F489159

General Info

Members Datasets Scaffolds Average Seq Length
1055 502 981 390

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_4042678|Ga0451853_4042678_74_1342
Length 422
Sequence MNASTSSRASSSLPDLPVFPGTASASGQPATLGVMGGGQLGRMFVHAAQRLGYFTAVLDPDPQSPAGLVSHHHIQTGYSDEKGLAELAALCAAVTTEFENVPAGALQALAASRPVAPGAAAVAIAQNRIEEKSHFTASAAESGVLAGVSCAPYAVIETEAQLRAVPADLLPGILKTARMGYDGKGQVRVKNAAELAGAWAGLKQAFCVLEKMLPLKAECSVVVARGWDGRVVSFAPQRNVHVDGILAVTQAYEGNMPAALAQRALAATHTIAHHVGYVGVLCVEFFLVDDGSADGALVVNEMAPRPHNSGHYTMDACDVSQFDLQVHAMAGLPLPQPRQHSPAIMLNLLGDVWVDAQGNSRTPDWQAVLALPGTHLHLYGKTEARAGRKMGHLNITGADVATVKATARQAAAILGLPGLEDI

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221611 Acidovorax sp. Root219 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
18 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
19 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
20 2643221652 Acidovorax sp. Root402 Isolate Unclassified
21 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
22 2643221656 Pelomonas sp. Root405 Isolate Unclassified
23 2643221658 Variovorax sp. Root411 Isolate Unclassified
24 2643221660 Methylibium sp. Root1272 Isolate Unclassified
25 2643221672 Variovorax sp. Root434 Isolate Unclassified
26 2643221683 Variovorax sp. Root473 Isolate Unclassified
27 2643221717 Acidovorax sp. Root267 Isolate Unclassified
28 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541307 Variovorax sp. GV008 Isolate Unclassified
31 2738541337 Pelomonas sp. BT06 Isolate Unclassified
32 2738543012 Acidovorax sp. CF301 Isolate Unclassified
33 2738543013 Variovorax sp. BT01 Isolate Unclassified
34 2738543019 Variovorax sp. GV040 Isolate Unclassified
35 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
36 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
37 2816332133 Acidovorax radicis 2721A Isolate Unclassified
38 2818991446 Variovorax sp. 1180 Isolate Unclassified
39 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
40 2831864461 Roseateles noduli HZ7 Isolate Nodule
41 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
42 2842677519 Variovorax sp. R-72495 Isolate Unclassified
43 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
44 2842733646 Variovorax sp. R-72446 Isolate Unclassified
45 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
46 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
47 2885198086 Variovorax sp. 679 Isolate Unclassified
48 2885211737 Variovorax sp. 553 Isolate Unclassified
49 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
50 2899924645 Variovorax sp. 369 Isolate Unclassified
51 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
52 2904456579 Variovorax sp. 2002 Isolate Unclassified
53 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
54 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
55 2928037797 Variovorax sp. 1126 Isolate Unclassified
56 2928044640 Variovorax sp. 1128 Isolate Unclassified
57 2928051484 Variovorax sp. 1133 Isolate Unclassified
58 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
59 2928070936 Variovorax gossypii 1167 Isolate Unclassified
60 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
61 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
62 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
63 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
64 2929520902 Variovorax beijingensis 502 Isolate Unclassified
65 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
66 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
67 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
68 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
69 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
70 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
71 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
72 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
73 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
74 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
75 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
82 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
83 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
84 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
85 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
86 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
87 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
88 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
89 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
90 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
91 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
92 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
93 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
94 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
95 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
96 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
97 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
98 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
99 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
100 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
101 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
102 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
103 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
104 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
113 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
114 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
115 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
116 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
117 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
121 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
122 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
123 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
124 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
125 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
126 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
127 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
130 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
131 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
132 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
135 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
136 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
137 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
144 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
145 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
148 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
149 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
152 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
153 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
154 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
155 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
156 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
159 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
160 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
161 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
162 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
165 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
166 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
167 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
168 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
176 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
177 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
180 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
181 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
182 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
183 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
184 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
185 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
189 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
190 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
191 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
192 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
193 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
194 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
195 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
196 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
197 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
198 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
199 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
200 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
201 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
202 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
203 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
204 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
205 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
206 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
212 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
213 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
214 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
217 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
218 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
225 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
227 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
230 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
283 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
287 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
293 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
294 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
295 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
296 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
297 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
298 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
299 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
300 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
301 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
302 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
303 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
304 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
305 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
306 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
307 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
308 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
309 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
310 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
313 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
314 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
317 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
318 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
321 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
322 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
323 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
325 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
326 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
327 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
328 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
336 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
337 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
338 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
339 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
340 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
341 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
342 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
343 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
344 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
345 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
346 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
347 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
348 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
349 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
350 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
351 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
352 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
353 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
354 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
355 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
356 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
357 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
358 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
359 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
360 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
361 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
362 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
363 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
364 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
365 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
366 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
367 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
368 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
369 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
370 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
371 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
372 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
373 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
374 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
375 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
376 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
377 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
378 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
379 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
380 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
381 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
382 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
383 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
384 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
385 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
386 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
387 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
390 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
391 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
392 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
393 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
394 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
395 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
396 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
397 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
398 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
399 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
400 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
401 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
402 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
403 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
404 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
405 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
406 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
407 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
414 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
415 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
416 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
417 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
418 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
419 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
420 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
433 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
434 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
435 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
436 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
437 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
438 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
439 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
440 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
441 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
448 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
449 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
459 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
460 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
461 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
462 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
463 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
464 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
465 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
466 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
473 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
481 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
482 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
485 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
486 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
487 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
488 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
497 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
498 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
499 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
500 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
501 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
502 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0.47
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.63
Nodule 0.76
Rhizoplane 2.37
Rhizosphere 54.69
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007049 3300001979 Bacteria 4606
2 JGI24740J21852_10016505 3300001979 Bacteria 2668
3 JGI24739J22299_10006314 3300001989 Bacteria 4475
4 JGI25155J39150_1000037 3300002704 Bacteria 97260
5 JGI25156J39149_1000024 3300002705 Bacteria 141748
6 JGI25156J39149_1000273 3300002705 Bacteria 35022
7 JGI25154J39366_1000043 3300002738 Bacteria 142417
8 JGI25154J39366_1001641 3300002738 Bacteria 7499
9 JGI25158J39367_1005090 3300002739 Bacteria 1942
10 JGI25157J39369_1000031 3300002741 Bacteria 141953
11 JGI25157J39369_1000141 3300002741 Bacteria 61029
12 JGI25152J39213_1007178 3300002773 Bacteria 2918
13 JGI25150J39212_1002395 3300002774 Bacteria 4697
14 JGI25150J39212_1004345 3300002774 Bacteria 3166
15 JGI25159J45721_1004996 3300002987 Bacteria 4246
16 JGI25159J45721_1007712 3300002987 Bacteria 3047
17 JGI25151J46595_10001536 3300003187 Bacteria 15422
18 JGI25151J46595_10002156 3300003187 Bacteria 12214
19 JGI25151J46595_10002752 3300003187 Bacteria 10217
20 JGI25151J46595_10011019 3300003187 Bacteria 4174
21 JGI25151J46595_10019115 3300003187 Bacteria 2920
22 JGI25153J46596_10001676 3300003215 Bacteria 13140
23 JGI25153J46596_10003840 3300003215 Bacteria 8278
24 JGI25153J46596_10016969 3300003215 Bacteria 2888
25 rootH1_10000170 3300003316 Bacteria 11868
26 rootH1_10000170 3300003323 Bacteria 3661
27 rootH1_10002432 3300003316 Bacteria 8940
28 rootH1_10043915 3300003316 Bacteria 4849
29 rootL2_10001066 3300003322 Bacteria 89444
30 rootL2_10090276 3300003322 Bacteria 6717
31 rootH1_10002491 3300003323 Bacteria 40530
32 JGI25160J50197_1000172 3300003354 Bacteria 55781
33 JGI25160J50197_1011812 3300003354 Bacteria 3068
34 JGI25161J50226_1000007 3300003374 Bacteria 256181
35 JGI25161J50226_1003544 3300003374 Bacteria 3532
36 JGI25161J50226_1005059 3300003374 Bacteria 2639
37 Ga0006562J51391_1039805 3300003578 Bacteria 9925
38 Ga0006562J51391_1039806 3300003578 Bacteria 9600
39 Ga0006562J51391_1066746 3300003578 Bacteria 3980
40 Ga0006562J51391_1066748 3300003578 Bacteria 2040
41 Ga0055539_1000219 3300003752 Bacteria 40919
42 Ga0055533_1000008 3300003756 Bacteria 575861
43 Ga0055525_1000054 3300003759 Bacteria 216523
44 Ga0055525_1001100 3300003759 Bacteria 6698
45 Ga0055535_1000271 3300003761 Bacteria 54319
46 Ga0055535_1000995 3300003761 Bacteria 18294
47 Ga0055535_1007207 3300003761 Bacteria 2149
48 Ga0055542_1000003 3300003762 Bacteria 582721
49 Ga0055529_1000321 3300003763 Bacteria 54307
50 Ga0055526_1001240 3300003771 Bacteria 18300
51 Ga0055526_1014459 3300003771 Bacteria 3245
52 Ga0055526_1015438 3300003771 Bacteria 3065
53 Ga0055526_1015538 3300003771 Bacteria 3051
54 Ga0055526_1017593 3300003771 Bacteria 2723
55 Ga0055537_1000356 3300003773 Bacteria 31055
56 Ga0055537_1001103 3300003773 Bacteria 11701
57 Ga0055537_1007183 3300003773 Bacteria 2723
58 Ga0055524_1000140 3300003775 Bacteria 85990
59 Ga0055524_1000213 3300003775 Bacteria 61225
60 Ga0055524_1000550 3300003775 Bacteria 28332
61 Ga0055524_1014230 3300003775 Bacteria 2959
62 Ga0055524_1015505 3300003775 Bacteria 2774
63 Ga0055536_1002468 3300003781 Bacteria 10386
64 Ga0055536_1006719 3300003781 Bacteria 5284
65 Ga0055536_1009794 3300003781 Bacteria 3906
66 Ga0055536_1015963 3300003781 Bacteria 2539
67 Ga0055536_1021287 3300003781 Bacteria 1972
68 Ga0055534_1000346 3300003784 Bacteria 29725
69 Ga0055534_1001067 3300003784 Bacteria 11831
70 Ga0055534_1001587 3300003784 Bacteria 8817
71 Ga0055534_1009018 3300003784 Bacteria 2204
72 Ga0055528_1000846 3300003790 Bacteria 20747
73 Ga0055528_1001593 3300003790 Bacteria 13457
74 Ga0055528_1015691 3300003790 Bacteria 2723
75 Ga0055530_10000763 3300003791 Bacteria 26793
76 Ga0055530_10003145 3300003791 Bacteria 9734
77 Ga0055530_10003770 3300003791 Bacteria 8359
78 Ga0055530_10015503 3300003791 Bacteria 2483
79 Ga0055540_1000133 3300003792 Bacteria 75104
80 Ga0055540_1000504 3300003792 Bacteria 29761
81 Ga0055540_1000765 3300003792 Bacteria 21856
82 Ga0055540_1003891 3300003792 Bacteria 7009
83 Ga0055540_1007562 3300003792 Bacteria 4069
84 Ga0055540_1007906 3300003792 Bacteria 3918
85 Ga0055540_1011179 3300003792 Bacteria 2918
86 Ga0055531_10000469 3300003794 Bacteria 37355
87 Ga0055531_10000973 3300003794 Bacteria 22864
88 Ga0055531_10002263 3300003794 Bacteria 13024
89 Ga0055531_10003310 3300003794 Bacteria 10312
90 Ga0055531_10004604 3300003794 Bacteria 8305
91 Ga0055531_10012397 3300003794 Bacteria 4014
92 Ga0055531_10018174 3300003794 Bacteria 2918
93 Ga0055531_10018180 3300003794 Bacteria 2918
94 Ga0055543_1000061 3300004625 Bacteria 98138
95 Ga0055543_1001261 3300004625 Bacteria 10444
96 Ga0055543_1005771 3300004625 Bacteria 3106
97 Ga0055543_1005778 3300004625 Bacteria 3103
98 Ga0065165_1000474 3300005262 Bacteria 62687
99 Ga0065165_1000621 3300005262 Bacteria 51523
100 Ga0065165_1005479 3300005262 Bacteria 7103
101 Ga0065165_1006179 3300005262 Bacteria 6391
102 Ga0065165_1008900 3300005262 Bacteria 4605
103 Ga0065165_1014201 3300005262 Bacteria 3106
104 Ga0070658_10008606 3300005327 Bacteria 8205
105 Ga0070658_10022214 3300005327 Bacteria 5091
106 Ga0070658_10040585 3300005327 Bacteria 3755
107 Ga0070658_10104791 3300005327 Bacteria 2340
108 Ga0070676_10019300 3300005328 Bacteria 3792
109 Ga0070676_10147765 3300005328 Bacteria 1502
110 Ga0070690_100012795 3300005330 Bacteria 4943
111 Ga0070670_100040263 3300005331 Bacteria 4019
112 Ga0070670_100061187 3300005331 Bacteria 3232
113 Ga0070670_100080010 3300005331 Unclassified 2808
114 Ga0070670_100098308 3300005331 Bacteria 2518
115 Ga0070670_100155303 3300005331 Bacteria 1981
116 Ga0070670_100199120 3300005331 Bacteria 1740
117 Ga0068869_100049108 3300005334 Bacteria 3053
118 Ga0068869_100226830 3300005334 Bacteria 1483
119 Ga0070666_10048516 3300005335 Bacteria 2853
120 Ga0070666_10095199 3300005335 Bacteria 2049
121 Ga0070680_100096268 3300005336 Bacteria 2454
122 Ga0068868_100017925 3300005338 Bacteria 5283
123 Ga0068868_100024364 3300005338 Bacteria 4592
124 Ga0068868_100055588 3300005338 Bacteria 3123
125 Ga0070660_100166540 3300005339 Bacteria 1778
126 Ga0070689_100045943 3300005340 Bacteria 3364
127 Ga0070689_100124259 3300005340 Bacteria 2064
128 Ga0070661_100018267 3300005344 Bacteria 4984
129 Ga0070661_100110471 3300005344 Bacteria 2052
130 Ga0070668_100020579 3300005347 Bacteria 4981
131 Ga0070675_100004369 3300005354 Bacteria 10783
132 Ga0070675_100089027 3300005354 Bacteria 2584
133 Ga0070675_100111069 3300005354 Bacteria 2319
134 Ga0070675_100238362 3300005354 Bacteria 1589
135 Ga0070671_100007073 3300005355 Bacteria 8988
136 Ga0070671_100017702 3300005355 Bacteria 5775
137 Ga0070671_100020190 3300005355 Bacteria 5430
138 Ga0070671_100023028 3300005355 Bacteria 5091
139 Ga0070674_100054573 3300005356 Unclassified 2764
140 Ga0070674_100085143 3300005356 Bacteria 2268
141 Ga0070673_100001467 3300005364 Bacteria 13796
142 Ga0070673_100007248 3300005364 Bacteria 7298
143 Ga0070673_100014291 3300005364 Bacteria 5522
144 Ga0070673_100020089 3300005364 Bacteria 4810
145 Ga0070659_100021184 3300005366 Bacteria 4946
146 Ga0070659_100168799 3300005366 Bacteria 1791
147 Ga0070667_100006934 3300005367 Bacteria 9413
148 Ga0070667_100180339 3300005367 Bacteria 1867
149 Ga0070667_100272942 3300005367 Bacteria 1517
150 Ga0070714_100318394 3300005435 Bacteria 1454
151 Ga0070663_100020950 3300005455 Bacteria 4338
152 Ga0070663_100188131 3300005455 Bacteria 1605
153 Ga0070678_100034556 3300005456 Bacteria 3522
154 Ga0070662_100012766 3300005457 Bacteria 5576
155 Ga0070662_100021970 3300005457 Bacteria 4362
156 Ga0070662_100051373 3300005457 Bacteria 2976
157 Ga0068867_100000245 3300005459 Bacteria 35758
158 Ga0068867_100000605 3300005459 Bacteria 23775
159 Ga0068867_100011924 3300005459 Bacteria 6141
160 Ga0068867_100021133 3300005459 Bacteria 4643
161 Ga0070706_100002995 3300005467 Bacteria 16740
162 Ga0070707_100067782 3300005468 Bacteria 3434
163 Ga0070679_100039040 3300005530 Bacteria 4720
164 Ga0070684_100199409 3300005535 Bacteria 1823
165 Ga0068853_100036201 3300005539 Bacteria 4195
166 Ga0068853_100071427 3300005539 Bacteria 3023
167 Ga0068853_100077168 3300005539 Bacteria 2910
168 Ga0070672_100002136 3300005543 Bacteria 12474
169 Ga0070672_100010450 3300005543 Bacteria 6441
170 Ga0070672_100029290 3300005543 Bacteria 4128
171 Ga0070672_100068866 3300005543 Bacteria 2808
172 Ga0070672_100117681 3300005543 Bacteria 2172
173 Ga0070665_100005540 3300005548 Bacteria 12985
174 Ga0070665_100008298 3300005548 Bacteria 10503
175 Ga0070665_100057790 3300005548 Unclassified 3889
176 Ga0070665_100291979 3300005548 Bacteria 1633
177 Ga0068855_100011340 3300005563 Bacteria 10760
178 Ga0068855_100046322 3300005563 Bacteria 5141
179 Ga0068855_100237784 3300005563 Bacteria 2036
180 Ga0068855_100412193 3300005563 Bacteria 1479
181 Ga0070664_100002435 3300005564 Bacteria 14972
182 Ga0070664_100048553 3300005564 Bacteria 3587
183 Ga0068857_100028700 3300005577 Bacteria 4909
184 Ga0068857_100031742 3300005577 Bacteria 4669
185 Ga0068857_100039422 3300005577 Bacteria 4184
186 Ga0068857_100055364 3300005577 Bacteria 3520
187 Ga0068854_100047028 3300005578 Bacteria 3074
188 Ga0068854_100101013 3300005578 Bacteria 2163
189 Ga0068854_100171813 3300005578 Bacteria 1687
190 Ga0068856_100000135 3300005614 Bacteria 74419
191 Ga0068856_100027773 3300005614 Bacteria 5521
192 Ga0068856_100399115 3300005614 Bacteria 1395
193 Ga0068852_100008014 3300005616 Bacteria 7748
194 Ga0068852_100023462 3300005616 Bacteria 4966
195 Ga0068852_100113592 3300005616 Bacteria 2467
196 Ga0068852_100286729 3300005616 Bacteria 1589
197 Ga0068864_100039478 3300005618 Bacteria 4035
198 Ga0068861_100022363 3300005719 Bacteria 4554
199 Ga0068851_10018422 3300005834 Bacteria 3362
200 Ga0068851_10065776 3300005834 Bacteria 1867
201 Ga0068863_100017699 3300005841 Bacteria 6821
202 Ga0068858_100347127 3300005842 Bacteria 1421
203 Ga0068860_100000384 3300005843 Bacteria 57893
204 Ga0068860_100097440 3300005843 Bacteria 2804
205 Ga0068860_100272194 3300005843 Bacteria 1653
206 Ga0068862_100037567 3300005844 Bacteria 4104
207 Ga0075365_10027748 3300006038 Bacteria 3605
208 Ga0075365_10100168 3300006038 Bacteria 1983
209 Ga0075368_10048762 3300006042 Bacteria 1679
210 Ga0075363_100029235 3300006048 Bacteria 2843
211 Ga0075363_100090501 3300006048 Bacteria 1683
212 Ga0075363_100139801 3300006048 Bacteria 1363
213 Ga0075364_10012964 3300006051 Bacteria 5117
214 Ga0075364_10053774 3300006051 Bacteria 2632
215 Ga0075364_10207369 3300006051 Bacteria 1329
216 Ga0075362_10001785 3300006177 Bacteria 7012
217 Ga0075362_10005324 3300006177 Bacteria 4700
218 Ga0075362_10009607 3300006177 Bacteria 3747
219 Ga0075362_10053518 3300006177 Bacteria 1812
220 Ga0075367_10159630 3300006178 Bacteria 1402
221 Ga0075369_10010982 3300006186 Bacteria 3552
222 Ga0075369_10046293 3300006186 Bacteria 1873
223 Ga0075366_10002666 3300006195 Bacteria 9199
224 Ga0075366_10011244 3300006195 Bacteria 5051
225 Ga0075366_10017453 3300006195 Bacteria 4130
226 Ga0075366_10029529 3300006195 Bacteria 3221
227 Ga0075366_10032812 3300006195 Bacteria 3057
228 Ga0075366_10042553 3300006195 Bacteria 2689
229 Ga0075366_10077926 3300006195 Bacteria 1978
230 Ga0075366_10092230 3300006195 Bacteria 1815
231 Ga0075366_10093239 3300006195 Bacteria 1805
232 Ga0097621_100140511 3300006237 Bacteria 2063
233 Ga0075370_10003469 3300006353 Bacteria 7514
234 Ga0075370_10004178 3300006353 Bacteria 6967
235 Ga0075370_10006062 3300006353 Bacteria 6058
236 Ga0075370_10011470 3300006353 Bacteria 4658
237 Ga0075370_10012670 3300006353 Bacteria 4463
238 Ga0075370_10032077 3300006353 Bacteria 2935
239 Ga0075370_10042272 3300006353 Bacteria 2575
240 Ga0075429_100000224 3300006880 Bacteria 38311
241 Ga0068865_100002745 3300006881 Bacteria 10461
242 Ga0068865_100017355 3300006881 Bacteria 4629
243 Ga0099823_1000005 3300006944 Bacteria 139631
244 Ga0079104_1000053 3300006946 Bacteria 168604
245 Ga0099826_10000959 3300006948 Bacteria 16025
246 Ga0105244_10002315 3300009036 Bacteria 14476
247 Ga0105240_10002477 3300009093 Bacteria 29680
248 Ga0105240_10009882 3300009093 Bacteria 13462
249 Ga0105240_10146487 3300009093 Bacteria 2817
250 Ga0105240_10332956 3300009093 Bacteria 1727
251 Ga0105240_10433567 3300009093 Bacteria 1474
252 Ga0105245_10026119 3300009098 Bacteria 5139
253 Ga0105245_10042445 3300009098 Bacteria 4059
254 Ga0105245_10048303 3300009098 Bacteria 3807
255 Ga0105243_10004228 3300009148 Bacteria 11379
256 Ga0105243_10006082 3300009148 Bacteria 9332
257 Ga0105243_10061212 3300009148 Bacteria 3010
258 Ga0105243_10067374 3300009148 Bacteria 2882
259 Ga0105243_10095301 3300009148 Bacteria 2459
260 Ga0105243_10138475 3300009148 Bacteria 2073
261 Ga0105243_10148545 3300009148 Bacteria 2008
262 Ga0105241_10243781 3300009174 Bacteria 1520
263 Ga0105241_10257780 3300009174 Bacteria 1481
264 Ga0105242_10016941 3300009176 Bacteria 5671
265 Ga0105248_10001355 3300009177 Bacteria 27299
266 Ga0105237_10000668 3300009545 Bacteria 47303
267 Ga0105237_10011246 3300009545 Bacteria 9474
268 Ga0105237_10028106 3300009545 Bacteria 5731
269 Ga0105237_10046071 3300009545 Bacteria 4387
270 Ga0105238_10007313 3300009551 Bacteria 11057
271 Ga0105238_10061434 3300009551 Bacteria 3760
272 Ga0105238_10106330 3300009551 Bacteria 2788
273 Ga0105238_10180384 3300009551 Bacteria 2088
274 Ga0105249_10017117 3300009553 Bacteria 6433
275 Ga0105239_10020399 3300010375 Bacteria 7311
276 Ga0105239_10021874 3300010375 Bacteria 7050
277 Ga0105239_10025029 3300010375 Bacteria 6576
278 Ga0105239_10032539 3300010375 Bacteria 5730
279 Ga0105246_10038570 3300011119 Bacteria 3214
280 Ga0105246_10119579 3300011119 Bacteria 1950
281 Ga0157317_1001054 3300012475 Bacteria 1405
282 Ga0157319_1000005 3300012497 Bacteria 372810
283 Ga0157373_10023614 3300013100 Bacteria 4456
284 Ga0157371_10118626 3300013102 Bacteria 1881
285 Ga0157370_10231461 3300013104 Bacteria 1710
286 Ga0157369_10143197 3300013105 Bacteria 2528
287 Ga0157369_10211029 3300013105 Bacteria 2035
288 Ga0157374_10183833 3300013296 Bacteria 2043
289 Ga0157378_10096431 3300013297 Bacteria 2695
290 Ga0157378_10357565 3300013297 Bacteria 1428
291 Ga0163162_10000794 3300013306 Bacteria 29387
292 Ga0163162_10001355 3300013306 Bacteria 22806
293 Ga0157372_10556056 3300013307 Bacteria 1338
294 Ga0157375_10040833 3300013308 Bacteria 4475
295 Ga0157375_10197055 3300013308 Bacteria 2169
296 Ga0163163_10096492 3300014325 Bacteria 2976
297 Ga0157380_10012894 3300014326 Bacteria 6076
298 Ga0157380_10183432 3300014326 Bacteria 1841
299 Ga0157380_10335850 3300014326 Bacteria 1407
300 Ga0182008_10004921 3300014497 Bacteria 7702
301 Ga0182008_10010747 3300014497 Bacteria 4891
302 Ga0157377_10000034 3300014745 Bacteria 117744
303 Ga0157379_10009090 3300014968 Bacteria 8659
304 Ga0157379_10073730 3300014968 Bacteria 3055
305 Ga0157379_10083761 3300014968 Bacteria 2858
306 Ga0157376_10083963 3300014969 Bacteria 2741
307 Ga0157376_10269892 3300014969 Bacteria 1598
308 Ga0182006_1001345 3300015261 Bacteria 15063
309 Ga0182006_1063506 3300015261 Bacteria 1387
310 Ga0182007_10000317 3300015262 Bacteria 30601
311 Ga0182007_10001372 3300015262 Bacteria 13100
312 Ga0183362_10004 3300015683 Bacteria 569303
313 Ga0163161_10000361 3300017792 Bacteria 38156
314 Ga0163161_10011636 3300017792 Bacteria 6108
315 Ga0163161_10096335 3300017792 Bacteria 2196
316 Ga0213872_10001003 3300021361 Bacteria 19713
317 Ga0213872_10004509 3300021361 Bacteria 7376
318 Ga0213872_10012188 3300021361 Bacteria 4053
319 Ga0213872_10017132 3300021361 Bacteria 3353
320 Ga0213876_10095098 3300021384 Bacteria 1578
321 Ga0213875_10060163 3300021388 Bacteria 1777
322 Ga0209435_100008 3300025206 Bacteria 503644
323 Ga0209674_100015 3300025226 Bacteria 697299
324 Ga0209672_101139 3300025228 Bacteria 11037
325 Ga0209563_100017 3300025230 Bacteria 796449
326 Ga0209563_100075 3300025230 Bacteria 216575
327 Ga0207427_100444 3300025231 Bacteria 22994
328 Ga0209258_100015 3300025242 Bacteria 706310
329 Ga0209258_100025 3300025242 Bacteria 534777
330 Ga0209258_100726 3300025242 Bacteria 21958
331 Ga0207425_1000570 3300025245 Bacteria 21658
332 Ga0207425_1002945 3300025245 Bacteria 5699
333 Ga0207425_1006495 3300025245 Bacteria 3192
334 Ga0207425_1007181 3300025245 Bacteria 2969
335 Ga0209646_1000079 3300025246 Bacteria 207677
336 Ga0209646_1000438 3300025246 Bacteria 22604
337 Ga0209026_1000028 3300025250 Bacteria 341399
338 Ga0209026_1000067 3300025250 Bacteria 207677
339 Ga0209677_100037 3300025253 Bacteria 286702
340 Ga0209677_100113 3300025253 Bacteria 84174
341 Ga0209677_101296 3300025253 Bacteria 11131
342 Ga0209148_1000028 3300025254 Bacteria 582773
343 Ga0209759_1000021 3300025256 Bacteria 341399
344 Ga0209759_1000056 3300025256 Bacteria 207677
345 Ga0209759_1001016 3300025256 Bacteria 18856
346 Ga0209759_1001538 3300025256 Bacteria 12653
347 Ga0209129_1000049 3300025258 Bacteria 268086
348 Ga0209129_1000158 3300025258 Bacteria 103711
349 Ga0209129_1002921 3300025258 Bacteria 7835
350 Ga0209129_1011570 3300025258 Bacteria 2096
351 Ga0209565_1000041 3300025263 Bacteria 251081
352 Ga0209565_1000259 3300025263 Bacteria 56285
353 Ga0209565_1000333 3300025263 Bacteria 42094
354 Ga0209565_1002282 3300025263 Bacteria 7077
355 Ga0209565_1004128 3300025263 Bacteria 4517
356 Ga0209565_1007247 3300025263 Bacteria 3011
357 Ga0209455_1000166 3300025272 Bacteria 113101
358 Ga0209673_1000193 3300025273 Bacteria 123134
359 Ga0209673_1000364 3300025273 Bacteria 81319
360 Ga0209673_1004816 3300025273 Bacteria 7077
361 Ga0209673_1005119 3300025273 Bacteria 6717
362 Ga0209673_1014689 3300025273 Bacteria 3020
363 Ga0209673_1021019 3300025273 Bacteria 2294
364 Ga0209673_1033619 3300025273 Bacteria 1560
365 Ga0209130_1000245 3300025284 Bacteria 68668
366 Ga0209130_1000708 3300025284 Bacteria 29740
367 Ga0209130_1001785 3300025284 Bacteria 12655
368 Ga0209130_1002505 3300025284 Bacteria 9064
369 Ga0209130_1002770 3300025284 Bacteria 8248
370 Ga0209675_1000220 3300025291 Bacteria 59335
371 Ga0209675_1000316 3300025291 Bacteria 43181
372 Ga0209675_1003708 3300025291 Bacteria 7104
373 Ga0209675_1015740 3300025291 Bacteria 2231
374 Ga0209676_1000013 3300025292 Bacteria 816080
375 Ga0209676_1000074 3300025292 Bacteria 305770
376 Ga0209676_1000209 3300025292 Bacteria 130388
377 Ga0209676_1000689 3300025292 Bacteria 47629
378 Ga0209676_1002936 3300025292 Bacteria 11131
379 Ga0209676_1006483 3300025292 Bacteria 5765
380 Ga0209676_1014369 3300025292 Bacteria 2981
381 Ga0209676_1027482 3300025292 Bacteria 1790
382 Ga0209025_1000283 3300025294 Bacteria 114855
383 Ga0209025_1001092 3300025294 Bacteria 39204
384 Ga0209025_1001101 3300025294 Bacteria 38908
385 Ga0209025_1003444 3300025294 Bacteria 14976
386 Ga0209025_1003852 3300025294 Bacteria 13624
387 Ga0209025_1022772 3300025294 Bacteria 3306
388 Ga0209025_1025542 3300025294 Bacteria 3002
389 Ga0209025_1029710 3300025294 Bacteria 2636
390 Ga0209025_1054573 3300025294 Bacteria 1555
391 Ga0209564_1000021 3300025295 Bacteria 571316
392 Ga0209564_1000282 3300025295 Bacteria 103837
393 Ga0209564_1000363 3300025295 Bacteria 84210
394 Ga0209564_1001279 3300025295 Bacteria 27663
395 Ga0209564_1001670 3300025295 Bacteria 21241
396 Ga0209564_1003353 3300025295 Bacteria 11082
397 Ga0209564_1013238 3300025295 Bacteria 3523
398 Ga0209758_1000496 3300025297 Bacteria 64085
399 Ga0209758_1000815 3300025297 Bacteria 43876
400 Ga0209758_1000910 3300025297 Bacteria 40059
401 Ga0209758_1009742 3300025297 Bacteria 5899
402 Ga0209050_1000008 3300025298 Bacteria 1144179
403 Ga0209050_1000015 3300025298 Bacteria 759102
404 Ga0209050_1000996 3300025298 Bacteria 35727
405 Ga0209050_1001406 3300025298 Bacteria 26103
406 Ga0209050_1002179 3300025298 Bacteria 17697
407 Ga0209050_1002987 3300025298 Bacteria 13163
408 Ga0209050_1006789 3300025298 Bacteria 6669
409 Ga0209256_1000003 3300025299 Bacteria 1661127
410 Ga0209256_1000045 3300025299 Bacteria 325506
411 Ga0209256_1000264 3300025299 Bacteria 92750
412 Ga0209256_1000304 3300025299 Bacteria 85971
413 Ga0209256_1000309 3300025299 Bacteria 85294
414 Ga0209256_1001207 3300025299 Bacteria 28954
415 Ga0209256_1027278 3300025299 Bacteria 1630
416 Ga0207426_1000091 3300025302 Bacteria 280561
417 Ga0207426_1000108 3300025302 Bacteria 242257
418 Ga0207426_1000130 3300025302 Bacteria 210271
419 Ga0207426_1002234 3300025302 Bacteria 12910
420 Ga0209051_1000004 3300025303 Bacteria 1155596
421 Ga0209051_1000005 3300025303 Bacteria 1142353
422 Ga0209051_1000010 3300025303 Bacteria 641298
423 Ga0209051_1000156 3300025303 Bacteria 128246
424 Ga0209051_1000306 3300025303 Bacteria 77135
425 Ga0209051_1000621 3300025303 Bacteria 40763
426 Ga0209051_1000680 3300025303 Bacteria 37836
427 Ga0209051_1001349 3300025303 Bacteria 21311
428 Ga0209051_1006701 3300025303 Bacteria 6438
429 Ga0209051_1019395 3300025303 Bacteria 2968
430 Ga0209257_1000015 3300025304 Bacteria 908141
431 Ga0209257_1000016 3300025304 Bacteria 908015
432 Ga0209257_1000026 3300025304 Bacteria 723225
433 Ga0209257_1000048 3300025304 Bacteria 455536
434 Ga0209257_1000172 3300025304 Bacteria 167434
435 Ga0209257_1000315 3300025304 Bacteria 102293
436 Ga0209257_1000981 3300025304 Bacteria 38736
437 Ga0209257_1003138 3300025304 Bacteria 14743
438 Ga0209257_1014093 3300025304 Bacteria 3473
439 Ga0209257_1016709 3300025304 Bacteria 2947
440 Ga0207697_10000321 3300025315 Bacteria 26793
441 Ga0207655_1001367 3300025728 Bacteria 22840
442 Ga0207682_10029747 3300025893 Bacteria 2185
443 Ga0207688_10001947 3300025901 Bacteria 11055
444 Ga0207645_10005998 3300025907 Bacteria 8744
445 Ga0207645_10045667 3300025907 Bacteria 2799
446 Ga0207643_10030070 3300025908 Bacteria 3022
447 Ga0207705_10019722 3300025909 Bacteria 4822
448 Ga0207705_10166511 3300025909 Bacteria 1658
449 Ga0207684_10045694 3300025910 Bacteria 3713
450 Ga0207684_10049002 3300025910 Bacteria 3584
451 Ga0207695_10004981 3300025913 Bacteria 17877
452 Ga0207695_10007014 3300025913 Bacteria 14454
453 Ga0207695_10047957 3300025913 Bacteria 4514
454 Ga0207695_10057931 3300025913 Bacteria 4023
455 Ga0207695_10124467 3300025913 Bacteria 2542
456 Ga0207671_10021969 3300025914 Bacteria 4833
457 Ga0207671_10145514 3300025914 Bacteria 1828
458 Ga0207660_10061622 3300025917 Bacteria 2700
459 Ga0207657_10017128 3300025919 Bacteria 6961
460 Ga0207657_10105000 3300025919 Bacteria 2340
461 Ga0207649_10000614 3300025920 Bacteria 24092
462 Ga0207652_10069419 3300025921 Bacteria 3059
463 Ga0207652_10076312 3300025921 Bacteria 2922
464 Ga0207681_10079142 3300025923 Bacteria 2315
465 Ga0207681_10191266 3300025923 Bacteria 1566
466 Ga0207694_10028649 3300025924 Bacteria 4246
467 Ga0207650_10054134 3300025925 Bacteria 2975
468 Ga0207650_10071989 3300025925 Bacteria 2601
469 Ga0207659_10228316 3300025926 Bacteria 1500
470 Ga0207659_10252640 3300025926 Bacteria 1431
471 Ga0207687_10009833 3300025927 Bacteria 6260
472 Ga0207687_10038401 3300025927 Bacteria 3272
473 Ga0207687_10115900 3300025927 Bacteria 1996
474 Ga0207687_10250675 3300025927 Bacteria 1407
475 Ga0207664_10029018 3300025929 Bacteria 4212
476 Ga0207644_10017792 3300025931 Bacteria 4806
477 Ga0207644_10026836 3300025931 Bacteria 3975
478 Ga0207644_10158156 3300025931 Bacteria 1759
479 Ga0207690_10009309 3300025932 Bacteria 5835
480 Ga0207690_10013071 3300025932 Bacteria 4980
481 Ga0207706_10002180 3300025933 Bacteria 19100
482 Ga0207706_10032088 3300025933 Bacteria 4677
483 Ga0207706_10173593 3300025933 Bacteria 1894
484 Ga0207686_10000960 3300025934 Bacteria 17164
485 Ga0207709_10000433 3300025935 Bacteria 39614
486 Ga0207709_10000838 3300025935 Bacteria 23593
487 Ga0207709_10001092 3300025935 Bacteria 19873
488 Ga0207709_10012723 3300025935 Bacteria 4639
489 Ga0207709_10061034 3300025935 Bacteria 2354
490 Ga0207669_10049782 3300025937 Bacteria 2500
491 Ga0207704_10023252 3300025938 Bacteria 3337
492 Ga0207665_10145960 3300025939 Bacteria 1691
493 Ga0207691_10004655 3300025940 Bacteria 13284
494 Ga0207691_10005007 3300025940 Bacteria 12778
495 Ga0207711_10146343 3300025941 Bacteria 2129
496 Ga0207689_10018687 3300025942 Bacteria 5847
497 Ga0207689_10169441 3300025942 Bacteria 1799
498 Ga0207661_10133563 3300025944 Bacteria 2129
499 Ga0207679_10000077 3300025945 Bacteria 86432
500 Ga0207679_10095392 3300025945 Bacteria 2312
501 Ga0207679_10125626 3300025945 Bacteria 2049
502 Ga0207667_10003517 3300025949 Bacteria 19368
503 Ga0207667_10040596 3300025949 Bacteria 4955
504 Ga0207667_10189447 3300025949 Bacteria 2111
505 Ga0207667_10297476 3300025949 Bacteria 1649
506 Ga0207651_10004806 3300025960 Bacteria 6875
507 Ga0207651_10078807 3300025960 Bacteria 2364
508 Ga0207651_10232572 3300025960 Bacteria 1497
509 Ga0207712_10009930 3300025961 Bacteria 6033
510 Ga0207640_10032295 3300025981 Bacteria 3245
511 Ga0207640_10133252 3300025981 Bacteria 1799
512 Ga0207658_10029648 3300025986 Bacteria 3867
513 Ga0207658_10036634 3300025986 Bacteria 3518
514 Ga0207677_10021042 3300026023 Bacteria 3977
515 Ga0207677_10028704 3300026023 Bacteria 3524
516 Ga0207703_10041044 3300026035 Bacteria 3706
517 Ga0207639_10040814 3300026041 Bacteria 3466
518 Ga0207678_10037832 3300026067 Bacteria 4196
519 Ga0207678_10052599 3300026067 Bacteria 3512
520 Ga0207678_10061958 3300026067 Bacteria 3217
521 Ga0207708_10060111 3300026075 Bacteria 2901
522 Ga0207702_10001523 3300026078 Bacteria 22929
523 Ga0207702_10024832 3300026078 Bacteria 4972
524 Ga0207702_10136882 3300026078 Bacteria 2211
525 Ga0207702_10196605 3300026078 Bacteria 1867
526 Ga0207648_10000054 3300026089 Bacteria 106684
527 Ga0207648_10002852 3300026089 Bacteria 18291
528 Ga0207648_10004823 3300026089 Bacteria 13753
529 Ga0207648_10016725 3300026089 Bacteria 6693
530 Ga0207648_10030389 3300026089 Bacteria 4785
531 Ga0207648_10149976 3300026089 Bacteria 2057
532 Ga0207676_10027619 3300026095 Bacteria 4229
533 Ga0207676_10054808 3300026095 Bacteria 3126
534 Ga0207676_10280172 3300026095 Bacteria 1513
535 Ga0207674_10005841 3300026116 Bacteria 14594
536 Ga0207674_10008175 3300026116 Bacteria 12132
537 Ga0207674_10016268 3300026116 Bacteria 8147
538 Ga0207674_10054882 3300026116 Bacteria 4054
539 Ga0207675_100025649 3300026118 Bacteria 5486
540 Ga0207675_100036742 3300026118 Bacteria 4569
541 Ga0207683_10023817 3300026121 Bacteria 5267
542 Ga0207683_10136967 3300026121 Bacteria 2204
543 Ga0207683_10296511 3300026121 Bacteria 1479
544 Ga0207698_10019411 3300026142 Bacteria 4654
545 Ga0207698_10035266 3300026142 Bacteria 3657
546 Ga0207698_10036734 3300026142 Bacteria 3600
547 Ga0207698_10050766 3300026142 Bacteria 3167
548 Ga0207698_10175478 3300026142 Bacteria 1892
549 Ga0207698_10191700 3300026142 Bacteria 1821
550 Ga0207698_10339731 3300026142 Bacteria 1414
551 Ga0209281_1000147 3300027111 Bacteria 168586
552 Ga0209389_1000295 3300027296 Bacteria 31035
553 Ga0209968_1000628 3300027526 Bacteria 5458
554 Ga0209970_1001072 3300027614 Bacteria 4837
555 Ga0209282_1000107 3300027666 Bacteria 54230
556 Ga0209966_1000117 3300027695 Bacteria 35145
557 Ga0209974_10032873 3300027876 Bacteria 1720
558 Ga0268266_10005478 3300028379 Bacteria 11822
559 Ga0268266_10030341 3300028379 Bacteria 4593
560 Ga0268266_10042256 3300028379 Unclassified 3893
561 Ga0268265_10003306 3300028380 Bacteria 11674
562 Ga0268265_10135271 3300028380 Bacteria 2055
563 Ga0268265_10181367 3300028380 Bacteria 1809
564 Ga0268264_10001034 3300028381 Bacteria 27952
565 Ga0268264_10062691 3300028381 Bacteria 3123
566 Ga0268264_10095775 3300028381 Bacteria 2569
567 Ga0265336_10000274 3300028666 Bacteria 36140
568 Ga0307517_10072069 3300028786 Bacteria 3085
569 Ga0307517_10121377 3300028786 Bacteria 1930
570 Ga0307515_10000139 3300028794 Bacteria 173074
571 Ga0307515_10004822 3300028794 Bacteria 27609
572 Ga0307515_10005936 3300028794 Bacteria 24621
573 Ga0307515_10011641 3300028794 Bacteria 16669
574 Ga0307515_10060941 3300028794 Bacteria 5367
575 Ga0307515_10081261 3300028794 Bacteria 4212
576 Ga0307515_10157352 3300028794 Bacteria 2337
577 Ga0265324_10022676 3300029957 Bacteria 2242
578 Ga0307512_10010416 3300030522 Bacteria 8867
579 Ga0307512_10044434 3300030522 Bacteria 3652
580 Ga0316177_1147685 3300030731 Bacteria 2456
581 Ga0316176_1019717 3300030732 Bacteria 5051
582 Ga0316179_1045655 3300030734 Bacteria 1476
583 Ga0316183_1086347 3300030742 Bacteria 2728
584 Ga0316182_1395773 3300030745 Bacteria 1404
585 Ga0265330_10000174 3300031235 Bacteria 49860
586 Ga0265330_10009612 3300031235 Bacteria 4589
587 Ga0265332_10000048 3300031238 Bacteria 113285
588 Ga0265328_10006713 3300031239 Bacteria 4846
589 Ga0265328_10019614 3300031239 Bacteria 2595
590 Ga0265325_10006440 3300031241 Bacteria 7119
591 Ga0265331_10022083 3300031250 Bacteria 3250
592 Ga0265327_10000080 3300031251 Bacteria 206086
593 Ga0265327_10000925 3300031251 Bacteria 42948
594 Ga0265327_10002797 3300031251 Bacteria 17626
595 Ga0265327_10011216 3300031251 Bacteria 6206
596 Ga0265316_10000176 3300031344 Bacteria 72297
597 Ga0307513_10004491 3300031456 Bacteria 18612
598 Ga0307513_10004870 3300031456 Bacteria 17818
599 Ga0307513_10005821 3300031456 Bacteria 16188
600 Ga0307513_10008739 3300031456 Bacteria 12903
601 Ga0307513_10046962 3300031456 Bacteria 4702
602 Ga0307513_10086947 3300031456 Bacteria 3202
603 Ga0307509_10000698 3300031507 Bacteria 57430
604 Ga0307509_10039083 3300031507 Bacteria 5172
605 Ga0307509_10250815 3300031507 Bacteria 1554
606 Ga0307408_100000012 3300031548 Bacteria 408153
607 Ga0307408_100031021 3300031548 Bacteria 3717
608 Ga0307408_100060389 3300031548 Bacteria 2763
609 Ga0307408_100159554 3300031548 Bacteria 1790
610 Ga0307408_100178395 3300031548 Bacteria 1701
611 Ga0307408_100229417 3300031548 Bacteria 1519
612 Ga0307508_10000504 3300031616 Bacteria 46711
613 Ga0307514_10000339 3300031649 Bacteria 111130
614 Ga0307514_10002566 3300031649 Bacteria 18663
615 Ga0307514_10003227 3300031649 Bacteria 15920
616 Ga0307514_10007369 3300031649 Bacteria 9478
617 Ga0265314_10000132 3300031711 Bacteria 113285
618 Ga0265314_10000882 3300031711 Bacteria 35754
619 Ga0307516_10001199 3300031730 Bacteria 36246
620 Ga0307516_10007072 3300031730 Bacteria 12977
621 Ga0307516_10034081 3300031730 Bacteria 5120
622 Ga0307516_10041822 3300031730 Bacteria 4551
623 Ga0307516_10133884 3300031730 Bacteria 2255
624 Ga0307516_10256683 3300031730 Bacteria 1440
625 Ga0307405_10071205 3300031731 Bacteria 2236
626 Ga0307410_10016446 3300031852 Bacteria 4413
627 Ga0307406_10020825 3300031901 Bacteria 3869
628 Ga0307406_10101144 3300031901 Bacteria 1964
629 Ga0307412_10086029 3300031911 Bacteria 2186
630 Ga0307412_10093686 3300031911 Bacteria 2107
631 Ga0307416_100018698 3300032002 Bacteria 4891
632 Ga0307416_100070883 3300032002 Bacteria 2892
633 Ga0307416_100092169 3300032002 Bacteria 2605
634 Ga0307416_100219979 3300032002 Bacteria 1820
635 Ga0307414_10035032 3300032004 Bacteria 3336
636 Ga0307414_10066493 3300032004 Bacteria 2577
637 Ga0307411_10005248 3300032005 Bacteria 6340
638 Ga0307411_10092065 3300032005 Bacteria 2119
639 Ga0316593_10018061 3300032168 Bacteria 2161
640 Ga0307507_10080161 3300033179 Bacteria 2880
641 Ga0307510_10000426 3300033180 Bacteria 40466
642 Ga0307510_10027810 3300033180 Bacteria 6469
643 Ga0307510_10033683 3300033180 Bacteria 5750
644 Ga0373939_0000047 3300035114 Bacteria 43790
645 Ga0373960_0001152 3300035121 Bacteria 5741
646 Ga0373961_0020937 3300035241 Bacteria 1734
647 Ga0373931_0000579 3300035691 Bacteria 15108
648 Ga0373931_0022811 3300035691 Bacteria 3153
649 Ga0373931_0054113 3300035691 Bacteria 2144
650 Ga0316582_0140047 3300036647 Bacteria 1630
651 Ga0395899_0008314 3300037312 Bacteria 7987
652 Ga0395899_0014983 3300037312 Bacteria 5913
653 Ga0395900_0001308 3300037418 Bacteria 30266
654 Ga0395900_0019620 3300037418 Bacteria 6893
655 Ga0395900_0036461 3300037418 Bacteria 5070
656 Ga0395900_0092989 3300037418 Bacteria 3098
657 Ga0395898_0002912 3300037466 Bacteria 19475
658 Ga0395898_0008455 3300037466 Bacteria 10879
659 Ga0395898_0013070 3300037466 Bacteria 8557
660 Ga0395898_0025264 3300037466 Bacteria 5987
661 Ga0395898_0028823 3300037466 Bacteria 5565
662 Ga0395905_0000432 3300037471 Bacteria 58505
663 Ga0395905_0000504 3300037471 Bacteria 53598
664 Ga0395905_0002540 3300037471 Bacteria 20135
665 Ga0395905_0004034 3300037471 Bacteria 15413
666 Ga0395905_0005387 3300037471 Bacteria 13076
667 Ga0395905_0011861 3300037471 Bacteria 8413
668 Ga0395905_0028947 3300037471 Bacteria 5221
669 Ga0395905_0029755 3300037471 Bacteria 5147
670 Ga0395905_0034159 3300037471 Bacteria 4774
671 Ga0395905_0038030 3300037471 Bacteria 4514
672 Ga0395905_0040851 3300037471 Bacteria 4351
673 Ga0395905_0061234 3300037471 Bacteria 3520
674 Ga0395905_0083148 3300037471 Bacteria 2999
675 Ga0395905_0128803 3300037471 Bacteria 2380
676 Ga0316581_0007161 3300037588 Bacteria 2983
677 Ga0436364_0241783 3300037853 Bacteria 3108
678 Ga0436364_1356834 3300037853 Bacteria 1508
679 Ga0395901_0006507 3300038443 Bacteria 11821
680 Ga0395901_0024911 3300038443 Bacteria 6142
681 Ga0395901_0053630 3300038443 Bacteria 4189
682 Ga0395901_0084582 3300038443 Bacteria 3315
683 Ga0395901_0359346 3300038443 Bacteria 1502
684 Ga0400483_062160 3300039062 Bacteria 34333
685 Ga0400483_158300 3300039062 Bacteria 14388
686 Ga0400483_160107 3300039062 Bacteria 13880
687 Ga0436365_0112515 3300039437 Bacteria 3551
688 Ga0436365_0287923 3300039437 Bacteria 2883
689 Ga0436365_0974771 3300039437 Bacteria 5898
690 Ga0436361_0156562 3300039447 Bacteria 6162
691 Ga0436361_0264437 3300039447 Bacteria 60444
692 Ga0436361_0272384 3300039447 Bacteria 13210
693 Ga0436361_0827051 3300039447 Bacteria 2739
694 Ga0439436_0011478 3300041404 Bacteria 2691
695 Ga0439436_0020293 3300041404 Bacteria 1980
696 Ga0439466_0018087 3300041411 Bacteria 2531
697 Ga0439465_0007667 3300041413 Bacteria 3425
698 Ga0451793_1547269 3300041452 Bacteria 2343
699 Ga0451839_1626730 3300041496 Bacteria 1658
700 Ga0451851_0584746 3300041507 Bacteria 1480
701 Ga0451853_4042678 3300041512 Bacteria 1563
702 Ga0439442_001212 3300042002 Bacteria 5132
703 Ga0439442_002138 3300042002 Bacteria 3887
704 Ga0439445_0023936 3300042004 Bacteria 1549
705 Ga0439445_0025144 3300042004 Bacteria 1518
706 Ga0439432_009856 3300042006 Bacteria 3323
707 Ga0439449_0003996 3300042007 Bacteria 5704
708 Ga0439452_006839 3300042010 Bacteria 3540
709 Ga0439462_0001911 3300042015 Bacteria 4744
710 Ga0450911_001157 3300042115 Bacteria 6505
711 Ga0450917_000309 3300042120 Bacteria 3601
712 Ga0450919_000132 3300042121 Bacteria 7624
713 Ga0450920_005304 3300042122 Bacteria 2286
714 Ga0450920_010904 3300042122 Bacteria 1688
715 Ga0450923_000606 3300042125 Bacteria 4119
716 Ga0450923_001222 3300042125 Bacteria 3316
717 Ga0450888_000258 3300042126 Bacteria 4916
718 Ga0450890_000482 3300042127 Bacteria 5846
719 Ga0450890_001454 3300042127 Bacteria 3406
720 Ga0450890_001951 3300042127 Bacteria 2915
721 Ga0450891_001653 3300042129 Bacteria 2295
722 Ga0450892_000718 3300042130 Bacteria 3697
723 Ga0450894_002761 3300042131 Bacteria 2328
724 Ga0450896_002019 3300042133 Bacteria 2584
725 Ga0450898_001291 3300042134 Bacteria 3265
726 Ga0450898_011820 3300042134 Bacteria 1435
727 Ga0450889_000025 3300042144 Bacteria 12924
728 Ga0450906_000686 3300042145 Bacteria 7259
729 Ga0450906_001537 3300042145 Bacteria 5042
730 Ga0450910_000244 3300042147 Bacteria 6237
731 Ga0450908_000233 3300042184 Bacteria 11214
732 Ga0450908_008161 3300042184 Bacteria 1964
733 Ga0450909_010803 3300042185 Bacteria 1336
734 Ga0439459_0000990 3300042438 Bacteria 4030
735 Ga0450916_005246 3300042530 Bacteria 1493
736 Ga0450918_000057 3300042531 Bacteria 22722
737 Ga0450918_004991 3300042531 Bacteria 2391
738 Ga0450893_0002098 3300042532 Bacteria 3104
739 Ga0451577_0000126 3300042876 Bacteria 168037
740 Ga0451577_0006685 3300042876 Bacteria 11445
741 Ga0451577_0018745 3300042876 Bacteria 6367
742 Ga0451577_0086850 3300042876 Bacteria 2791
743 Ga0466969_0000018 3300044656 Bacteria 102911
744 Ga0466969_0007499 3300044656 Bacteria 5800
745 Ga0466969_0024919 3300044656 Bacteria 3076
746 Ga0466972_0005104 3300044658 Bacteria 6575
747 Ga0453683_0007182 3300044673 Bacteria 7590
748 Ga0466965_0054848 3300044683 Bacteria 1982
749 Ga0466966_0014306 3300044684 Bacteria 5253
750 Ga0466966_0035444 3300044684 Bacteria 3222
751 Ga0466966_0123612 3300044684 Bacteria 1588
752 Ga0466961_0006521 3300044693 Bacteria 7416
753 Ga0466961_0046171 3300044693 Bacteria 2786
754 Ga0466961_0078138 3300044693 Bacteria 2096
755 Ga0466963_0017494 3300044694 Bacteria 4469
756 Ga0466963_0066522 3300044694 Bacteria 2417
757 Ga0466963_0089148 3300044694 Bacteria 2098
758 Ga0466964_0016300 3300044706 Bacteria 2836
759 Ga0453684_0000365 3300044712 Bacteria 186233
760 Ga0453684_0008286 3300044712 Bacteria 18722
761 Ga0453684_0026097 3300044712 Bacteria 8456
762 Ga0453684_0035441 3300044712 Bacteria 6896
763 Ga0466971_0034133 3300044719 Bacteria 2280
764 Ga0466968_0016365 3300044735 Bacteria 2952
765 Ga0466968_0043870 3300044735 Bacteria 1894
766 Ga0466970_0048635 3300044765 Bacteria 2261
767 Ga0466970_0049986 3300044765 Bacteria 2230
768 Ga0466957_0004358 3300044842 Bacteria 7868
769 Ga0466959_0009769 3300045049 Bacteria 6835
770 Ga0466959_0024616 3300045049 Bacteria 4460
771 Ga0466959_0031472 3300045049 Bacteria 3924
772 Ga0466959_0167643 3300045049 Bacteria 1541
773 Ga0451576_0000627 3300045051 Bacteria 73597
774 Ga0451576_0010718 3300045051 Bacteria 10495
775 Ga0451576_0048235 3300045051 Bacteria 4475
776 Ga0451576_0065287 3300045051 Bacteria 3790
777 Ga0451576_0073572 3300045051 Bacteria 3556
778 Ga0451576_0085485 3300045051 Bacteria 3281
779 Ga0451576_0126862 3300045051 Bacteria 2659
780 Ga0466958_0009242 3300045836 Bacteria 5487
781 Ga0495592_0000499 3300046454 Bacteria 28648
782 Ga0495590_0003163 3300046457 Bacteria 6732
783 Ga0495638_0030970 3300046460 Bacteria 3440
784 Ga0495638_0077223 3300046460 Bacteria 2028
785 Ga0495650_0009623 3300046471 Bacteria 5479
786 Ga0495650_0065547 3300046471 Bacteria 1441
787 Ga0495583_0000428 3300046506 Bacteria 63526
788 Ga0495606_0000821 3300046507 Bacteria 47099
789 Ga0495608_0066591 3300046511 Bacteria 2358
790 Ga0495610_0019230 3300046512 Bacteria 3830
791 Ga0495616_0001020 3300046513 Bacteria 20032
792 Ga0495620_0016702 3300046515 Bacteria 3677
793 Ga0495631_0000803 3300046518 Bacteria 20026
794 Ga0495632_0002352 3300046519 Bacteria 14499
795 Ga0495632_0020371 3300046519 Bacteria 3591
796 Ga0495632_0106906 3300046519 Bacteria 1316
797 Ga0495637_0002174 3300046520 Bacteria 10964
798 Ga0495643_0033985 3300046522 Bacteria 2816
799 Ga0495654_0001492 3300046530 Bacteria 16011
800 Ga0495654_0018028 3300046530 Bacteria 3703
801 Ga0495621_0009162 3300046539 Bacteria 2996
802 Ga0495621_0027194 3300046539 Bacteria 1935
803 Ga0495597_0007542 3300046542 Bacteria 5516
804 Ga0495645_0037182 3300046543 Bacteria 3548
805 Ga0495656_0001009 3300046615 Bacteria 9102
806 Ga0495668_0017953 3300046616 Bacteria 4097
807 Ga0495668_0021362 3300046616 Bacteria 3713
808 Ga0495625_0000098 3300046660 Bacteria 140987
809 Ga0495625_0000827 3300046660 Bacteria 42621
810 Ga0495625_0013529 3300046660 Bacteria 6549
811 Ga0495625_0091088 3300046660 Bacteria 2108
812 Ga0495659_0048833 3300046664 Bacteria 1535
813 Ga0495588_0053425 3300046674 Bacteria 2083
814 Ga0495647_0005177 3300046681 Bacteria 4272
815 Ga0495658_0032461 3300046683 Bacteria 2851
816 Ga0495669_0041763 3300046684 Bacteria 2038
817 Ga0495671_0006329 3300046692 Bacteria 6847
818 Ga0495649_0000380 3300046694 Bacteria 38612
819 Ga0495649_0003008 3300046694 Bacteria 11564
820 Ga0495589_0062792 3300046794 Bacteria 1822
821 Ga0495660_0026773 3300046810 Bacteria 3266
822 Ga0495674_0053355 3300047319 Bacteria 3554
823 Ga0495687_000850 3300047443 Bacteria 32575
824 Ga0495687_008280 3300047443 Bacteria 5978
825 Ga0495685_012460 3300047447 Bacteria 2881
826 Ga0495686_0023279 3300047472 Bacteria 4087
827 Ga0496100_0053208 3300048903 Bacteria 2635
828 Ga0496101_0003712 3300048904 Bacteria 9524
829 Ga0496102_0003201 3300048905 Bacteria 13884
830 Ga0496102_0040796 3300048905 Bacteria 4200
831 Ga0496103_0049276 3300048906 Bacteria 2604
832 Ga0496104_0098843 3300048907 Bacteria 2794
833 Ga0496104_0126968 3300048907 Bacteria 2449
834 Ga0496106_0025782 3300048909 Bacteria 4375
835 Ga0496108_0052454 3300048911 Bacteria 3418
836 Ga0496109_0000810 3300048912 Bacteria 26068
837 Ga0496109_0005617 3300048912 Bacteria 10495
838 Ga0496109_0045569 3300048912 Bacteria 3980
839 Ga0496109_0097926 3300048912 Bacteria 2719
840 Ga0496109_0214464 3300048912 Bacteria 1810
841 Ga0496111_0024896 3300048914 Bacteria 4221
842 Ga0496112_0009640 3300048915 Bacteria 8713
843 Ga0496113_0137469 3300048916 Bacteria 1921
844 Ga0496114_0056418 3300048917 Bacteria 3278
845 Ga0496114_0085310 3300048917 Bacteria 2675
846 Ga0496114_0301106 3300048917 Bacteria 1416
847 Ga0496115_0008890 3300048918 Bacteria 7445
848 Ga0496116_0008159 3300048919 Bacteria 9141
849 Ga0496116_0020369 3300048919 Bacteria 5039
850 Ga0496117_0000029 3300048920 Bacteria 392339
851 Ga0496117_0029813 3300048920 Bacteria 4199
852 Ga0496117_0039574 3300048920 Bacteria 3477
853 Ga0496118_0022033 3300048921 Bacteria 5586
854 Ga0496118_0026467 3300048921 Bacteria 4939
855 Ga0496121_0003335 3300048924 Bacteria 23043
856 Ga0496121_0015328 3300048924 Bacteria 8044
857 Ga0496121_0080422 3300048924 Bacteria 2583
858 Ga0496122_0069768 3300048925 Bacteria 2515
859 Ga0496122_0114005 3300048925 Bacteria 1764
860 Ga0496123_0030703 3300048926 Bacteria 3928
861 Ga0496123_0057303 3300048926 Bacteria 2537
862 Ga0496123_0155100 3300048926 Bacteria 1229
863 Ga0496123_0180729 3300048926 Bacteria 1102
864 Ga0496124_0000733 3300048927 Bacteria 53604
865 Ga0496124_0046785 3300048927 Bacteria 3703
866 Ga0496124_0056407 3300048927 Bacteria 3313
867 Ga0496124_0076165 3300048927 Bacteria 2770
868 Ga0496125_0017746 3300048928 Bacteria 6774
869 Ga0496125_0017837 3300048928 Bacteria 6754
870 Ga0496125_0046766 3300048928 Bacteria 3627
871 Ga0496125_0051955 3300048928 Bacteria 3375
872 Ga0496125_0054939 3300048928 Bacteria 3250
873 Ga0501291_003279 3300049514 Bacteria 2004
874 Ga0501292_009696 3300049515 Bacteria 1432
875 Ga0501031_0001713 3300049568 Bacteria 13770
876 Ga0501031_0029305 3300049568 Bacteria 3591
877 Ga0501034_0345305 3300049571 Bacteria 1418
878 Ga0501036_0117354 3300049572 Bacteria 2248
879 Ga0501039_0293249 3300049575 Bacteria 1279
880 Ga0501041_0084458 3300049577 Bacteria 1957
881 Ga0501043_0000058 3300049579 Bacteria 102030
882 Ga0501046_0000051 3300049580 Bacteria 133545
883 Ga0501047_0000003 3300049581 Bacteria 508375
884 Ga0501047_0016202 3300049581 Bacteria 7112
885 Ga0501047_0287546 3300049581 Bacteria 1488
886 Ga0501070_0147670 3300049586 Bacteria 1940
887 Ga0501075_0032839 3300049591 Bacteria 3859
888 Ga0501076_0079761 3300049592 Bacteria 2627
889 Ga0501076_0296899 3300049592 Bacteria 1324
890 Ga0501198_000007 3300049649 Bacteria 129700
891 Ga0501222_000005 3300049662 Bacteria 129724
892 Ga0501249_004367 3300049679 Bacteria 2872
893 Ga0501225_0024202 3300049705 Bacteria 1672
894 Ga0501229_000685 3300049706 Bacteria 3816
895 Ga0501080_0202514 3300049742 Bacteria 1822
896 Ga0501081_0099489 3300049743 Bacteria 2055
897 Ga0501083_0025871 3300049744 Bacteria 4062
898 Ga0501267_002227 3300049764 Bacteria 1725
899 Ga0501044_0004830 3300049823 Bacteria 15074
900 Ga0501045_0015123 3300049824 Bacteria 5477
901 Ga0501045_0210284 3300049824 Unclassified 1449
902 nmdc:mga03683_29128_c1 3300050489 Bacteria 2200
903 nmdc:mga03683_59943_c1 3300050489 Bacteria 1606
904 nmdc:mga03683_916_c1 3300050489 Bacteria 8502
905 nmdc:mga03n38_117193_c1 3300050490 Bacteria 1304
906 nmdc:mga03n38_21764_c1 3300050490 Bacteria 2585
907 nmdc:mga03n38_45913_c1 3300050490 Bacteria 1926
908 nmdc:mga03n38_56000_c1 3300050490 Bacteria 1778
909 nmdc:mga03n38_58155_c1 3300050490 Bacteria 1751
910 nmdc:mga03n38_70573_c1 3300050490 Bacteria 1616
911 nmdc:mga00v17_31205_c1 3300050491 Bacteria 3141
912 nmdc:mga0yw44_88132_c1 3300050492 Bacteria 1957
913 nmdc:mga0k408_103336_c1 3300050493 Bacteria 1681
914 nmdc:mga0k408_103779_c1 3300050493 Bacteria 1677
915 nmdc:mga0k408_10449_c1 3300050493 Bacteria 5018
916 nmdc:mga0k408_10776_c1 3300050493 Bacteria 4956
917 nmdc:mga0k408_134114_c1 3300050493 Bacteria 1471
918 nmdc:mga0k408_1536_c1 3300050493 Bacteria 12468
919 nmdc:mga0k408_196283_c1 3300050493 Bacteria 1205
920 nmdc:mga0k408_21153_c1 3300050493 Bacteria 3652
921 nmdc:mga0k408_35374_c1 3300050493 Bacteria 2865
922 nmdc:mga0k408_366_c1 3300050493 Bacteria 24717
923 nmdc:mga0k408_49562_c1 3300050493 Bacteria 2431
924 nmdc:mga0k408_8221_c1 3300050493 Bacteria 5592
925 nmdc:mga0k408_83171_c1 3300050493 Bacteria 1876
926 nmdc:mga0k408_87039_c1 3300050493 Bacteria 1835
927 nmdc:mga0k408_98163_c1 3300050493 Bacteria 1726
928 nmdc:mga06z11_21913_c2 3300050494 Bacteria 2652
929 nmdc:mga07m45_10234_c1 3300050496 Bacteria 4892
930 nmdc:mga07m45_29854_c1 3300050496 Bacteria 3018
931 nmdc:mga07m45_2992_c2 3300050496 Bacteria 7393
932 nmdc:mga07m45_2998_c1 3300050496 Bacteria 1502
933 nmdc:mga07m45_3088_c1 3300050496 Bacteria 7964
934 nmdc:mga07m45_3233_c1 3300050496 Bacteria 7824
935 nmdc:mga07m45_4705_c1 3300050496 Bacteria 6701
936 nmdc:mga07m45_6187_c1 3300050496 Bacteria 6038
937 nmdc:mga07m45_64416_c1 3300050496 Bacteria 2080
938 nmdc:mga07m45_6836_c1 3300050496 Bacteria 5800
939 nmdc:mga07m45_9468_c1 3300050496 Bacteria 5056
940 nmdc:mga09592_174_c1 3300050508 Bacteria 45665
941 nmdc:mga0sz30_35023_c1 3300050516 Bacteria 2093
942 nmdc:mga0sz30_42066_c1 3300050516 Bacteria 1922
943 Ga0500635_0000070 3300053080 Bacteria 67480
944 Ga0500578_0000417 3300053086 Bacteria 52045
945 Ga0500651_0000093 3300053093 Bacteria 55843
946 Ga0500651_0001098 3300053093 Bacteria 13378
947 Ga0500651_0065399 3300053093 Bacteria 2266
948 Ga0500566_0106332 3300053094 Bacteria 1531
949 Ga0500562_002046 3300053108 Bacteria 5042
950 Ga0500571_000137 3300053110 Bacteria 24800
951 Ga0500593_000471 3300053117 Bacteria 16019
952 Ga0500593_000805 3300053117 Bacteria 11731
953 Ga0500593_001574 3300053117 Bacteria 8215
954 Ga0500594_0005325 3300053118 Bacteria 2851
955 Ga0500607_004111 3300053121 Bacteria 10178
956 Ga0500608_006080 3300053122 Bacteria 4875
957 Ga0500608_010693 3300053122 Bacteria 3949
958 Ga0500642_0008356 3300053130 Bacteria 3538
959 Ga0500642_0020754 3300053130 Bacteria 2588
960 Ga0500652_001084 3300053131 Bacteria 8794
961 Ga0500652_064140 3300053131 Bacteria 1516
962 Ga0500655_000776 3300053133 Bacteria 6285
963 Ga0500658_0000827 3300053134 Bacteria 12740
964 Ga0500658_0011664 3300053134 Bacteria 3238
965 Ga0500658_0029034 3300053134 Bacteria 2149
966 Ga0500559_0000097 3300053136 Bacteria 70124
967 Ga0500559_0004744 3300053136 Bacteria 6381
968 Ga0500559_0023297 3300053136 Bacteria 2628
969 Ga0500568_0004144 3300053139 Bacteria 7832
970 Ga0500568_0004342 3300053139 Bacteria 7602
971 Ga0500568_0007402 3300053139 Bacteria 5388
972 Ga0500568_0015839 3300053139 Bacteria 3364
973 Ga0500590_064552 3300053148 Bacteria 1833
974 Ga0500622_0000198 3300053156 Bacteria 63633
975 Ga0500622_0005315 3300053156 Bacteria 7764
976 Ga0500627_0002058 3300053158 Bacteria 5820
977 Ga0500645_000259 3300053730 Bacteria 38655
978 Ga0500645_002355 3300053730 Bacteria 8513
979 Ga0500587_000676 3300053739 Bacteria 4338
980 Ga0500661_008021 3300055283 Bacteria 1946
981 Ga0466962_0003983 3300061719 Bacteria 7072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100318394 Ga0070714_1003183941 333
2 3300025929 Ga0207664_10029018 Ga0207664_100290182 333
3 3300042134 Ga0450898_011820 Ga0450898_011820_404_1423 339
4 3300035691 Ga0373931_0054113 Ga0373931_0054113_293_1375 340
5 3300037853 Ga0436364_1356834 Ga0436364_1356834_270_1385 342
6 3300046681 Ga0495647_0005177 Ga0495647_0005177_619_1701 347
7 3300049572 Ga0501036_0117354 Ga0501036_0117354_15_1064 347
8 3300025927 Ga0207687_10115900 Ga0207687_101159003 348
9 3300046543 Ga0495645_0037182 Ga0495645_0037182_2251_3459 349
10 3300048926 Ga0496123_0180729 Ga0496123_0180729_17_1090 350
11 3300042122 Ga0450920_005304 Ga0450920_005304_13_1071 351
12 iso_pu_bacteria 2786546548 2787508467 351
13 3300021388 Ga0213875_10060163 Ga0213875_100601632 352
14 3300037853 Ga0436364_0241783 Ga0436364_0241783_1724_2791 352
15 3300049586 Ga0501070_0147670 Ga0501070_0147670_782_1852 352
16 3300049744 Ga0501083_0025871 Ga0501083_0025871_1538_2608 352
17 3300039437 Ga0436365_0112515 Ga0436365_0112515_1847_3019 353
18 3300003781 Ga0055536_1002468 Ga0055536_10024686 354
19 3300005355 Ga0070671_100007073 Ga0070671_10000707310 354
20 3300025292 Ga0209676_1000689 Ga0209676_100068910 354
21 3300005327 Ga0070658_10022214 Ga0070658_100222145 355
22 3300005338 Ga0068868_100024364 Ga0068868_1000243647 355
23 3300005455 Ga0070663_100188131 Ga0070663_1001881311 355
24 3300005456 Ga0070678_100034556 Ga0070678_1000345565 355
25 3300005535 Ga0070684_100199409 Ga0070684_1001994092 355
26 3300005539 Ga0068853_100036201 Ga0068853_1000362014 355
27 3300005543 Ga0070672_100117681 Ga0070672_1001176813 355
28 3300005577 Ga0068857_100039422 Ga0068857_1000394224 355
29 3300009174 Ga0105241_10243781 Ga0105241_102437812 355
30 3300009551 Ga0105238_10106330 Ga0105238_101063305 355
31 3300010375 Ga0105239_10021874 Ga0105239_100218745 355
32 3300021384 Ga0213876_10095098 Ga0213876_100950982 355
33 3300025907 Ga0207645_10045667 Ga0207645_100456672 355
34 3300025944 Ga0207661_10133563 Ga0207661_101335633 355
35 3300026023 Ga0207677_10028704 Ga0207677_100287042 355
36 3300026041 Ga0207639_10040814 Ga0207639_100408144 355
37 3300026067 Ga0207678_10037832 Ga0207678_100378325 355
38 3300026089 Ga0207648_10030389 Ga0207648_100303894 355
39 3300026116 Ga0207674_10008175 Ga0207674_100081755 355
40 3300026121 Ga0207683_10023817 Ga0207683_100238175 355
41 3300026142 Ga0207698_10035266 Ga0207698_100352665 355
42 3300035691 Ga0373931_0022811 Ga0373931_0022811_1116_2201 355
43 3300039062 Ga0400483_062160 Ga0400483_062160_6805_7881 355
44 3300039062 Ga0400483_158300 Ga0400483_158300_7380_8456 355
45 3300039437 Ga0436365_0974771 Ga0436365_0974771_624_1703 355
46 3300049571 Ga0501034_0345305 Ga0501034_0345305_330_1406 355
47 3300053130 Ga0500642_0008356 Ga0500642_0008356_2128_3204 355
48 3300053134 Ga0500658_0011664 Ga0500658_0011664_813_1889 355
49 3300053139 Ga0500568_0004144 Ga0500568_0004144_3596_4672 355
50 3300039062 Ga0400483_160107 Ga0400483_160107_4433_5512 356
51 3300039437 Ga0436365_0287923 Ga0436365_0287923_1786_2862 356
52 3300049577 Ga0501041_0084458 Ga0501041_0084458_850_1935 356
53 3300049581 Ga0501047_0287546 Ga0501047_0287546_218_1297 356
54 3300049591 Ga0501075_0032839 Ga0501075_0032839_1764_2849 356
55 3300049592 Ga0501076_0079761 Ga0501076_0079761_539_1624 356
56 3300049824 Ga0501045_0210284 Ga0501045_0210284_338_1423 356
57 3300050493 nmdc:mga0k408_196283_c1 nmdc:mga0k408_196283_c1_110_1183 356
58 3300047319 Ga0495674_0053355 Ga0495674_0053355_2134_3216 357
59 3300009174 Ga0105241_10257780 Ga0105241_102577802 359
60 3300025939 Ga0207665_10145960 Ga0207665_101459602 359
61 3300042530 Ga0450916_005246 Ga0450916_005246_312_1475 359
62 3300042532 Ga0450893_0002098 Ga0450893_0002098_562_1725 359
63 3300048916 Ga0496113_0137469 Ga0496113_0137469_18_1100 359
64 3300048917 Ga0496114_0056418 Ga0496114_0056418_760_2013 359
65 iso_pu_bacteria 2643221646 2644260990 359
66 iso_pu_bacteria 2939615513 2939615677 359
67 3300005354 Ga0070675_100238362 Ga0070675_1002383622 360
68 3300046519 Ga0495632_0106906 Ga0495632_0106906_37_1122 360
69 iso_pu_bacteria 2928519762 2928520417 360
70 3300006353 Ga0075370_10011470 Ga0075370_100114702 362
71 3300048920 Ga0496117_0000029 Ga0496117_0000029_110007_111113 362
72 3300021361 Ga0213872_10017132 Ga0213872_100171322 363
73 3300039447 Ga0436361_0827051 Ga0436361_0827051_553_1647 363
74 3300049823 Ga0501044_0004830 Ga0501044_0004830_5630_6766 363
75 3300050493 nmdc:mga0k408_103779_c1 nmdc:mga0k408_103779_c1_37_1137 363
76 3300021361 Ga0213872_10004509 Ga0213872_100045097 364
77 3300031239 Ga0265328_10006713 Ga0265328_100067134 364
78 3300031250 Ga0265331_10022083 Ga0265331_100220833 364
79 3300031251 Ga0265327_10000080 Ga0265327_1000008088 364
80 3300039447 Ga0436361_0264437 Ga0436361_0264437_55702_56865 364
81 3300050489 nmdc:mga03683_59943_c1 nmdc:mga03683_59943_c1_10_1104 364
82 iso_pu_bacteria 2881644220 2881645022 364
83 iso_pu_bacteria 3006973921 3006978298 364
84 3300048912 Ga0496109_0000810 Ga0496109_0000810_11443_12630 365
85 3300048917 Ga0496114_0085310 Ga0496114_0085310_608_1726 365
86 3300048924 Ga0496121_0015328 Ga0496121_0015328_5321_6505 365
87 3300050493 nmdc:mga0k408_103336_c1 nmdc:mga0k408_103336_c1_417_1514 365
88 3300025941 Ga0207711_10146343 Ga0207711_101463432 366
89 3300049568 Ga0501031_0029305 Ga0501031_0029305_1409_2521 366
90 3300049575 Ga0501039_0293249 Ga0501039_0293249_39_1151 366
91 3300049592 Ga0501076_0296899 Ga0501076_0296899_157_1269 366
92 3300049743 Ga0501081_0099489 Ga0501081_0099489_337_1449 366
93 iso_pu_bacteria 3001272096 3001272105 366
94 3300003316 rootH1_10002432 rootH1_100024325 367
95 3300004625 Ga0055543_1001261 Ga0055543_10012619 367
96 3300005262 Ga0065165_1000474 Ga0065165_100047424 367
97 3300048903 Ga0496100_0053208 Ga0496100_0053208_1502_2608 367
98 3300048904 Ga0496101_0003712 Ga0496101_0003712_4175_5281 367
99 3300048905 Ga0496102_0003201 Ga0496102_0003201_5320_6426 367
100 3300048906 Ga0496103_0049276 Ga0496103_0049276_196_1302 367
101 3300048907 Ga0496104_0126968 Ga0496104_0126968_1021_2127 367
102 3300048909 Ga0496106_0025782 Ga0496106_0025782_3023_4129 367
103 3300031649 Ga0307514_10000339 Ga0307514_100003398 368
104 3300042184 Ga0450908_008161 Ga0450908_008161_17_1126 368
105 3300049581 Ga0501047_0016202 Ga0501047_0016202_4018_5154 368
106 iso_pu_bacteria 3001267043 3001271207 368
107 iso_pu_bacteria 3006988479 3006992730 368
108 3300005364 Ga0070673_100020089 Ga0070673_1000200892 370
109 3300014326 Ga0157380_10335850 Ga0157380_103358501 370
110 3300050493 nmdc:mga0k408_21153_c1 nmdc:mga0k408_21153_c1_860_1999 370
111 3300005340 Ga0070689_100045943 Ga0070689_1000459433 371
112 3300006195 Ga0075366_10002666 Ga0075366_100026667 371
113 3300028379 Ga0268266_10030341 Ga0268266_100303412 371
114 3300050493 nmdc:mga0k408_1536_c1 nmdc:mga0k408_1536_c1_10791_11909 371
115 3300050496 nmdc:mga07m45_10234_c1 nmdc:mga07m45_10234_c1_3012_4130 371
116 3300005331 Ga0070670_100155303 Ga0070670_1001553032 372
117 3300005354 Ga0070675_100111069 Ga0070675_1001110692 372
118 3300005548 Ga0070665_100005540 Ga0070665_1000055408 372
119 3300005616 Ga0068852_100023462 Ga0068852_1000234625 372
120 3300005834 Ga0068851_10065776 Ga0068851_100657762 372
121 3300011119 Ga0105246_10038570 Ga0105246_100385702 372
122 3300013296 Ga0157374_10183833 Ga0157374_101838332 372
123 3300025925 Ga0207650_10071989 Ga0207650_100719892 372
124 3300025931 Ga0207644_10158156 Ga0207644_101581562 372
125 3300026067 Ga0207678_10061958 Ga0207678_100619582 372
126 3300026142 Ga0207698_10050766 Ga0207698_100507663 372
127 3300032168 Ga0316593_10018061 Ga0316593_100180612 372
128 3300036647 Ga0316582_0140047 Ga0316582_0140047_441_1577 372
129 3300037466 Ga0395898_0025264 Ga0395898_0025264_4841_5959 372
130 3300037466 Ga0395898_0028823 Ga0395898_0028823_3717_4838 372
131 3300037588 Ga0316581_0007161 Ga0316581_0007161_1518_2654 372
132 3300038443 Ga0395901_0006507 Ga0395901_0006507_4891_6012 372
133 3300046530 Ga0495654_0018028 Ga0495654_0018028_26_1144 372
134 3300048905 Ga0496102_0040796 Ga0496102_0040796_16_1137 372
135 3300048912 Ga0496109_0005617 Ga0496109_0005617_5480_6604 372
136 3300048918 Ga0496115_0008890 Ga0496115_0008890_5507_6637 372
137 3300049705 Ga0501225_0024202 Ga0501225_0024202_527_1648 372
138 3300053080 Ga0500635_0000070 Ga0500635_0000070_50682_51803 372
139 3300003792 Ga0055540_1007562 Ga0055540_10075623 373
140 3300003794 Ga0055531_10000973 Ga0055531_100009736 373
141 3300013306 Ga0163162_10001355 Ga0163162_1000135519 373
142 3300025273 Ga0209673_1021019 Ga0209673_10210192 373
143 3300025303 Ga0209051_1000306 Ga0209051_100030652 373
144 3300025304 Ga0209257_1000015 Ga0209257_1000015401 373
145 3300031507 Ga0307509_10250815 Ga0307509_102508152 373
146 3300005548 Ga0070665_100057790 Ga0070665_1000577902 374
147 3300010375 Ga0105239_10025029 Ga0105239_100250296 374
148 3300028379 Ga0268266_10042256 Ga0268266_100422564 374
149 3300053139 Ga0500568_0015839 Ga0500568_0015839_2219_3346 374
150 3300005334 Ga0068869_100049108 Ga0068869_1000491082 375
151 3300005468 Ga0070707_100067782 Ga0070707_1000677823 375
152 3300005539 Ga0068853_100071427 Ga0068853_1000714272 375
153 3300005577 Ga0068857_100031742 Ga0068857_1000317425 375
154 3300006177 Ga0075362_10005324 Ga0075362_100053242 375
155 3300006186 Ga0075369_10046293 Ga0075369_100462932 375
156 3300006353 Ga0075370_10006062 Ga0075370_100060625 375
157 3300006880 Ga0075429_100000224 Ga0075429_1000002244 375
158 3300025933 Ga0207706_10173593 Ga0207706_101735932 375
159 3300025942 Ga0207689_10018687 Ga0207689_100186873 375
160 3300025981 Ga0207640_10133252 Ga0207640_101332521 375
161 3300026116 Ga0207674_10005841 Ga0207674_100058416 375
162 3300050496 nmdc:mga07m45_4705_c1 nmdc:mga07m45_4705_c1_1799_3058 375
163 3300050508 nmdc:mga09592_174_c1 nmdc:mga09592_174_c1_3063_4265 375
164 3300005548 Ga0070665_100008298 Ga0070665_1000082982 376
165 3300035114 Ga0373939_0000047 Ga0373939_0000047_22096_23283 376
166 3300035121 Ga0373960_0001152 Ga0373960_0001152_3621_4808 376
167 3300035241 Ga0373961_0020937 Ga0373961_0020937_516_1703 376
168 3300035691 Ga0373931_0000579 Ga0373931_0000579_9815_11002 376
169 3300045051 Ga0451576_0073572 Ga0451576_0073572_2323_3459 376
170 3300048926 Ga0496123_0155100 Ga0496123_0155100_28_1173 376
171 3300005331 Ga0070670_100061187 Ga0070670_1000611874 377
172 3300005364 Ga0070673_100001467 Ga0070673_10000146710 377
173 3300005367 Ga0070667_100180339 Ga0070667_1001803392 377
174 3300013308 Ga0157375_10197055 Ga0157375_101970552 377
175 3300014325 Ga0163163_10096492 Ga0163163_100964922 377
176 3300025926 Ga0207659_10228316 Ga0207659_102283162 377
177 3300025940 Ga0207691_10005007 Ga0207691_1000500713 377
178 3300025960 Ga0207651_10232572 Ga0207651_102325722 377
179 3300025986 Ga0207658_10036634 Ga0207658_100366343 377
180 3300028379 Ga0268266_10005478 Ga0268266_100054786 377
181 iso_pu_bacteria 2831864461 2831867635 377
182 3300005328 Ga0070676_10147765 Ga0070676_101477652 378
183 3300005331 Ga0070670_100080010 Ga0070670_1000800102 378
184 3300005335 Ga0070666_10048516 Ga0070666_100485164 378
185 3300005354 Ga0070675_100004369 Ga0070675_1000043696 378
186 3300005356 Ga0070674_100054573 Ga0070674_1000545734 378
187 3300025940 Ga0207691_10004655 Ga0207691_1000465511 378
188 iso_pu_bacteria 2886848708 2886854914 378
189 3300041452 Ga0451793_1547269 Ga0451793_1547269_107_1288 379
190 iso_pu_bacteria 2643221544 2643744049 379
191 iso_pu_bacteria 2643221585 2643932478 379
192 iso_pu_bacteria 2643221639 2644219892 379
193 iso_pu_bacteria 2643221656 2644313729 379
194 iso_pu_bacteria 2738541337 2739054795 379
195 3300005335 Ga0070666_10095199 Ga0070666_100951992 380
196 3300005338 Ga0068868_100017925 Ga0068868_1000179252 380
197 3300005355 Ga0070671_100020190 Ga0070671_1000201906 380
198 3300005618 Ga0068864_100039478 Ga0068864_1000394784 380
199 3300005841 Ga0068863_100017699 Ga0068863_1000176992 380
200 3300014968 Ga0157379_10009090 Ga0157379_100090909 380
201 3300025295 Ga0209564_1000021 Ga0209564_100002145 380
202 3300026095 Ga0207676_10027619 Ga0207676_100276193 380
203 3300046616 Ga0495668_0021362 Ga0495668_0021362_1779_2927 380
204 3300053108 Ga0500562_002046 Ga0500562_002046_265_1470 380
205 3300003316 rootH1_10000170 rootH1_1000017012 381
206 3300003322 rootL2_10001066 rootL2_1000106626 381
207 3300003775 Ga0055524_1000550 Ga0055524_10005504 381
208 3300003794 Ga0055531_10003310 Ga0055531_100033108 381
209 3300005262 Ga0065165_1000621 Ga0065165_100062146 381
210 3300005331 Ga0070670_100040263 Ga0070670_1000402633 381
211 3300005338 Ga0068868_100055588 Ga0068868_1000555883 381
212 3300005347 Ga0070668_100020579 Ga0070668_1000205795 381
213 3300005354 Ga0070675_100089027 Ga0070675_1000890273 381
214 3300005355 Ga0070671_100017702 Ga0070671_1000177025 381
215 3300005356 Ga0070674_100085143 Ga0070674_1000851432 381
216 3300005364 Ga0070673_100007248 Ga0070673_1000072484 381
217 3300005457 Ga0070662_100051373 Ga0070662_1000513732 381
218 3300005459 Ga0068867_100000605 Ga0068867_1000006055 381
219 3300005459 Ga0068867_100011924 Ga0068867_1000119244 381
220 3300005543 Ga0070672_100002136 Ga0070672_1000021362 381
221 3300005616 Ga0068852_100286729 Ga0068852_1002867292 381
222 3300005719 Ga0068861_100022363 Ga0068861_1000223633 381
223 3300005842 Ga0068858_100347127 Ga0068858_1003471272 381
224 3300005843 Ga0068860_100000384 Ga0068860_10000038434 381
225 3300005844 Ga0068862_100037567 Ga0068862_1000375675 381
226 3300006195 Ga0075366_10029529 Ga0075366_100295293 381
227 3300006237 Ga0097621_100140511 Ga0097621_1001405112 381
228 3300006881 Ga0068865_100002745 Ga0068865_1000027456 381
229 3300006881 Ga0068865_100017355 Ga0068865_1000173553 381
230 3300009098 Ga0105245_10042445 Ga0105245_100424454 381
231 3300009148 Ga0105243_10095301 Ga0105243_100953012 381
232 3300009148 Ga0105243_10138475 Ga0105243_101384752 381
233 3300012475 Ga0157317_1001054 Ga0157317_10010541 381
234 3300012497 Ga0157319_1000005 Ga0157319_100000595 381
235 3300013308 Ga0157375_10040833 Ga0157375_100408335 381
236 3300025299 Ga0209256_1000309 Ga0209256_100030925 381
237 3300025304 Ga0209257_1000981 Ga0209257_10009815 381
238 3300025907 Ga0207645_10005998 Ga0207645_100059988 381
239 3300025908 Ga0207643_10030070 Ga0207643_100300704 381
240 3300025923 Ga0207681_10079142 Ga0207681_100791423 381
241 3300025925 Ga0207650_10054134 Ga0207650_100541343 381
242 3300025926 Ga0207659_10252640 Ga0207659_102526402 381
243 3300025927 Ga0207687_10250675 Ga0207687_102506752 381
244 3300025931 Ga0207644_10026836 Ga0207644_100268363 381
245 3300025933 Ga0207706_10032088 Ga0207706_100320882 381
246 3300025937 Ga0207669_10049782 Ga0207669_100497823 381
247 3300025938 Ga0207704_10023252 Ga0207704_100232523 381
248 3300025960 Ga0207651_10004806 Ga0207651_100048064 381
249 3300025961 Ga0207712_10009930 Ga0207712_100099302 381
250 3300026023 Ga0207677_10021042 Ga0207677_100210423 381
251 3300026035 Ga0207703_10041044 Ga0207703_100410444 381
252 3300026089 Ga0207648_10002852 Ga0207648_100028525 381
253 3300026089 Ga0207648_10016725 Ga0207648_100167254 381
254 3300026116 Ga0207674_10054882 Ga0207674_100548823 381
255 3300026118 Ga0207675_100036742 Ga0207675_1000367423 381
256 3300028380 Ga0268265_10003306 Ga0268265_1000330610 381
257 3300028381 Ga0268264_10001034 Ga0268264_1000103423 381
258 3300030522 Ga0307512_10044434 Ga0307512_100444343 381
259 3300031507 Ga0307509_10000698 Ga0307509_1000069830 381
260 3300033180 Ga0307510_10000426 Ga0307510_1000042619 381
261 3300033180 Ga0307510_10027810 Ga0307510_100278103 381
262 3300033180 Ga0307510_10033683 Ga0307510_100336834 381
263 3300042127 Ga0450890_000482 Ga0450890_000482_1665_2825 381
264 3300042438 Ga0439459_0000990 Ga0439459_0000990_2028_3188 381
265 3300046454 Ga0495592_0000499 Ga0495592_0000499_5191_6342 381
266 3300046471 Ga0495650_0065547 Ga0495650_0065547_183_1334 381
267 3300046512 Ga0495610_0019230 Ga0495610_0019230_471_1622 381
268 3300046515 Ga0495620_0016702 Ga0495620_0016702_1568_2719 381
269 3300048927 Ga0496124_0076165 Ga0496124_0076165_149_1309 381
270 3300050493 nmdc:mga0k408_134114_c1 nmdc:mga0k408_134114_c1_160_1353 381
271 3300050496 nmdc:mga07m45_29854_c1 nmdc:mga07m45_29854_c1_1592_2752 381
272 3300053093 Ga0500651_0065399 Ga0500651_0065399_297_1448 381
273 3300053131 Ga0500652_064140 Ga0500652_064140_198_1349 381
274 3300053136 Ga0500559_0000097 Ga0500559_0000097_62755_63906 381
275 3300053136 Ga0500559_0023297 Ga0500559_0023297_1328_2485 381
276 3300053156 Ga0500622_0005315 Ga0500622_0005315_5813_6985 381
277 iso_pu_bacteria 2643221570 2643864692 381
278 3300003215 JGI25153J46596_10001676 JGI25153J46596_1000167610 382
279 3300003316 rootH1_10043915 rootH1_100439154 382
280 3300003322 rootL2_10090276 rootL2_100902768 382
281 3300003771 Ga0055526_1001240 Ga0055526_10012406 382
282 3300003794 Ga0055531_10000469 Ga0055531_100004693 382
283 3300005331 Ga0070670_100199120 Ga0070670_1001991202 382
284 3300005364 Ga0070673_100014291 Ga0070673_1000142916 382
285 3300005543 Ga0070672_100029290 Ga0070672_1000292902 382
286 3300005563 Ga0068855_100237784 Ga0068855_1002377842 382
287 3300009098 Ga0105245_10048303 Ga0105245_100483033 382
288 3300009148 Ga0105243_10067374 Ga0105243_100673742 382
289 3300009553 Ga0105249_10017117 Ga0105249_100171176 382
290 3300014326 Ga0157380_10012894 Ga0157380_100128944 382
291 3300014968 Ga0157379_10073730 Ga0157379_100737303 382
292 3300021361 Ga0213872_10001003 Ga0213872_1000100319 382
293 3300021361 Ga0213872_10012188 Ga0213872_100121884 382
294 3300025245 Ga0207425_1000570 Ga0207425_10005704 382
295 3300025258 Ga0209129_1000158 Ga0209129_100015818 382
296 3300025295 Ga0209564_1000282 Ga0209564_100028218 382
297 3300025297 Ga0209758_1000910 Ga0209758_100091037 382
298 3300025298 Ga0209050_1002179 Ga0209050_100217918 382
299 3300025304 Ga0209257_1000016 Ga0209257_1000016148 382
300 3300025304 Ga0209257_1014093 Ga0209257_10140933 382
301 3300025909 Ga0207705_10019722 Ga0207705_100197224 382
302 3300025913 Ga0207695_10004981 Ga0207695_1000498118 382
303 3300025914 Ga0207671_10021969 Ga0207671_100219695 382
304 3300025924 Ga0207694_10028649 Ga0207694_100286495 382
305 3300025927 Ga0207687_10038401 Ga0207687_100384012 382
306 3300025935 Ga0207709_10061034 Ga0207709_100610342 382
307 3300025949 Ga0207667_10189447 Ga0207667_101894472 382
308 3300025960 Ga0207651_10078807 Ga0207651_100788072 382
309 3300026075 Ga0207708_10060111 Ga0207708_100601112 382
310 3300026078 Ga0207702_10196605 Ga0207702_101966052 382
311 3300026095 Ga0207676_10280172 Ga0207676_102801722 382
312 3300028380 Ga0268265_10181367 Ga0268265_101813672 382
313 3300028794 Ga0307515_10060941 Ga0307515_100609412 382
314 3300028794 Ga0307515_10081261 Ga0307515_100812613 382
315 3300031548 Ga0307408_100000012 Ga0307408_100000012262 382
316 3300032004 Ga0307414_10035032 Ga0307414_100350322 382
317 3300032005 Ga0307411_10005248 Ga0307411_100052482 382
318 3300037471 Ga0395905_0005387 Ga0395905_0005387_10428_11615 382
319 3300039447 Ga0436361_0156562 Ga0436361_0156562_1275_2438 382
320 3300039447 Ga0436361_0272384 Ga0436361_0272384_5452_6615 382
321 3300042120 Ga0450917_000309 Ga0450917_000309_330_1505 382
322 3300042126 Ga0450888_000258 Ga0450888_000258_1630_2805 382
323 3300042127 Ga0450890_001951 Ga0450890_001951_314_1489 382
324 3300042129 Ga0450891_001653 Ga0450891_001653_921_2096 382
325 3300042130 Ga0450892_000718 Ga0450892_000718_1145_2320 382
326 3300042144 Ga0450889_000025 Ga0450889_000025_10081_11256 382
327 3300042876 Ga0451577_0018745 Ga0451577_0018745_4270_5445 382
328 3300044712 Ga0453684_0026097 Ga0453684_0026097_2159_3316 382
329 3300045051 Ga0451576_0065287 Ga0451576_0065287_372_1535 382
330 3300045051 Ga0451576_0085485 Ga0451576_0085485_467_1642 382
331 3300047472 Ga0495686_0023279 Ga0495686_0023279_1763_2926 382
332 3300049514 Ga0501291_003279 Ga0501291_003279_206_1369 382
333 3300049649 Ga0501198_000007 Ga0501198_000007_47068_48219 382
334 3300049662 Ga0501222_000005 Ga0501222_000005_81525_82676 382
335 3300049706 Ga0501229_000685 Ga0501229_000685_1527_2690 382
336 3300049764 Ga0501267_002227 Ga0501267_002227_61_1224 382
337 3300050496 nmdc:mga07m45_9468_c1 nmdc:mga07m45_9468_c1_3811_4974 382
338 iso_pu_bacteria 2939631187 2939634697 382
339 3300003323 rootH1_10002491 rootH1_1000249119 383
340 3300003794 Ga0055531_10012397 Ga0055531_100123974 383
341 3300005614 Ga0068856_100027773 Ga0068856_1000277734 383
342 3300006195 Ga0075366_10092230 Ga0075366_100922302 383
343 3300006944 Ga0099823_1000005 Ga0099823_100000570 383
344 3300009148 Ga0105243_10148545 Ga0105243_101485452 383
345 3300025253 Ga0209677_101296 Ga0209677_10129610 383
346 3300025298 Ga0209050_1001406 Ga0209050_100140614 383
347 3300025299 Ga0209256_1001207 Ga0209256_10012074 383
348 3300025303 Ga0209051_1000621 Ga0209051_10006214 383
349 3300025304 Ga0209257_1003138 Ga0209257_100313811 383
350 3300025910 Ga0207684_10045694 Ga0207684_100456943 383
351 3300026078 Ga0207702_10024832 Ga0207702_100248324 383
352 3300026089 Ga0207648_10149976 Ga0207648_101499762 383
353 3300027296 Ga0209389_1000295 Ga0209389_100029529 383
354 3300028380 Ga0268265_10135271 Ga0268265_101352712 383
355 3300031901 Ga0307406_10101144 Ga0307406_101011442 383
356 3300037312 Ga0395899_0014983 Ga0395899_0014983_213_1367 383
357 3300038443 Ga0395901_0053630 Ga0395901_0053630_1733_2887 383
358 3300042876 Ga0451577_0086850 Ga0451577_0086850_91_1272 383
359 3300044694 Ga0466963_0089148 Ga0466963_0089148_445_1614 383
360 3300048928 Ga0496125_0017837 Ga0496125_0017837_2111_3280 383
361 3300050493 nmdc:mga0k408_8221_c1 nmdc:mga0k408_8221_c1_4236_5396 383
362 3300053117 Ga0500593_001574 Ga0500593_001574_6952_8112 383
363 iso_pu_bacteria 2547132374 2548500276 383
364 iso_pu_bacteria 2643221609 2644058399 383
365 iso_pu_bacteria 2643221611 2644073450 383
366 iso_pu_bacteria 2643221644 2644247189 383
367 iso_pu_bacteria 2643221652 2644296484 383
368 iso_pu_bacteria 2643221660 2644339818 383
369 iso_pu_bacteria 2643221717 2644647171 383
370 iso_pu_bacteria 2738543012 2739247033 383
371 iso_pu_bacteria 2816332133 2816469687 383
372 iso_pu_bacteria 2881101125 2881104357 383
373 3300002705 JGI25156J39149_1000273 JGI25156J39149_100027328 384
374 3300002738 JGI25154J39366_1001641 JGI25154J39366_10016416 384
375 3300002741 JGI25157J39369_1000141 JGI25157J39369_100014128 384
376 3300003752 Ga0055539_1000219 Ga0055539_100021937 384
377 3300003756 Ga0055533_1000008 Ga0055533_1000008155 384
378 3300003759 Ga0055525_1000054 Ga0055525_1000054116 384
379 3300003759 Ga0055525_1001100 Ga0055525_10011001 384
380 3300003761 Ga0055535_1007207 Ga0055535_10072072 384
381 3300005327 Ga0070658_10040585 Ga0070658_100405852 384
382 3300005340 Ga0070689_100124259 Ga0070689_1001242592 384
383 3300005355 Ga0070671_100023028 Ga0070671_1000230283 384
384 3300005366 Ga0070659_100168799 Ga0070659_1001687992 384
385 3300005457 Ga0070662_100021970 Ga0070662_1000219703 384
386 3300005459 Ga0068867_100000245 Ga0068867_10000024531 384
387 3300005543 Ga0070672_100010450 Ga0070672_1000104504 384
388 3300005563 Ga0068855_100046322 Ga0068855_1000463222 384
389 3300005577 Ga0068857_100028700 Ga0068857_1000287002 384
390 3300005578 Ga0068854_100047028 Ga0068854_1000470281 384
391 3300005614 Ga0068856_100000135 Ga0068856_10000013560 384
392 3300005843 Ga0068860_100272194 Ga0068860_1002721942 384
393 3300006038 Ga0075365_10027748 Ga0075365_100277483 384
394 3300006195 Ga0075366_10093239 Ga0075366_100932392 384
395 3300009148 Ga0105243_10004228 Ga0105243_1000422810 384
396 3300009177 Ga0105248_10001355 Ga0105248_1000135511 384
397 3300009545 Ga0105237_10028106 Ga0105237_100281063 384
398 3300010375 Ga0105239_10032539 Ga0105239_100325392 384
399 3300013105 Ga0157369_10211029 Ga0157369_102110292 384
400 3300013297 Ga0157378_10096431 Ga0157378_100964314 384
401 3300013306 Ga0163162_10000794 Ga0163162_1000079425 384
402 3300014745 Ga0157377_10000034 Ga0157377_100000346 384
403 3300014969 Ga0157376_10269892 Ga0157376_102698922 384
404 3300025226 Ga0209674_100015 Ga0209674_100015509 384
405 3300025230 Ga0209563_100017 Ga0209563_100017606 384
406 3300025230 Ga0209563_100075 Ga0209563_10007580 384
407 3300025231 Ga0207427_100444 Ga0207427_1004447 384
408 3300025242 Ga0209258_100726 Ga0209258_1007266 384
409 3300025246 Ga0209646_1000438 Ga0209646_100043814 384
410 3300025250 Ga0209026_1000028 Ga0209026_1000028113 384
411 3300025253 Ga0209677_100037 Ga0209677_100037106 384
412 3300025253 Ga0209677_100113 Ga0209677_10011330 384
413 3300025256 Ga0209759_1000021 Ga0209759_1000021173 384
414 3300025256 Ga0209759_1001016 Ga0209759_10010169 384
415 3300025303 Ga0209051_1006701 Ga0209051_10067013 384
416 3300025315 Ga0207697_10000321 Ga0207697_100003214 384
417 3300025901 Ga0207688_10001947 Ga0207688_100019471 384
418 3300025913 Ga0207695_10007014 Ga0207695_100070142 384
419 3300025913 Ga0207695_10047957 Ga0207695_100479573 384
420 3300025914 Ga0207671_10145514 Ga0207671_101455141 384
421 3300025931 Ga0207644_10017792 Ga0207644_100177923 384
422 3300025932 Ga0207690_10009309 Ga0207690_100093094 384
423 3300025933 Ga0207706_10002180 Ga0207706_1000218017 384
424 3300025935 Ga0207709_10000838 Ga0207709_1000083819 384
425 3300025949 Ga0207667_10003517 Ga0207667_1000351714 384
426 3300026078 Ga0207702_10001523 Ga0207702_1000152313 384
427 3300026089 Ga0207648_10000054 Ga0207648_1000005428 384
428 3300026095 Ga0207676_10054808 Ga0207676_100548083 384
429 3300026116 Ga0207674_10016268 Ga0207674_100162685 384
430 3300026142 Ga0207698_10191700 Ga0207698_101917002 384
431 3300028381 Ga0268264_10062691 Ga0268264_100626913 384
432 3300028666 Ga0265336_10000274 Ga0265336_100002749 384
433 3300028786 Ga0307517_10072069 Ga0307517_100720692 384
434 3300028794 Ga0307515_10000139 Ga0307515_10000139160 384
435 3300028794 Ga0307515_10005936 Ga0307515_1000593611 384
436 3300028794 Ga0307515_10011641 Ga0307515_1001164113 384
437 3300029957 Ga0265324_10022676 Ga0265324_100226763 384
438 3300030522 Ga0307512_10010416 Ga0307512_100104166 384
439 3300031235 Ga0265330_10009612 Ga0265330_100096124 384
440 3300031456 Ga0307513_10005821 Ga0307513_1000582112 384
441 3300031507 Ga0307509_10039083 Ga0307509_100390835 384
442 3300031548 Ga0307408_100159554 Ga0307408_1001595542 384
443 3300031616 Ga0307508_10000504 Ga0307508_1000050416 384
444 3300031649 Ga0307514_10002566 Ga0307514_1000256611 384
445 3300031711 Ga0265314_10000882 Ga0265314_100008822 384
446 3300031730 Ga0307516_10041822 Ga0307516_100418224 384
447 3300031730 Ga0307516_10133884 Ga0307516_101338842 384
448 3300032002 Ga0307416_100070883 Ga0307416_1000708832 384
449 3300032002 Ga0307416_100219979 Ga0307416_1002199791 384
450 3300033179 Ga0307507_10080161 Ga0307507_100801612 384
451 3300037418 Ga0395900_0001308 Ga0395900_0001308_6620_7813 384
452 3300037466 Ga0395898_0002912 Ga0395898_0002912_17608_18801 384
453 3300037471 Ga0395905_0029755 Ga0395905_0029755_2875_4035 384
454 3300037471 Ga0395905_0038030 Ga0395905_0038030_2129_3286 384
455 3300041496 Ga0451839_1626730 Ga0451839_1626730_295_1458 384
456 3300041507 Ga0451851_0584746 Ga0451851_0584746_99_1262 384
457 3300044658 Ga0466972_0005104 Ga0466972_0005104_335_1501 384
458 3300044673 Ga0453683_0007182 Ga0453683_0007182_712_1869 384
459 3300044684 Ga0466966_0123612 Ga0466966_0123612_369_1529 384
460 3300044693 Ga0466961_0046171 Ga0466961_0046171_249_1409 384
461 3300044694 Ga0466963_0066522 Ga0466963_0066522_831_1997 384
462 3300044706 Ga0466964_0016300 Ga0466964_0016300_852_2012 384
463 3300044712 Ga0453684_0008286 Ga0453684_0008286_9466_10626 384
464 3300044719 Ga0466971_0034133 Ga0466971_0034133_894_2054 384
465 3300044735 Ga0466968_0043870 Ga0466968_0043870_74_1234 384
466 3300045049 Ga0466959_0009769 Ga0466959_0009769_1145_2305 384
467 3300045049 Ga0466959_0031472 Ga0466959_0031472_293_1459 384
468 3300045051 Ga0451576_0010718 Ga0451576_0010718_6070_7227 384
469 3300045836 Ga0466958_0009242 Ga0466958_0009242_2264_3430 384
470 3300046471 Ga0495650_0009623 Ga0495650_0009623_4166_5326 384
471 3300046506 Ga0495583_0000428 Ga0495583_0000428_13695_14870 384
472 3300046507 Ga0495606_0000821 Ga0495606_0000821_30723_31898 384
473 3300046511 Ga0495608_0066591 Ga0495608_0066591_249_1421 384
474 3300046522 Ga0495643_0033985 Ga0495643_0033985_1187_2350 384
475 3300046660 Ga0495625_0000827 Ga0495625_0000827_6540_7703 384
476 3300046694 Ga0495649_0003008 Ga0495649_0003008_4046_5221 384
477 3300046794 Ga0495589_0062792 Ga0495589_0062792_114_1289 384
478 3300047447 Ga0495685_012460 Ga0495685_012460_1450_2616 384
479 3300048907 Ga0496104_0098843 Ga0496104_0098843_295_1479 384
480 3300048911 Ga0496108_0052454 Ga0496108_0052454_224_1384 384
481 3300048912 Ga0496109_0214464 Ga0496109_0214464_221_1405 384
482 3300048915 Ga0496112_0009640 Ga0496112_0009640_5340_6524 384
483 3300048924 Ga0496121_0003335 Ga0496121_0003335_19564_20748 384
484 3300048927 Ga0496124_0000733 Ga0496124_0000733_32782_33966 384
485 3300048928 Ga0496125_0017746 Ga0496125_0017746_3539_4723 384
486 3300049515 Ga0501292_009696 Ga0501292_009696_247_1410 384
487 3300049742 Ga0501080_0202514 Ga0501080_0202514_618_1781 384
488 3300050493 nmdc:mga0k408_35374_c1 nmdc:mga0k408_35374_c1_1019_2290 384
489 3300050493 nmdc:mga0k408_366_c1 nmdc:mga0k408_366_c1_18841_20004 384
490 3300050493 nmdc:mga0k408_83171_c1 nmdc:mga0k408_83171_c1_487_1659 384
491 3300050493 nmdc:mga0k408_98163_c1 nmdc:mga0k408_98163_c1_455_1618 384
492 3300053739 Ga0500587_000676 Ga0500587_000676_2079_3242 384
493 iso_pu_bacteria 2588253510 2588292838 384
494 iso_pu_bacteria 2643221596 2643992696 384
495 iso_pu_bacteria 2643221654 2644301004 384
496 iso_pu_bacteria 2990710928 2990715271 384
497 3300003215 JGI25153J46596_10003840 JGI25153J46596_100038406 385
498 3300005327 Ga0070658_10104791 Ga0070658_101047912 385
499 3300005330 Ga0070690_100012795 Ga0070690_1000127954 385
500 3300005344 Ga0070661_100110471 Ga0070661_1001104712 385
501 3300005455 Ga0070663_100020950 Ga0070663_1000209504 385
502 3300005457 Ga0070662_100012766 Ga0070662_1000127664 385
503 3300005467 Ga0070706_100002995 Ga0070706_1000029953 385
504 3300005614 Ga0068856_100399115 Ga0068856_1003991151 385
505 3300005616 Ga0068852_100008014 Ga0068852_1000080142 385
506 3300005616 Ga0068852_100113592 Ga0068852_1001135922 385
507 3300006042 Ga0075368_10048762 Ga0075368_100487622 385
508 3300006048 Ga0075363_100139801 Ga0075363_1001398011 385
509 3300006177 Ga0075362_10053518 Ga0075362_100535182 385
510 3300006195 Ga0075366_10032812 Ga0075366_100328122 385
511 3300006195 Ga0075366_10077926 Ga0075366_100779262 385
512 3300006353 Ga0075370_10004178 Ga0075370_100041787 385
513 3300006353 Ga0075370_10012670 Ga0075370_100126702 385
514 3300009093 Ga0105240_10009882 Ga0105240_1000988211 385
515 3300009093 Ga0105240_10332956 Ga0105240_103329562 385
516 3300009093 Ga0105240_10433567 Ga0105240_104335672 385
517 3300009098 Ga0105245_10026119 Ga0105245_100261192 385
518 3300009176 Ga0105242_10016941 Ga0105242_100169414 385
519 3300009545 Ga0105237_10000668 Ga0105237_100006687 385
520 3300009545 Ga0105237_10011246 Ga0105237_100112467 385
521 3300009551 Ga0105238_10007313 Ga0105238_1000731311 385
522 3300010375 Ga0105239_10020399 Ga0105239_100203992 385
523 3300013297 Ga0157378_10357565 Ga0157378_103575652 385
524 3300014969 Ga0157376_10083963 Ga0157376_100839632 385
525 3300025297 Ga0209758_1000815 Ga0209758_100081525 385
526 3300025893 Ga0207682_10029747 Ga0207682_100297472 385
527 3300025909 Ga0207705_10166511 Ga0207705_101665112 385
528 3300025910 Ga0207684_10049002 Ga0207684_100490023 385
529 3300025927 Ga0207687_10009833 Ga0207687_100098338 385
530 3300025934 Ga0207686_10000960 Ga0207686_1000096015 385
531 3300025981 Ga0207640_10032295 Ga0207640_100322953 385
532 3300026067 Ga0207678_10052599 Ga0207678_100525994 385
533 3300026078 Ga0207702_10136882 Ga0207702_101368822 385
534 3300026118 Ga0207675_100025649 Ga0207675_1000256493 385
535 3300026142 Ga0207698_10019411 Ga0207698_100194114 385
536 3300026142 Ga0207698_10036734 Ga0207698_100367343 385
537 3300027526 Ga0209968_1000628 Ga0209968_10006284 385
538 3300027695 Ga0209966_1000117 Ga0209966_10001172 385
539 3300027876 Ga0209974_10032873 Ga0209974_100328732 385
540 3300028786 Ga0307517_10121377 Ga0307517_101213772 385
541 3300031235 Ga0265330_10000174 Ga0265330_1000017421 385
542 3300031238 Ga0265332_10000048 Ga0265332_1000004821 385
543 3300031241 Ga0265325_10006440 Ga0265325_100064404 385
544 3300031456 Ga0307513_10046962 Ga0307513_100469622 385
545 3300031456 Ga0307513_10086947 Ga0307513_100869473 385
546 3300031711 Ga0265314_10000132 Ga0265314_1000013283 385
547 3300031730 Ga0307516_10001199 Ga0307516_100011992 385
548 3300031730 Ga0307516_10007072 Ga0307516_100070729 385
549 3300031730 Ga0307516_10256683 Ga0307516_102566832 385
550 3300037312 Ga0395899_0008314 Ga0395899_0008314_3453_4619 385
551 3300037418 Ga0395900_0019620 Ga0395900_0019620_5281_6447 385
552 3300037418 Ga0395900_0036461 Ga0395900_0036461_544_1710 385
553 3300037418 Ga0395900_0092989 Ga0395900_0092989_236_1396 385
554 3300037466 Ga0395898_0008455 Ga0395898_0008455_3193_4359 385
555 3300037466 Ga0395898_0013070 Ga0395898_0013070_5534_6700 385
556 3300037471 Ga0395905_0000432 Ga0395905_0000432_3203_4369 385
557 3300037471 Ga0395905_0002540 Ga0395905_0002540_13072_14238 385
558 3300037471 Ga0395905_0004034 Ga0395905_0004034_10838_12004 385
559 3300037471 Ga0395905_0011861 Ga0395905_0011861_537_1700 385
560 3300037471 Ga0395905_0028947 Ga0395905_0028947_2012_3178 385
561 3300037471 Ga0395905_0034159 Ga0395905_0034159_1558_2739 385
562 3300037471 Ga0395905_0040851 Ga0395905_0040851_2256_3416 385
563 3300037471 Ga0395905_0061234 Ga0395905_0061234_1124_2290 385
564 3300037471 Ga0395905_0083148 Ga0395905_0083148_934_2100 385
565 3300037471 Ga0395905_0128803 Ga0395905_0128803_227_1393 385
566 3300038443 Ga0395901_0024911 Ga0395901_0024911_3220_4386 385
567 3300038443 Ga0395901_0084582 Ga0395901_0084582_934_2100 385
568 3300042004 Ga0439445_0025144 Ga0439445_0025144_143_1324 385
569 3300042134 Ga0450898_001291 Ga0450898_001291_738_1904 385
570 3300044656 Ga0466969_0000018 Ga0466969_0000018_54471_55634 385
571 3300044656 Ga0466969_0007499 Ga0466969_0007499_4165_5331 385
572 3300044656 Ga0466969_0024919 Ga0466969_0024919_454_1617 385
573 3300044683 Ga0466965_0054848 Ga0466965_0054848_699_1862 385
574 3300044684 Ga0466966_0014306 Ga0466966_0014306_3178_4341 385
575 3300044684 Ga0466966_0035444 Ga0466966_0035444_634_1797 385
576 3300044693 Ga0466961_0006521 Ga0466961_0006521_1169_2335 385
577 3300044693 Ga0466961_0078138 Ga0466961_0078138_233_1396 385
578 3300044735 Ga0466968_0016365 Ga0466968_0016365_1707_2873 385
579 3300044765 Ga0466970_0048635 Ga0466970_0048635_394_1560 385
580 3300044765 Ga0466970_0049986 Ga0466970_0049986_1010_2173 385
581 3300044842 Ga0466957_0004358 Ga0466957_0004358_6311_7477 385
582 3300045049 Ga0466959_0024616 Ga0466959_0024616_492_1658 385
583 3300045049 Ga0466959_0167643 Ga0466959_0167643_340_1503 385
584 3300046457 Ga0495590_0003163 Ga0495590_0003163_2978_4156 385
585 3300046460 Ga0495638_0077223 Ga0495638_0077223_253_1419 385
586 3300046519 Ga0495632_0002352 Ga0495632_0002352_2135_3301 385
587 3300046519 Ga0495632_0020371 Ga0495632_0020371_1827_3005 385
588 3300046542 Ga0495597_0007542 Ga0495597_0007542_1446_2663 385
589 3300046616 Ga0495668_0017953 Ga0495668_0017953_48_1274 385
590 3300046660 Ga0495625_0013529 Ga0495625_0013529_4837_6003 385
591 3300046660 Ga0495625_0091088 Ga0495625_0091088_891_2069 385
592 3300046694 Ga0495649_0000380 Ga0495649_0000380_3623_4801 385
593 3300046810 Ga0495660_0026773 Ga0495660_0026773_1078_2256 385
594 3300047443 Ga0495687_000850 Ga0495687_000850_4157_5374 385
595 3300047443 Ga0495687_008280 Ga0495687_008280_2135_3313 385
596 3300049568 Ga0501031_0001713 Ga0501031_0001713_5159_6322 385
597 3300050489 nmdc:mga03683_29128_c1 nmdc:mga03683_29128_c1_371_1540 385
598 3300050490 nmdc:mga03n38_56000_c1 nmdc:mga03n38_56000_c1_32_1201 385
599 3300050490 nmdc:mga03n38_70573_c1 nmdc:mga03n38_70573_c1_211_1377 385
600 3300050491 nmdc:mga00v17_31205_c1 nmdc:mga00v17_31205_c1_146_1315 385
601 3300050493 nmdc:mga0k408_10776_c1 nmdc:mga0k408_10776_c1_1436_2605 385
602 3300050493 nmdc:mga0k408_49562_c1 nmdc:mga0k408_49562_c1_404_1618 385
603 3300050494 nmdc:mga06z11_21913_c2 nmdc:mga06z11_21913_c2_974_2140 385
604 3300050496 nmdc:mga07m45_3088_c1 nmdc:mga07m45_3088_c1_3555_4724 385
605 3300050496 nmdc:mga07m45_3233_c1 nmdc:mga07m45_3233_c1_6022_7203 385
606 3300050496 nmdc:mga07m45_6836_c1 nmdc:mga07m45_6836_c1_2463_3629 385
607 3300050516 nmdc:mga0sz30_42066_c1 nmdc:mga0sz30_42066_c1_552_1721 385
608 3300053130 Ga0500642_0020754 Ga0500642_0020754_559_1725 385
609 3300053131 Ga0500652_001084 Ga0500652_001084_7012_8178 385
610 3300053134 Ga0500658_0029034 Ga0500658_0029034_521_1699 385
611 3300053139 Ga0500568_0004342 Ga0500568_0004342_5997_7223 385
612 3300053148 Ga0500590_064552 Ga0500590_064552_370_1539 385
613 3300053156 Ga0500622_0000198 Ga0500622_0000198_61852_63018 385
614 3300061719 Ga0466962_0003983 Ga0466962_0003983_5071_6237 385
615 iso_pu_bacteria 2739367866 2740032516 385
616 iso_pu_bacteria 2842718218 2842720649 385
617 3300003775 Ga0055524_1000140 Ga0055524_100014058 386
618 3300003791 Ga0055530_10003145 Ga0055530_100031454 386
619 3300003792 Ga0055540_1000133 Ga0055540_100013346 386
620 3300005344 Ga0070661_100018267 Ga0070661_1000182673 386
621 3300005366 Ga0070659_100021184 Ga0070659_1000211843 386
622 3300005367 Ga0070667_100006934 Ga0070667_1000069343 386
623 3300005564 Ga0070664_100002435 Ga0070664_10000243513 386
624 3300005564 Ga0070664_100048553 Ga0070664_1000485532 386
625 3300005843 Ga0068860_100097440 Ga0068860_1000974402 386
626 3300006946 Ga0079104_1000053 Ga0079104_100005360 386
627 3300014968 Ga0157379_10083761 Ga0157379_100837612 386
628 3300025298 Ga0209050_1000996 Ga0209050_100099627 386
629 3300025299 Ga0209256_1000045 Ga0209256_1000045191 386
630 3300025303 Ga0209051_1000004 Ga0209051_10000041013 386
631 3300025304 Ga0209257_1000315 Ga0209257_100031560 386
632 3300025920 Ga0207649_10000614 Ga0207649_100006147 386
633 3300025921 Ga0207652_10069419 Ga0207652_100694193 386
634 3300025923 Ga0207681_10191266 Ga0207681_101912662 386
635 3300025932 Ga0207690_10013071 Ga0207690_100130713 386
636 3300025945 Ga0207679_10000077 Ga0207679_1000007721 386
637 3300025945 Ga0207679_10125626 Ga0207679_101256262 386
638 3300025986 Ga0207658_10029648 Ga0207658_100296482 386
639 3300027111 Ga0209281_1000147 Ga0209281_100014760 386
640 3300028381 Ga0268264_10095775 Ga0268264_100957752 386
641 3300031239 Ga0265328_10019614 Ga0265328_100196143 386
642 3300031251 Ga0265327_10000925 Ga0265327_1000092511 386
643 3300031731 Ga0307405_10071205 Ga0307405_100712052 386
644 3300038443 Ga0395901_0359346 Ga0395901_0359346_188_1357 386
645 3300042115 Ga0450911_001157 Ga0450911_001157_61_1245 386
646 3300042121 Ga0450919_000132 Ga0450919_000132_972_2141 386
647 3300042125 Ga0450923_000606 Ga0450923_000606_2118_3287 386
648 3300042531 Ga0450918_000057 Ga0450918_000057_7444_8613 386
649 3300042876 Ga0451577_0000126 Ga0451577_0000126_27189_28412 386
650 3300044712 Ga0453684_0000365 Ga0453684_0000365_34514_35737 386
651 3300044712 Ga0453684_0035441 Ga0453684_0035441_4044_5216 386
652 3300045051 Ga0451576_0000627 Ga0451576_0000627_29272_30495 386
653 3300048912 Ga0496109_0097926 Ga0496109_0097926_213_1391 386
654 3300048928 Ga0496125_0046766 Ga0496125_0046766_2204_3388 386
655 3300048928 Ga0496125_0054939 Ga0496125_0054939_552_1736 386
656 iso_pu_bacteria 2585428058 2587735600 386
657 iso_pu_bacteria 2842733646 2842738632 386
658 3300001979 JGI24740J21852_10016505 JGI24740J21852_100165052 387
659 3300005327 Ga0070658_10008606 Ga0070658_100086068 387
660 3300005328 Ga0070676_10019300 Ga0070676_100193003 387
661 3300005459 Ga0068867_100021133 Ga0068867_1000211335 387
662 3300005563 Ga0068855_100412193 Ga0068855_1004121932 387
663 3300014326 Ga0157380_10183432 Ga0157380_101834322 387
664 3300014497 Ga0182008_10004921 Ga0182008_100049213 387
665 3300015262 Ga0182007_10001372 Ga0182007_100013726 387
666 3300015683 Ga0183362_10004 Ga0183362_1000429 387
667 3300017792 Ga0163161_10011636 Ga0163161_100116365 387
668 3300025949 Ga0207667_10297476 Ga0207667_102974762 387
669 3300026089 Ga0207648_10004823 Ga0207648_100048239 387
670 3300026121 Ga0207683_10136967 Ga0207683_101369672 387
671 3300026121 Ga0207683_10296511 Ga0207683_102965112 387
672 3300026142 Ga0207698_10339731 Ga0207698_103397312 387
673 3300027614 Ga0209970_1001072 Ga0209970_10010725 387
674 3300031251 Ga0265327_10011216 Ga0265327_100112162 387
675 3300031344 Ga0265316_10000176 Ga0265316_1000017633 387
676 3300037471 Ga0395905_0000504 Ga0395905_0000504_25170_26357 387
677 3300042002 Ga0439442_002138 Ga0439442_002138_2094_3260 387
678 3300042876 Ga0451577_0006685 Ga0451577_0006685_3109_4320 387
679 3300045051 Ga0451576_0048235 Ga0451576_0048235_151_1359 387
680 3300045051 Ga0451576_0126862 Ga0451576_0126862_1111_2304 387
681 3300046539 Ga0495621_0009162 Ga0495621_0009162_710_1876 387
682 3300046615 Ga0495656_0001009 Ga0495656_0001009_5025_6191 387
683 3300046684 Ga0495669_0041763 Ga0495669_0041763_777_1943 387
684 3300048912 Ga0496109_0045569 Ga0496109_0045569_2245_3411 387
685 3300048914 Ga0496111_0024896 Ga0496111_0024896_2058_3224 387
686 3300048917 Ga0496114_0301106 Ga0496114_0301106_59_1225 387
687 3300049579 Ga0501043_0000058 Ga0501043_0000058_32688_33920 387
688 3300049580 Ga0501046_0000051 Ga0501046_0000051_68158_69390 387
689 3300049581 Ga0501047_0000003 Ga0501047_0000003_439014_440246 387
690 3300049824 Ga0501045_0015123 Ga0501045_0015123_2067_3299 387
691 iso_pu_bacteria 2511231002 2511245341 387
692 3300003761 Ga0055535_1000271 Ga0055535_10002717 388
693 3300003763 Ga0055529_1000321 Ga0055529_100032142 388
694 3300005262 Ga0065165_1008900 Ga0065165_10089003 388
695 3300005336 Ga0070680_100096268 Ga0070680_1000962682 388
696 3300005339 Ga0070660_100166540 Ga0070660_1001665402 388
697 3300005530 Ga0070679_100039040 Ga0070679_1000390405 388
698 3300005563 Ga0068855_100011340 Ga0068855_1000113407 388
699 3300006195 Ga0075366_10011244 Ga0075366_100112444 388
700 3300006353 Ga0075370_10003469 Ga0075370_100034693 388
701 3300006353 Ga0075370_10042272 Ga0075370_100422723 388
702 3300009093 Ga0105240_10002477 Ga0105240_1000247723 388
703 3300009551 Ga0105238_10061434 Ga0105238_100614342 388
704 3300025242 Ga0209258_100025 Ga0209258_1000258 388
705 3300025256 Ga0209759_1001538 Ga0209759_10015382 388
706 3300025272 Ga0209455_1000166 Ga0209455_100016689 388
707 3300025913 Ga0207695_10057931 Ga0207695_100579313 388
708 3300025917 Ga0207660_10061622 Ga0207660_100616222 388
709 3300025919 Ga0207657_10017128 Ga0207657_100171282 388
710 3300025921 Ga0207652_10076312 Ga0207652_100763123 388
711 3300028794 Ga0307515_10004822 Ga0307515_1000482222 388
712 3300031456 Ga0307513_10004491 Ga0307513_1000449118 388
713 3300031456 Ga0307513_10008739 Ga0307513_1000873910 388
714 3300031649 Ga0307514_10003227 Ga0307514_100032277 388
715 3300032002 Ga0307416_100018698 Ga0307416_1000186982 388
716 3300041404 Ga0439436_0020293 Ga0439436_0020293_641_1810 388
717 3300042004 Ga0439445_0023936 Ga0439445_0023936_261_1430 388
718 3300042006 Ga0439432_009856 Ga0439432_009856_1995_3164 388
719 3300042007 Ga0439449_0003996 Ga0439449_0003996_1090_2259 388
720 3300042010 Ga0439452_006839 Ga0439452_006839_1654_2823 388
721 3300042015 Ga0439462_0001911 Ga0439462_0001911_487_1656 388
722 3300042145 Ga0450906_001537 Ga0450906_001537_361_1530 388
723 3300050490 nmdc:mga03n38_117193_c1 nmdc:mga03n38_117193_c1_103_1272 388
724 3300050493 nmdc:mga0k408_10449_c1 nmdc:mga0k408_10449_c1_1851_3020 388
725 3300050496 nmdc:mga07m45_2998_c1 nmdc:mga07m45_2998_c1_145_1320 388
726 3300050496 nmdc:mga07m45_6187_c1 nmdc:mga07m45_6187_c1_3810_4979 388
727 3300053086 Ga0500578_0000417 Ga0500578_0000417_8073_9248 388
728 iso_pu_bacteria 2734482258 2735818178 388
729 3300031730 Ga0307516_10034081 Ga0307516_100340815 389
730 3300041512 Ga0451853_4042678 Ga0451853_4042678_74_1342 389
731 3300044694 Ga0466963_0017494 Ga0466963_0017494_2964_4220 389
732 3300046530 Ga0495654_0001492 Ga0495654_0001492_10534_11733 389
733 iso_pu_bacteria 2585428057 2587725949 389
734 iso_pu_bacteria 2738543013 2739247829 389
735 iso_pu_bacteria 2904541872 2904546720 389
736 iso_pu_bacteria 2929160207 2929166169 389
737 3300002704 JGI25155J39150_1000037 JGI25155J39150_100003712 390
738 3300002705 JGI25156J39149_1000024 JGI25156J39149_100002469 390
739 3300002738 JGI25154J39366_1000043 JGI25154J39366_100004370 390
740 3300002741 JGI25157J39369_1000031 JGI25157J39369_100003159 390
741 3300002774 JGI25150J39212_1002395 JGI25150J39212_10023953 390
742 3300002987 JGI25159J45721_1004996 JGI25159J45721_10049961 390
743 3300003187 JGI25151J46595_10011019 JGI25151J46595_100110193 390
744 3300003354 JGI25160J50197_1000172 JGI25160J50197_100017225 390
745 3300003374 JGI25161J50226_1000007 JGI25161J50226_1000007104 390
746 3300003771 Ga0055526_1014459 Ga0055526_10144593 390
747 3300003771 Ga0055526_1015538 Ga0055526_10155382 390
748 3300003773 Ga0055537_1000356 Ga0055537_100035627 390
749 3300003775 Ga0055524_1000213 Ga0055524_10002136 390
750 3300003781 Ga0055536_1006719 Ga0055536_10067193 390
751 3300003784 Ga0055534_1001067 Ga0055534_10010676 390
752 3300003790 Ga0055528_1000846 Ga0055528_100084615 390
753 3300003791 Ga0055530_10000763 Ga0055530_1000076323 390
754 3300003792 Ga0055540_1000504 Ga0055540_10005047 390
755 3300003794 Ga0055531_10002263 Ga0055531_100022636 390
756 3300004625 Ga0055543_1000061 Ga0055543_10000616 390
757 3300005262 Ga0065165_1005479 Ga0065165_10054796 390
758 3300005262 Ga0065165_1006179 Ga0065165_10061794 390
759 3300005578 Ga0068854_100171813 Ga0068854_1001718132 390
760 3300006051 Ga0075364_10012964 Ga0075364_100129646 390
761 3300006177 Ga0075362_10001785 Ga0075362_100017855 390
762 3300006195 Ga0075366_10017453 Ga0075366_100174533 390
763 3300017792 Ga0163161_10096335 Ga0163161_100963351 390
764 3300025206 Ga0209435_100008 Ga0209435_100008399 390
765 3300025245 Ga0207425_1002945 Ga0207425_10029453 390
766 3300025246 Ga0209646_1000079 Ga0209646_1000079122 390
767 3300025250 Ga0209026_1000067 Ga0209026_1000067122 390
768 3300025256 Ga0209759_1000056 Ga0209759_1000056122 390
769 3300025263 Ga0209565_1000041 Ga0209565_100004146 390
770 3300025263 Ga0209565_1000333 Ga0209565_100033327 390
771 3300025273 Ga0209673_1000364 Ga0209673_100036437 390
772 3300025273 Ga0209673_1033619 Ga0209673_10336191 390
773 3300025284 Ga0209130_1000245 Ga0209130_100024525 390
774 3300025284 Ga0209130_1000708 Ga0209130_10007086 390
775 3300025291 Ga0209675_1000316 Ga0209675_100031630 390
776 3300025292 Ga0209676_1000013 Ga0209676_1000013281 390
777 3300025292 Ga0209676_1006483 Ga0209676_10064836 390
778 3300025294 Ga0209025_1003852 Ga0209025_100385211 390
779 3300025294 Ga0209025_1025542 Ga0209025_10255423 390
780 3300025294 Ga0209025_1029710 Ga0209025_10297102 390
781 3300025295 Ga0209564_1000363 Ga0209564_100036365 390
782 3300025295 Ga0209564_1001670 Ga0209564_100167015 390
783 3300025295 Ga0209564_1013238 Ga0209564_10132384 390
784 3300025297 Ga0209758_1009742 Ga0209758_10097424 390
785 3300025298 Ga0209050_1000008 Ga0209050_1000008281 390
786 3300025298 Ga0209050_1006789 Ga0209050_10067895 390
787 3300025299 Ga0209256_1000003 Ga0209256_1000003120 390
788 3300025299 Ga0209256_1027278 Ga0209256_10272782 390
789 3300025302 Ga0207426_1000091 Ga0207426_1000091115 390
790 3300025302 Ga0207426_1002234 Ga0207426_10022346 390
791 3300025303 Ga0209051_1000005 Ga0209051_1000005281 390
792 3300025304 Ga0209257_1000048 Ga0209257_1000048281 390
793 3300031456 Ga0307513_10004870 Ga0307513_1000487010 390
794 3300031548 Ga0307408_100060389 Ga0307408_1000603893 390
795 3300042131 Ga0450894_002761 Ga0450894_002761_592_1764 390
796 3300053093 Ga0500651_0001098 Ga0500651_0001098_11150_12391 390
797 3300053117 Ga0500593_000805 Ga0500593_000805_3271_4512 390
798 3300053730 Ga0500645_000259 Ga0500645_000259_10037_11287 390
799 3300053730 Ga0500645_002355 Ga0500645_002355_5002_6252 390
800 3300055283 Ga0500661_008021 Ga0500661_008021_211_1452 390
801 3300005543 Ga0070672_100068866 Ga0070672_1000688663 391
802 3300006178 Ga0075367_10159630 Ga0075367_101596301 391
803 3300031852 Ga0307410_10016446 Ga0307410_100164462 392
804 iso_pu_bacteria 2643221628 2644163726 392
805 iso_pu_bacteria 2842677519 2842678299 392
806 iso_pu_bacteria 2904449895 2904451123 392
807 iso_pu_bacteria 2904456579 2904457977 392
808 iso_pu_bacteria 2919462493 2919465672 392
809 iso_pu_bacteria 2945945610 2945950962 392
810 3300003187 JGI25151J46595_10002752 JGI25151J46595_100027522 393
811 3300003784 Ga0055534_1001587 Ga0055534_10015874 393
812 3300005331 Ga0070670_100098308 Ga0070670_1000983082 393
813 3300005548 Ga0070665_100291979 Ga0070665_1002919792 393
814 3300025284 Ga0209130_1001785 Ga0209130_10017858 393
815 3300025292 Ga0209676_1014369 Ga0209676_10143693 393
816 3300025294 Ga0209025_1000283 Ga0209025_100028358 393
817 3300046539 Ga0495621_0027194 Ga0495621_0027194_27_1214 393
818 iso_pu_bacteria 2929520902 2929526408 393
819 iso_pu_bacteria 2945909444 2945915015 393
820 iso_pu_bacteria 2945984333 2945989587 393
821 3300031251 Ga0265327_10002797 Ga0265327_100027972 394
822 iso_pu_bacteria 2643221683 2644466527 394
823 iso_pu_bacteria 2738541307 2738882029 394
824 iso_pu_bacteria 2885198086 2885203881 394
825 iso_pu_bacteria 2885211737 2885217784 394
826 iso_pu_bacteria 2928115317 2928118830 394
827 3300009093 Ga0105240_10146487 Ga0105240_101464872 395
828 3300009545 Ga0105237_10046071 Ga0105237_100460713 395
829 3300013104 Ga0157370_10231461 Ga0157370_102314612 395
830 3300013105 Ga0157369_10143197 Ga0157369_101431973 395
831 3300025913 Ga0207695_10124467 Ga0207695_101244672 395
832 3300025919 Ga0207657_10105000 Ga0207657_101050003 395
833 3300025935 Ga0207709_10000433 Ga0207709_1000043340 395
834 3300025949 Ga0207667_10040596 Ga0207667_100405963 395
835 3300026142 Ga0207698_10175478 Ga0207698_101754782 395
836 3300048927 Ga0496124_0056407 Ga0496124_0056407_635_1825 395
837 iso_pu_bacteria 2928084124 2928085660 395
838 iso_pu_bacteria 2945972063 2945974401 395
839 3300003773 Ga0055537_1001103 Ga0055537_100110312 396
840 3300003781 Ga0055536_1021287 Ga0055536_10212872 396
841 3300003784 Ga0055534_1000346 Ga0055534_10003462 396
842 3300003790 Ga0055528_1001593 Ga0055528_10015932 396
843 3300003792 Ga0055540_1000765 Ga0055540_100076518 396
844 3300003792 Ga0055540_1003891 Ga0055540_10038917 396
845 3300006038 Ga0075365_10100168 Ga0075365_101001682 396
846 3300006048 Ga0075363_100029235 Ga0075363_1000292353 396
847 3300006048 Ga0075363_100090501 Ga0075363_1000905012 396
848 3300006051 Ga0075364_10053774 Ga0075364_100537742 396
849 3300006051 Ga0075364_10207369 Ga0075364_102073692 396
850 3300006177 Ga0075362_10009607 Ga0075362_100096073 396
851 3300006186 Ga0075369_10010982 Ga0075369_100109823 396
852 3300006195 Ga0075366_10042553 Ga0075366_100425532 396
853 3300006353 Ga0075370_10032077 Ga0075370_100320772 396
854 3300006948 Ga0099826_10000959 Ga0099826_100009595 396
855 3300025263 Ga0209565_1000259 Ga0209565_100025963 396
856 3300025273 Ga0209673_1000193 Ga0209673_100019325 396
857 3300025273 Ga0209673_1014689 Ga0209673_10146892 396
858 3300025291 Ga0209675_1000220 Ga0209675_100022025 396
859 3300025292 Ga0209676_1000209 Ga0209676_100020981 396
860 3300025292 Ga0209676_1027482 Ga0209676_10274822 396
861 3300025294 Ga0209025_1022772 Ga0209025_10227722 396
862 3300025303 Ga0209051_1000156 Ga0209051_100015632 396
863 3300025303 Ga0209051_1001349 Ga0209051_100134919 396
864 3300027666 Ga0209282_1000107 Ga0209282_10001072 396
865 3300030731 Ga0316177_1147685 Ga0316177_11476853 396
866 3300030732 Ga0316176_1019717 Ga0316176_10197171 396
867 3300030734 Ga0316179_1045655 Ga0316179_10456552 396
868 3300030742 Ga0316183_1086347 Ga0316183_10863473 396
869 3300030745 Ga0316182_1395773 Ga0316182_13957731 396
870 3300031548 Ga0307408_100031021 Ga0307408_1000310213 396
871 3300031548 Ga0307408_100178395 Ga0307408_1001783951 396
872 3300031548 Ga0307408_100229417 Ga0307408_1002294172 396
873 3300031901 Ga0307406_10020825 Ga0307406_100208252 396
874 3300031911 Ga0307412_10086029 Ga0307412_100860292 396
875 3300032005 Ga0307411_10092065 Ga0307411_100920652 396
876 3300041404 Ga0439436_0011478 Ga0439436_0011478_573_1763 396
877 3300041411 Ga0439466_0018087 Ga0439466_0018087_185_1375 396
878 3300041413 Ga0439465_0007667 Ga0439465_0007667_1910_3100 396
879 3300042002 Ga0439442_001212 Ga0439442_001212_573_1763 396
880 3300042122 Ga0450920_010904 Ga0450920_010904_265_1455 396
881 3300042125 Ga0450923_001222 Ga0450923_001222_567_1757 396
882 3300042127 Ga0450890_001454 Ga0450890_001454_618_1808 396
883 3300042133 Ga0450896_002019 Ga0450896_002019_1159_2349 396
884 3300042145 Ga0450906_000686 Ga0450906_000686_5129_6319 396
885 3300042147 Ga0450910_000244 Ga0450910_000244_3220_4410 396
886 3300042184 Ga0450908_000233 Ga0450908_000233_8209_9399 396
887 3300042185 Ga0450909_010803 Ga0450909_010803_35_1225 396
888 3300042531 Ga0450918_004991 Ga0450918_004991_261_1451 396
889 3300046660 Ga0495625_0000098 Ga0495625_0000098_20036_21226 396
890 3300049679 Ga0501249_004367 Ga0501249_004367_1387_2580 396
891 3300050489 nmdc:mga03683_916_c1 nmdc:mga03683_916_c1_6594_7784 396
892 3300050490 nmdc:mga03n38_21764_c1 nmdc:mga03n38_21764_c1_388_1578 396
893 3300050490 nmdc:mga03n38_45913_c1 nmdc:mga03n38_45913_c1_501_1691 396
894 3300050490 nmdc:mga03n38_58155_c1 nmdc:mga03n38_58155_c1_518_1708 396
895 3300050492 nmdc:mga0yw44_88132_c1 nmdc:mga0yw44_88132_c1_474_1664 396
896 3300050493 nmdc:mga0k408_87039_c1 nmdc:mga0k408_87039_c1_518_1708 396
897 3300050496 nmdc:mga07m45_64416_c1 nmdc:mga07m45_64416_c1_524_1714 396
898 3300050516 nmdc:mga0sz30_35023_c1 nmdc:mga0sz30_35023_c1_241_1431 396
899 iso_pu_bacteria 2643221658 2644327043 396
900 iso_pu_bacteria 2643221672 2644398846 396
901 3300003187 JGI25151J46595_10001536 JGI25151J46595_1000153613 397
902 3300003187 JGI25151J46595_10002156 JGI25151J46595_100021564 397
903 3300009148 Ga0105243_10061212 Ga0105243_100612123 397
904 3300017792 Ga0163161_10000361 Ga0163161_100003618 397
905 3300025294 Ga0209025_1001101 Ga0209025_100110142 397
906 3300025935 Ga0207709_10012723 Ga0207709_100127234 397
907 3300031649 Ga0307514_10007369 Ga0307514_100073693 397
908 3300031911 Ga0307412_10093686 Ga0307412_100936862 397
909 3300050496 nmdc:mga07m45_2992_c2 nmdc:mga07m45_2992_c2_2732_3925 397
910 3300003578 Ga0006562J51391_1039805 Ga0006562J51391_10398052 398
911 3300003578 Ga0006562J51391_1039806 Ga0006562J51391_10398069 398
912 3300005367 Ga0070667_100272942 Ga0070667_1002729421 398
913 3300013100 Ga0157373_10023614 Ga0157373_100236143 398
914 3300015261 Ga0182006_1063506 Ga0182006_10635061 398
915 3300025294 Ga0209025_1054573 Ga0209025_10545732 398
916 3300028794 Ga0307515_10157352 Ga0307515_101573522 398
917 3300032002 Ga0307416_100092169 Ga0307416_1000921693 398
918 3300032004 Ga0307414_10066493 Ga0307414_100664933 398
919 3300046460 Ga0495638_0030970 Ga0495638_0030970_1087_2289 398
920 3300046513 Ga0495616_0001020 Ga0495616_0001020_11442_12644 398
921 3300046518 Ga0495631_0000803 Ga0495631_0000803_11066_12265 398
922 3300046520 Ga0495637_0002174 Ga0495637_0002174_8487_9683 398
923 3300046664 Ga0495659_0048833 Ga0495659_0048833_114_1310 398
924 3300046674 Ga0495588_0053425 Ga0495588_0053425_64_1266 398
925 3300046683 Ga0495658_0032461 Ga0495658_0032461_258_1460 398
926 3300046692 Ga0495671_0006329 Ga0495671_0006329_5265_6461 398
927 3300048919 Ga0496116_0008159 Ga0496116_0008159_1366_2562 398
928 3300048920 Ga0496117_0029813 Ga0496117_0029813_1528_2724 398
929 3300048924 Ga0496121_0080422 Ga0496121_0080422_886_2082 398
930 3300048925 Ga0496122_0069768 Ga0496122_0069768_807_2003 398
931 3300048925 Ga0496122_0114005 Ga0496122_0114005_189_1388 398
932 3300048926 Ga0496123_0030703 Ga0496123_0030703_652_1848 398
933 3300048926 Ga0496123_0057303 Ga0496123_0057303_795_1994 398
934 3300048928 Ga0496125_0051955 Ga0496125_0051955_1552_2748 398
935 3300053093 Ga0500651_0000093 Ga0500651_0000093_10404_11606 398
936 3300053094 Ga0500566_0106332 Ga0500566_0106332_279_1481 398
937 3300053110 Ga0500571_000137 Ga0500571_000137_2758_3960 398
938 3300053117 Ga0500593_000471 Ga0500593_000471_10969_12165 398
939 3300053118 Ga0500594_0005325 Ga0500594_0005325_1609_2808 398
940 3300053121 Ga0500607_004111 Ga0500607_004111_269_1465 398
941 3300053122 Ga0500608_010693 Ga0500608_010693_2209_3411 398
942 3300053133 Ga0500655_000776 Ga0500655_000776_3173_4375 398
943 3300053134 Ga0500658_0000827 Ga0500658_0000827_11060_12262 398
944 3300053136 Ga0500559_0004744 Ga0500559_0004744_3490_4689 398
945 3300053139 Ga0500568_0007402 Ga0500568_0007402_3071_4270 398
946 3300053158 Ga0500627_0002058 Ga0500627_0002058_3396_4592 398
947 iso_pu_bacteria 2599185214 2599621793 398
948 iso_pu_bacteria 2599185226 2599670523 398
949 iso_pu_bacteria 2599185227 2599679013 398
950 iso_pu_bacteria 2599185229 2599691304 398
951 iso_pu_bacteria 2818991446 2819597962 398
952 iso_pu_bacteria 2831265667 2831268951 398
953 iso_pu_bacteria 2838054893 2838058379 398
954 iso_pu_bacteria 2899924645 2899929381 398
955 iso_pu_bacteria 2928037797 2928040175 398
956 iso_pu_bacteria 2928044640 2928047076 398
957 iso_pu_bacteria 2928051484 2928057720 398
958 iso_pu_bacteria 2928064002 2928067897 398
959 iso_pu_bacteria 2928070936 2928072461 398
960 3300003781 Ga0055536_1009794 Ga0055536_10097943 400
961 3300003791 Ga0055530_10015503 Ga0055530_100155032 400
962 3300003792 Ga0055540_1007906 Ga0055540_10079063 400
963 3300003794 Ga0055531_10004604 Ga0055531_100046042 400
964 3300005334 Ga0068869_100226830 Ga0068869_1002268301 400
965 3300005577 Ga0068857_100055364 Ga0068857_1000553642 400
966 3300005578 Ga0068854_100101013 Ga0068854_1001010132 400
967 3300009036 Ga0105244_10002315 Ga0105244_100023152 400
968 3300009148 Ga0105243_10006082 Ga0105243_100060822 400
969 3300009551 Ga0105238_10180384 Ga0105238_101803842 400
970 3300011119 Ga0105246_10119579 Ga0105246_101195792 400
971 3300014497 Ga0182008_10010747 Ga0182008_100107477 400
972 3300015261 Ga0182006_1001345 Ga0182006_10013457 400
973 3300015262 Ga0182007_10000317 Ga0182007_1000031726 400
974 3300025292 Ga0209676_1002936 Ga0209676_100293611 400
975 3300025298 Ga0209050_1002987 Ga0209050_100298713 400
976 3300025303 Ga0209051_1000680 Ga0209051_10006803 400
977 3300025304 Ga0209257_1000172 Ga0209257_100017248 400
978 3300025728 Ga0207655_1001367 Ga0207655_10013673 400
979 3300025935 Ga0207709_10001092 Ga0207709_1000109221 400
980 3300025942 Ga0207689_10169441 Ga0207689_101694412 400
981 3300025945 Ga0207679_10095392 Ga0207679_100953922 400
982 3300048919 Ga0496116_0020369 Ga0496116_0020369_2835_4037 400
983 3300048920 Ga0496117_0039574 Ga0496117_0039574_145_1347 400
984 3300048921 Ga0496118_0026467 Ga0496118_0026467_1163_2365 400
985 3300053122 Ga0500608_006080 Ga0500608_006080_2168_3370 400
986 3300002739 JGI25158J39367_1005090 JGI25158J39367_10050902 402
987 3300002773 JGI25152J39213_1007178 JGI25152J39213_10071782 402
988 3300002774 JGI25150J39212_1004345 JGI25150J39212_10043452 402
989 3300002987 JGI25159J45721_1007712 JGI25159J45721_10077122 402
990 3300003187 JGI25151J46595_10019115 JGI25151J46595_100191152 402
991 3300003215 JGI25153J46596_10016969 JGI25153J46596_100169692 402
992 3300003354 JGI25160J50197_1011812 JGI25160J50197_10118122 402
993 3300003374 JGI25161J50226_1003544 JGI25161J50226_10035443 402
994 3300003374 JGI25161J50226_1005059 JGI25161J50226_10050592 402
995 3300003578 Ga0006562J51391_1066746 Ga0006562J51391_10667463 402
996 3300003578 Ga0006562J51391_1066748 Ga0006562J51391_10667483 402
997 3300003761 Ga0055535_1000995 Ga0055535_100099512 402
998 3300003762 Ga0055542_1000003 Ga0055542_1000003112 402
999 3300003771 Ga0055526_1015438 Ga0055526_10154382 402
1000 3300003771 Ga0055526_1017593 Ga0055526_10175932 402
1001 3300003773 Ga0055537_1007183 Ga0055537_10071832 402
1002 3300003775 Ga0055524_1014230 Ga0055524_10142302 402
1003 3300003775 Ga0055524_1015505 Ga0055524_10155052 402
1004 3300003781 Ga0055536_1015963 Ga0055536_10159632 402
1005 3300003784 Ga0055534_1009018 Ga0055534_10090182 402
1006 3300003790 Ga0055528_1015691 Ga0055528_10156912 402
1007 3300003791 Ga0055530_10003770 Ga0055530_100037702 402
1008 3300003792 Ga0055540_1011179 Ga0055540_10111793 402
1009 3300003794 Ga0055531_10018174 Ga0055531_100181742 402
1010 3300003794 Ga0055531_10018180 Ga0055531_100181803 402
1011 3300004625 Ga0055543_1005771 Ga0055543_10057712 402
1012 3300004625 Ga0055543_1005778 Ga0055543_10057782 402
1013 3300005262 Ga0065165_1014201 Ga0065165_10142012 402
1014 3300005834 Ga0068851_10018422 Ga0068851_100184223 402
1015 3300013102 Ga0157371_10118626 Ga0157371_101186262 402
1016 3300013307 Ga0157372_10556056 Ga0157372_105560561 402
1017 3300025228 Ga0209672_101139 Ga0209672_1011392 402
1018 3300025242 Ga0209258_100015 Ga0209258_100015231 402
1019 3300025245 Ga0207425_1006495 Ga0207425_10064953 402
1020 3300025245 Ga0207425_1007181 Ga0207425_10071812 402
1021 3300025254 Ga0209148_1000028 Ga0209148_1000028437 402
1022 3300025258 Ga0209129_1000049 Ga0209129_1000049236 402
1023 3300025258 Ga0209129_1002921 Ga0209129_10029213 402
1024 3300025258 Ga0209129_1011570 Ga0209129_10115702 402
1025 3300025263 Ga0209565_1002282 Ga0209565_10022822 402
1026 3300025263 Ga0209565_1004128 Ga0209565_10041284 402
1027 3300025263 Ga0209565_1007247 Ga0209565_10072473 402
1028 3300025273 Ga0209673_1004816 Ga0209673_10048162 402
1029 3300025273 Ga0209673_1005119 Ga0209673_10051196 402
1030 3300025284 Ga0209130_1002505 Ga0209130_10025052 402
1031 3300025284 Ga0209130_1002770 Ga0209130_10027707 402
1032 3300025291 Ga0209675_1003708 Ga0209675_10037082 402
1033 3300025291 Ga0209675_1015740 Ga0209675_10157402 402
1034 3300025292 Ga0209676_1000074 Ga0209676_1000074237 402
1035 3300025294 Ga0209025_1001092 Ga0209025_100109235 402
1036 3300025294 Ga0209025_1003444 Ga0209025_100344415 402
1037 3300025295 Ga0209564_1001279 Ga0209564_10012792 402
1038 3300025295 Ga0209564_1003353 Ga0209564_100335311 402
1039 3300025297 Ga0209758_1000496 Ga0209758_100049614 402
1040 3300025298 Ga0209050_1000015 Ga0209050_1000015233 402
1041 3300025299 Ga0209256_1000264 Ga0209256_100026452 402
1042 3300025299 Ga0209256_1000304 Ga0209256_100030452 402
1043 3300025302 Ga0207426_1000108 Ga0207426_1000108178 402
1044 3300025302 Ga0207426_1000130 Ga0207426_1000130160 402
1045 3300025303 Ga0209051_1000010 Ga0209051_1000010233 402
1046 3300025303 Ga0209051_1019395 Ga0209051_10193953 402
1047 3300025304 Ga0209257_1000026 Ga0209257_1000026444 402
1048 3300025304 Ga0209257_1016709 Ga0209257_10167092 402
1049 iso_pu_bacteria 2738541277 2738721855 402
1050 iso_pu_bacteria 2738543019 2739282219 402
1051 3300001979 JGI24740J21852_10007049 JGI24740J21852_100070495 406
1052 3300001989 JGI24739J22299_10006314 JGI24739J22299_100063143 406
1053 3300005539 Ga0068853_100077168 Ga0068853_1000771682 406
1054 3300048921 Ga0496118_0022033 Ga0496118_0022033_358_1578 406
1055 3300048927 Ga0496124_0046785 Ga0496124_0046785_1254_2474 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

29

126

0.99

PF02222

ATP-grasp

ATP-grasp domain

145

317

0.95

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

343

406

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4izo-assembly1.cif.gz_A crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis 0.9659 8 398
4izo-assembly1.cif.gz_A crystal structure of kinase phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia thailandensis 0.9609 8 398
4e4t-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.959 8 399
4e4t-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9579 8 399
4e4t-assembly1.cif.gz_B crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9541 8 399
ID Description Score Start End Superfamily
4izoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9892 8 117 3.40.50.20
4izoA03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9754 189 397 3.30.470.20
3v4sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9722 10 117 3.40.50.20
4izoA03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9706 189 397 3.30.470.20
3aw8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 16 110 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A4Q5WH15-F1-model_v4 deleted 0.998 8 314
AF-A0A3C1MWY2-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.9952 10 117 GO:0005829
AF-A0A4Q5WH15-F1-model_v4 deleted 0.9884 8 314
AF-A0A1I7Y3B8-F1-model_v4 Multifunctional fusion protein 0.9778 22 398 GO:0004638
GO:0004639
GO:0005524
GO:0005829
GO:0005975
GO:0006189
GO:0008270
GO:0016832
AF-A0A7C5KY93-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9774 1 395 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.34 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map