 | |||
| 1074 | JGI25154J39366_1000004 | |||
| 1075 | Ga0006759J45824_1008941 | |||
| 1076 | JGI25406J46586_10032623 | |||
| 1077 | JGI25153J46596_10000224 | |||
| 1078 | rootH2_10020011 | |||
| 1079 | rootH2_10059474 | |||
| 1080 | rootL2_10002073 | |||
| 1081 | rootL2_10022324 | |||
| 1082 | rootL2_10080770 | |||
| 1083 | rootL2_10159435 | |||
| 1084 | rootH1_10017832 | |||
| 1085 | rootH1_10132169 | |||
| 1086 | rootH1_10293201 | |||
| 1087 | JGI25160J50197_1002326 | |||
| 1088 | JGI25160J50197_1015175 | |||
| 1089 | Ga0006556J51387_1001902 | |||
| 1090 | Ga0007417J51691_1006438 | |||
| 1091 | Ga0006557J51388_1002740 | |||
| 1092 | Ga0006558J51389_1002884 | |||
| 1093 | Ga0006559J51393_1002205 | |||
| 1094 | Ga0006553J51392_1001961 | |||
| 1095 | Ga0006555J51386_1001801 | |||
| 1096 | Ga0006560J51390_1001990 | |||
| 1097 | Ga0006554J51385_1001999 | |||
| 1098 | Ga0007410J51695_1014397 | |||
| 1099 | Ga0007409J51694_1006724 | |||
| 1100 | Ga0055526_1008813 | |||
| 1101 | Ga0055528_1000355 | |||
| 1102 | Ga0055530_10000425 | |||
| 1103 | Ga0055531_10000411 | |||
| 1104 | Ga0058863_11636828 | |||
| 1105 | Ga0058863_11883630 | |||
| 1106 | Ga0058861_10004224 | |||
| 1107 | Ga0058861_10012567 | |||
| 1108 | Ga0058860_10086452 | |||
| 1109 | Ga0058862_12751224 | |||
| 1110 | Ga0058862_12825977 | |||
| 1111 | Ga0065165_1000148 | |||
| 1112 | Ga0065165_1016429 | |||
| 1113 | Ga0065703_1004179 | |||
| 1114 | Ga0065704_10000184 | |||
| 1115 | Ga0065704_10070159 | |||
| 1116 | Ga0065704_10078716 | |||
| 1117 | Ga0065712_10002337 | |||
| 1118 | Ga0065712_10073174 | |||
| 1119 | Ga0065712_10129514 | |||
| 1120 | Ga0065715_10136544 | |||
| 1121 | Ga0065707_10081733 | |||
| 1122 | Ga0065707_10104464 | |||
| 1123 | Ga0070658_10035269 | |||
| 1124 | Ga0070658_10039863 | |||
| 1125 | Ga0070658_10068803 | |||
| 1126 | Ga0070658_10075337 | |||
| 1127 | Ga0070658_10079595 | |||
| 1128 | Ga0070676_10010728 | |||
| 1129 | Ga0070676_10028456 | |||
| 1130 | Ga0070683_100001238 | |||
| 1131 | Ga0070683_100001444 | |||
| 1132 | Ga0070683_100016015 | |||
| 1133 | Ga0070683_100016889 | |||
| 1134 | Ga0070683_100097695 | |||
| 1135 | Ga0070690_100003044 | |||
| 1136 | Ga0070690_100082032 | |||
| 1137 | Ga0070670_100043927 | |||
| 1138 | Ga0070670_100058211 | |||
| 1139 | Ga0070670_100071060 | |||
| 1140 | Ga0070670_100099943 | |||
| 1141 | Ga0070670_100108494 | |||
| 1142 | Ga0068869_100005880 | |||
| 1143 | Ga0068869_100011976 | |||
| 1144 | Ga0068869_100015556 | |||
| 1145 | Ga0070666_10000637 | |||
| 1146 | Ga0070666_10005840 | |||
| 1147 | Ga0070666_10011699 | |||
| 1148 | Ga0070666_10119571 | |||
| 1149 | Ga0070680_100007800 | |||
| 1150 | Ga0070680_100018238 | |||
| 1151 | Ga0070682_100000039 | |||
| 1152 | Ga0070682_100001382 | |||
| 1153 | Ga0068868_100020492 | |||
| 1154 | Ga0068868_100026625 | |||
| 1155 | Ga0068868_100050438 | |||
| 1156 | Ga0068868_100221104 | |||
| 1157 | Ga0070660_100070186 | |||
| 1158 | Ga0070660_100095441 | |||
| 1159 | Ga0070689_100009324 | |||
| 1160 | Ga0070689_100130708 | |||
| 1161 | Ga0070689_100163509 | |||
| 1162 | Ga0070691_10024246 | |||
| 1163 | Ga0070687_100036328 | |||
| 1164 | Ga0070661_100005250 | |||
| 1165 | Ga0070668_100007075 | |||
| 1166 | Ga0070668_100042795 | |||
| 1167 | Ga0070668_100128906 | |||
| 1168 | Ga0070669_100007234 | |||
| 1169 | Ga0070669_100155357 | |||
| 1170 | Ga0070669_100207736 | |||
| 1171 | Ga0070675_100002069 | |||
| 1172 | Ga0070675_100025237 | |||
| 1173 | Ga0070675_100031894 | |||
| 1174 | Ga0070675_100036599 | |||
| 1175 | Ga0070675_100042510 | |||
| 1176 | Ga0070675_100071319 | |||
| 1177 | Ga0070675_100080671 | |||
| 1178 | Ga0070671_100012510 | |||
| 1179 | Ga0070674_100031917 | |||
| 1180 | Ga0070674_100140115 | |||
| 1181 | Ga0070673_100039888 | |||
| 1182 | Ga0070673_100106028 | |||
| 1183 | Ga0070688_100004093 | |||
| 1184 | Ga0070688_100034193 | |||
| 1185 | Ga0070688_100047054 | |||
| 1186 | Ga0070659_100044535 | |||
| 1187 | Ga0070659_100076513 | |||
| 1188 | Ga0070659_100169298 | |||
| 1189 | Ga0070667_100001496 | |||
| 1190 | Ga0070667_100014740 | |||
| 1191 | Ga0070667_100046485 | |||
| 1192 | Ga0070667_100140788 | |||
| 1193 | Ga0070713_100082748 | |||
| 1194 | Ga0070700_100040804 | |||
| 1195 | Ga0070663_100048185 | |||
| 1196 | Ga0070678_100029174 | |||
| 1197 | Ga0070678_100031427 | |||
| 1198 | Ga0070662_100007468 | |||
| 1199 | Ga0070662_100020198 | |||
| 1200 | Ga0070681_10019192 | |||
| 1201 | Ga0070681_10022486 | |||
| 1202 | Ga0070681_10037397 | |||
| 1203 | Ga0070681_10043308 | |||
| 1204 | Ga0068867_100007411 | |||
| 1205 | Ga0068867_100009973 | |||
| 1206 | Ga0068867_100012400 | |||
| 1207 | Ga0068867_100061331 | |||
| 1208 | Ga0068867_100115120 | |||
| 1209 | Ga0070685_10010662 | |||
| 1210 | Ga0070685_10029590 | |||
| 1211 | Ga0070685_10099300 | |||
| 1212 | Ga0070698_100010157 | |||
| 1213 | Ga0070698_100013783 | |||
| 1214 | Ga0070698_100022097 | |||
| 1215 | Ga0070699_100243571 | |||
| 1216 | Ga0070679_100001941 | |||
| 1217 | Ga0070679_100004204 | |||
| 1218 | Ga0070679_100004852 | |||
| 1219 | Ga0070679_100006603 | |||
| 1220 | Ga0070679_100016816 | |||
| 1221 | Ga0070679_100173092 | |||
| 1222 | Ga0070684_100004827 | |||
| 1223 | Ga0070684_100026655 | |||
| 1224 | Ga0070684_100053228 | |||
| 1225 | Ga0070684_100066340 | |||
| 1226 | Ga0068853_100000276 | |||
| 1227 | Ga0068853_100010323 | |||
| 1228 | Ga0068853_100057243 | |||
| 1229 | Ga0068853_100068730 | |||
| 1230 | Ga0068853_100149047 | |||
| 1231 | Ga0070672_100000891 | |||
| 1232 | Ga0070672_100012051 | |||
| 1233 | Ga0070672_100015554 | |||
| 1234 | Ga0070672_100031872 | |||
| 1235 | Ga0070672_100053581 | |||
| 1236 | Ga0070672_100058944 | |||
| 1237 | Ga0070686_100023983 | |||
| 1238 | Ga0070686_100060414 | |||
| 1239 | Ga0070686_100086005 | |||
| 1240 | Ga0070665_100000001 | |||
| 1241 | Ga0070665_100006717 | |||
| 1242 | Ga0070665_100008882 | |||
| 1243 | Ga0070665_100165554 | |||
| 1244 | Ga0068855_100001835 | |||
| 1245 | Ga0068855_100007690 | |||
| 1246 | Ga0068855_100077125 | |||
| 1247 | Ga0068855_100211089 | |||
| 1248 | Ga0068855_100241664 | |||
| 1249 | Ga0070664_100000321 | |||
| 1250 | Ga0070664_100022940 | |||
| 1251 | Ga0070664_100035604 | |||
| 1252 | Ga0070664_100057743 | |||
| 1253 | Ga0070664_100113391 | |||
| 1254 | Ga0070664_100116519 | |||
| 1255 | Ga0068857_100001139 | |||
| 1256 | Ga0068857_100003724 | |||
| 1257 | Ga0068857_100007529 | |||
| 1258 | Ga0068857_100040032 | |||
| 1259 | Ga0068857_100046729 | |||
| 1260 | Ga0068857_100067152 | |||
| 1261 | Ga0068857_100083434 | |||
| 1262 | Ga0068854_100063732 | |||
| 1263 | Ga0068854_100122710 | |||
| 1264 | Ga0068854_100126928 | |||
| 1265 | Ga0068856_100011104 | |||
| 1266 | Ga0068856_100014039 | |||
| 1267 | Ga0068856_100020619 | |||
| 1268 | Ga0068856_100030709 | |||
| 1269 | Ga0068856_100043776 | |||
| 1270 | Ga0068856_100081424 | |||
| 1271 | Ga0068856_100175544 | |||
| 1272 | Ga0068856_100224251 | |||
| 1273 | Ga0068852_100002151 | |||
| 1274 | Ga0068852_100006664 | |||
| 1275 | Ga0068852_100009018 | |||
| 1276 | Ga0068852_100012493 | |||
| 1277 | Ga0068852_100046206 | |||
| 1278 | Ga0068852_100059122 | |||
| 1279 | Ga0068852_100084705 | |||
| 1280 | Ga0068859_100000029 | |||
| 1281 | Ga0068859_100002114 | |||
| 1282 | Ga0068859_100008303 | |||
| 1283 | Ga0068859_100013957 | |||
| 1284 | Ga0068859_100041845 | |||
| 1285 | Ga0068859_100059969 | |||
| 1286 | Ga0068859_100120020 | |||
| 1287 | Ga0068859_100252668 | |||
| 1288 | Ga0068864_100004500 | |||
| 1289 | Ga0068864_100027276 | |||
| 1290 | Ga0068864_100031790 | |||
| 1291 | Ga0068864_100085759 | |||
| 1292 | Ga0068864_100095796 | |||
| 1293 | Ga0068864_100105231 | |||
| 1294 | Ga0068861_100003057 | |||
| 1295 | Ga0068861_100010966 | |||
| 1296 | Ga0068861_100069206 | |||
| 1297 | Ga0068861_100175543 | |||
| 1298 | Ga0068851_10000700 | |||
| 1299 | Ga0068851_10034762 | |||
| 1300 | Ga0068851_10070802 | |||
| 1301 | Ga0068863_100013276 | |||
| 1302 | Ga0068863_100024625 | |||
| 1303 | Ga0068863_100054921 | |||
| 1304 | Ga0068863_100133984 | |||
| 1305 | Ga0068863_100138099 | |||
| 1306 | Ga0068858_100022432 | |||
| 1307 | Ga0068858_100032010 | |||
| 1308 | Ga0068858_100121301 | |||
| 1309 | Ga0068860_100000004 | |||
| 1310 | Ga0068860_100000888 | |||
| 1311 | Ga0068860_100003442 | |||
| 1312 | Ga0068860_100011991 | |||
| 1313 | Ga0068860_100014813 | |||
| 1314 | Ga0068860_100029918 | |||
| 1315 | Ga0068860_100058702 | |||
| 1316 | Ga0068860_100058812 | |||
| 1317 | Ga0068860_100123470 | |||
| 1318 | Ga0068862_100098660 | |||
| 1319 | Ga0068862_100108486 | |||
| 1320 | Ga0068862_100148170 | |||
| 1321 | Ga0081539_10000037 | |||
| 1322 | Ga0075364_10018791 | |||
| 1323 | Ga0075366_10032815 | |||
| 1324 | Ga0075366_10033322 | |||
| 1325 | Ga0075366_10091755 | |||
| 1326 | Ga0097621_100002686 | |||
| 1327 | Ga0097621_100003597 | |||
| 1328 | Ga0097621_100007374 | |||
| 1329 | Ga0097621_100013550 | |||
| 1330 | Ga0097621_100026587 | |||
| 1331 | Ga0097621_100048389 | |||
| 1332 | Ga0097621_100066510 | |||
| 1333 | Ga0097621_100075505 | |||
| 1334 | Ga0068871_100000076 | |||
| 1335 | Ga0068871_100010710 | |||
| 1336 | Ga0068871_100014864 | |||
| 1337 | Ga0068871_100030731 | |||
| 1338 | Ga0075428_100016924 | |||
| 1339 | Ga0075428_100017350 | |||
| 1340 | Ga0075428_100048921 | |||
| 1341 | Ga0075428_100164787 | |||
| 1342 | Ga0075428_100365710 | |||
| 1343 | Ga0075430_100003812 | |||
| 1344 | Ga0075430_100051479 | |||
| 1345 | Ga0075431_100012623 | |||
| 1346 | Ga0075429_100000539 | |||
| 1347 | Ga0075429_100039248 | |||
| 1348 | Ga0068865_100016033 | |||
| 1349 | Ga0068865_100079134 | |||
| 1350 | Ga0068865_100092796 | |||
| 1351 | Ga0097620_100000029 | |||
| 1352 | Ga0097620_100002114 | |||
| 1353 | Ga0097620_100008303 | |||
| 1354 | Ga0097620_100013956 | |||
| 1355 | Ga0097620_100041849 | |||
| 1356 | Ga0097620_100059969 | |||
| 1357 | Ga0097620_100120019 | |||
| 1358 | Ga0097620_100252678 | |||
| 1359 | Ga0105240_10000131 | |||
| 1360 | Ga0105240_10002773 | |||
| 1361 | Ga0105240_10003397 | |||
| 1362 | Ga0105240_10003620 | |||
| 1363 | Ga0105240_10004711 | |||
| 1364 | Ga0105240_10006456 | |||
| 1365 | Ga0105240_10016334 | |||
| 1366 | Ga0105240_10028113 | |||
| 1367 | Ga0105240_10031577 | |||
| 1368 | Ga0105240_10042295 | |||
| 1369 | Ga0105240_10119331 | |||
| 1370 | Ga0111539_10002138 | |||
| 1371 | Ga0111539_10115534 | |||
| 1372 | Ga0105245_10060441 | |||
| 1373 | Ga0105247_10027268 | |||
| 1374 | Ga0105247_10057125 | |||
| 1375 | Ga0114129_10036098 | |||
| 1376 | Ga0105243_10193772 | |||
| 1377 | Ga0105241_10000764 | |||
| 1378 | Ga0105241_10001337 | |||
| 1379 | Ga0105241_10001925 | |||
| 1380 | Ga0105241_10034397 | |||
| 1381 | Ga0105242_10019613 | |||
| 1382 | Ga0105242_10059527 | |||
| 1383 | Ga0105242_10094281 | |||
| 1384 | Ga0105248_10026892 | |||
| 1385 | Ga0105237_10000377 | |||
| 1386 | Ga0105237_10002457 | |||
| 1387 | Ga0105237_10002932 | |||
| 1388 | Ga0105237_10008643 | |||
| 1389 | Ga0105237_10013544 | |||
| 1390 | Ga0105237_10013564 | |||
| 1391 | Ga0105237_10015625 | |||
| 1392 | Ga0105238_10025254 | |||
| 1393 | Ga0105238_10058072 | |||
| 1394 | Ga0105249_10001339 | |||
| 1395 | Ga0105249_10021951 | |||
| 1396 | Ga0105249_10042337 | |||
| 1397 | Ga0105249_10131482 | |||
| 1398 | Ga0105249_10367601 | |||
| 1399 | Ga0105239_10000029 | |||
| 1400 | Ga0105239_10000714 | |||
| 1401 | Ga0105239_10001999 | |||
| 1402 | Ga0105239_10002549 | |||
| 1403 | Ga0105239_10005380 | |||
| 1404 | Ga0105239_10005636 | |||
| 1405 | Ga0105239_10019534 | |||
| 1406 | Ga0105239_10022019 | |||
| 1407 | Ga0105239_10023622 | |||
| 1408 | Ga0105239_10041121 | |||
| 1409 | Ga0105239_10055909 | |||
| 1410 | Ga0105239_10157937 | |||
| 1411 | Ga0105239_10205821 | |||
| 1412 | Ga0105246_10006069 | |||
| 1413 | Ga0105246_10049467 | |||
| 1414 | Ga0105246_10112213 | |||
| 1415 | Ga0157373_10000350 | |||
| 1416 | Ga0157373_10009312 | |||
| 1417 | Ga0157373_10010190 | |||
| 1418 | Ga0157373_10013041 | |||
| 1419 | Ga0157373_10024322 | |||
| 1420 | Ga0157373_10036664 | |||
| 1421 | Ga0157371_10001416 | |||
| 1422 | Ga0157371_10002643 | |||
| 1423 | Ga0157371_10003115 | |||
| 1424 | Ga0157371_10003982 | |||
| 1425 | Ga0157371_10006222 | |||
| 1426 | Ga0157371_10009640 | |||
| 1427 | Ga0157371_10019168 | |||
| 1428 | Ga0157371_10035435 | |||
| 1429 | Ga0157370_10000478 | |||
| 1430 | Ga0157370_10000530 | |||
| 1431 | Ga0157370_10001941 | |||
| 1432 | Ga0157370_10003057 | |||
| 1433 | Ga0157370_10110923 | |||
| 1434 | Ga0157369_10036543 | |||
| 1435 | Ga0157369_10041768 | |||
| 1436 | Ga0157369_10044835 | |||
| 1437 | Ga0157369_10063839 | |||
| 1438 | Ga0157369_10179875 | |||
| 1439 | Ga0157374_10000001 | |||
| 1440 | Ga0157374_10000719 | |||
| 1441 | Ga0157374_10002479 | |||
| 1442 | Ga0157374_10012275 | |||
| 1443 | Ga0157374_10053886 | |||
| 1444 | Ga0157374_10057778 | |||
| 1445 | Ga0157374_10139195 | |||
| 1446 | Ga0157378_10004321 | |||
| 1447 | Ga0157378_10012543 | |||
| 1448 | Ga0157378_10019488 | |||
| 1449 | Ga0157378_10026764 | |||
| 1450 | Ga0157378_10030980 | |||
| 1451 | Ga0163162_10002251 | |||
| 1452 | Ga0163162_10004108 | |||
| 1453 | Ga0163162_10008316 | |||
| 1454 | Ga0163162_10010477 | |||
| 1455 | Ga0163162_10011862 | |||
| 1456 | Ga0163162_10017201 | |||
| 1457 | Ga0163162_10020291 | |||
| 1458 | Ga0163162_10022959 | |||
| 1459 | Ga0163162_10092099 | |||
| 1460 | Ga0163162_10123303 | |||
| 1461 | Ga0163162_10170787 | |||
| 1462 | Ga0163162_10234754 | |||
| 1463 | Ga0157372_10000494 | |||
| 1464 | Ga0157372_10000535 | |||
| 1465 | Ga0157372_10002089 | |||
| 1466 | Ga0157372_10018796 | |||
| 1467 | Ga0157372_10028256 | |||
| 1468 | Ga0157372_10040251 | |||
| 1469 | Ga0157372_10051209 | |||
| 1470 | Ga0157372_10060015 | |||
| 1471 | Ga0157372_10074861 | |||
| 1472 | Ga0157372_10102209 | |||
| 1473 | Ga0157372_10103417 | |||
| 1474 | Ga0157372_10113493 | |||
| 1475 | Ga0157372_10180826 | |||
| 1476 | Ga0157372_10201609 | |||
| 1477 | Ga0157372_10317550 | |||
| 1478 | Ga0157375_10000754 | |||
| 1479 | Ga0157375_10062733 | |||
| 1480 | Ga0157375_10106071 | |||
| 1481 | Ga0157375_10227876 | |||
| 1482 | Ga0163163_10001404 | |||
| 1483 | Ga0163163_10002372 | |||
| 1484 | Ga0163163_10011499 | |||
| 1485 | Ga0163163_10014951 | |||
| 1486 | Ga0163163_10059223 | |||
| 1487 | Ga0163163_10079251 | |||
| 1488 | Ga0163163_10194588 | |||
| 1489 | Ga0157380_10000065 | |||
| 1490 | Ga0157380_10004489 | |||
| 1491 | Ga0157380_10004871 | |||
| 1492 | Ga0157380_10008145 | |||
| 1493 | Ga0157380_10059197 | |||
| 1494 | Ga0157380_10082005 | |||
| 1495 | Ga0157380_10117460 | |||
| 1496 | Ga0157377_10001833 | |||
| 1497 | Ga0157377_10005286 | |||
| 1498 | Ga0157377_10007983 | |||
| 1499 | Ga0157377_10018633 | |||
| 1500 | Ga0157377_10078099 | |||
| 1501 | Ga0157379_10012636 | |||
| 1502 | Ga0157379_10013980 | |||
| 1503 | Ga0157379_10030553 | |||
| 1504 | Ga0157379_10040673 | |||
| 1505 | Ga0157376_10003097 | |||
| 1506 | Ga0157376_10003487 | |||
| 1507 | Ga0157376_10006460 | |||
| 1508 | Ga0157376_10008586 | |||
| 1509 | Ga0157376_10009241 | |||
| 1510 | Ga0157376_10019752 | |||
| 1511 | Ga0157376_10034923 | |||
| 1512 | Ga0157376_10084377 | |||
| 1513 | Ga0182005_1000040 | |||
| 1514 | Ga0163161_10002671 | |||
| 1515 | Ga0197907_10001091 | |||
| 1516 | Ga0206356_11044593 | |||
| 1517 | Ga0206356_11188758 | |||
| 1518 | Ga0206349_1124235 | |||
| 1519 | Ga0206349_1476759 | |||
| 1520 | Ga0206355_1306531 | |||
| 1521 | Ga0206352_10358918 | |||
| 1522 | Ga0206350_10994793 | |||
| 1523 | Ga0206354_10690293 | |||
| 1524 | Ga0206353_11975280 | |||
| 1525 | Ga0213876_10001135 | |||
| 1526 | Ga0213876_10008319 | |||
| 1527 | Ga0224712_10032821 | |||
| 1528 | Ga0224712_10051383 | |||
| 1529 | Ga0256720_152123 | |||
| 1530 | Ga0247524_101506 | |||
| 1531 | Ga0247519_101388 | |||
| 1532 | Ga0247521_101613 | |||
| 1533 | Ga0247526_102217 | |||
| 1534 | Ga0247529_101655 | |||
| 1535 | Ga0247518_102078 | |||
| 1536 | Ga0247516_103277 | |||
| 1537 | Ga0247530_100778 | |||
| 1538 | Ga0247515_102482 | |||
| 1539 | Ga0247527_101226 | |||
| 1540 | Ga0247531_102163 | |||
| 1541 | Ga0247525_101521 | |||
| 1542 | Ga0247528_100975 | |||
| 1543 | Ga0247513_101520 | |||
| 1544 | Ga0247523_101818 | |||
| 1545 | Ga0247520_101842 | |||
| 1546 | Ga0247522_101379 | |||
| 1547 | Ga0247517_102772 | |||
| 1548 | Ga0247512_102652 | |||
| 1549 | Ga0209436_100835 | |||
| 1550 | Ga0209258_100075 | |||
| 1551 | Ga0209646_1000025 | |||
| 1552 | Ga0209026_1000312 | |||
| 1553 | Ga0209148_1000085 | |||
| 1554 | Ga0209673_1000197 | |||
| 1555 | Ga0209130_1000540 | |||
| 1556 | Ga0209564_1002016 | |||
| 1557 | Ga0209564_1006989 | |||
| 1558 | Ga0209758_1013571 | |||
| 1559 | Ga0209758_1026448 | |||
| 1560 | Ga0209050_1000204 | |||
| 1561 | Ga0207426_1000019 | |||
| 1562 | Ga0207426_1000057 | |||
| 1563 | Ga0207426_1000332 | |||
| 1564 | Ga0207426_1004122 | |||
| 1565 | Ga0209257_1000004 | |||
| 1566 | Ga0207656_10000242 | |||
| 1567 | Ga0207656_10001795 | |||
| 1568 | Ga0207682_10010567 | |||
| 1569 | Ga0207710_10018469 | |||
| 1570 | Ga0207710_10042150 | |||
| 1571 | Ga0207688_10050268 | |||
| 1572 | Ga0207680_10000016 | |||
| 1573 | Ga0207680_10005281 | |||
| 1574 | Ga0207680_10006952 | |||
| 1575 | Ga0207680_10141803 | |||
| 1576 | Ga0207647_10010657 | |||
| 1577 | Ga0207647_10011240 | |||
| 1578 | Ga0207647_10028854 | |||
| 1579 | Ga0207645_10000245 | |||
| 1580 | Ga0207645_10014460 | |||
| 1581 | Ga0207645_10014729 | |||
| 1582 | Ga0207645_10022723 | |||
| 1583 | Ga0207643_10006102 | |||
| 1584 | Ga0207643_10010745 | |||
| 1585 | Ga0207705_10004089 | |||
| 1586 | Ga0207705_10028047 | |||
| 1587 | Ga0207705_10084391 | |||
| 1588 | Ga0207705_10094177 | |||
| 1589 | Ga0207654_10000299 | |||
| 1590 | Ga0207654_10002562 | |||
| 1591 | Ga0207654_10090731 | |||
| 1592 | Ga0207707_10000121 | |||
| 1593 | Ga0207707_10106885 | |||
| 1594 | Ga0207707_10245673 | |||
| 1595 | Ga0207695_10000057 | |||
| 1596 | Ga0207695_10000217 | |||
| 1597 | Ga0207695_10000266 | |||
| 1598 | Ga0207695_10000568 | |||
| 1599 | Ga0207695_10001216 | |||
| 1600 | Ga0207695_10009606 | |||
| 1601 | Ga0207695_10016181 | |||
| 1602 | Ga0207695_10018698 | |||
| 1603 | Ga0207695_10248067 | |||
| 1604 | Ga0207671_10000725 | |||
| 1605 | Ga0207671_10002783 | |||
| 1606 | Ga0207671_10004167 | |||
| 1607 | Ga0207671_10007745 | |||
| 1608 | Ga0207671_10035098 | |||
| 1609 | Ga0207671_10094283 | |||
| 1610 | Ga0207660_10000354 | |||
| 1611 | Ga0207660_10029342 | |||
| 1612 | Ga0207657_10004379 | |||
| 1613 | Ga0207657_10006314 | |||
| 1614 | Ga0207657_10068682 | |||
| 1615 | Ga0207649_10007338 | |||
| 1616 | Ga0207652_10000160 | |||
| 1617 | Ga0207652_10000561 | |||
| 1618 | Ga0207652_10002749 | |||
| 1619 | Ga0207652_10014959 | |||
| 1620 | Ga0207652_10056382 | |||
| 1621 | Ga0207652_10056556 | |||
| 1622 | Ga0207681_10003524 | |||
| 1623 | Ga0207681_10071596 | |||
| 1624 | Ga0207681_10191661 | |||
| 1625 | Ga0207650_10000628 | |||
| 1626 | Ga0207650_10052169 | |||
| 1627 | Ga0207650_10095151 | |||
| 1628 | Ga0207659_10026830 | |||
| 1629 | Ga0207659_10036380 | |||
| 1630 | Ga0207659_10122253 | |||
| 1631 | Ga0207659_10136427 | |||
| 1632 | Ga0207687_10033514 | |||
| 1633 | Ga0207644_10006635 | |||
| 1634 | Ga0207644_10133527 | |||
| 1635 | Ga0207644_10150454 | |||
| 1636 | Ga0207690_10069216 | |||
| 1637 | Ga0207690_10086335 | |||
| 1638 | Ga0207706_10003545 | |||
| 1639 | Ga0207706_10010731 | |||
| 1640 | Ga0207706_10014210 | |||
| 1641 | Ga0207706_10063617 | |||
| 1642 | Ga0207706_10074701 | |||
| 1643 | Ga0207706_10081989 | |||
| 1644 | Ga0207686_10002107 | |||
| 1645 | Ga0207686_10012076 | |||
| 1646 | Ga0207686_10063858 | |||
| 1647 | Ga0207670_10002060 | |||
| 1648 | Ga0207670_10024082 | |||
| 1649 | Ga0207670_10136263 | |||
| 1650 | Ga0207669_10030045 | |||
| 1651 | Ga0207704_10008934 | |||
| 1652 | Ga0207704_10047774 | |||
| 1653 | Ga0207704_10098056 | |||
| 1654 | Ga0207691_10001933 | |||
| 1655 | Ga0207691_10006183 | |||
| 1656 | Ga0207691_10019082 | |||
| 1657 | Ga0207691_10026632 | |||
| 1658 | Ga0207691_10037910 | |||
| 1659 | Ga0207691_10172527 | |||
| 1660 | Ga0207689_10000681 | |||
| 1661 | Ga0207689_10000983 | |||
| 1662 | Ga0207689_10006134 | |||
| 1663 | Ga0207689_10007631 | |||
| 1664 | Ga0207661_10000620 | |||
| 1665 | Ga0207661_10016604 | |||
| 1666 | Ga0207679_10000683 | |||
| 1667 | Ga0207679_10024422 | |||
| 1668 | Ga0207679_10026675 | |||
| 1669 | Ga0207679_10055592 | |||
| 1670 | Ga0207679_10060468 | |||
| 1671 | Ga0207667_10000246 | |||
| 1672 | Ga0207667_10000451 | |||
| 1673 | Ga0207667_10003666 | |||
| 1674 | Ga0207667_10017632 | |||
| 1675 | Ga0207667_10023624 | |||
| 1676 | Ga0207667_10029781 | |||
| 1677 | Ga0207667_10074991 | |||
| 1678 | Ga0207667_10131553 | |||
| 1679 | Ga0207667_10135292 | |||
| 1680 | Ga0207651_10003723 | |||
| 1681 | Ga0207651_10064820 | |||
| 1682 | Ga0207651_10075940 | |||
| 1683 | Ga0207712_10003055 | |||
| 1684 | Ga0207712_10035406 | |||
| 1685 | Ga0207712_10066056 | |||
| 1686 | Ga0207668_10004760 | |||
| 1687 | Ga0207668_10020320 | |||
| 1688 | Ga0207668_10038885 | |||
| 1689 | Ga0207668_10061973 | |||
| 1690 | Ga0207658_10005434 | |||
| 1691 | Ga0207658_10007307 | |||
| 1692 | Ga0207658_10065977 | |||
| 1693 | Ga0207658_10078329 | |||
| 1694 | Ga0207658_10090080 | |||
| 1695 | Ga0207658_10100505 | |||
| 1696 | Ga0207658_10166092 | |||
| 1697 | Ga0207677_10003111 | |||
| 1698 | Ga0207677_10014532 | |||
| 1699 | Ga0207677_10070347 | |||
| 1700 | Ga0207677_10076993 | |||
| 1701 | Ga0207677_10112542 | |||
| 1702 | Ga0207677_10202766 | |||
| 1703 | Ga0207703_10177854 | |||
| 1704 | Ga0207639_10047670 | |||
| 1705 | Ga0207639_10068205 | |||
| 1706 | Ga0207639_10117019 | |||
| 1707 | Ga0207639_10168152 | |||
| 1708 | Ga0207639_10177547 | |||
| 1709 | Ga0207639_10255744 | |||
| 1710 | Ga0207678_10026406 | |||
| 1711 | Ga0207708_10053534 | |||
| 1712 | Ga0207702_10014507 | |||
| 1713 | Ga0207702_10018329 | |||
| 1714 | Ga0207702_10023270 | |||
| 1715 | Ga0207702_10039046 | |||
| 1716 | Ga0207702_10047717 | |||
| 1717 | Ga0207702_10190488 | |||
| 1718 | Ga0207702_10200369 | |||
| 1719 | Ga0207641_10001043 | |||
| 1720 | Ga0207641_10007146 | |||
| 1721 | Ga0207641_10028096 | |||
| 1722 | Ga0207641_10158191 | |||
| 1723 | Ga0207648_10004405 | |||
| 1724 | Ga0207648_10004983 | |||
| 1725 | Ga0207648_10019657 | |||
| 1726 | Ga0207648_10020128 | |||
| 1727 | Ga0207648_10030590 | |||
| 1728 | Ga0207648_10032678 | |||
| 1729 | Ga0207648_10051997 | |||
| 1730 | Ga0207648_10122781 | |||
| 1731 | Ga0207648_10190187 | |||
| 1732 | Ga0207648_10201176 | |||
| 1733 | Ga0207676_10007718 | |||
| 1734 | Ga0207676_10016235 | |||
| 1735 | Ga0207676_10063144 | |||
| 1736 | Ga0207676_10076483 | |||
| 1737 | Ga0207676_10095372 | |||
| 1738 | Ga0207674_10004668 | |||
| 1739 | Ga0207674_10006324 | |||
| 1740 | Ga0207674_10021677 | |||
| 1741 | Ga0207674_10026972 | |||
| 1742 | Ga0207674_10029266 | |||
| 1743 | Ga0207674_10045517 | |||
| 1744 | Ga0207674_10080436 | |||
| 1745 | Ga0207674_10123916 | |||
| 1746 | Ga0207675_100001355 | |||
| 1747 | Ga0207675_100002256 | |||
| 1748 | Ga0207675_100279405 | |||
| 1749 | Ga0207683_10001367 | |||
| 1750 | Ga0207683_10011208 | |||
| 1751 | Ga0207683_10030595 | |||
| 1752 | Ga0207683_10071019 | |||
| 1753 | Ga0207683_10205954 | |||
| 1754 | Ga0207698_10001664 | |||
| 1755 | Ga0207698_10009221 | |||
| 1756 | Ga0207698_10033396 | |||
| 1757 | Ga0207698_10082831 | |||
| 1758 | Ga0207428_10035888 | |||
| 1759 | Ga0268266_10000065 | |||
| 1760 | Ga0268266_10004126 | |||
| 1761 | Ga0268266_10061568 | |||
| 1762 | Ga0268265_10082256 | |||
| 1763 | Ga0268265_10161776 | |||
| 1764 | Ga0268264_10000011 | |||
| 1765 | Ga0268264_10001194 | |||
| 1766 | Ga0268264_10009266 | |||
| 1767 | Ga0268264_10015628 | |||
| 1768 | Ga0268264_10029024 | |||
| 1769 | Ga0268264_10032221 | |||
| 1770 | Ga0268264_10220845 | |||
| 1771 | Ga0265334_10012539 | |||
| 1772 | Ga0265334_10013266 | |||
| 1773 | Ga0307517_10003653 | |||
| 1774 | Ga0307517_10081796 | |||
| 1775 | Ga0307515_10000001 | |||
| 1776 | Ga0307515_10000107 | |||
| 1777 | Ga0311001_1014117 | |||
| 1778 | Ga0311011_143046 | |||
| 1779 | Ga0311003_168779 | |||
| 1780 | Ga0307511_10000734 | |||
| 1781 | Ga0265331_10048543 | |||
| 1782 | Ga0265327_10000055 | |||
| 1783 | Ga0265327_10000837 | |||
| 1784 | Ga0265327_10002040 | |||
| 1785 | Ga0265327_10002148 | |||
| 1786 | Ga0265327_10002921 | |||
| 1787 | Ga0265327_10004316 | |||
| 1788 | Ga0265327_10021534 | |||
| 1789 | Ga0265327_10036998 | |||
| 1790 | Ga0265327_10038492 | |||
| 1791 | Ga0310116_101673 | |||
| 1792 | Ga0310117_101718 | |||
| 1793 | Ga0310107_103802 | |||
| 1794 | Ga0307508_10001362 | |||
| 1795 | Ga0310102_100379 | |||
| 1796 | Ga0310108_101564 | |||
| 1797 | Ga0310106_100790 | |||
| 1798 | Ga0310115_101550 | |||
| 1799 | Ga0310113_101709 | |||
| 1800 | Ga0310118_101225 | |||
| 1801 | Ga0310105_102040 | |||
| 1802 | Ga0310111_102280 | |||
| 1803 | Ga0310114_101717 | |||
| 1804 | Ga0310119_103144 | |||
| 1805 | Ga0310101_103167 | |||
| 1806 | Ga0316576_10112301 | |||
| 1807 | Ga0316578_10008900 | |||
| 1808 | Ga0307516_10002940 | |||
| 1809 | Ga0307516_10021081 | |||
| 1810 | Ga0316577_10016854 | |||
| 1811 | Ga0316044_101502 | |||
| 1812 | Ga0316045_103574 | |||
| 1813 | Ga0316042_103921 | |||
| 1814 | Ga0316043_103537 | |||
| 1815 | Ga0307409_100193773 | |||
| 1816 | Ga0307414_10064534 | |||
| 1817 | Ga0307414_10238559 | |||
| 1818 | Ga0316593_10004444 | |||
| 1819 | Ga0316593_10008297 | |||
| 1820 | Ga0316593_10015071 | |||
| 1821 | Ga0316593_10031435 | |||
| 1822 | Ga0307510_10006641 | |||
| 1823 | Ga0316586_1005568 | |||
| 1824 | Ga0316586_1005978 | |||
| 1825 | Ga0316588_1003075 | |||
| 1826 | Ga0316587_1006783 | |||
| 1827 | Ga0316596_1003878 | |||
| 1828 | Ga0316596_1017087 | |||
| 1829 | Ga0316574_0042011 | |||
| 1830 | Ga0373924_0023239 | |||
| 1831 | Ga0373937_0035200 | |||
| 1832 | Ga0373937_0079296 | |||
| 1833 | Ga0310112_004665 | |||
| 1834 | Ga0310109_001797 | |||
| 1835 | Ga0310109_003343 | |||
| 1836 | Ga0310110_003655 | |||
| 1837 | Ga0310110_007110 | |||
| 1838 | Ga0316584_0020865 | |||
| 1839 | Ga0316584_0078812 | |||
| 1840 | Ga0316584_0084594 | |||
| 1841 | Ga0373925_0192627 | |||
| 1842 | Ga0395899_0000025 | |||
| 1843 | Ga0395899_0004705 | |||
| 1844 | Ga0395899_0022148 | |||
| 1845 | Ga0395899_0125390 | |||
| 1846 | Ga0395900_0010127 | |||
| 1847 | Ga0395900_0024239 | |||
| 1848 | Ga0395900_0069958 | |||
| 1849 | Ga0395900_0094055 | |||
| 1850 | Ga0395900_0114073 | |||
| 1851 | Ga0395900_0122247 | |||
| 1852 | Ga0395900_0160006 | |||
| 1853 | Ga0395900_0208414 | |||
| 1854 | Ga0395898_0000738 | |||
| 1855 | Ga0395898_0024244 | |||
| 1856 | Ga0395905_0000011 | |||
| 1857 | Ga0395905_0000424 | |||
| 1858 | Ga0395905_0002077 | |||
| 1859 | Ga0395905_0058731 | |||
| 1860 | Ga0395905_0078678 | |||
| 1861 | Ga0395905_0174138 | |||
| 1862 | Ga0395901_0000701 | |||
| 1863 | Ga0395901_0002159 | |||
| 1864 | Ga0395901_0006937 | |||
| 1865 | Ga0395901_0164236 | |||
| 1866 | Ga0395901_0310372 | |||
| 1867 | Ga0400489_30943 | |||
| 1868 | Ga0400489_46343 | |||
| 1869 | Ga0436365_0527492 | |||
| 1870 | Ga0436365_0645548 | |||
| 1871 | Ga0436365_0722843 | |||
| 1872 | Ga0436365_1777169 | |||
| 1873 | Ga0451796_21607 | |||
| 1874 | Ga0451799_07084 | |||
| 1875 | Ga0451805_012004 | |||
| 1876 | Ga0451840_16749 | |||
| 1877 | Ga0451844_11196 | |||
| 1878 | Ga0451846_05625 | |||
| 1879 | Ga0451850_03754 | |||
| 1880 | Ga0451854_32005 | |||
| 1881 | Ga0451853_2490003 | |||
| 1882 | Ga0452268_04908 | |||
| 1883 | Ga0452271_09524 | |||
| 1884 | Ga0439431_0000898 | |||
| 1885 | Ga0439445_0004707 | |||
| 1886 | Ga0439449_0002063 | |||
| 1887 | Ga0439457_000194 | |||
| 1888 | Ga0439457_017921 | |||
| 1889 | Ga0439462_0003569 | |||
| 1890 | Ga0439434_0050937 | |||
| 1891 | Ga0451577_0000433 | |||
| 1892 | Ga0451577_0000651 | |||
| 1893 | Ga0451577_0001245 | |||
| 1894 | Ga0451577_0009644 | |||
| 1895 | Ga0451577_0037169 | |||
| 1896 | Ga0451577_0100917 | |||
| 1897 | Ga0451577_0102594 | |||
| 1898 | Ga0451577_0175564 | |||
| 1899 | Ga0451577_0187558 | |||
| 1900 | Ga0451577_0215014 | |||
| 1901 | Ga0451577_0216186 | |||
| 1902 | Ga0451577_0254697 | |||
| 1903 | Ga0466969_0000235 | |||
| 1904 | Ga0466972_0000129 | |||
| 1905 | Ga0466972_0017374 | |||
| 1906 | Ga0453683_0000015 | |||
| 1907 | Ga0453683_0000055 | |||
| 1908 | Ga0453683_0000370 | |||
| 1909 | Ga0453683_0005928 | |||
| 1910 | Ga0453683_0077239 | |||
| 1911 | Ga0466966_0000280 | |||
| 1912 | Ga0453684_0000288 | |||
| 1913 | Ga0453684_0000527 | |||
| 1914 | Ga0453684_0001433 | |||
| 1915 | Ga0453684_0001448 | |||
| 1916 | Ga0453684_0002895 | |||
| 1917 | Ga0453684_0011070 | |||
| 1918 | Ga0453684_0011269 | |||
| 1919 | Ga0453684_0012598 | |||
| 1920 | Ga0453684_0028890 | |||
| 1921 | Ga0453684_0050914 | |||
| 1922 | Ga0453684_0055349 | |||
| 1923 | Ga0453684_0073633 | |||
| 1924 | Ga0453684_0163183 | |||
| 1925 | Ga0453684_0169504 | |||
| 1926 | Ga0453684_0289054 | |||
| 1927 | Ga0466971_0013802 | |||
| 1928 | Ga0466970_0001553 | |||
| 1929 | Ga0466957_0000047 | |||
| 1930 | Ga0466957_0003227 | |||
| 1931 | Ga0466959_0000015 | |||
| 1932 | Ga0451576_0000003 | |||
| 1933 | Ga0451576_0000211 | |||
| 1934 | Ga0451576_0000689 | |||
| 1935 | Ga0451576_0000720 | |||
| 1936 | Ga0451576_0003461 | |||
| 1937 | Ga0451576_0007161 | |||
| 1938 | Ga0451576_0102824 | |||
| 1939 | Ga0495627_003275 | |||
| 1940 | Ga0495592_0031395 | |||
| 1941 | Ga0495638_0078741 | |||
| 1942 | Ga0495653_0059728 | |||
| 1943 | Ga0495580_0022374 | |||
| 1944 | Ga0495606_0012333 | |||
| 1945 | Ga0495618_0011353 | |||
| 1946 | Ga0495628_0021332 | |||
| 1947 | Ga0495630_0017424 | |||
| 1948 | Ga0495648_0011939 | |||
| 1949 | Ga0495640_0030887 | |||
| 1950 | Ga0495586_0073845 | |||
| 1951 | Ga0495633_0000017 | |||
| 1952 | Ga0495667_0039334 | |||
| 1953 | Ga0495668_0000191 | |||
| 1954 | Ga0495668_0000227 | |||
| 1955 | Ga0495668_0001856 | |||
| 1956 | Ga0495668_0020328 | |||
| 1957 | Ga0495611_0000021 | |||
| 1958 | Ga0495625_0026632 | |||
| 1959 | Ga0495625_0151307 | |||
| 1960 | Ga0495658_0117179 | |||
| 1961 | Ga0495613_0000219 | |||
| 1962 | Ga0495670_0039078 | |||
| 1963 | Ga0495636_0000008 | |||
| 1964 | Ga0495672_0010692 | |||
| 1965 | Ga0495672_0077034 | |||
| 1966 | Ga0495672_0084345 | |||
| 1967 | Ga0495672_0091007 | |||
| 1968 | Ga0495687_000001 | |||
| 1969 | Ga0495684_0051204 | |||
| 1970 | Ga0495686_0000094 | |||
| 1971 | Ga0495686_0000981 | |||
| 1972 | Ga0495686_0034390 | |||
| 1973 | Ga0496108_0160946 | |||
| 1974 | Ga0496109_0175023 | |||
| 1975 | Ga0496109_0180913 | |||
| 1976 | Ga0496111_0079053 | |||
| 1977 | Ga0496114_0002781 | |||
| 1978 | Ga0496121_0000010 | |||
| 1979 | Ga0496125_0113352 | |||
| 1980 | Ga0496126_0104265 | |||
| 1981 | Ga0501309_003473 | |||
| 1982 | Ga0501305_004091 | |||
| 1983 | Ga0501031_0062697 | |||
| 1984 | Ga0501032_0008278 | |||
| 1985 | Ga0501032_0033612 | |||
| 1986 | Ga0501034_0000400 | |||
| 1987 | Ga0501034_0002020 | |||
| 1988 | Ga0501034_0003274 | |||
| 1989 | Ga0501034_0018272 | |||
| 1990 | Ga0501034_0056204 | |||
| 1991 | Ga0501034_0058086 | |||
| 1992 | Ga0501034_0060026 | |||
| 1993 | Ga0501034_0317360 | |||
| 1994 | Ga0501036_0014453 | |||
| 1995 | Ga0501036_0082726 | |||
| 1996 | Ga0501036_0125704 | |||
| 1997 | Ga0501036_0145007 | |||
| 1998 | Ga0501037_0009762 | |||
| 1999 | Ga0501038_0049949 | |||
| 2000 | Ga0501038_0192564 | |||
| 2001 | Ga0501039_0029048 | |||
| 2002 | Ga0501043_0041368 | |||
| 2003 | Ga0501043_0051224 | |||
| 2004 | Ga0501043_0079529 | |||
| 2005 | Ga0501043_0083676 | |||
| 2006 | Ga0501046_0028556 | |||
| 2007 | Ga0501046_0212684 | |||
| 2008 | Ga0501047_0033258 | |||
| 2009 | Ga0501047_0051131 | |||
| 2010 | Ga0501047_0168208 | |||
| 2011 | Ga0501048_0074370 | |||
| 2012 | Ga0501070_0107975 | |||
| 2013 | Ga0501074_0012038 | |||
| 2014 | Ga0501198_001390 | |||
| 2015 | Ga0501201_000556 | |||
| 2016 | Ga0501202_013013 | |||
| 2017 | Ga0501206_000657 | |||
| 2018 | Ga0501207_000568 | |||
| 2019 | Ga0501217_001767 | |||
| 2020 | Ga0501222_002907 | |||
| 2021 | Ga0501223_001352 | |||
| 2022 | Ga0501243_001338 | |||
| 2023 | Ga0501259_001263 | |||
| 2024 | Ga0501259_004609 | |||
| 2025 | Ga0501219_000154 | |||
| 2026 | Ga0501221_001292 | |||
| 2027 | Ga0501225_0000705 | |||
| 2028 | Ga0501225_0004141 | |||
| 2029 | Ga0501225_0013263 | |||
| 2030 | Ga0501079_0140382 | |||
| 2031 | Ga0501080_0070949 | |||
| 2032 | Ga0501080_0375209 | |||
| 2033 | Ga0501241_000089 | |||
| 2034 | Ga0501266_002636 | |||
| 2035 | Ga0501283_001644 | |||
| 2036 | Ga0501035_0007882 | |||
| 2037 | Ga0501035_0034348 | |||
| 2038 | Ga0501035_0036432 | |||
| 2039 | Ga0501035_0188004 | |||
| 2040 | Ga0501035_0244238 | |||
| 2041 | Ga0501044_0009652 | |||
| 2042 | Ga0501044_0012704 | |||
| 2043 | Ga0501044_0037532 | |||
| 2044 | Ga0501044_0087996 | |||
| 2045 | Ga0501044_0181350 | |||
| 2046 | Ga0501044_0319162 | |||
| 2047 | Ga0501284_00104 | |||
| 2048 | nmdc:mga0k408_13738_c1 | |||
| 2049 | nmdc:mga05p37_3235_c1 | |||
| 2050 | nmdc:mga09592_106306_c1 | |||
| 2051 | nmdc:mga09592_1546_c1 | |||
| 2052 | nmdc:mga0qj67_14639_c1 | |||
| 2053 | nmdc:mga0qj67_45337_c1 | |||
| 2054 | nmdc:mga06r32_20657_c1 | |||
| 2055 | nmdc:mga06r32_4303_c1 | |||
| 2056 | nmdc:mga08y16_13230_c1 | |||
| 2057 | nmdc:mga0n895_93045_c2 | |||
| 2058 | Ga0500578_0000362 | |||
| 2059 | Ga0500578_0015601 | |||
| 2060 | Ga0500644_0000233 | |||
| 2061 | Ga0500581_064306 | |||
| 2062 | Ga0500646_0025164 | |||
| 2063 | Ga0500583_0000053 | |||
| 2064 | Ga0500583_0003049 | |||
| 2065 | Ga0500562_000025 | |||
| 2066 | Ga0500569_001850 | |||
| 2067 | Ga0500594_0020966 | |||
| 2068 | Ga0500607_055459 | |||
| 2069 | Ga0500642_0000960 | |||
| 2070 | Ga0500642_0013043 | |||
| 2071 | Ga0500652_003510 | |||
| 2072 | Ga0500652_053905 | |||
| 2073 | Ga0500568_0000593 | |||
| 2074 | Ga0500568_0034432 | |||
| 2075 | Ga0500588_0006338 | |||
| 2076 | Ga0500588_0038620 | |||
| 2077 | Ga0500604_0003300 | |||
| 2078 | Ga0500616_0004500 | |||
| 2079 | Ga0500616_0012441 | |||
| 2080 | Ga0500622_0000319 | |||
| 2081 | Ga0500622_0000917 | |||
| 2082 | Ga0500622_0016530 | |||
| 2083 | Ga0500636_0026955 | |||
| 2084 | Ga0500611_000061 | |||
| 2085 | Ga0501084_0010875 | |||
| 2086 | Ga0501084_0020074 | |||
| 2087 | Ga0500661_001516 | |||
| 2088 | Ga0587070_006321 | |||
| 2089 | Ga0587073_0003063 | |||
| 2090 | Ga0587077_005091 | |||
| 2091 | Ga0587080_001676 | |||
| 2092 | Ga0587080_008247 | |||
| 2093 | Ga0587082_004058 | |||
| 2094 | Ga0587083_0004724 | |||
| 2095 | Ga0587083_0010177 | |||
| 2096 | Ga0587088_007944 | |||
| 2097 | Ga0587089_003294 | |||
| 2098 | Ga0587091_004506 | |||
| 2099 | Ga0587091_009086 | |||
| 2100 | Ga0587098_001772 | |||
| 2101 | Ga0587109_010290 | |||
| 2102 | Ga0587128_003514 | |||
| 2103 | Ga0587128_004960 | |||
| 2104 | Ga0587068_004206 | |||
| 2105 | Ga0587072_003720 | |||
| 2106 | Ga0587078_002717 | |||
| 2107 | Ga0587079_005858 | |||
| 2108 | Ga0587102_002131 | |||
| 2109 | Ga0587071_003078 | |||
| 2110 | Ga0587111_0002972 | |||
| 2111 | Ga0501082_0198686 | |||
| 2112 | 2738724428 | |||
| 2113 | 2819572031 | |||
| 2114 | 2819586395 | |||
| 2115 | 2819677801 | |||
| 2116 | 2821141724 | |||
| 2117 | 2881957752 | |||
| 2118 | 2883073140 | |||
| 2119 | 2884797751 | |||
| 2120 | 2896087441 | |||
| 2121 | 2896114791 | |||
| 2122 | 2904469861 | |||
| 2123 | 2914763015 | |||
| 2124 | 2929155194 | |||
| 2125 | 2929183199 | |||
| 2126 | 2929245332 | |||
| 2127 | 2929927581 | |||
| 2128 | 2945979160 | |||
| 2129 | 2946014974 | |||
| 2130 | 8003151429 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6csc-assembly1.cif.gz_A | chicken citrate synthase complex with trifluoroacetonyl-coa and citrate | 0.9769 | 2 | 426 |
| 8gqz-assembly1.cif.gz_B | crystal structure of mitochondrial citrate synthase (cit1) from saccharomyces cerevisiae | 0.9748 | 2 | 430 |
| 2cts-assembly1.cif.gz_A-2 | crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution | 0.971 | 4 | 427 |
| 5uqs-assembly1.cif.gz_C | crystal structure of citrate synthase from sus scrofa | 0.9708 | 2 | 426 |
| 8gqz-assembly1.cif.gz_B | crystal structure of mitochondrial citrate synthase (cit1) from saccharomyces cerevisiae | 0.9704 | 2 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1al6A01 | Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 | 0.969 | 4 | 426 | 1.10.580.10 |
| af_Q8I6U7_394_509_1.10.580.10 | Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 | 0.9679 | 269 | 381 | 1.10.580.10 |
| 5cscA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 | 0.9635 | 269 | 380 | 1.10.230.10 |
| af_A4HXU4_300_422_1.10.580.10 | Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 | 0.9632 | 269 | 381 | 1.10.580.10 |
| 1cscA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 | 0.9535 | 269 | 381 | 1.10.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F8VRI6-F1-model_v4 | Citrate synthase | 0.9928 | 40 | 177 |
GO:0005739
GO:0046912 |
| AF-A0A851UWE9-F1-model_v4 | Citrate synthase | 0.9904 | 56 | 266 |
GO:0004108
GO:0005759 GO:0005975 GO:0006099 |
| AF-A0A6P1B313-F1-model_v4 | deleted | 0.9896 | 288 | 390 |
|
| AF-A0A7K6Q6C9-F1-model_v4 | Citrate synthase | 0.9895 | 77 | 266 |
GO:0004108
GO:0005759 GO:0005975 GO:0006099 |
| AF-A0A7S3FQ18-F1-model_v4 | Citrate synthase | 0.9895 | 280 | 377 |
GO:0004108
GO:0005759 GO:0005975 GO:0006099 |