F489140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1054 | 623 | 875 | 167 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2824600985|2824608500 |
| Length | 196 |
| Sequence | ADDHESPKRHPPQGMGPGLRWDDSGVLGGAPSMTPLRAGILSALVTLVLDQASKLWLLNVFDLAHRGAVRVTPFFDLVLAWNIGISFGWLQNDSQAAQLALMAVKGIAVVALAIWMARSHTLLATIALGLIIGGAIGNGIDRLAYGAVVDFALFHIEIGGKTYNWYVFNLADVAIVAGVAALLYDSFLGVPAAKAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 18 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2791355199 | |||
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 25 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 29 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 35 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 38 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 39 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 49 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 50 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 51 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 52 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 53 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 54 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 55 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 56 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 57 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 58 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 59 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 60 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 61 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 62 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 63 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 64 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 65 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 66 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 72 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 73 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 74 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 75 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 76 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 77 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 78 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 79 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 80 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 81 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 82 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 83 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 86 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 87 | 2922368715 | |||
| 88 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 89 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 90 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 91 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 92 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 93 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 94 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 95 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 96 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 97 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 98 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 99 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 100 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 101 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 102 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 103 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 104 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 105 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 106 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 107 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 108 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 109 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 110 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 111 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 112 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 113 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 114 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 115 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 116 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 117 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 118 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 119 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 120 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 121 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 122 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 123 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 124 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 125 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 126 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 127 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 128 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 129 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 130 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 131 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 132 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 133 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 134 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 135 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 136 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 137 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 138 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 139 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 140 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 141 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 142 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 143 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 144 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 145 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 146 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 147 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 148 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 149 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 150 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 151 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 152 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 153 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 154 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 155 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 156 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 157 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 161 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 162 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 163 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 165 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 167 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 169 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 174 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 176 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 178 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 183 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 186 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 187 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 192 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 193 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 194 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 195 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 197 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 198 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 199 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 200 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 201 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 202 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 203 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 204 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 205 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 206 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 208 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 209 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 210 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 211 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 215 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 216 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 217 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 218 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 220 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 221 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 222 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 223 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 224 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 225 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 227 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 228 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 229 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 230 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 231 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 232 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 244 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 257 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 258 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 259 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 260 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 261 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 262 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 263 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 264 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 265 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 336 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 337 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 338 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 346 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 347 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 348 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 349 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 350 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 351 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 352 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 353 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 354 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 355 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 356 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 357 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 358 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 359 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 360 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 361 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 362 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 363 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 364 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 365 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 366 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 367 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 368 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 369 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 370 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 371 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 372 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 373 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 374 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 376 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 377 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 378 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 379 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 380 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 381 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 382 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 383 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 384 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 385 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 387 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 388 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 389 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 390 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 391 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 392 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 393 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 394 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 395 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 396 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 397 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 398 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 399 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 400 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 401 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 402 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 403 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 404 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 405 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 406 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 407 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 408 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 409 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 410 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 411 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 412 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 413 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 414 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 415 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 416 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 417 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 418 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 419 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 487 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 488 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 489 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 490 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 491 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 492 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 494 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 495 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 496 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 497 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 498 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 499 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 500 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 501 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 502 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 503 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 504 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 505 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 506 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 507 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 508 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 509 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 510 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 511 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 531 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 532 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 533 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 534 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 535 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 536 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 537 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 546 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 548 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 549 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 553 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 554 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 556 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 557 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 558 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 559 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 560 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 561 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 562 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 564 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 565 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 566 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 567 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 568 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 569 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 570 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 571 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 572 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 573 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 574 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 575 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 576 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 577 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 579 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 580 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 581 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 582 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 583 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 584 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 585 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 586 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 587 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 588 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 589 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 590 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 591 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 592 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 593 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 594 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 595 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 596 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 598 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 599 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 600 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 601 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 602 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 603 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 604 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 605 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 606 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 607 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 608 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 609 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 610 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 611 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 612 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 613 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 614 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 615 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 616 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 617 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 618 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 619 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 620 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 621 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 622 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 623 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.08 |
| Metatranscriptomes | 0.1 |
| Isolates | 16.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.9 |
| Nodule | 13.09 |
| Rhizoplane | 7.4 |
| Rhizosphere | 52.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001545 | 3300003215 | Bacteria | 13670 |
| 2 | JGI25153J46596_10003712 | 3300003215 | Bacteria | 8429 |
| 3 | JGI25153J46596_10003975 | 3300003215 | Bacteria | 8089 |
| 4 | JGI25153J46596_10016779 | 3300003215 | Bacteria | 2917 |
| 5 | JGI25160J50197_1003036 | 3300003354 | Bacteria | 7655 |
| 6 | JGI25404J52841_10009905 | 3300003659 | Bacteria | 2044 |
| 7 | JGI25404J52841_10020979 | 3300003659 | Bacteria | 1414 |
| 8 | JGI25404J52841_10045704 | 3300003659 | Bacteria | 923 |
| 9 | JGI25404J52841_10060183 | 3300003659 | Bacteria | 796 |
| 10 | Ga0055542_1002315 | 3300003762 | Bacteria | 6550 |
| 11 | Ga0055529_1039971 | 3300003763 | Bacteria | 569 |
| 12 | Ga0055526_1038662 | 3300003771 | Bacteria | 1227 |
| 13 | Ga0055531_10031944 | 3300003794 | Bacteria | 1731 |
| 14 | Ga0065165_1009084 | 3300005262 | Bacteria | 4519 |
| 15 | Ga0070683_100200130 | 3300005329 | Bacteria | 1897 |
| 16 | Ga0070683_100663465 | 3300005329 | Bacteria | 998 |
| 17 | Ga0070670_100522711 | 3300005331 | Bacteria | 1057 |
| 18 | Ga0070670_100797797 | 3300005331 | Bacteria | 853 |
| 19 | Ga0068869_100405036 | 3300005334 | Bacteria | 1123 |
| 20 | Ga0070666_10377989 | 3300005335 | Bacteria | 1017 |
| 21 | Ga0070680_100210780 | 3300005336 | Bacteria | 1639 |
| 22 | Ga0070682_100310912 | 3300005337 | Bacteria | 1160 |
| 23 | Ga0068868_101145613 | 3300005338 | Bacteria | 717 |
| 24 | Ga0070661_100086294 | 3300005344 | Bacteria | 2320 |
| 25 | Ga0070668_100071817 | 3300005347 | Bacteria | 2696 |
| 26 | Ga0070668_100103943 | 3300005347 | Bacteria | 2254 |
| 27 | Ga0070668_100145405 | 3300005347 | Bacteria | 1913 |
| 28 | Ga0070668_100631157 | 3300005347 | Bacteria | 940 |
| 29 | Ga0070671_100047293 | 3300005355 | Bacteria | 3578 |
| 30 | Ga0070674_100716824 | 3300005356 | Bacteria | 856 |
| 31 | Ga0070688_100170205 | 3300005365 | Bacteria | 1503 |
| 32 | Ga0070667_100667180 | 3300005367 | Bacteria | 961 |
| 33 | Ga0070709_10119514 | 3300005434 | Bacteria | 1784 |
| 34 | Ga0070709_10308962 | 3300005434 | Bacteria | 1157 |
| 35 | Ga0070709_10866062 | 3300005434 | Bacteria | 713 |
| 36 | Ga0070714_100009317 | 3300005435 | Bacteria | 7713 |
| 37 | Ga0070714_101512203 | 3300005435 | Bacteria | 656 |
| 38 | Ga0070713_100111093 | 3300005436 | Bacteria | 2390 |
| 39 | Ga0070710_10001623 | 3300005437 | Bacteria | 10622 |
| 40 | Ga0070711_100002600 | 3300005439 | Bacteria | 10342 |
| 41 | Ga0070663_100245385 | 3300005455 | Bacteria | 1415 |
| 42 | Ga0070678_100130094 | 3300005456 | Bacteria | 1998 |
| 43 | Ga0070678_100136192 | 3300005456 | Bacteria | 1958 |
| 44 | Ga0070678_100140700 | 3300005456 | Bacteria | 1931 |
| 45 | Ga0070678_100533455 | 3300005456 | Bacteria | 1040 |
| 46 | Ga0070678_100990004 | 3300005456 | Bacteria | 772 |
| 47 | Ga0070681_10059065 | 3300005458 | Bacteria | 3814 |
| 48 | Ga0070681_10120889 | 3300005458 | Bacteria | 2554 |
| 49 | Ga0070681_10576844 | 3300005458 | Bacteria | 1039 |
| 50 | Ga0070699_100364648 | 3300005518 | Bacteria | 1303 |
| 51 | Ga0070679_100355837 | 3300005530 | Bacteria | 1412 |
| 52 | Ga0070684_100515847 | 3300005535 | Bacteria | 1108 |
| 53 | Ga0068853_100096571 | 3300005539 | Bacteria | 2607 |
| 54 | Ga0068853_100196899 | 3300005539 | Bacteria | 1833 |
| 55 | Ga0068853_100334691 | 3300005539 | Bacteria | 1406 |
| 56 | Ga0070672_100549490 | 3300005543 | Bacteria | 1003 |
| 57 | Ga0070696_100439503 | 3300005546 | Bacteria | 1027 |
| 58 | Ga0070693_100051061 | 3300005547 | Bacteria | 2366 |
| 59 | Ga0070693_100097209 | 3300005547 | Bacteria | 1787 |
| 60 | Ga0070693_100471662 | 3300005547 | Bacteria | 885 |
| 61 | Ga0070665_100169276 | 3300005548 | Bacteria | 2186 |
| 62 | Ga0070665_100183895 | 3300005548 | Bacteria | 2090 |
| 63 | Ga0070665_101748841 | 3300005548 | Bacteria | 629 |
| 64 | Ga0068855_100106562 | 3300005563 | Bacteria | 3221 |
| 65 | Ga0068857_100144830 | 3300005577 | Bacteria | 2149 |
| 66 | Ga0068857_100208519 | 3300005577 | Bacteria | 1782 |
| 67 | Ga0068854_100754336 | 3300005578 | Bacteria | 845 |
| 68 | Ga0068856_100327511 | 3300005614 | Bacteria | 1549 |
| 69 | Ga0068856_100450631 | 3300005614 | Bacteria | 1308 |
| 70 | Ga0068856_101738401 | 3300005614 | Bacteria | 636 |
| 71 | Ga0070702_100545629 | 3300005615 | Bacteria | 860 |
| 72 | Ga0068852_100035224 | 3300005616 | Bacteria | 4173 |
| 73 | Ga0068852_100099846 | 3300005616 | Bacteria | 2617 |
| 74 | Ga0068852_101806298 | 3300005616 | Bacteria | 634 |
| 75 | Ga0068859_100256367 | 3300005617 | Bacteria | 1840 |
| 76 | Ga0068859_101269473 | 3300005617 | Bacteria | 811 |
| 77 | Ga0068859_101918619 | 3300005617 | Bacteria | 654 |
| 78 | Ga0068864_100214742 | 3300005618 | Bacteria | 1773 |
| 79 | Ga0068870_11045159 | 3300005840 | Bacteria | 585 |
| 80 | Ga0068858_100096388 | 3300005842 | Bacteria | 2756 |
| 81 | Ga0068858_100136471 | 3300005842 | Bacteria | 2301 |
| 82 | Ga0068860_100000367 | 3300005843 | Bacteria | 59534 |
| 83 | Ga0068860_100275629 | 3300005843 | Bacteria | 1643 |
| 84 | Ga0068862_100481751 | 3300005844 | Bacteria | 1174 |
| 85 | Ga0081455_10005963 | 3300005937 | Bacteria | 13212 |
| 86 | Ga0081455_10082596 | 3300005937 | Bacteria | 2628 |
| 87 | Ga0081540_1009361 | 3300005983 | Bacteria | 6756 |
| 88 | Ga0081540_1017980 | 3300005983 | Bacteria | 4354 |
| 89 | Ga0081540_1025360 | 3300005983 | Bacteria | 3413 |
| 90 | Ga0081540_1025400 | 3300005983 | Bacteria | 3409 |
| 91 | Ga0081540_1057447 | 3300005983 | Bacteria | 1882 |
| 92 | Ga0081539_10023797 | 3300005985 | Bacteria | 3998 |
| 93 | Ga0081539_10069314 | 3300005985 | Bacteria | 1899 |
| 94 | Ga0070717_10050183 | 3300006028 | Bacteria | 3428 |
| 95 | Ga0070717_10253006 | 3300006028 | Bacteria | 1557 |
| 96 | Ga0070717_10350458 | 3300006028 | Bacteria | 1320 |
| 97 | Ga0075365_10044781 | 3300006038 | Bacteria | 2901 |
| 98 | Ga0075365_10048215 | 3300006038 | Bacteria | 2803 |
| 99 | Ga0075365_10433016 | 3300006038 | Bacteria | 929 |
| 100 | Ga0075368_10007086 | 3300006042 | Bacteria | 3948 |
| 101 | Ga0075368_10026301 | 3300006042 | Bacteria | 2238 |
| 102 | Ga0075363_100054681 | 3300006048 | Bacteria | 2136 |
| 103 | Ga0075363_100216706 | 3300006048 | Bacteria | 1096 |
| 104 | Ga0075363_100231412 | 3300006048 | Bacteria | 1061 |
| 105 | Ga0075363_100320648 | 3300006048 | Bacteria | 902 |
| 106 | Ga0075364_10349673 | 3300006051 | Bacteria | 1007 |
| 107 | Ga0075364_10433616 | 3300006051 | Bacteria | 898 |
| 108 | Ga0070715_10207749 | 3300006163 | Bacteria | 999 |
| 109 | Ga0070716_100048505 | 3300006173 | Bacteria | 2401 |
| 110 | Ga0070712_100149931 | 3300006175 | Bacteria | 1789 |
| 111 | Ga0070712_100696505 | 3300006175 | Bacteria | 866 |
| 112 | Ga0075362_10071498 | 3300006177 | Bacteria | 1585 |
| 113 | Ga0075362_10084236 | 3300006177 | Bacteria | 1468 |
| 114 | Ga0075362_10125668 | 3300006177 | Bacteria | 1217 |
| 115 | Ga0075362_10278658 | 3300006177 | Bacteria | 827 |
| 116 | Ga0075367_10053707 | 3300006178 | Bacteria | 2388 |
| 117 | Ga0075367_10095584 | 3300006178 | Bacteria | 1812 |
| 118 | Ga0075367_10924306 | 3300006178 | Bacteria | 556 |
| 119 | Ga0075369_10113439 | 3300006186 | Bacteria | 1223 |
| 120 | Ga0075369_10242851 | 3300006186 | Bacteria | 835 |
| 121 | Ga0075369_10322707 | 3300006186 | Bacteria | 722 |
| 122 | Ga0075369_10342871 | 3300006186 | Bacteria | 700 |
| 123 | Ga0075366_10091150 | 3300006195 | Bacteria | 1826 |
| 124 | Ga0075366_10095291 | 3300006195 | Bacteria | 1784 |
| 125 | Ga0097621_100432833 | 3300006237 | Bacteria | 1182 |
| 126 | Ga0075370_10024162 | 3300006353 | Bacteria | 3354 |
| 127 | Ga0075370_10027287 | 3300006353 | Bacteria | 3167 |
| 128 | Ga0075370_10181635 | 3300006353 | Bacteria | 1238 |
| 129 | Ga0075370_10276290 | 3300006353 | Bacteria | 998 |
| 130 | Ga0068871_100307152 | 3300006358 | Bacteria | 1394 |
| 131 | Ga0075434_100209149 | 3300006871 | Bacteria | 1971 |
| 132 | Ga0075434_100733678 | 3300006871 | Bacteria | 1005 |
| 133 | Ga0075429_101236216 | 3300006880 | Bacteria | 652 |
| 134 | Ga0068865_100734418 | 3300006881 | Bacteria | 846 |
| 135 | Ga0075436_100709886 | 3300006914 | Bacteria | 745 |
| 136 | Ga0097620_100256370 | 3300006931 | Bacteria | 1840 |
| 137 | Ga0097620_100375662 | 3300006931 | Bacteria | 1517 |
| 138 | Ga0097620_101269513 | 3300006931 | Bacteria | 811 |
| 139 | Ga0097620_101917685 | 3300006931 | Bacteria | 654 |
| 140 | Ga0099825_1051875 | 3300006941 | Bacteria | 859 |
| 141 | Ga0099824_1031414 | 3300006942 | Bacteria | 2018 |
| 142 | Ga0099822_1070392 | 3300006943 | Bacteria | 986 |
| 143 | Ga0099823_1016181 | 3300006944 | Bacteria | 7341 |
| 144 | Ga0099823_1099633 | 3300006944 | Bacteria | 898 |
| 145 | Ga0075435_100341684 | 3300007076 | Bacteria | 1283 |
| 146 | Ga0099794_10014948 | 3300007265 | Bacteria | 3414 |
| 147 | Ga0105240_10097539 | 3300009093 | Bacteria | 3581 |
| 148 | Ga0105240_10257634 | 3300009093 | Bacteria | 2014 |
| 149 | Ga0105245_10035055 | 3300009098 | Bacteria | 4452 |
| 150 | Ga0105245_10153537 | 3300009098 | Bacteria | 2179 |
| 151 | Ga0105247_10017288 | 3300009101 | Bacteria | 4329 |
| 152 | Ga0105247_10040927 | 3300009101 | Bacteria | 2834 |
| 153 | Ga0105247_10155100 | 3300009101 | Bacteria | 1512 |
| 154 | Ga0105247_10217410 | 3300009101 | Bacteria | 1292 |
| 155 | Ga0105243_10163960 | 3300009148 | Bacteria | 1919 |
| 156 | Ga0105243_11274174 | 3300009148 | Bacteria | 751 |
| 157 | Ga0105241_10022979 | 3300009174 | Bacteria | 4623 |
| 158 | Ga0105241_10071503 | 3300009174 | Bacteria | 2693 |
| 159 | Ga0105241_10094456 | 3300009174 | Bacteria | 2365 |
| 160 | Ga0105241_10357440 | 3300009174 | Bacteria | 1270 |
| 161 | Ga0105241_10420292 | 3300009174 | Bacteria | 1176 |
| 162 | Ga0105241_10528139 | 3300009174 | Bacteria | 1056 |
| 163 | Ga0105242_10092057 | 3300009176 | Bacteria | 2554 |
| 164 | Ga0105242_10571422 | 3300009176 | Bacteria | 1087 |
| 165 | Ga0105242_10597086 | 3300009176 | Bacteria | 1066 |
| 166 | Ga0105248_10272253 | 3300009177 | Bacteria | 1907 |
| 167 | Ga0105248_10713352 | 3300009177 | Bacteria | 1132 |
| 168 | Ga0105237_10036086 | 3300009545 | Bacteria | 5002 |
| 169 | Ga0105237_10180282 | 3300009545 | Bacteria | 2113 |
| 170 | Ga0105237_10204960 | 3300009545 | Bacteria | 1972 |
| 171 | Ga0105237_10219970 | 3300009545 | Bacteria | 1899 |
| 172 | Ga0105237_10459895 | 3300009545 | Bacteria | 1279 |
| 173 | Ga0105238_10130744 | 3300009551 | Bacteria | 2489 |
| 174 | Ga0105238_10281315 | 3300009551 | Bacteria | 1645 |
| 175 | Ga0105238_10363603 | 3300009551 | Bacteria | 1437 |
| 176 | Ga0105238_10381016 | 3300009551 | Bacteria | 1402 |
| 177 | Ga0105238_10441472 | 3300009551 | Bacteria | 1298 |
| 178 | Ga0105238_10806522 | 3300009551 | Bacteria | 954 |
| 179 | Ga0105239_10078222 | 3300010375 | Bacteria | 3640 |
| 180 | Ga0105239_10138528 | 3300010375 | Bacteria | 2710 |
| 181 | Ga0105239_10345144 | 3300010375 | Bacteria | 1680 |
| 182 | Ga0105239_10452600 | 3300010375 | Bacteria | 1456 |
| 183 | Ga0105239_10839295 | 3300010375 | Bacteria | 1053 |
| 184 | Ga0105239_10862669 | 3300010375 | Bacteria | 1038 |
| 185 | Ga0105239_11654658 | 3300010375 | Bacteria | 741 |
| 186 | Ga0105239_12273241 | 3300010375 | Bacteria | 631 |
| 187 | Ga0105239_12279171 | 3300010375 | Bacteria | 630 |
| 188 | Ga0105246_10062491 | 3300011119 | Bacteria | 2595 |
| 189 | Ga0105246_10324616 | 3300011119 | Bacteria | 1252 |
| 190 | Ga0157342_1026416 | 3300012507 | Bacteria | 707 |
| 191 | Ga0157370_10117616 | 3300013104 | Bacteria | 2483 |
| 192 | Ga0157374_10098280 | 3300013296 | Bacteria | 2802 |
| 193 | Ga0157374_10159026 | 3300013296 | Bacteria | 2200 |
| 194 | Ga0157374_11083567 | 3300013296 | Bacteria | 821 |
| 195 | Ga0157378_10068602 | 3300013297 | Bacteria | 3180 |
| 196 | Ga0157378_10159002 | 3300013297 | Bacteria | 2112 |
| 197 | Ga0163162_10163256 | 3300013306 | Bacteria | 2350 |
| 198 | Ga0163162_10416075 | 3300013306 | Bacteria | 1476 |
| 199 | Ga0163162_11138511 | 3300013306 | Bacteria | 885 |
| 200 | Ga0157372_10174205 | 3300013307 | Bacteria | 2490 |
| 201 | Ga0157372_10655539 | 3300013307 | Bacteria | 1222 |
| 202 | Ga0157375_10113699 | 3300013308 | Bacteria | 2808 |
| 203 | Ga0157375_10321761 | 3300013308 | Bacteria | 1711 |
| 204 | Ga0157375_11409464 | 3300013308 | Bacteria | 821 |
| 205 | Ga0157375_12236816 | 3300013308 | Bacteria | 652 |
| 206 | Ga0163163_10062643 | 3300014325 | Bacteria | 3686 |
| 207 | Ga0163163_10107040 | 3300014325 | Bacteria | 2822 |
| 208 | Ga0163163_10239356 | 3300014325 | Bacteria | 1865 |
| 209 | Ga0163163_10433885 | 3300014325 | Bacteria | 1373 |
| 210 | Ga0163163_11013229 | 3300014325 | Bacteria | 894 |
| 211 | Ga0157380_10674945 | 3300014326 | Bacteria | 1034 |
| 212 | Ga0157377_10469638 | 3300014745 | Bacteria | 873 |
| 213 | Ga0157376_10004272 | 3300014969 | Bacteria | 9918 |
| 214 | Ga0157376_11122562 | 3300014969 | Bacteria | 812 |
| 215 | Ga0182005_1091804 | 3300015265 | Bacteria | 845 |
| 216 | Ga0163161_10298534 | 3300017792 | Bacteria | 1268 |
| 217 | Ga0206353_11199008 | 3300020082 | Bacteria | 2032 |
| 218 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 219 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 220 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 221 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 222 | Ga0213873_10011107 | 3300021358 | Bacteria | 1918 |
| 223 | Ga0213876_10002782 | 3300021384 | Bacteria | 10187 |
| 224 | Ga0213876_10206921 | 3300021384 | Bacteria | 1043 |
| 225 | Ga0213871_10008575 | 3300021441 | Bacteria | 2261 |
| 226 | Ga0207425_1015495 | 3300025245 | Bacteria | 1709 |
| 227 | Ga0209677_101642 | 3300025253 | Bacteria | 9406 |
| 228 | Ga0209148_1001022 | 3300025254 | Bacteria | 17599 |
| 229 | Ga0209148_1014767 | 3300025254 | Bacteria | 1376 |
| 230 | Ga0209233_1002396 | 3300025261 | Bacteria | 6923 |
| 231 | Ga0209233_1008190 | 3300025261 | Bacteria | 3254 |
| 232 | Ga0209233_1027288 | 3300025261 | Bacteria | 1385 |
| 233 | Ga0209233_1058459 | 3300025261 | Bacteria | 754 |
| 234 | Ga0209455_1003787 | 3300025272 | Bacteria | 5202 |
| 235 | Ga0209455_1012975 | 3300025272 | Bacteria | 1961 |
| 236 | Ga0209455_1030912 | 3300025272 | Bacteria | 907 |
| 237 | Ga0209564_1009562 | 3300025295 | Bacteria | 4593 |
| 238 | Ga0209564_1012127 | 3300025295 | Bacteria | 3787 |
| 239 | Ga0209758_1000595 | 3300025297 | Bacteria | 56364 |
| 240 | Ga0209758_1000604 | 3300025297 | Bacteria | 55558 |
| 241 | Ga0209758_1001332 | 3300025297 | Bacteria | 29913 |
| 242 | Ga0209758_1005029 | 3300025297 | Bacteria | 10525 |
| 243 | Ga0209758_1006626 | 3300025297 | Bacteria | 8204 |
| 244 | Ga0209758_1107988 | 3300025297 | Bacteria | 776 |
| 245 | Ga0209758_1114322 | 3300025297 | Bacteria | 741 |
| 246 | Ga0209256_1005227 | 3300025299 | Bacteria | 7610 |
| 247 | Ga0209256_1073616 | 3300025299 | Bacteria | 762 |
| 248 | Ga0207426_1000500 | 3300025302 | Bacteria | 58181 |
| 249 | Ga0207426_1002368 | 3300025302 | Bacteria | 12217 |
| 250 | Ga0209257_1001217 | 3300025304 | Bacteria | 32229 |
| 251 | Ga0209257_1013493 | 3300025304 | Bacteria | 3625 |
| 252 | Ga0207697_10051661 | 3300025315 | Bacteria | 1699 |
| 253 | Ga0207697_10061848 | 3300025315 | Bacteria | 1558 |
| 254 | Ga0207696_1060702 | 3300025711 | Bacteria | 1064 |
| 255 | Ga0207692_10020286 | 3300025898 | Bacteria | 3020 |
| 256 | Ga0207642_10022211 | 3300025899 | Bacteria | 2512 |
| 257 | Ga0207642_10368731 | 3300025899 | Bacteria | 852 |
| 258 | Ga0207710_10019370 | 3300025900 | Bacteria | 2903 |
| 259 | Ga0207710_10059403 | 3300025900 | Bacteria | 1731 |
| 260 | Ga0207688_10133793 | 3300025901 | Bacteria | 1455 |
| 261 | Ga0207688_10169394 | 3300025901 | Bacteria | 1298 |
| 262 | Ga0207688_10321271 | 3300025901 | Bacteria | 950 |
| 263 | Ga0207680_10209180 | 3300025903 | Bacteria | 1333 |
| 264 | Ga0207647_10000809 | 3300025904 | Bacteria | 24246 |
| 265 | Ga0207685_10531917 | 3300025905 | Bacteria | 623 |
| 266 | Ga0207699_10047038 | 3300025906 | Bacteria | 2527 |
| 267 | Ga0207699_10347838 | 3300025906 | Bacteria | 1046 |
| 268 | Ga0207699_10411575 | 3300025906 | Bacteria | 964 |
| 269 | Ga0207645_10094910 | 3300025907 | Bacteria | 1920 |
| 270 | Ga0207645_10349114 | 3300025907 | Bacteria | 990 |
| 271 | Ga0207643_10004944 | 3300025908 | Bacteria | 7132 |
| 272 | Ga0207643_10099827 | 3300025908 | Bacteria | 1701 |
| 273 | Ga0207643_10519980 | 3300025908 | Bacteria | 762 |
| 274 | Ga0207654_10024849 | 3300025911 | Bacteria | 3225 |
| 275 | Ga0207654_10042969 | 3300025911 | Bacteria | 2560 |
| 276 | Ga0207654_10065125 | 3300025911 | Bacteria | 2145 |
| 277 | Ga0207654_10161942 | 3300025911 | Bacteria | 1446 |
| 278 | Ga0207707_10054246 | 3300025912 | Bacteria | 3489 |
| 279 | Ga0207707_10163382 | 3300025912 | Bacteria | 1946 |
| 280 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 281 | Ga0207695_10260343 | 3300025913 | Bacteria | 1632 |
| 282 | Ga0207671_10017843 | 3300025914 | Bacteria | 5460 |
| 283 | Ga0207671_10156502 | 3300025914 | Bacteria | 1763 |
| 284 | Ga0207671_10225088 | 3300025914 | Bacteria | 1470 |
| 285 | Ga0207671_10329786 | 3300025914 | Bacteria | 1208 |
| 286 | Ga0207671_10835451 | 3300025914 | Bacteria | 730 |
| 287 | Ga0207693_10017479 | 3300025915 | Bacteria | 5721 |
| 288 | Ga0207693_10599361 | 3300025915 | Bacteria | 858 |
| 289 | Ga0207663_10093655 | 3300025916 | Bacteria | 2000 |
| 290 | Ga0207663_10631438 | 3300025916 | Bacteria | 844 |
| 291 | Ga0207660_10081611 | 3300025917 | Bacteria | 2377 |
| 292 | Ga0207662_10100747 | 3300025918 | Bacteria | 1789 |
| 293 | Ga0207657_10321217 | 3300025919 | Bacteria | 1224 |
| 294 | Ga0207657_10464861 | 3300025919 | Bacteria | 992 |
| 295 | Ga0207649_10054147 | 3300025920 | Bacteria | 2496 |
| 296 | Ga0207652_10098834 | 3300025921 | Bacteria | 2574 |
| 297 | Ga0207681_10518018 | 3300025923 | Bacteria | 978 |
| 298 | Ga0207694_10120934 | 3300025924 | Bacteria | 2091 |
| 299 | Ga0207694_10183233 | 3300025924 | Bacteria | 1699 |
| 300 | Ga0207694_10475199 | 3300025924 | Bacteria | 1045 |
| 301 | Ga0207650_10185992 | 3300025925 | Bacteria | 1657 |
| 302 | Ga0207650_10257937 | 3300025925 | Bacteria | 1413 |
| 303 | Ga0207659_10617647 | 3300025926 | Bacteria | 925 |
| 304 | Ga0207687_10013862 | 3300025927 | Bacteria | 5265 |
| 305 | Ga0207687_10128143 | 3300025927 | Bacteria | 1908 |
| 306 | Ga0207687_10190187 | 3300025927 | Bacteria | 1597 |
| 307 | Ga0207700_10055580 | 3300025928 | Bacteria | 2976 |
| 308 | Ga0207644_10115686 | 3300025931 | Bacteria | 2034 |
| 309 | Ga0207644_10138400 | 3300025931 | Bacteria | 1872 |
| 310 | Ga0207690_10255795 | 3300025932 | Bacteria | 1355 |
| 311 | Ga0207706_10084263 | 3300025933 | Bacteria | 2794 |
| 312 | Ga0207706_10405394 | 3300025933 | Bacteria | 1182 |
| 313 | Ga0207686_10307016 | 3300025934 | Bacteria | 1180 |
| 314 | Ga0207709_10164080 | 3300025935 | Bacteria | 1552 |
| 315 | Ga0207709_10889825 | 3300025935 | Bacteria | 723 |
| 316 | Ga0207709_11022253 | 3300025935 | Bacteria | 676 |
| 317 | Ga0207670_10163221 | 3300025936 | Bacteria | 1665 |
| 318 | Ga0207669_10017039 | 3300025937 | Bacteria | 3714 |
| 319 | Ga0207669_10418624 | 3300025937 | Bacteria | 1054 |
| 320 | Ga0207704_10134148 | 3300025938 | Bacteria | 1720 |
| 321 | Ga0207704_11532497 | 3300025938 | Bacteria | 572 |
| 322 | Ga0207665_10010040 | 3300025939 | Bacteria | 6217 |
| 323 | Ga0207691_10133924 | 3300025940 | Bacteria | 2187 |
| 324 | Ga0207691_10407220 | 3300025940 | Bacteria | 1160 |
| 325 | Ga0207691_11195863 | 3300025940 | Bacteria | 630 |
| 326 | Ga0207711_10082496 | 3300025941 | Bacteria | 2810 |
| 327 | Ga0207711_10177015 | 3300025941 | Bacteria | 1938 |
| 328 | Ga0207689_10112861 | 3300025942 | Bacteria | 2234 |
| 329 | Ga0207689_10136945 | 3300025942 | Bacteria | 2016 |
| 330 | Ga0207661_10108866 | 3300025944 | Bacteria | 2340 |
| 331 | Ga0207679_11012622 | 3300025945 | Bacteria | 761 |
| 332 | Ga0207667_10022298 | 3300025949 | Bacteria | 6998 |
| 333 | Ga0207667_10230284 | 3300025949 | Bacteria | 1898 |
| 334 | Ga0207651_10130277 | 3300025960 | Bacteria | 1924 |
| 335 | Ga0207651_10228541 | 3300025960 | Bacteria | 1509 |
| 336 | Ga0207712_11678954 | 3300025961 | Bacteria | 569 |
| 337 | Ga0207668_10160886 | 3300025972 | Bacteria | 1749 |
| 338 | Ga0207668_10279874 | 3300025972 | Bacteria | 1367 |
| 339 | Ga0207658_10185974 | 3300025986 | Bacteria | 1723 |
| 340 | Ga0207658_11556876 | 3300025986 | Bacteria | 604 |
| 341 | Ga0207677_10043795 | 3300026023 | Bacteria | 2978 |
| 342 | Ga0207677_10138302 | 3300026023 | Bacteria | 1861 |
| 343 | Ga0207703_10041071 | 3300026035 | Bacteria | 3704 |
| 344 | Ga0207703_10298174 | 3300026035 | Bacteria | 1469 |
| 345 | Ga0207703_10486185 | 3300026035 | Bacteria | 1157 |
| 346 | Ga0207639_10177248 | 3300026041 | Bacteria | 1810 |
| 347 | Ga0207639_10363851 | 3300026041 | Bacteria | 1295 |
| 348 | Ga0207639_10393807 | 3300026041 | Bacteria | 1247 |
| 349 | Ga0207639_10483368 | 3300026041 | Bacteria | 1129 |
| 350 | Ga0207678_10070878 | 3300026067 | Bacteria | 2988 |
| 351 | Ga0207678_11089251 | 3300026067 | Bacteria | 707 |
| 352 | Ga0207708_10065642 | 3300026075 | Bacteria | 2775 |
| 353 | Ga0207702_10442860 | 3300026078 | Bacteria | 1259 |
| 354 | Ga0207702_10785019 | 3300026078 | Bacteria | 941 |
| 355 | Ga0207702_11104669 | 3300026078 | Bacteria | 787 |
| 356 | Ga0207702_11368565 | 3300026078 | Bacteria | 702 |
| 357 | Ga0207641_10185125 | 3300026088 | Bacteria | 1910 |
| 358 | Ga0207641_10469134 | 3300026088 | Bacteria | 1219 |
| 359 | Ga0207641_10948065 | 3300026088 | Bacteria | 856 |
| 360 | Ga0207648_10058938 | 3300026089 | Bacteria | 3348 |
| 361 | Ga0207676_10242608 | 3300026095 | Bacteria | 1617 |
| 362 | Ga0207676_10485069 | 3300026095 | Bacteria | 1171 |
| 363 | Ga0207674_10158819 | 3300026116 | Bacteria | 2216 |
| 364 | Ga0207674_10226270 | 3300026116 | Bacteria | 1819 |
| 365 | Ga0207674_10710059 | 3300026116 | Bacteria | 971 |
| 366 | Ga0207675_100146969 | 3300026118 | Bacteria | 2242 |
| 367 | Ga0207683_10028851 | 3300026121 | Bacteria | 4801 |
| 368 | Ga0207683_10125376 | 3300026121 | Bacteria | 2307 |
| 369 | Ga0207683_10181102 | 3300026121 | Bacteria | 1911 |
| 370 | Ga0207683_10556569 | 3300026121 | Bacteria | 1061 |
| 371 | Ga0207683_10866877 | 3300026121 | Bacteria | 838 |
| 372 | Ga0207698_10067853 | 3300026142 | Bacteria | 2814 |
| 373 | Ga0207698_10112768 | 3300026142 | Bacteria | 2283 |
| 374 | Ga0207698_10288957 | 3300026142 | Bacteria | 1520 |
| 375 | Ga0207698_10350693 | 3300026142 | Bacteria | 1394 |
| 376 | Ga0207698_10761890 | 3300026142 | Bacteria | 968 |
| 377 | Ga0207698_10765327 | 3300026142 | Bacteria | 965 |
| 378 | Ga0207698_11176026 | 3300026142 | Bacteria | 781 |
| 379 | Ga0207698_11705416 | 3300026142 | Bacteria | 645 |
| 380 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 381 | Ga0209389_1000070 | 3300027296 | Bacteria | 97498 |
| 382 | Ga0209589_1000420 | 3300027357 | Bacteria | 58471 |
| 383 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 384 | Ga0209489_100196 | 3300027361 | Bacteria | 97498 |
| 385 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 386 | Ga0209179_1003083 | 3300027512 | Bacteria | 2353 |
| 387 | Ga0209588_1040404 | 3300027671 | Bacteria | 1505 |
| 388 | Ga0209813_10048196 | 3300027866 | Bacteria | 1322 |
| 389 | Ga0209813_10128294 | 3300027866 | Bacteria | 890 |
| 390 | Ga0268266_10001750 | 3300028379 | Bacteria | 24844 |
| 391 | Ga0268266_10005449 | 3300028379 | Bacteria | 11859 |
| 392 | Ga0268266_10097894 | 3300028379 | Bacteria | 2580 |
| 393 | Ga0268266_10132547 | 3300028379 | Bacteria | 2230 |
| 394 | Ga0268266_10199329 | 3300028379 | Bacteria | 1831 |
| 395 | Ga0268266_10256709 | 3300028379 | Bacteria | 1618 |
| 396 | Ga0268266_10760568 | 3300028379 | Bacteria | 935 |
| 397 | Ga0268265_11021481 | 3300028380 | Bacteria | 817 |
| 398 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 399 | Ga0268264_10110353 | 3300028381 | Bacteria | 2408 |
| 400 | Ga0268264_10161794 | 3300028381 | Bacteria | 2017 |
| 401 | Ga0265334_10107696 | 3300028573 | Bacteria | 1003 |
| 402 | Ga0265318_10165207 | 3300028577 | Bacteria | 811 |
| 403 | Ga0265336_10000560 | 3300028666 | Bacteria | 21132 |
| 404 | Ga0307517_10178890 | 3300028786 | Bacteria | 1374 |
| 405 | Ga0307517_10326417 | 3300028786 | Bacteria | 846 |
| 406 | Ga0307515_10133021 | 3300028794 | Bacteria | 2724 |
| 407 | Ga0265338_10000271 | 3300028800 | Bacteria | 94819 |
| 408 | Ga0307511_10278380 | 3300030521 | Bacteria | 776 |
| 409 | Ga0265340_10005857 | 3300031247 | Bacteria | 6802 |
| 410 | Ga0265316_10214867 | 3300031344 | Bacteria | 1421 |
| 411 | Ga0307513_10193740 | 3300031456 | Bacteria | 1881 |
| 412 | Ga0307509_10320647 | 3300031507 | Bacteria | 1286 |
| 413 | Ga0307408_100799426 | 3300031548 | Bacteria | 856 |
| 414 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 415 | Ga0307508_10241982 | 3300031616 | Bacteria | 1402 |
| 416 | Ga0307516_10133801 | 3300031730 | Bacteria | 2256 |
| 417 | Ga0307516_10161705 | 3300031730 | Bacteria | 1989 |
| 418 | Ga0307413_10513134 | 3300031824 | Bacteria | 965 |
| 419 | Ga0307406_10134380 | 3300031901 | Bacteria | 1741 |
| 420 | Ga0307406_10147290 | 3300031901 | Bacteria | 1675 |
| 421 | Ga0307412_10408302 | 3300031911 | Bacteria | 1108 |
| 422 | Ga0307412_10813577 | 3300031911 | Bacteria | 812 |
| 423 | Ga0307412_10984088 | 3300031911 | Bacteria | 744 |
| 424 | Ga0307416_100084245 | 3300032002 | Bacteria | 2701 |
| 425 | Ga0307414_10575764 | 3300032004 | Bacteria | 1007 |
| 426 | Ga0307411_10695523 | 3300032005 | Bacteria | 885 |
| 427 | Ga0307415_100296597 | 3300032126 | Bacteria | 1337 |
| 428 | Ga0307510_10031136 | 3300033180 | Bacteria | 6032 |
| 429 | Ga0373959_0021676 | 3300034820 | Bacteria | 1236 |
| 430 | Ga0373938_0121312 | 3300034957 | Bacteria | 674 |
| 431 | Ga0373934_0009704 | 3300035086 | Bacteria | 3610 |
| 432 | Ga0373944_0106891 | 3300035089 | Bacteria | 951 |
| 433 | Ga0373951_0119604 | 3300035091 | Bacteria | 716 |
| 434 | Ga0373932_0021778 | 3300035112 | Bacteria | 1695 |
| 435 | Ga0373939_0148781 | 3300035114 | Bacteria | 851 |
| 436 | Ga0373953_0022892 | 3300035117 | Bacteria | 2361 |
| 437 | Ga0373954_0011571 | 3300035118 | Bacteria | 3912 |
| 438 | Ga0373956_0140481 | 3300035119 | Bacteria | 1133 |
| 439 | Ga0373957_0031808 | 3300035120 | Bacteria | 1940 |
| 440 | Ga0373946_0284139 | 3300035171 | Bacteria | 815 |
| 441 | Ga0373946_0328360 | 3300035171 | Bacteria | 761 |
| 442 | Ga0373955_0015334 | 3300035172 | Bacteria | 3749 |
| 443 | Ga0373924_0006000 | 3300035410 | Bacteria | 4332 |
| 444 | Ga0373931_0101514 | 3300035691 | Bacteria | 1619 |
| 445 | Ga0373931_0349698 | 3300035691 | Bacteria | 925 |
| 446 | Ga0373935_0183460 | 3300035692 | Bacteria | 1438 |
| 447 | Ga0373935_0228053 | 3300035692 | Bacteria | 1296 |
| 448 | Ga0373927_0004320 | 3300035695 | Bacteria | 9967 |
| 449 | Ga0373927_0047393 | 3300035695 | Bacteria | 2780 |
| 450 | Ga0373933_0021248 | 3300035724 | Bacteria | 3685 |
| 451 | Ga0373937_0073767 | 3300036401 | Bacteria | 3148 |
| 452 | Ga0373925_0039274 | 3300037068 | Bacteria | 3502 |
| 453 | Ga0373925_0167487 | 3300037068 | Bacteria | 1733 |
| 454 | Ga0373925_0400779 | 3300037068 | Bacteria | 1119 |
| 455 | Ga0373925_1309624 | 3300037068 | Bacteria | 594 |
| 456 | Ga0395899_0273897 | 3300037312 | Bacteria | 1150 |
| 457 | Ga0395900_0178057 | 3300037418 | Bacteria | 2162 |
| 458 | Ga0395900_0360121 | 3300037418 | Bacteria | 1426 |
| 459 | Ga0395900_0446611 | 3300037418 | Bacteria | 1250 |
| 460 | Ga0395898_0165429 | 3300037466 | Bacteria | 2115 |
| 461 | Ga0395905_0004875 | 3300037471 | Bacteria | 13829 |
| 462 | Ga0395905_0012983 | 3300037471 | Bacteria | 8005 |
| 463 | Ga0395905_0081127 | 3300037471 | Bacteria | 3040 |
| 464 | Ga0395905_0744728 | 3300037471 | Bacteria | 882 |
| 465 | Ga0436364_0575905 | 3300037853 | Bacteria | 2015 |
| 466 | Ga0436364_1072071 | 3300037853 | Bacteria | 1406 |
| 467 | Ga0436364_1201965 | 3300037853 | Bacteria | 1293 |
| 468 | Ga0395901_0007708 | 3300038443 | Bacteria | 10856 |
| 469 | Ga0395901_0102845 | 3300038443 | Bacteria | 2998 |
| 470 | Ga0395901_0268958 | 3300038443 | Bacteria | 1773 |
| 471 | Ga0395901_0325799 | 3300038443 | Bacteria | 1589 |
| 472 | Ga0395901_1078356 | 3300038443 | Bacteria | 775 |
| 473 | Ga0436365_0024912 | 3300039437 | Bacteria | 3590 |
| 474 | Ga0436365_0066782 | 3300039437 | Bacteria | 1047 |
| 475 | Ga0436365_0198024 | 3300039437 | Bacteria | 1046 |
| 476 | Ga0436365_1058179 | 3300039437 | Bacteria | 1939 |
| 477 | Ga0436365_1083010 | 3300039437 | Bacteria | 744 |
| 478 | Ga0436365_1145349 | 3300039437 | Bacteria | 3464 |
| 479 | Ga0436365_1272860 | 3300039437 | Bacteria | 25483 |
| 480 | Ga0436365_1730046 | 3300039437 | Bacteria | 3169 |
| 481 | Ga0436360_0054328 | 3300039438 | Bacteria | 2054 |
| 482 | Ga0436361_0244793 | 3300039447 | Bacteria | 3118 |
| 483 | Ga0436363_1035359 | 3300039450 | Bacteria | 792 |
| 484 | Ga0436363_1041115 | 3300039450 | Bacteria | 2834 |
| 485 | Ga0436363_1501048 | 3300039450 | Bacteria | 4628 |
| 486 | Ga0436362_0098915 | 3300039453 | Bacteria | 7476 |
| 487 | Ga0436362_0999249 | 3300039453 | Bacteria | 2898 |
| 488 | Ga0451787_264771 | 3300041441 | Bacteria | 668 |
| 489 | Ga0451793_1168289 | 3300041452 | Bacteria | 566 |
| 490 | Ga0451797_0551223 | 3300041453 | Bacteria | 634 |
| 491 | Ga0451798_0889358 | 3300041458 | Bacteria | 579 |
| 492 | Ga0451841_0822327 | 3300041498 | Bacteria | 869 |
| 493 | Ga0451853_0828513 | 3300041512 | Bacteria | 882 |
| 494 | Ga0439451_097863 | 3300042009 | Bacteria | 593 |
| 495 | Ga0439446_0143078 | 3300042156 | Bacteria | 782 |
| 496 | Ga0466972_0290874 | 3300044658 | Bacteria | 763 |
| 497 | Ga0466972_0434317 | 3300044658 | Bacteria | 616 |
| 498 | Ga0466965_0008749 | 3300044683 | Bacteria | 4690 |
| 499 | Ga0466965_0049162 | 3300044683 | Bacteria | 2090 |
| 500 | Ga0466966_0513492 | 3300044684 | Bacteria | 721 |
| 501 | Ga0466963_0172797 | 3300044694 | Bacteria | 1507 |
| 502 | Ga0466963_0686548 | 3300044694 | Bacteria | 722 |
| 503 | Ga0466964_0638306 | 3300044706 | Bacteria | 588 |
| 504 | Ga0466971_0095286 | 3300044719 | Bacteria | 1365 |
| 505 | Ga0466968_0044536 | 3300044735 | Bacteria | 1881 |
| 506 | Ga0466970_0174738 | 3300044765 | Bacteria | 1191 |
| 507 | Ga0466957_0110450 | 3300044842 | Bacteria | 1743 |
| 508 | Ga0466960_0293881 | 3300044901 | Bacteria | 914 |
| 509 | Ga0466960_0766001 | 3300044901 | Bacteria | 582 |
| 510 | Ga0466959_0204762 | 3300045049 | Bacteria | 1373 |
| 511 | Ga0466958_0148746 | 3300045836 | Bacteria | 1477 |
| 512 | Ga0466958_0692538 | 3300045836 | Bacteria | 664 |
| 513 | Ga0466967_0050670 | 3300045976 | Bacteria | 3636 |
| 514 | Ga0466967_0105036 | 3300045976 | Bacteria | 2587 |
| 515 | Ga0495627_050768 | 3300046453 | Bacteria | 1249 |
| 516 | Ga0495592_0025512 | 3300046454 | Bacteria | 4486 |
| 517 | Ga0495603_0008563 | 3300046455 | Bacteria | 6182 |
| 518 | Ga0495603_0036192 | 3300046455 | Bacteria | 2963 |
| 519 | Ga0495629_0013615 | 3300046459 | Bacteria | 5869 |
| 520 | Ga0495638_0023174 | 3300046460 | Bacteria | 4065 |
| 521 | Ga0495651_0029933 | 3300046462 | Bacteria | 4245 |
| 522 | Ga0495653_0036044 | 3300046463 | Bacteria | 3899 |
| 523 | Ga0495580_0122657 | 3300046472 | Bacteria | 1804 |
| 524 | Ga0495582_0536299 | 3300046473 | Bacteria | 677 |
| 525 | Ga0495605_0029311 | 3300046474 | Bacteria | 2835 |
| 526 | Ga0495605_0337569 | 3300046474 | Bacteria | 633 |
| 527 | Ga0495639_0012900 | 3300046475 | Bacteria | 3606 |
| 528 | Ga0495639_0079933 | 3300046475 | Bacteria | 1521 |
| 529 | Ga0495639_0285222 | 3300046475 | Bacteria | 821 |
| 530 | Ga0495662_0390799 | 3300046476 | Bacteria | 683 |
| 531 | Ga0495584_0171270 | 3300046491 | Bacteria | 1103 |
| 532 | Ga0495585_0045326 | 3300046492 | Bacteria | 2455 |
| 533 | Ga0495585_0202630 | 3300046492 | Bacteria | 1009 |
| 534 | Ga0495585_0406931 | 3300046492 | Bacteria | 655 |
| 535 | Ga0495606_0129346 | 3300046507 | Bacteria | 1503 |
| 536 | Ga0495606_0314086 | 3300046507 | Bacteria | 844 |
| 537 | Ga0495608_0018003 | 3300046511 | Bacteria | 4880 |
| 538 | Ga0495610_0151587 | 3300046512 | Bacteria | 988 |
| 539 | Ga0495616_0050458 | 3300046513 | Bacteria | 2080 |
| 540 | Ga0495616_0188975 | 3300046513 | Bacteria | 911 |
| 541 | Ga0495620_0029187 | 3300046515 | Bacteria | 2556 |
| 542 | Ga0495628_0084347 | 3300046516 | Bacteria | 2465 |
| 543 | Ga0495632_0026711 | 3300046519 | Bacteria | 3034 |
| 544 | Ga0495632_0352628 | 3300046519 | Bacteria | 647 |
| 545 | Ga0495643_0004848 | 3300046522 | Bacteria | 9271 |
| 546 | Ga0495643_0026039 | 3300046522 | Bacteria | 3306 |
| 547 | Ga0495644_0025625 | 3300046523 | Bacteria | 2238 |
| 548 | Ga0495644_0054133 | 3300046523 | Bacteria | 1507 |
| 549 | Ga0495648_0066129 | 3300046524 | Bacteria | 2121 |
| 550 | Ga0495648_0133827 | 3300046524 | Bacteria | 1314 |
| 551 | Ga0495666_0075650 | 3300046526 | Bacteria | 1596 |
| 552 | Ga0495652_0034292 | 3300046529 | Bacteria | 4424 |
| 553 | Ga0495654_0093881 | 3300046530 | Bacteria | 1389 |
| 554 | Ga0495640_0020771 | 3300046533 | Bacteria | 4828 |
| 555 | Ga0495587_0027969 | 3300046536 | Bacteria | 3432 |
| 556 | Ga0495598_0005121 | 3300046537 | Bacteria | 2886 |
| 557 | Ga0495609_0138707 | 3300046538 | Bacteria | 1038 |
| 558 | Ga0495609_0230566 | 3300046538 | Bacteria | 767 |
| 559 | Ga0495597_0041294 | 3300046542 | Bacteria | 2061 |
| 560 | Ga0495597_0139766 | 3300046542 | Bacteria | 999 |
| 561 | Ga0495622_0039342 | 3300046557 | Bacteria | 2202 |
| 562 | Ga0495667_0148129 | 3300046559 | Bacteria | 1511 |
| 563 | Ga0495656_0010809 | 3300046615 | Bacteria | 3331 |
| 564 | Ga0495656_0090884 | 3300046615 | Bacteria | 1396 |
| 565 | Ga0495668_0034954 | 3300046616 | Bacteria | 2817 |
| 566 | Ga0495668_0094820 | 3300046616 | Bacteria | 1633 |
| 567 | Ga0495668_0119115 | 3300046616 | Bacteria | 1444 |
| 568 | Ga0495668_0278050 | 3300046616 | Bacteria | 917 |
| 569 | Ga0495625_0241269 | 3300046660 | Bacteria | 1176 |
| 570 | Ga0495625_0271937 | 3300046660 | Bacteria | 1093 |
| 571 | Ga0495625_0474228 | 3300046660 | Bacteria | 769 |
| 572 | Ga0495625_0695905 | 3300046660 | Bacteria | 601 |
| 573 | Ga0495635_0004740 | 3300046663 | Bacteria | 9449 |
| 574 | Ga0495635_0278960 | 3300046663 | Bacteria | 1123 |
| 575 | Ga0495661_0146571 | 3300046665 | Bacteria | 1279 |
| 576 | Ga0495588_0085353 | 3300046674 | Bacteria | 1650 |
| 577 | Ga0495657_0040814 | 3300046675 | Bacteria | 3179 |
| 578 | Ga0495599_0009114 | 3300046678 | Bacteria | 6050 |
| 579 | Ga0495623_0027272 | 3300046679 | Bacteria | 3673 |
| 580 | Ga0495646_0101174 | 3300046680 | Bacteria | 1652 |
| 581 | Ga0495646_0447170 | 3300046680 | Bacteria | 668 |
| 582 | Ga0495647_0124365 | 3300046681 | Bacteria | 1088 |
| 583 | Ga0495670_0505415 | 3300046691 | Bacteria | 656 |
| 584 | Ga0495649_0015741 | 3300046694 | Bacteria | 4299 |
| 585 | Ga0495649_0054232 | 3300046694 | Bacteria | 2168 |
| 586 | Ga0495649_0162971 | 3300046694 | Bacteria | 1169 |
| 587 | Ga0495589_0063663 | 3300046794 | Bacteria | 1809 |
| 588 | Ga0495589_0102589 | 3300046794 | Bacteria | 1383 |
| 589 | Ga0495589_0190294 | 3300046794 | Bacteria | 971 |
| 590 | Ga0495600_0016248 | 3300046809 | Bacteria | 4720 |
| 591 | Ga0495600_0171298 | 3300046809 | Bacteria | 1401 |
| 592 | Ga0495660_0371803 | 3300046810 | Bacteria | 632 |
| 593 | Ga0495604_0073874 | 3300047317 | Bacteria | 2571 |
| 594 | Ga0495636_0128406 | 3300047318 | Bacteria | 1126 |
| 595 | Ga0495674_0155440 | 3300047319 | Bacteria | 1916 |
| 596 | Ga0495672_0018431 | 3300047320 | Bacteria | 4633 |
| 597 | Ga0495672_0227717 | 3300047320 | Bacteria | 916 |
| 598 | Ga0495672_0228158 | 3300047320 | Bacteria | 915 |
| 599 | Ga0495680_0046199 | 3300047322 | Bacteria | 3434 |
| 600 | Ga0495683_0027253 | 3300047323 | Bacteria | 2922 |
| 601 | Ga0495675_0017312 | 3300047444 | Bacteria | 4566 |
| 602 | Ga0495685_017436 | 3300047447 | Bacteria | 2460 |
| 603 | Ga0495673_0025262 | 3300047469 | Bacteria | 2856 |
| 604 | Ga0495673_0099887 | 3300047469 | Bacteria | 1174 |
| 605 | Ga0495681_0281572 | 3300047470 | Bacteria | 648 |
| 606 | Ga0495684_0009966 | 3300047471 | Bacteria | 7340 |
| 607 | Ga0495686_0077492 | 3300047472 | Bacteria | 2035 |
| 608 | Ga0495686_0091932 | 3300047472 | Bacteria | 1841 |
| 609 | Ga0495686_0125430 | 3300047472 | Bacteria | 1527 |
| 610 | Ga0495686_0126699 | 3300047472 | Bacteria | 1518 |
| 611 | Ga0495686_0180845 | 3300047472 | Bacteria | 1222 |
| 612 | Ga0495686_0283526 | 3300047472 | Bacteria | 920 |
| 613 | Ga0495686_0535841 | 3300047472 | Bacteria | 613 |
| 614 | Ga0495593_0013827 | 3300047673 | Bacteria | 4597 |
| 615 | Ga0495593_0166671 | 3300047673 | Bacteria | 1111 |
| 616 | Ga0495602_0031668 | 3300048088 | Bacteria | 4995 |
| 617 | Ga0495615_0066502 | 3300048090 | Bacteria | 963 |
| 618 | Ga0496100_0028982 | 3300048903 | Bacteria | 3419 |
| 619 | Ga0496100_0242518 | 3300048903 | Bacteria | 1330 |
| 620 | Ga0496100_0300392 | 3300048903 | Bacteria | 1201 |
| 621 | Ga0496100_0482964 | 3300048903 | Bacteria | 953 |
| 622 | Ga0496101_0009139 | 3300048904 | Bacteria | 6505 |
| 623 | Ga0496101_0121111 | 3300048904 | Bacteria | 1978 |
| 624 | Ga0496101_0164672 | 3300048904 | Bacteria | 1702 |
| 625 | Ga0496101_0729660 | 3300048904 | Bacteria | 782 |
| 626 | Ga0496102_0004648 | 3300048905 | Bacteria | 11622 |
| 627 | Ga0496102_0028991 | 3300048905 | Bacteria | 4948 |
| 628 | Ga0496102_0038354 | 3300048905 | Bacteria | 4323 |
| 629 | Ga0496102_0391409 | 3300048905 | Bacteria | 1307 |
| 630 | Ga0496102_0728897 | 3300048905 | Bacteria | 914 |
| 631 | Ga0496102_1706541 | 3300048905 | Bacteria | 548 |
| 632 | Ga0496103_0004501 | 3300048906 | Bacteria | 8444 |
| 633 | Ga0496103_0014170 | 3300048906 | Bacteria | 4733 |
| 634 | Ga0496103_0082966 | 3300048906 | Bacteria | 2018 |
| 635 | Ga0496103_0121354 | 3300048906 | Bacteria | 1665 |
| 636 | Ga0496103_0239956 | 3300048906 | Bacteria | 1166 |
| 637 | Ga0496104_0025212 | 3300048907 | Bacteria | 5480 |
| 638 | Ga0496104_0086445 | 3300048907 | Bacteria | 2993 |
| 639 | Ga0496104_0152751 | 3300048907 | Bacteria | 2216 |
| 640 | Ga0496104_0691846 | 3300048907 | Bacteria | 927 |
| 641 | Ga0496105_0004610 | 3300048908 | Bacteria | 10383 |
| 642 | Ga0496105_0010472 | 3300048908 | Bacteria | 7291 |
| 643 | Ga0496105_0114313 | 3300048908 | Bacteria | 2226 |
| 644 | Ga0496106_0000686 | 3300048909 | Bacteria | 24281 |
| 645 | Ga0496106_0014778 | 3300048909 | Bacteria | 5772 |
| 646 | Ga0496106_0542348 | 3300048909 | Bacteria | 933 |
| 647 | Ga0496106_0656786 | 3300048909 | Bacteria | 838 |
| 648 | Ga0496106_1004280 | 3300048909 | Bacteria | 656 |
| 649 | Ga0496107_0002437 | 3300048910 | Bacteria | 12048 |
| 650 | Ga0496107_0425198 | 3300048910 | Bacteria | 987 |
| 651 | Ga0496108_0030616 | 3300048911 | Bacteria | 4459 |
| 652 | Ga0496108_0067910 | 3300048911 | Bacteria | 3007 |
| 653 | Ga0496108_0383370 | 3300048911 | Bacteria | 1227 |
| 654 | Ga0496108_0597677 | 3300048911 | Bacteria | 962 |
| 655 | Ga0496109_0003924 | 3300048912 | Bacteria | 12429 |
| 656 | Ga0496109_0054969 | 3300048912 | Bacteria | 3631 |
| 657 | Ga0496109_0112472 | 3300048912 | Bacteria | 2532 |
| 658 | Ga0496109_0122962 | 3300048912 | Bacteria | 2418 |
| 659 | Ga0496109_0347674 | 3300048912 | Bacteria | 1401 |
| 660 | Ga0496109_0417796 | 3300048912 | Bacteria | 1267 |
| 661 | Ga0496110_0005589 | 3300048913 | Bacteria | 9870 |
| 662 | Ga0496110_0049214 | 3300048913 | Bacteria | 3696 |
| 663 | Ga0496110_0241290 | 3300048913 | Bacteria | 1644 |
| 664 | Ga0496110_0383155 | 3300048913 | Bacteria | 1281 |
| 665 | Ga0496110_0940505 | 3300048913 | Bacteria | 771 |
| 666 | Ga0496111_0007510 | 3300048914 | Bacteria | 7152 |
| 667 | Ga0496111_0010019 | 3300048914 | Bacteria | 6342 |
| 668 | Ga0496111_0063755 | 3300048914 | Bacteria | 2673 |
| 669 | Ga0496111_0203532 | 3300048914 | Bacteria | 1471 |
| 670 | Ga0496111_0744225 | 3300048914 | Bacteria | 711 |
| 671 | Ga0496111_1046989 | 3300048914 | Bacteria | 583 |
| 672 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 673 | Ga0496112_0007998 | 3300048915 | Bacteria | 9432 |
| 674 | Ga0496112_0022619 | 3300048915 | Bacteria | 5993 |
| 675 | Ga0496112_0036993 | 3300048915 | Bacteria | 4763 |
| 676 | Ga0496112_0142462 | 3300048915 | Bacteria | 2366 |
| 677 | Ga0496112_0186224 | 3300048915 | Bacteria | 2039 |
| 678 | Ga0496112_0304463 | 3300048915 | Bacteria | 1539 |
| 679 | Ga0496113_0005790 | 3300048916 | Bacteria | 7750 |
| 680 | Ga0496113_0012118 | 3300048916 | Bacteria | 5784 |
| 681 | Ga0496113_0028000 | 3300048916 | Bacteria | 4047 |
| 682 | Ga0496113_0152914 | 3300048916 | Bacteria | 1821 |
| 683 | Ga0496113_0182827 | 3300048916 | Bacteria | 1662 |
| 684 | Ga0496114_0008237 | 3300048917 | Bacteria | 8262 |
| 685 | Ga0496114_0040502 | 3300048917 | Bacteria | 3857 |
| 686 | Ga0496114_0481885 | 3300048917 | Bacteria | 1097 |
| 687 | Ga0496115_0004137 | 3300048918 | Bacteria | 10474 |
| 688 | Ga0496115_0009886 | 3300048918 | Bacteria | 7103 |
| 689 | Ga0496115_0226615 | 3300048918 | Bacteria | 1542 |
| 690 | Ga0496115_0318838 | 3300048918 | Bacteria | 1272 |
| 691 | Ga0496115_0791657 | 3300048918 | Bacteria | 739 |
| 692 | Ga0496116_0061378 | 3300048919 | Bacteria | 2434 |
| 693 | Ga0496116_0132742 | 3300048919 | Bacteria | 1416 |
| 694 | Ga0496117_0035078 | 3300048920 | Bacteria | 3771 |
| 695 | Ga0496117_0059165 | 3300048920 | Bacteria | 2649 |
| 696 | Ga0496117_0108529 | 3300048920 | Bacteria | 1736 |
| 697 | Ga0496117_0280598 | 3300048920 | Bacteria | 892 |
| 698 | Ga0496118_0002254 | 3300048921 | Bacteria | 26418 |
| 699 | Ga0496118_0011526 | 3300048921 | Bacteria | 8619 |
| 700 | Ga0496118_0091384 | 3300048921 | Bacteria | 2094 |
| 701 | Ga0496118_0109252 | 3300048921 | Bacteria | 1841 |
| 702 | Ga0496119_0141737 | 3300048922 | Bacteria | 1297 |
| 703 | Ga0496119_0179815 | 3300048922 | Bacteria | 1110 |
| 704 | Ga0496119_0234809 | 3300048922 | Bacteria | 931 |
| 705 | Ga0496119_0291122 | 3300048922 | Bacteria | 808 |
| 706 | Ga0496120_0228428 | 3300048923 | Bacteria | 885 |
| 707 | Ga0496120_0261752 | 3300048923 | Bacteria | 807 |
| 708 | Ga0496120_0343035 | 3300048923 | Bacteria | 673 |
| 709 | Ga0496121_0000418 | 3300048924 | Bacteria | 84182 |
| 710 | Ga0496121_0032083 | 3300048924 | Bacteria | 4782 |
| 711 | Ga0496121_0054413 | 3300048924 | Bacteria | 3344 |
| 712 | Ga0496121_0115792 | 3300048924 | Bacteria | 2035 |
| 713 | Ga0496121_0212461 | 3300048924 | Bacteria | 1369 |
| 714 | Ga0496121_0258504 | 3300048924 | Bacteria | 1204 |
| 715 | Ga0496121_0398086 | 3300048924 | Bacteria | 903 |
| 716 | Ga0496121_0511767 | 3300048924 | Bacteria | 760 |
| 717 | Ga0496122_0233982 | 3300048925 | Bacteria | 1042 |
| 718 | Ga0496123_0129961 | 3300048926 | Bacteria | 1397 |
| 719 | Ga0496124_0001129 | 3300048927 | Bacteria | 42006 |
| 720 | Ga0496124_0097302 | 3300048927 | Bacteria | 2390 |
| 721 | Ga0496124_0321680 | 3300048927 | Bacteria | 1107 |
| 722 | Ga0496125_0000158 | 3300048928 | Bacteria | 151273 |
| 723 | Ga0496125_0001222 | 3300048928 | Bacteria | 38526 |
| 724 | Ga0496125_0066546 | 3300048928 | Bacteria | 2846 |
| 725 | Ga0496125_0146477 | 3300048928 | Bacteria | 1631 |
| 726 | Ga0496125_0401690 | 3300048928 | Bacteria | 801 |
| 727 | Ga0496126_0001668 | 3300048929 | Bacteria | 33320 |
| 728 | Ga0496126_0018732 | 3300048929 | Bacteria | 6849 |
| 729 | Ga0496126_0020931 | 3300048929 | Bacteria | 6401 |
| 730 | Ga0496126_0033351 | 3300048929 | Bacteria | 4844 |
| 731 | Ga0496126_0148025 | 3300048929 | Bacteria | 2015 |
| 732 | Ga0496126_0251863 | 3300048929 | Bacteria | 1471 |
| 733 | Ga0496126_0305050 | 3300048929 | Bacteria | 1312 |
| 734 | Ga0496126_0329149 | 3300048929 | Bacteria | 1254 |
| 735 | Ga0496126_0427584 | 3300048929 | Bacteria | 1069 |
| 736 | Ga0495682_0025675 | 3300049460 | Bacteria | 2192 |
| 737 | Ga0495682_0050392 | 3300049460 | Bacteria | 1515 |
| 738 | Ga0501032_0090827 | 3300049569 | Bacteria | 2027 |
| 739 | Ga0501032_0147391 | 3300049569 | Bacteria | 1549 |
| 740 | Ga0501032_0231282 | 3300049569 | Bacteria | 1202 |
| 741 | Ga0501033_0102788 | 3300049570 | Bacteria | 2084 |
| 742 | Ga0501033_0203626 | 3300049570 | Bacteria | 1413 |
| 743 | Ga0501033_0579114 | 3300049570 | Bacteria | 771 |
| 744 | Ga0501034_1512917 | 3300049571 | Bacteria | 545 |
| 745 | Ga0501036_0282354 | 3300049572 | Bacteria | 1389 |
| 746 | Ga0501036_0638273 | 3300049572 | Bacteria | 882 |
| 747 | Ga0501038_0352460 | 3300049574 | Bacteria | 1146 |
| 748 | Ga0501038_0588485 | 3300049574 | Bacteria | 843 |
| 749 | Ga0501039_0990388 | 3300049575 | Bacteria | 653 |
| 750 | Ga0501043_0949468 | 3300049579 | Bacteria | 614 |
| 751 | Ga0501046_0244336 | 3300049580 | Bacteria | 1323 |
| 752 | Ga0501047_0016108 | 3300049581 | Bacteria | 7130 |
| 753 | Ga0501047_0101596 | 3300049581 | Bacteria | 2755 |
| 754 | Ga0501047_0110149 | 3300049581 | Bacteria | 2636 |
| 755 | Ga0501048_0038823 | 3300049582 | Bacteria | 3417 |
| 756 | Ga0501068_0197463 | 3300049584 | Bacteria | 1276 |
| 757 | Ga0501069_0435329 | 3300049585 | Bacteria | 778 |
| 758 | Ga0501070_0005564 | 3300049586 | Bacteria | 10744 |
| 759 | Ga0501070_0208694 | 3300049586 | Bacteria | 1604 |
| 760 | Ga0501070_0392522 | 3300049586 | Bacteria | 1123 |
| 761 | Ga0501074_0009318 | 3300049590 | Bacteria | 7132 |
| 762 | Ga0501076_0117789 | 3300049592 | Bacteria | 2150 |
| 763 | Ga0501080_0138025 | 3300049742 | Bacteria | 2255 |
| 764 | Ga0501083_0804066 | 3300049744 | Bacteria | 612 |
| 765 | Ga0501044_0079839 | 3300049823 | Bacteria | 3314 |
| 766 | Ga0501044_0173484 | 3300049823 | Bacteria | 2126 |
| 767 | Ga0501044_0393994 | 3300049823 | Bacteria | 1298 |
| 768 | Ga0501044_0676144 | 3300049823 | Bacteria | 919 |
| 769 | nmdc:mga03683_174577_c1 | 3300050489 | Unclassified | 978 |
| 770 | nmdc:mga03683_365116_c1 | 3300050489 | Bacteria | 685 |
| 771 | nmdc:mga03n38_134724_c1 | 3300050490 | Bacteria | 1228 |
| 772 | nmdc:mga03n38_310084_c1 | 3300050490 | Bacteria | 850 |
| 773 | nmdc:mga03n38_40940_c1 | 3300050490 | Bacteria | 2016 |
| 774 | nmdc:mga03n38_99218_c1 | 3300050490 | Bacteria | 1402 |
| 775 | nmdc:mga00v17_128515_c1 | 3300050491 | Bacteria | 1618 |
| 776 | nmdc:mga00v17_45968_c1 | 3300050491 | Bacteria | 2640 |
| 777 | nmdc:mga0yw44_109719_c2 | 3300050492 | Bacteria | 1233 |
| 778 | nmdc:mga0yw44_36135_c1 | 3300050492 | Bacteria | 2909 |
| 779 | nmdc:mga0yw44_36870_c2 | 3300050492 | Bacteria | 1837 |
| 780 | nmdc:mga0yw44_432789_c1 | 3300050492 | Bacteria | 891 |
| 781 | nmdc:mga0yw44_690365_c1 | 3300050492 | Bacteria | 694 |
| 782 | nmdc:mga0yw44_75742_c1 | 3300050492 | Bacteria | 2099 |
| 783 | nmdc:mga0yw44_88943_c1 | 3300050492 | Bacteria | 1948 |
| 784 | nmdc:mga0k408_175467_c1 | 3300050493 | Bacteria | 1278 |
| 785 | nmdc:mga0k408_214694_c1 | 3300050493 | Bacteria | 1149 |
| 786 | nmdc:mga0k408_469409_c1 | 3300050493 | Bacteria | 747 |
| 787 | nmdc:mga0k408_61570_c1 | 3300050493 | Bacteria | 2182 |
| 788 | nmdc:mga06z11_128769_c1 | 3300050494 | Bacteria | 1419 |
| 789 | nmdc:mga06z11_4761_c1 | 3300050494 | Bacteria | 5368 |
| 790 | nmdc:mga06z11_627598_c1 | 3300050494 | Bacteria | 654 |
| 791 | nmdc:mga04h51_41115_c1 | 3300050495 | Bacteria | 1509 |
| 792 | nmdc:mga04h51_59298_c1 | 3300050495 | Bacteria | 1308 |
| 793 | nmdc:mga04h51_88470_c1 | 3300050495 | Bacteria | 1111 |
| 794 | nmdc:mga07m45_141838_c1 | 3300050496 | Bacteria | 1392 |
| 795 | nmdc:mga07m45_19452_c1 | 3300050496 | Bacteria | 3680 |
| 796 | nmdc:mga07m45_239371_c1 | 3300050496 | Bacteria | 1056 |
| 797 | nmdc:mga07m45_322575_c1 | 3300050496 | Bacteria | 898 |
| 798 | nmdc:mga07m45_43829_c1 | 3300050496 | Bacteria | 1596 |
| 799 | nmdc:mga07m45_48318_c1 | 3300050496 | Bacteria | 2393 |
| 800 | nmdc:mga07m45_66829_c1 | 3300050496 | Bacteria | 2043 |
| 801 | nmdc:mga07m45_70799_c1 | 3300050496 | Bacteria | 1984 |
| 802 | nmdc:mga05p37_100622_c1 | 3300050507 | Bacteria | 3560 |
| 803 | nmdc:mga09592_298197_c1 | 3300050508 | Bacteria | 1397 |
| 804 | nmdc:mga0qj67_629016_c1 | 3300050509 | Bacteria | 857 |
| 805 | nmdc:mga08y16_231865_c1 | 3300050511 | Bacteria | 1909 |
| 806 | nmdc:mga0n895_509252_c1 | 3300050512 | Bacteria | 1212 |
| 807 | nmdc:mga0n895_614776_c1 | 3300050512 | Bacteria | 1088 |
| 808 | nmdc:mga08x19_637422_c1 | 3300050514 | Bacteria | 756 |
| 809 | nmdc:mga0a205_177406_c1 | 3300050515 | Bacteria | 2025 |
| 810 | nmdc:mga0sz30_105824_c1 | 3300050516 | Bacteria | 1231 |
| 811 | nmdc:mga0sz30_139620_c1 | 3300050516 | Bacteria | 1070 |
| 812 | nmdc:mga0sz30_75702_c1 | 3300050516 | Bacteria | 1453 |
| 813 | Ga0495601_0090645 | 3300053077 | Bacteria | 1967 |
| 814 | Ga0495601_0435467 | 3300053077 | Bacteria | 849 |
| 815 | Ga0500610_0250074 | 3300053079 | Bacteria | 818 |
| 816 | Ga0500635_0017554 | 3300053080 | Bacteria | 2146 |
| 817 | Ga0495655_0028161 | 3300053083 | Bacteria | 1339 |
| 818 | Ga0495595_0015913 | 3300053084 | Bacteria | 3211 |
| 819 | Ga0495619_0012111 | 3300053085 | Bacteria | 5433 |
| 820 | Ga0495619_0495950 | 3300053085 | Bacteria | 840 |
| 821 | Ga0500578_0198420 | 3300053086 | Bacteria | 1229 |
| 822 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 823 | Ga0500644_0027691 | 3300053088 | Bacteria | 1766 |
| 824 | Ga0500647_0231044 | 3300053091 | Bacteria | 823 |
| 825 | Ga0500583_0056880 | 3300053092 | Bacteria | 1834 |
| 826 | Ga0500651_0111687 | 3300053093 | Bacteria | 1667 |
| 827 | Ga0500566_0001097 | 3300053094 | Bacteria | 15678 |
| 828 | Ga0500640_022449 | 3300053095 | Bacteria | 2727 |
| 829 | Ga0500641_0011847 | 3300053096 | Bacteria | 3172 |
| 830 | Ga0500641_0042629 | 3300053096 | Bacteria | 1839 |
| 831 | Ga0500555_005971 | 3300053103 | Bacteria | 3454 |
| 832 | Ga0500556_0039804 | 3300053104 | Bacteria | 1649 |
| 833 | Ga0500557_000030 | 3300053105 | Bacteria | 76944 |
| 834 | Ga0500562_006360 | 3300053108 | Bacteria | 2978 |
| 835 | Ga0500569_023926 | 3300053109 | Bacteria | 1647 |
| 836 | Ga0500569_177594 | 3300053109 | Bacteria | 723 |
| 837 | Ga0500572_012340 | 3300053111 | Bacteria | 2092 |
| 838 | Ga0500592_065714 | 3300053116 | Bacteria | 596 |
| 839 | Ga0500594_0040125 | 3300053118 | Bacteria | 1276 |
| 840 | Ga0500595_002867 | 3300053119 | Bacteria | 8270 |
| 841 | Ga0500607_025594 | 3300053121 | Bacteria | 3282 |
| 842 | Ga0500608_022223 | 3300053122 | Bacteria | 2939 |
| 843 | Ga0500628_029919 | 3300053129 | Bacteria | 1174 |
| 844 | Ga0500642_0000383 | 3300053130 | Bacteria | 14747 |
| 845 | Ga0500642_0028004 | 3300053130 | Bacteria | 2319 |
| 846 | Ga0500655_032876 | 3300053133 | Bacteria | 1002 |
| 847 | Ga0500655_073864 | 3300053133 | Bacteria | 697 |
| 848 | Ga0500658_0202644 | 3300053134 | Bacteria | 907 |
| 849 | Ga0500559_0063419 | 3300053136 | Bacteria | 1651 |
| 850 | Ga0500559_0396141 | 3300053136 | Bacteria | 642 |
| 851 | Ga0500564_046420 | 3300053138 | Bacteria | 1992 |
| 852 | Ga0500573_0239073 | 3300053140 | Bacteria | 943 |
| 853 | Ga0500573_0440813 | 3300053140 | Bacteria | 605 |
| 854 | Ga0500579_242467 | 3300053143 | Bacteria | 596 |
| 855 | Ga0500588_0052558 | 3300053146 | Bacteria | 1276 |
| 856 | Ga0500588_0064029 | 3300053146 | Bacteria | 1187 |
| 857 | Ga0500589_091389 | 3300053147 | Bacteria | 1340 |
| 858 | Ga0500590_236454 | 3300053148 | Bacteria | 739 |
| 859 | Ga0500604_0062468 | 3300053151 | Bacteria | 1173 |
| 860 | Ga0500622_0038670 | 3300053156 | Bacteria | 2489 |
| 861 | Ga0500624_005683 | 3300053157 | Bacteria | 1665 |
| 862 | Ga0500638_081150 | 3300053162 | Bacteria | 1540 |
| 863 | Ga0500639_129909 | 3300053163 | Bacteria | 1195 |
| 864 | Ga0500636_0001605 | 3300053177 | Bacteria | 12316 |
| 865 | Ga0500636_0020415 | 3300053177 | Bacteria | 3923 |
| 866 | Ga0500637_0266197 | 3300053178 | Bacteria | 950 |
| 867 | Ga0500611_061758 | 3300053727 | Bacteria | 890 |
| 868 | Ga0500625_093427 | 3300053729 | Bacteria | 1280 |
| 869 | Ga0500645_089807 | 3300053730 | Bacteria | 872 |
| 870 | Ga0500609_003839 | 3300053731 | Bacteria | 2096 |
| 871 | Ga0500599_005210 | 3300053736 | Bacteria | 1628 |
| 872 | Ga0500601_000369 | 3300053737 | Bacteria | 8116 |
| 873 | Ga0500601_044490 | 3300053737 | Bacteria | 544 |
| 874 | Ga0501082_0184978 | 3300060353 | Bacteria | 1813 |
| 875 | Ga0466962_0354289 | 3300061719 | Bacteria | 731 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0049162 | Ga0466965_0049162_1440_1970 | 147 |
| 2 | 3300048906 | Ga0496103_0121354 | Ga0496103_0121354_1145_1639 | 149 |
| 3 | 3300046615 | Ga0495656_0090884 | Ga0495656_0090884_792_1310 | 151 |
| 4 | 3300048905 | Ga0496102_0728897 | Ga0496102_0728897_49_546 | 151 |
| 5 | 3300005937 | Ga0081455_10005963 | Ga0081455_100059632 | 152 |
| 6 | 3300003659 | JGI25404J52841_10060183 | JGI25404J52841_100601832 | 153 |
| 7 | 3300006048 | Ga0075363_100231412 | Ga0075363_1002314122 | 154 |
| 8 | 3300005985 | Ga0081539_10069314 | Ga0081539_100693142 | 155 |
| 9 | 3300014969 | Ga0157376_11122562 | Ga0157376_111225622 | 155 |
| 10 | 3300048914 | Ga0496111_0063755 | Ga0496111_0063755_587_1108 | 155 |
| 11 | 3300048915 | Ga0496112_0304463 | Ga0496112_0304463_122_643 | 155 |
| 12 | 3300005436 | Ga0070713_100111093 | Ga0070713_1001110932 | 156 |
| 13 | 3300005985 | Ga0081539_10023797 | Ga0081539_100237972 | 156 |
| 14 | 3300006177 | Ga0075362_10125668 | Ga0075362_101256682 | 156 |
| 15 | 3300009545 | Ga0105237_10219970 | Ga0105237_102199702 | 156 |
| 16 | 3300009545 | Ga0105237_10459895 | Ga0105237_104598952 | 156 |
| 17 | 3300009551 | Ga0105238_10130744 | Ga0105238_101307443 | 156 |
| 18 | 3300009551 | Ga0105238_10281315 | Ga0105238_102813152 | 156 |
| 19 | 3300010375 | Ga0105239_10862669 | Ga0105239_108626692 | 156 |
| 20 | 3300025914 | Ga0207671_10225088 | Ga0207671_102250882 | 156 |
| 21 | 3300025914 | Ga0207671_10329786 | Ga0207671_103297862 | 156 |
| 22 | 3300026078 | Ga0207702_10785019 | Ga0207702_107850192 | 156 |
| 23 | 3300026142 | Ga0207698_11176026 | Ga0207698_111760261 | 156 |
| 24 | 3300032126 | Ga0307415_100296597 | Ga0307415_1002965972 | 156 |
| 25 | 3300049585 | Ga0501069_0435329 | Ga0501069_0435329_47_565 | 156 |
| 26 | 3300005347 | Ga0070668_100145405 | Ga0070668_1001454051 | 157 |
| 27 | 3300005356 | Ga0070674_100716824 | Ga0070674_1007168242 | 157 |
| 28 | 3300005617 | Ga0068859_101269473 | Ga0068859_1012694731 | 157 |
| 29 | 3300005840 | Ga0068870_11045159 | Ga0068870_110451591 | 157 |
| 30 | 3300005844 | Ga0068862_100481751 | Ga0068862_1004817512 | 157 |
| 31 | 3300006353 | Ga0075370_10276290 | Ga0075370_102762902 | 157 |
| 32 | 3300006880 | Ga0075429_101236216 | Ga0075429_1012362161 | 157 |
| 33 | 3300006931 | Ga0097620_101269513 | Ga0097620_1012695131 | 157 |
| 34 | 3300010375 | Ga0105239_11654658 | Ga0105239_116546581 | 157 |
| 35 | 3300010375 | Ga0105239_12273241 | Ga0105239_122732411 | 157 |
| 36 | 3300011119 | Ga0105246_10324616 | Ga0105246_103246162 | 157 |
| 37 | 3300014325 | Ga0163163_11013229 | Ga0163163_110132291 | 157 |
| 38 | 3300017792 | Ga0163161_10298534 | Ga0163161_102985342 | 157 |
| 39 | 3300021384 | Ga0213876_10002782 | Ga0213876_100027827 | 157 |
| 40 | 3300025908 | Ga0207643_10004944 | Ga0207643_100049442 | 157 |
| 41 | 3300025935 | Ga0207709_10164080 | Ga0207709_101640802 | 157 |
| 42 | 3300025942 | Ga0207689_10136945 | Ga0207689_101369452 | 157 |
| 43 | 3300025972 | Ga0207668_10160886 | Ga0207668_101608862 | 157 |
| 44 | 3300031901 | Ga0307406_10147290 | Ga0307406_101472903 | 157 |
| 45 | 3300032005 | Ga0307411_10695523 | Ga0307411_106955232 | 157 |
| 46 | 3300037853 | Ga0436364_1072071 | Ga0436364_1072071_198_695 | 157 |
| 47 | 3300039437 | Ga0436365_1272860 | Ga0436365_1272860_23901_24410 | 157 |
| 48 | 3300039450 | Ga0436363_1041115 | Ga0436363_1041115_216_725 | 157 |
| 49 | 3300039453 | Ga0436362_0098915 | Ga0436362_0098915_3316_3825 | 157 |
| 50 | 3300041452 | Ga0451793_1168289 | Ga0451793_1168289_22_495 | 157 |
| 51 | 3300041458 | Ga0451798_0889358 | Ga0451798_0889358_49_567 | 157 |
| 52 | 3300048924 | Ga0496121_0258504 | Ga0496121_0258504_706_1179 | 157 |
| 53 | 3300050496 | nmdc:mga07m45_322575_c1 | nmdc:mga07m45_322575_c1_302_796 | 157 |
| 54 | 3300050508 | nmdc:mga09592_298197_c1 | nmdc:mga09592_298197_c1_735_1253 | 157 |
| 55 | 3300053109 | Ga0500569_023926 | Ga0500569_023926_707_1201 | 157 |
| 56 | 3300009174 | Ga0105241_10420292 | Ga0105241_104202922 | 158 |
| 57 | 3300026088 | Ga0207641_10948065 | Ga0207641_109480652 | 158 |
| 58 | 3300039437 | Ga0436365_1145349 | Ga0436365_1145349_904_1500 | 158 |
| 59 | 3300046538 | Ga0495609_0230566 | Ga0495609_0230566_210_728 | 158 |
| 60 | 3300047472 | Ga0495686_0126699 | Ga0495686_0126699_336_854 | 158 |
| 61 | 3300005456 | Ga0070678_100990004 | Ga0070678_1009900041 | 159 |
| 62 | 3300026121 | Ga0207683_10866877 | Ga0207683_108668771 | 159 |
| 63 | 3300046794 | Ga0495589_0190294 | Ga0495589_0190294_372_893 | 159 |
| 64 | 3300053093 | Ga0500651_0111687 | Ga0500651_0111687_467_961 | 159 |
| 65 | 3300010375 | Ga0105239_12279171 | Ga0105239_122791711 | 160 |
| 66 | iso_pu_bacteria | 2507262055 | 2507511960 | 160 |
| 67 | iso_pu_bacteria | 2508501009 | 2508545623 | 160 |
| 68 | iso_pu_bacteria | 2508501042 | 2508694437 | 160 |
| 69 | iso_pu_bacteria | 2511231028 | 2511398051 | 160 |
| 70 | iso_pu_bacteria | 2513237092 | 2513627414 | 160 |
| 71 | iso_pu_bacteria | 2513237095 | 2513651019 | 160 |
| 72 | iso_pu_bacteria | 2513237102 | 2513699450 | 160 |
| 73 | iso_pu_bacteria | 2513237139 | 2513874421 | 160 |
| 74 | iso_pu_bacteria | 2515154112 | 2515624635 | 160 |
| 75 | iso_pu_bacteria | 2617270735 | 2617349710 | 160 |
| 76 | iso_pu_bacteria | 2617270741 | 2617376888 | 160 |
| 77 | iso_pu_bacteria | 2802429603 | 2805921015 | 160 |
| 78 | iso_pu_bacteria | 2824617872 | 2824625762 | 160 |
| 79 | iso_pu_bacteria | 2824626560 | 2824633317 | 160 |
| 80 | iso_pu_bacteria | 2824635225 | 2824642215 | 160 |
| 81 | iso_pu_bacteria | 2824644064 | 2824649563 | 160 |
| 82 | iso_pu_bacteria | 2824653114 | 2824660495 | 160 |
| 83 | iso_pu_bacteria | 2824661429 | 2824670887 | 160 |
| 84 | iso_pu_bacteria | 2824671348 | 2824674323 | 160 |
| 85 | iso_pu_bacteria | 2824679649 | 2824686392 | 160 |
| 86 | iso_pu_bacteria | 2824687955 | 2824690821 | 160 |
| 87 | iso_pu_bacteria | 2824696289 | 2824700252 | 160 |
| 88 | iso_pu_bacteria | 2824704595 | 2824711821 | 160 |
| 89 | iso_pu_bacteria | 2824714736 | 2824721721 | 160 |
| 90 | iso_pu_bacteria | 2824723954 | 2824731573 | 160 |
| 91 | iso_pu_bacteria | 2824732956 | 2824739750 | 160 |
| 92 | iso_pu_bacteria | 2824746037 | 2824751342 | 160 |
| 93 | iso_pu_bacteria | 2824753945 | 2824763133 | 160 |
| 94 | iso_pu_bacteria | 2824763712 | 2824771252 | 160 |
| 95 | iso_pu_bacteria | 2824773399 | 2824776915 | 160 |
| 96 | iso_pu_bacteria | 2838122688 | 2838128466 | 160 |
| 97 | iso_pu_bacteria | 2841941048 | 2841942326 | 160 |
| 98 | iso_pu_bacteria | 2841957949 | 2841960879 | 160 |
| 99 | iso_pu_bacteria | 2841983080 | 2841984340 | 160 |
| 100 | iso_pu_bacteria | 2844315083 | 2844321182 | 160 |
| 101 | iso_pu_bacteria | 2847930680 | 2847932233 | 160 |
| 102 | iso_pu_bacteria | 2847939898 | 2847943464 | 160 |
| 103 | iso_pu_bacteria | 2849076700 | 2849077182 | 160 |
| 104 | iso_pu_bacteria | 2857509624 | 2857515242 | 160 |
| 105 | iso_pu_bacteria | 2874590934 | 2874592155 | 160 |
| 106 | iso_pu_bacteria | 2874612657 | 2874617855 | 160 |
| 107 | iso_pu_bacteria | 2874628541 | 2874630899 | 160 |
| 108 | iso_pu_bacteria | 2874645413 | 2874646989 | 160 |
| 109 | iso_pu_bacteria | 2876761206 | 2876767506 | 160 |
| 110 | iso_pu_bacteria | 2876771140 | 2876772366 | 160 |
| 111 | iso_pu_bacteria | 2876818435 | 2876819635 | 160 |
| 112 | iso_pu_bacteria | 2879074833 | 2879076210 | 160 |
| 113 | iso_pu_bacteria | 2879083081 | 2879089362 | 160 |
| 114 | iso_pu_bacteria | 2879099564 | 2879106366 | 160 |
| 115 | iso_pu_bacteria | 2879127579 | 2879132610 | 160 |
| 116 | iso_pu_bacteria | 2879142872 | 2879144680 | 160 |
| 117 | iso_pu_bacteria | 2881364244 | 2881371058 | 160 |
| 118 | iso_pu_bacteria | 2881665667 | 2881669166 | 160 |
| 119 | iso_pu_bacteria | 2885366525 | 2885373986 | 160 |
| 120 | iso_pu_bacteria | 2885409591 | 2885412414 | 160 |
| 121 | iso_pu_bacteria | 2888378607 | 2888387464 | 160 |
| 122 | iso_pu_bacteria | 2888388044 | 2888391724 | 160 |
| 123 | iso_pu_bacteria | 2888419890 | 2888426697 | 160 |
| 124 | iso_pu_bacteria | 2903727486 | 2903728606 | 160 |
| 125 | iso_pu_bacteria | 2904711408 | 2904713760 | 160 |
| 126 | iso_pu_bacteria | 2906602504 | 2906607797 | 160 |
| 127 | iso_pu_bacteria | 2906626472 | 2906630088 | 160 |
| 128 | iso_pu_bacteria | 2906643746 | 2906651776 | 160 |
| 129 | iso_pu_bacteria | 2908775508 | 2908782786 | 160 |
| 130 | iso_pu_bacteria | 2922368715 | 2922370463 | 160 |
| 131 | iso_pu_bacteria | 2922393267 | 2922396516 | 160 |
| 132 | iso_pu_bacteria | 2929615660 | 2929620046 | 160 |
| 133 | iso_pu_bacteria | 2929624759 | 2929629359 | 160 |
| 134 | iso_pu_bacteria | 2932784394 | 2932789511 | 160 |
| 135 | iso_pu_bacteria | 2932794094 | 2932796814 | 160 |
| 136 | iso_pu_bacteria | 2932801729 | 2932802408 | 160 |
| 137 | iso_pu_bacteria | 2932809354 | 2932814982 | 160 |
| 138 | iso_pu_bacteria | 2932818245 | 2932824161 | 160 |
| 139 | iso_pu_bacteria | 2932828146 | 2932834111 | 160 |
| 140 | iso_pu_bacteria | 2933577622 | 2933581964 | 160 |
| 141 | iso_pu_bacteria | 2935608549 | 2935613401 | 160 |
| 142 | iso_pu_bacteria | 2935616580 | 2935623499 | 160 |
| 143 | iso_pu_bacteria | 2935638405 | 2935644867 | 160 |
| 144 | iso_pu_bacteria | 2935648319 | 2935653719 | 160 |
| 145 | iso_pu_bacteria | 2935656913 | 2935662468 | 160 |
| 146 | iso_pu_bacteria | 2935665750 | 2935671935 | 160 |
| 147 | iso_pu_bacteria | 2935675223 | 2935683137 | 160 |
| 148 | iso_pu_bacteria | 2935684952 | 2935689305 | 160 |
| 149 | iso_pu_bacteria | 2935694250 | 2935697435 | 160 |
| 150 | iso_pu_bacteria | 2935703347 | 2935711010 | 160 |
| 151 | iso_pu_bacteria | 2935713505 | 2935720251 | 160 |
| 152 | iso_pu_bacteria | 2935722832 | 2935728132 | 160 |
| 153 | iso_pu_bacteria | 2935732158 | 2935737271 | 160 |
| 154 | iso_pu_bacteria | 2935741537 | 2935746668 | 160 |
| 155 | iso_pu_bacteria | 2935750917 | 2935757635 | 160 |
| 156 | iso_pu_bacteria | 2935760218 | 2935764011 | 160 |
| 157 | iso_pu_bacteria | 2935801545 | 2935808599 | 160 |
| 158 | iso_pu_bacteria | 2935810662 | 2935817396 | 160 |
| 159 | iso_pu_bacteria | 2935819856 | 2935824746 | 160 |
| 160 | iso_pu_bacteria | 2935827899 | 2935834287 | 160 |
| 161 | iso_pu_bacteria | 2935837841 | 2935844870 | 160 |
| 162 | iso_pu_bacteria | 2935847175 | 2935851966 | 160 |
| 163 | iso_pu_bacteria | 2935855204 | 2935861894 | 160 |
| 164 | iso_pu_bacteria | 2935864058 | 2935868471 | 160 |
| 165 | iso_pu_bacteria | 2935873716 | 2935879245 | 160 |
| 166 | iso_pu_bacteria | 2935883170 | 2935887156 | 160 |
| 167 | iso_pu_bacteria | 2935908558 | 2935911314 | 160 |
| 168 | iso_pu_bacteria | 2935916978 | 2935920846 | 160 |
| 169 | iso_pu_bacteria | 2935926038 | 2935928343 | 160 |
| 170 | iso_pu_bacteria | 2935934488 | 2935937988 | 160 |
| 171 | iso_pu_bacteria | 2935942939 | 2935945270 | 160 |
| 172 | iso_pu_bacteria | 2935951376 | 2935954224 | 160 |
| 173 | iso_pu_bacteria | 2935967501 | 2935971508 | 160 |
| 174 | iso_pu_bacteria | 2935975950 | 2935982126 | 160 |
| 175 | iso_pu_bacteria | 2935984226 | 2935990533 | 160 |
| 176 | iso_pu_bacteria | 2935992306 | 2935998588 | 160 |
| 177 | iso_pu_bacteria | 2936002035 | 2936008951 | 160 |
| 178 | iso_pu_bacteria | 2936011229 | 2936016884 | 160 |
| 179 | iso_pu_bacteria | 2936019824 | 2936025517 | 160 |
| 180 | iso_pu_bacteria | 2936028420 | 2936034245 | 160 |
| 181 | iso_pu_bacteria | 2936037263 | 2936044193 | 160 |
| 182 | iso_pu_bacteria | 2936046547 | 2936052302 | 160 |
| 183 | iso_pu_bacteria | 2936055302 | 2936060581 | 160 |
| 184 | iso_pu_bacteria | 2940556831 | 2940563543 | 160 |
| 185 | iso_pu_bacteria | 2941538514 | 2941545236 | 160 |
| 186 | iso_pu_bacteria | 3005483717 | 3005490269 | 160 |
| 187 | iso_pu_bacteria | 3005587118 | 3005591638 | 160 |
| 188 | iso_pu_bacteria | 3005594810 | 3005601512 | 160 |
| 189 | iso_pu_bacteria | 3005718088 | 3005724213 | 160 |
| 190 | iso_pu_bacteria | 8006926726 | 8006928123 | 160 |
| 191 | iso_pu_bacteria | 8016583857 | 8016587891 | 160 |
| 192 | iso_pu_bacteria | 8016630954 | 8016637102 | 160 |
| 193 | iso_pu_bacteria | 8017057580 | 8017066123 | 160 |
| 194 | iso_pu_bacteria | 8019576017 | 8019578507 | 160 |
| 195 | iso_pu_bacteria | 8019586578 | 8019596554 | 160 |
| 196 | iso_pu_bacteria | 8019597564 | 8019605150 | 160 |
| 197 | iso_pu_bacteria | 8019608314 | 8019613391 | 160 |
| 198 | iso_pu_bacteria | 8019619141 | 8019624068 | 160 |
| 199 | iso_pu_bacteria | 8019629233 | 8019637960 | 160 |
| 200 | iso_pu_bacteria | 8019638758 | 8019641668 | 160 |
| 201 | iso_pu_bacteria | 8019668869 | 8019675411 | 160 |
| 202 | iso_pu_bacteria | 8019687851 | 8019695077 | 160 |
| 203 | iso_pu_bacteria | 8055742211 | 8055750201 | 160 |
| 204 | iso_pu_bacteria | 8056967851 | 8056975979 | 160 |
| 205 | 3300035086 | Ga0373934_0009704 | Ga0373934_0009704_851_1339 | 161 |
| 206 | 3300035117 | Ga0373953_0022892 | Ga0373953_0022892_169_657 | 161 |
| 207 | 3300035118 | Ga0373954_0011571 | Ga0373954_0011571_1731_2219 | 161 |
| 208 | 3300035119 | Ga0373956_0140481 | Ga0373956_0140481_153_641 | 161 |
| 209 | 3300035120 | Ga0373957_0031808 | Ga0373957_0031808_948_1436 | 161 |
| 210 | 3300035172 | Ga0373955_0015334 | Ga0373955_0015334_847_1335 | 161 |
| 211 | 3300035410 | Ga0373924_0006000 | Ga0373924_0006000_1285_1773 | 161 |
| 212 | 3300035724 | Ga0373933_0021248 | Ga0373933_0021248_2123_2611 | 161 |
| 213 | 3300036401 | Ga0373937_0073767 | Ga0373937_0073767_2633_3121 | 161 |
| 214 | 3300046454 | Ga0495592_0025512 | Ga0495592_0025512_1251_1739 | 161 |
| 215 | 3300046459 | Ga0495629_0013615 | Ga0495629_0013615_1372_1860 | 161 |
| 216 | 3300046462 | Ga0495651_0029933 | Ga0495651_0029933_1577_2065 | 161 |
| 217 | 3300046463 | Ga0495653_0036044 | Ga0495653_0036044_1489_1977 | 161 |
| 218 | 3300046476 | Ga0495662_0390799 | Ga0495662_0390799_50_538 | 161 |
| 219 | 3300046511 | Ga0495608_0018003 | Ga0495608_0018003_3397_3885 | 161 |
| 220 | 3300046516 | Ga0495628_0084347 | Ga0495628_0084347_1204_1692 | 161 |
| 221 | 3300046529 | Ga0495652_0034292 | Ga0495652_0034292_3364_3852 | 161 |
| 222 | 3300046533 | Ga0495640_0020771 | Ga0495640_0020771_1882_2370 | 161 |
| 223 | 3300046536 | Ga0495587_0027969 | Ga0495587_0027969_2372_2860 | 161 |
| 224 | 3300046559 | Ga0495667_0148129 | Ga0495667_0148129_28_516 | 161 |
| 225 | 3300046663 | Ga0495635_0004740 | Ga0495635_0004740_4665_5153 | 161 |
| 226 | 3300046675 | Ga0495657_0040814 | Ga0495657_0040814_1951_2439 | 161 |
| 227 | 3300046678 | Ga0495599_0009114 | Ga0495599_0009114_2057_2545 | 161 |
| 228 | 3300046679 | Ga0495623_0027272 | Ga0495623_0027272_2445_2933 | 161 |
| 229 | 3300046680 | Ga0495646_0101174 | Ga0495646_0101174_599_1087 | 161 |
| 230 | 3300046809 | Ga0495600_0016248 | Ga0495600_0016248_1399_1887 | 161 |
| 231 | 3300047317 | Ga0495604_0073874 | Ga0495604_0073874_1422_1910 | 161 |
| 232 | 3300047319 | Ga0495674_0155440 | Ga0495674_0155440_213_701 | 161 |
| 233 | 3300047322 | Ga0495680_0046199 | Ga0495680_0046199_1951_2439 | 161 |
| 234 | 3300047444 | Ga0495675_0017312 | Ga0495675_0017312_1707_2195 | 161 |
| 235 | 3300047471 | Ga0495684_0009966 | Ga0495684_0009966_3988_4476 | 161 |
| 236 | 3300047673 | Ga0495593_0013827 | Ga0495593_0013827_1497_1985 | 161 |
| 237 | 3300048088 | Ga0495602_0031668 | Ga0495602_0031668_3705_4193 | 161 |
| 238 | 3300050494 | nmdc:mga06z11_128769_c1 | nmdc:mga06z11_128769_c1_15_500 | 161 |
| 239 | 3300053077 | Ga0495601_0090645 | Ga0495601_0090645_613_1101 | 161 |
| 240 | 3300053084 | Ga0495595_0015913 | Ga0495595_0015913_1701_2189 | 161 |
| 241 | 3300053085 | Ga0495619_0012111 | Ga0495619_0012111_3260_3748 | 161 |
| 242 | 3300053140 | Ga0500573_0440813 | Ga0500573_0440813_11_499 | 161 |
| 243 | iso_pu_bacteria | 2524023210 | 2524470877 | 161 |
| 244 | iso_pu_bacteria | 2643221651 | 2644289845 | 161 |
| 245 | iso_pu_bacteria | 2885383462 | 2885390961 | 161 |
| 246 | iso_pu_bacteria | 2903768456 | 2903776564 | 161 |
| 247 | iso_pu_bacteria | 8006984368 | 8006989833 | 161 |
| 248 | 3300005329 | Ga0070683_100200130 | Ga0070683_1002001302 | 162 |
| 249 | 3300006177 | Ga0075362_10071498 | Ga0075362_100714982 | 162 |
| 250 | 3300006353 | Ga0075370_10024162 | Ga0075370_100241622 | 162 |
| 251 | 3300050489 | nmdc:mga03683_174577_c1 | nmdc:mga03683_174577_c1_248_739 | 162 |
| 252 | 3300050490 | nmdc:mga03n38_134724_c1 | nmdc:mga03n38_134724_c1_255_746 | 162 |
| 253 | 3300050495 | nmdc:mga04h51_41115_c1 | nmdc:mga04h51_41115_c1_32_523 | 162 |
| 254 | 3300050496 | nmdc:mga07m45_239371_c1 | nmdc:mga07m45_239371_c1_435_926 | 162 |
| 255 | 3300050496 | nmdc:mga07m45_70799_c1 | nmdc:mga07m45_70799_c1_1267_1758 | 162 |
| 256 | 3300005336 | Ga0070680_100210780 | Ga0070680_1002107802 | 163 |
| 257 | 3300005458 | Ga0070681_10576844 | Ga0070681_105768441 | 163 |
| 258 | 3300025912 | Ga0207707_10163382 | Ga0207707_101633822 | 163 |
| 259 | 3300026116 | Ga0207674_10710059 | Ga0207674_107100592 | 163 |
| 260 | 3300003215 | JGI25153J46596_10003975 | JGI25153J46596_100039759 | 164 |
| 261 | 3300003215 | JGI25153J46596_10016779 | JGI25153J46596_100167791 | 164 |
| 262 | 3300003354 | JGI25160J50197_1003036 | JGI25160J50197_10030369 | 164 |
| 263 | 3300003763 | Ga0055529_1039971 | Ga0055529_10399711 | 164 |
| 264 | 3300005548 | Ga0070665_100169276 | Ga0070665_1001692762 | 164 |
| 265 | 3300005548 | Ga0070665_100183895 | Ga0070665_1001838953 | 164 |
| 266 | 3300005614 | Ga0068856_100450631 | Ga0068856_1004506312 | 164 |
| 267 | 3300005616 | Ga0068852_100035224 | Ga0068852_1000352242 | 164 |
| 268 | 3300005616 | Ga0068852_100099846 | Ga0068852_1000998462 | 164 |
| 269 | 3300005843 | Ga0068860_100000367 | Ga0068860_10000036743 | 164 |
| 270 | 3300005983 | Ga0081540_1009361 | Ga0081540_10093612 | 164 |
| 271 | 3300006038 | Ga0075365_10044781 | Ga0075365_100447813 | 164 |
| 272 | 3300006051 | Ga0075364_10433616 | Ga0075364_104336162 | 164 |
| 273 | 3300006178 | Ga0075367_10924306 | Ga0075367_109243061 | 164 |
| 274 | 3300006186 | Ga0075369_10322707 | Ga0075369_103227072 | 164 |
| 275 | 3300006942 | Ga0099824_1031414 | Ga0099824_10314142 | 164 |
| 276 | 3300006943 | Ga0099822_1070392 | Ga0099822_10703921 | 164 |
| 277 | 3300006944 | Ga0099823_1016181 | Ga0099823_10161819 | 164 |
| 278 | 3300006944 | Ga0099823_1099633 | Ga0099823_10996332 | 164 |
| 279 | 3300009093 | Ga0105240_10097539 | Ga0105240_100975392 | 164 |
| 280 | 3300009101 | Ga0105247_10155100 | Ga0105247_101551002 | 164 |
| 281 | 3300009148 | Ga0105243_10163960 | Ga0105243_101639601 | 164 |
| 282 | 3300009174 | Ga0105241_10022979 | Ga0105241_100229793 | 164 |
| 283 | 3300009174 | Ga0105241_10071503 | Ga0105241_100715033 | 164 |
| 284 | 3300009545 | Ga0105237_10036086 | Ga0105237_100360862 | 164 |
| 285 | 3300009545 | Ga0105237_10180282 | Ga0105237_101802823 | 164 |
| 286 | 3300009551 | Ga0105238_10441472 | Ga0105238_104414722 | 164 |
| 287 | 3300011119 | Ga0105246_10062491 | Ga0105246_100624912 | 164 |
| 288 | 3300013296 | Ga0157374_10098280 | Ga0157374_100982803 | 164 |
| 289 | 3300013306 | Ga0163162_10416075 | Ga0163162_104160752 | 164 |
| 290 | 3300014325 | Ga0163163_10107040 | Ga0163163_101070402 | 164 |
| 291 | 3300014745 | Ga0157377_10469638 | Ga0157377_104696381 | 164 |
| 292 | 3300015265 | Ga0182005_1091804 | Ga0182005_10918042 | 164 |
| 293 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007348 | 164 |
| 294 | 3300021321 | Ga0214542_1000007 | Ga0214542_100000733 | 164 |
| 295 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006259 | 164 |
| 296 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009348 | 164 |
| 297 | 3300025261 | Ga0209233_1008190 | Ga0209233_10081902 | 164 |
| 298 | 3300025261 | Ga0209233_1058459 | Ga0209233_10584592 | 164 |
| 299 | 3300025272 | Ga0209455_1030912 | Ga0209455_10309122 | 164 |
| 300 | 3300025295 | Ga0209564_1009562 | Ga0209564_10095622 | 164 |
| 301 | 3300025297 | Ga0209758_1001332 | Ga0209758_100133220 | 164 |
| 302 | 3300025297 | Ga0209758_1005029 | Ga0209758_10050297 | 164 |
| 303 | 3300025297 | Ga0209758_1006626 | Ga0209758_10066267 | 164 |
| 304 | 3300025302 | Ga0207426_1000500 | Ga0207426_100050034 | 164 |
| 305 | 3300025302 | Ga0207426_1002368 | Ga0207426_10023689 | 164 |
| 306 | 3300025908 | Ga0207643_10519980 | Ga0207643_105199802 | 164 |
| 307 | 3300025911 | Ga0207654_10042969 | Ga0207654_100429692 | 164 |
| 308 | 3300025913 | Ga0207695_10000123 | Ga0207695_10000123101 | 164 |
| 309 | 3300025916 | Ga0207663_10631438 | Ga0207663_106314381 | 164 |
| 310 | 3300025923 | Ga0207681_10518018 | Ga0207681_105180182 | 164 |
| 311 | 3300025927 | Ga0207687_10190187 | Ga0207687_101901872 | 164 |
| 312 | 3300025933 | Ga0207706_10405394 | Ga0207706_104053942 | 164 |
| 313 | 3300026067 | Ga0207678_10070878 | Ga0207678_100708782 | 164 |
| 314 | 3300026142 | Ga0207698_10067853 | Ga0207698_100678532 | 164 |
| 315 | 3300027296 | Ga0209389_1000019 | Ga0209389_1000019138 | 164 |
| 316 | 3300027296 | Ga0209389_1000070 | Ga0209389_100007055 | 164 |
| 317 | 3300027357 | Ga0209589_1000420 | Ga0209589_100042011 | 164 |
| 318 | 3300027361 | Ga0209489_100033 | Ga0209489_100033137 | 164 |
| 319 | 3300027361 | Ga0209489_100196 | Ga0209489_10019657 | 164 |
| 320 | 3300028379 | Ga0268266_10199329 | Ga0268266_101993292 | 164 |
| 321 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042304 | 164 |
| 322 | 3300037418 | Ga0395900_0360121 | Ga0395900_0360121_543_1037 | 164 |
| 323 | 3300037471 | Ga0395905_0004875 | Ga0395905_0004875_10224_10718 | 164 |
| 324 | 3300037471 | Ga0395905_0012983 | Ga0395905_0012983_1808_2302 | 164 |
| 325 | 3300037471 | Ga0395905_0744728 | Ga0395905_0744728_55_549 | 164 |
| 326 | 3300038443 | Ga0395901_0102845 | Ga0395901_0102845_373_867 | 164 |
| 327 | 3300038443 | Ga0395901_1078356 | Ga0395901_1078356_157_651 | 164 |
| 328 | 3300039437 | Ga0436365_0066782 | Ga0436365_0066782_305_799 | 164 |
| 329 | 3300039437 | Ga0436365_1058179 | Ga0436365_1058179_87_581 | 164 |
| 330 | 3300041441 | Ga0451787_264771 | Ga0451787_264771_63_557 | 164 |
| 331 | 3300041498 | Ga0451841_0822327 | Ga0451841_0822327_325_819 | 164 |
| 332 | 3300041512 | Ga0451853_0828513 | Ga0451853_0828513_361_855 | 164 |
| 333 | 3300044658 | Ga0466972_0290874 | Ga0466972_0290874_50_544 | 164 |
| 334 | 3300044658 | Ga0466972_0434317 | Ga0466972_0434317_84_578 | 164 |
| 335 | 3300044683 | Ga0466965_0008749 | Ga0466965_0008749_2579_3073 | 164 |
| 336 | 3300044735 | Ga0466968_0044536 | Ga0466968_0044536_743_1237 | 164 |
| 337 | 3300044765 | Ga0466970_0174738 | Ga0466970_0174738_382_876 | 164 |
| 338 | 3300044901 | Ga0466960_0766001 | Ga0466960_0766001_76_570 | 164 |
| 339 | 3300045836 | Ga0466958_0692538 | Ga0466958_0692538_78_572 | 164 |
| 340 | 3300045976 | Ga0466967_0050670 | Ga0466967_0050670_16_510 | 164 |
| 341 | 3300046460 | Ga0495638_0023174 | Ga0495638_0023174_2308_2802 | 164 |
| 342 | 3300046474 | Ga0495605_0029311 | Ga0495605_0029311_1995_2489 | 164 |
| 343 | 3300046492 | Ga0495585_0045326 | Ga0495585_0045326_1529_2023 | 164 |
| 344 | 3300046522 | Ga0495643_0004848 | Ga0495643_0004848_5238_5732 | 164 |
| 345 | 3300046522 | Ga0495643_0026039 | Ga0495643_0026039_1225_1719 | 164 |
| 346 | 3300046524 | Ga0495648_0066129 | Ga0495648_0066129_395_889 | 164 |
| 347 | 3300046524 | Ga0495648_0133827 | Ga0495648_0133827_483_977 | 164 |
| 348 | 3300046542 | Ga0495597_0041294 | Ga0495597_0041294_1050_1544 | 164 |
| 349 | 3300046616 | Ga0495668_0034954 | Ga0495668_0034954_1004_1498 | 164 |
| 350 | 3300046660 | Ga0495625_0241269 | Ga0495625_0241269_327_821 | 164 |
| 351 | 3300046694 | Ga0495649_0015741 | Ga0495649_0015741_2184_2678 | 164 |
| 352 | 3300046694 | Ga0495649_0162971 | Ga0495649_0162971_168_662 | 164 |
| 353 | 3300046794 | Ga0495589_0063663 | Ga0495589_0063663_148_642 | 164 |
| 354 | 3300047323 | Ga0495683_0027253 | Ga0495683_0027253_397_891 | 164 |
| 355 | 3300047472 | Ga0495686_0077492 | Ga0495686_0077492_528_1022 | 164 |
| 356 | 3300047472 | Ga0495686_0283526 | Ga0495686_0283526_215_709 | 164 |
| 357 | 3300048904 | Ga0496101_0729660 | Ga0496101_0729660_238_732 | 164 |
| 358 | 3300048905 | Ga0496102_0038354 | Ga0496102_0038354_59_553 | 164 |
| 359 | 3300048906 | Ga0496103_0004501 | Ga0496103_0004501_5305_5799 | 164 |
| 360 | 3300048907 | Ga0496104_0691846 | Ga0496104_0691846_279_773 | 164 |
| 361 | 3300048908 | Ga0496105_0114313 | Ga0496105_0114313_37_531 | 164 |
| 362 | 3300048909 | Ga0496106_0656786 | Ga0496106_0656786_143_637 | 164 |
| 363 | 3300048912 | Ga0496109_0112472 | Ga0496109_0112472_1884_2378 | 164 |
| 364 | 3300048913 | Ga0496110_0383155 | Ga0496110_0383155_550_1044 | 164 |
| 365 | 3300048913 | Ga0496110_0940505 | Ga0496110_0940505_144_638 | 164 |
| 366 | 3300048914 | Ga0496111_0744225 | Ga0496111_0744225_172_666 | 164 |
| 367 | 3300048915 | Ga0496112_0022619 | Ga0496112_0022619_368_862 | 164 |
| 368 | 3300048916 | Ga0496113_0012118 | Ga0496113_0012118_5143_5637 | 164 |
| 369 | 3300048918 | Ga0496115_0318838 | Ga0496115_0318838_331_825 | 164 |
| 370 | 3300048919 | Ga0496116_0061378 | Ga0496116_0061378_69_563 | 164 |
| 371 | 3300048920 | Ga0496117_0059165 | Ga0496117_0059165_765_1259 | 164 |
| 372 | 3300048920 | Ga0496117_0280598 | Ga0496117_0280598_237_731 | 164 |
| 373 | 3300048921 | Ga0496118_0091384 | Ga0496118_0091384_79_573 | 164 |
| 374 | 3300048921 | Ga0496118_0109252 | Ga0496118_0109252_141_635 | 164 |
| 375 | 3300048922 | Ga0496119_0141737 | Ga0496119_0141737_297_791 | 164 |
| 376 | 3300048922 | Ga0496119_0234809 | Ga0496119_0234809_99_593 | 164 |
| 377 | 3300048922 | Ga0496119_0291122 | Ga0496119_0291122_98_592 | 164 |
| 378 | 3300048923 | Ga0496120_0261752 | Ga0496120_0261752_105_599 | 164 |
| 379 | 3300048924 | Ga0496121_0398086 | Ga0496121_0398086_110_604 | 164 |
| 380 | 3300048927 | Ga0496124_0097302 | Ga0496124_0097302_742_1236 | 164 |
| 381 | 3300048928 | Ga0496125_0066546 | Ga0496125_0066546_631_1125 | 164 |
| 382 | 3300049460 | Ga0495682_0025675 | Ga0495682_0025675_567_1061 | 164 |
| 383 | 3300049570 | Ga0501033_0203626 | Ga0501033_0203626_319_813 | 164 |
| 384 | 3300049572 | Ga0501036_0638273 | Ga0501036_0638273_313_807 | 164 |
| 385 | 3300049574 | Ga0501038_0588485 | Ga0501038_0588485_257_751 | 164 |
| 386 | 3300049575 | Ga0501039_0990388 | Ga0501039_0990388_122_616 | 164 |
| 387 | 3300049823 | Ga0501044_0079839 | Ga0501044_0079839_1208_1702 | 164 |
| 388 | 3300050492 | nmdc:mga0yw44_36135_c1 | nmdc:mga0yw44_36135_c1_1574_2068 | 164 |
| 389 | 3300050492 | nmdc:mga0yw44_690365_c1 | nmdc:mga0yw44_690365_c1_156_650 | 164 |
| 390 | 3300050493 | nmdc:mga0k408_214694_c1 | nmdc:mga0k408_214694_c1_181_675 | 164 |
| 391 | 3300050493 | nmdc:mga0k408_61570_c1 | nmdc:mga0k408_61570_c1_838_1332 | 164 |
| 392 | 3300050495 | nmdc:mga04h51_88470_c1 | nmdc:mga04h51_88470_c1_43_537 | 164 |
| 393 | 3300050496 | nmdc:mga07m45_141838_c1 | nmdc:mga07m45_141838_c1_567_1061 | 164 |
| 394 | 3300050496 | nmdc:mga07m45_43829_c1 | nmdc:mga07m45_43829_c1_553_1047 | 164 |
| 395 | 3300050496 | nmdc:mga07m45_66829_c1 | nmdc:mga07m45_66829_c1_1484_1978 | 164 |
| 396 | 3300050516 | nmdc:mga0sz30_105824_c1 | nmdc:mga0sz30_105824_c1_402_896 | 164 |
| 397 | 3300050516 | nmdc:mga0sz30_139620_c1 | nmdc:mga0sz30_139620_c1_561_1055 | 164 |
| 398 | 3300053079 | Ga0500610_0250074 | Ga0500610_0250074_49_543 | 164 |
| 399 | 3300053080 | Ga0500635_0017554 | Ga0500635_0017554_413_907 | 164 |
| 400 | 3300053083 | Ga0495655_0028161 | Ga0495655_0028161_390_884 | 164 |
| 401 | 3300053086 | Ga0500578_0198420 | Ga0500578_0198420_246_740 | 164 |
| 402 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_283845_284339 | 164 |
| 403 | 3300053091 | Ga0500647_0231044 | Ga0500647_0231044_19_513 | 164 |
| 404 | 3300053092 | Ga0500583_0056880 | Ga0500583_0056880_1135_1629 | 164 |
| 405 | 3300053094 | Ga0500566_0001097 | Ga0500566_0001097_3636_4130 | 164 |
| 406 | 3300053095 | Ga0500640_022449 | Ga0500640_022449_1946_2440 | 164 |
| 407 | 3300053103 | Ga0500555_005971 | Ga0500555_005971_1901_2395 | 164 |
| 408 | 3300053104 | Ga0500556_0039804 | Ga0500556_0039804_356_850 | 164 |
| 409 | 3300053105 | Ga0500557_000030 | Ga0500557_000030_42424_42918 | 164 |
| 410 | 3300053108 | Ga0500562_006360 | Ga0500562_006360_899_1393 | 164 |
| 411 | 3300053109 | Ga0500569_177594 | Ga0500569_177594_135_629 | 164 |
| 412 | 3300053111 | Ga0500572_012340 | Ga0500572_012340_1391_1885 | 164 |
| 413 | 3300053121 | Ga0500607_025594 | Ga0500607_025594_1297_1791 | 164 |
| 414 | 3300053122 | Ga0500608_022223 | Ga0500608_022223_1794_2288 | 164 |
| 415 | 3300053130 | Ga0500642_0000383 | Ga0500642_0000383_12847_13341 | 164 |
| 416 | 3300053130 | Ga0500642_0028004 | Ga0500642_0028004_698_1192 | 164 |
| 417 | 3300053133 | Ga0500655_032876 | Ga0500655_032876_390_884 | 164 |
| 418 | 3300053136 | Ga0500559_0063419 | Ga0500559_0063419_1027_1521 | 164 |
| 419 | 3300053136 | Ga0500559_0396141 | Ga0500559_0396141_18_512 | 164 |
| 420 | 3300053138 | Ga0500564_046420 | Ga0500564_046420_654_1148 | 164 |
| 421 | 3300053140 | Ga0500573_0239073 | Ga0500573_0239073_390_884 | 164 |
| 422 | 3300053146 | Ga0500588_0052558 | Ga0500588_0052558_360_854 | 164 |
| 423 | 3300053148 | Ga0500590_236454 | Ga0500590_236454_74_568 | 164 |
| 424 | 3300053156 | Ga0500622_0038670 | Ga0500622_0038670_1442_1936 | 164 |
| 425 | 3300053157 | Ga0500624_005683 | Ga0500624_005683_258_752 | 164 |
| 426 | 3300053163 | Ga0500639_129909 | Ga0500639_129909_684_1178 | 164 |
| 427 | 3300053177 | Ga0500636_0001605 | Ga0500636_0001605_5081_5575 | 164 |
| 428 | 3300053177 | Ga0500636_0020415 | Ga0500636_0020415_2977_3474 | 164 |
| 429 | 3300053178 | Ga0500637_0266197 | Ga0500637_0266197_432_926 | 164 |
| 430 | 3300053729 | Ga0500625_093427 | Ga0500625_093427_58_552 | 164 |
| 431 | 3300053731 | Ga0500609_003839 | Ga0500609_003839_268_762 | 164 |
| 432 | 3300053736 | Ga0500599_005210 | Ga0500599_005210_368_862 | 164 |
| 433 | 3300053737 | Ga0500601_000369 | Ga0500601_000369_5596_6090 | 164 |
| 434 | 3300053737 | Ga0500601_044490 | Ga0500601_044490_19_513 | 164 |
| 435 | 3300003659 | JGI25404J52841_10045704 | JGI25404J52841_100457041 | 165 |
| 436 | 3300005434 | Ga0070709_10308962 | Ga0070709_103089622 | 165 |
| 437 | 3300005434 | Ga0070709_10866062 | Ga0070709_108660621 | 165 |
| 438 | 3300005435 | Ga0070714_101512203 | Ga0070714_1015122032 | 165 |
| 439 | 3300005456 | Ga0070678_100140700 | Ga0070678_1001407002 | 165 |
| 440 | 3300005456 | Ga0070678_100533455 | Ga0070678_1005334551 | 165 |
| 441 | 3300005458 | Ga0070681_10120889 | Ga0070681_101208892 | 165 |
| 442 | 3300005530 | Ga0070679_100355837 | Ga0070679_1003558372 | 165 |
| 443 | 3300005548 | Ga0070665_101748841 | Ga0070665_1017488412 | 165 |
| 444 | 3300005563 | Ga0068855_100106562 | Ga0068855_1001065622 | 165 |
| 445 | 3300005614 | Ga0068856_101738401 | Ga0068856_1017384012 | 165 |
| 446 | 3300005617 | Ga0068859_101918619 | Ga0068859_1019186192 | 165 |
| 447 | 3300005842 | Ga0068858_100136471 | Ga0068858_1001364712 | 165 |
| 448 | 3300005983 | Ga0081540_1017980 | Ga0081540_10179802 | 165 |
| 449 | 3300006048 | Ga0075363_100216706 | Ga0075363_1002167062 | 165 |
| 450 | 3300006048 | Ga0075363_100320648 | Ga0075363_1003206481 | 165 |
| 451 | 3300006175 | Ga0070712_100696505 | Ga0070712_1006965052 | 165 |
| 452 | 3300006177 | Ga0075362_10084236 | Ga0075362_100842362 | 165 |
| 453 | 3300006195 | Ga0075366_10095291 | Ga0075366_100952913 | 165 |
| 454 | 3300006871 | Ga0075434_100733678 | Ga0075434_1007336782 | 165 |
| 455 | 3300006914 | Ga0075436_100709886 | Ga0075436_1007098861 | 165 |
| 456 | 3300006931 | Ga0097620_101917685 | Ga0097620_1019176851 | 165 |
| 457 | 3300009093 | Ga0105240_10257634 | Ga0105240_102576343 | 165 |
| 458 | 3300009098 | Ga0105245_10153537 | Ga0105245_101535372 | 165 |
| 459 | 3300009101 | Ga0105247_10017288 | Ga0105247_100172882 | 165 |
| 460 | 3300009148 | Ga0105243_11274174 | Ga0105243_112741741 | 165 |
| 461 | 3300009174 | Ga0105241_10357440 | Ga0105241_103574402 | 165 |
| 462 | 3300009174 | Ga0105241_10528139 | Ga0105241_105281392 | 165 |
| 463 | 3300009176 | Ga0105242_10092057 | Ga0105242_100920573 | 165 |
| 464 | 3300009176 | Ga0105242_10571422 | Ga0105242_105714222 | 165 |
| 465 | 3300009177 | Ga0105248_10272253 | Ga0105248_102722532 | 165 |
| 466 | 3300009177 | Ga0105248_10713352 | Ga0105248_107133522 | 165 |
| 467 | 3300009551 | Ga0105238_10363603 | Ga0105238_103636032 | 165 |
| 468 | 3300009551 | Ga0105238_10381016 | Ga0105238_103810162 | 165 |
| 469 | 3300009551 | Ga0105238_10806522 | Ga0105238_108065222 | 165 |
| 470 | 3300010375 | Ga0105239_10345144 | Ga0105239_103451443 | 165 |
| 471 | 3300013104 | Ga0157370_10117616 | Ga0157370_101176162 | 165 |
| 472 | 3300013297 | Ga0157378_10068602 | Ga0157378_100686022 | 165 |
| 473 | 3300013306 | Ga0163162_10163256 | Ga0163162_101632562 | 165 |
| 474 | 3300013306 | Ga0163162_11138511 | Ga0163162_111385112 | 165 |
| 475 | 3300013307 | Ga0157372_10174205 | Ga0157372_101742052 | 165 |
| 476 | 3300013307 | Ga0157372_10655539 | Ga0157372_106555392 | 165 |
| 477 | 3300013308 | Ga0157375_10113699 | Ga0157375_101136992 | 165 |
| 478 | 3300013308 | Ga0157375_11409464 | Ga0157375_114094641 | 165 |
| 479 | 3300013308 | Ga0157375_12236816 | Ga0157375_122368161 | 165 |
| 480 | 3300014325 | Ga0163163_10062643 | Ga0163163_100626432 | 165 |
| 481 | 3300014325 | Ga0163163_10239356 | Ga0163163_102393562 | 165 |
| 482 | 3300014325 | Ga0163163_10433885 | Ga0163163_104338852 | 165 |
| 483 | 3300014326 | Ga0157380_10674945 | Ga0157380_106749452 | 165 |
| 484 | 3300020082 | Ga0206353_11199008 | Ga0206353_111990082 | 165 |
| 485 | 3300021384 | Ga0213876_10206921 | Ga0213876_102069212 | 165 |
| 486 | 3300025253 | Ga0209677_101642 | Ga0209677_1016428 | 165 |
| 487 | 3300025272 | Ga0209455_1012975 | Ga0209455_10129752 | 165 |
| 488 | 3300025297 | Ga0209758_1114322 | Ga0209758_11143221 | 165 |
| 489 | 3300025899 | Ga0207642_10368731 | Ga0207642_103687312 | 165 |
| 490 | 3300025906 | Ga0207699_10347838 | Ga0207699_103478382 | 165 |
| 491 | 3300025911 | Ga0207654_10024849 | Ga0207654_100248493 | 165 |
| 492 | 3300025913 | Ga0207695_10260343 | Ga0207695_102603432 | 165 |
| 493 | 3300025915 | Ga0207693_10599361 | Ga0207693_105993612 | 165 |
| 494 | 3300025921 | Ga0207652_10098834 | Ga0207652_100988342 | 165 |
| 495 | 3300025924 | Ga0207694_10475199 | Ga0207694_104751992 | 165 |
| 496 | 3300025934 | Ga0207686_10307016 | Ga0207686_103070162 | 165 |
| 497 | 3300025935 | Ga0207709_10889825 | Ga0207709_108898251 | 165 |
| 498 | 3300025941 | Ga0207711_10177015 | Ga0207711_101770152 | 165 |
| 499 | 3300025949 | Ga0207667_10022298 | Ga0207667_100222988 | 165 |
| 500 | 3300025986 | Ga0207658_10185974 | Ga0207658_101859742 | 165 |
| 501 | 3300026041 | Ga0207639_10177248 | Ga0207639_101772482 | 165 |
| 502 | 3300026041 | Ga0207639_10363851 | Ga0207639_103638512 | 165 |
| 503 | 3300026078 | Ga0207702_11104669 | Ga0207702_111046692 | 165 |
| 504 | 3300026078 | Ga0207702_11368565 | Ga0207702_113685651 | 165 |
| 505 | 3300026088 | Ga0207641_10185125 | Ga0207641_101851252 | 165 |
| 506 | 3300026121 | Ga0207683_10181102 | Ga0207683_101811023 | 165 |
| 507 | 3300026142 | Ga0207698_10761890 | Ga0207698_107618901 | 165 |
| 508 | 3300027512 | Ga0209179_1003083 | Ga0209179_10030833 | 165 |
| 509 | 3300028379 | Ga0268266_10760568 | Ga0268266_107605682 | 165 |
| 510 | 3300028573 | Ga0265334_10107696 | Ga0265334_101076961 | 165 |
| 511 | 3300028577 | Ga0265318_10165207 | Ga0265318_101652071 | 165 |
| 512 | 3300028666 | Ga0265336_10000560 | Ga0265336_1000056010 | 165 |
| 513 | 3300028786 | Ga0307517_10326417 | Ga0307517_103264172 | 165 |
| 514 | 3300028794 | Ga0307515_10133021 | Ga0307515_101330212 | 165 |
| 515 | 3300028800 | Ga0265338_10000271 | Ga0265338_1000027187 | 165 |
| 516 | 3300031247 | Ga0265340_10005857 | Ga0265340_100058575 | 165 |
| 517 | 3300031344 | Ga0265316_10214867 | Ga0265316_102148672 | 165 |
| 518 | 3300031456 | Ga0307513_10193740 | Ga0307513_101937402 | 165 |
| 519 | 3300031548 | Ga0307408_100799426 | Ga0307408_1007994261 | 165 |
| 520 | 3300031730 | Ga0307516_10133801 | Ga0307516_101338013 | 165 |
| 521 | 3300031730 | Ga0307516_10161705 | Ga0307516_101617052 | 165 |
| 522 | 3300031911 | Ga0307412_10813577 | Ga0307412_108135772 | 165 |
| 523 | 3300035089 | Ga0373944_0106891 | Ga0373944_0106891_99_596 | 165 |
| 524 | 3300035091 | Ga0373951_0119604 | Ga0373951_0119604_137_634 | 165 |
| 525 | 3300035112 | Ga0373932_0021778 | Ga0373932_0021778_251_748 | 165 |
| 526 | 3300035114 | Ga0373939_0148781 | Ga0373939_0148781_167_664 | 165 |
| 527 | 3300035171 | Ga0373946_0328360 | Ga0373946_0328360_79_576 | 165 |
| 528 | 3300035691 | Ga0373931_0349698 | Ga0373931_0349698_214_711 | 165 |
| 529 | 3300035692 | Ga0373935_0183460 | Ga0373935_0183460_83_580 | 165 |
| 530 | 3300035692 | Ga0373935_0228053 | Ga0373935_0228053_37_534 | 165 |
| 531 | 3300035695 | Ga0373927_0004320 | Ga0373927_0004320_8083_8580 | 165 |
| 532 | 3300035695 | Ga0373927_0047393 | Ga0373927_0047393_2201_2698 | 165 |
| 533 | 3300037068 | Ga0373925_0167487 | Ga0373925_0167487_430_927 | 165 |
| 534 | 3300037068 | Ga0373925_0400779 | Ga0373925_0400779_606_1103 | 165 |
| 535 | 3300037068 | Ga0373925_1309624 | Ga0373925_1309624_69_566 | 165 |
| 536 | 3300037312 | Ga0395899_0273897 | Ga0395899_0273897_640_1140 | 165 |
| 537 | 3300037418 | Ga0395900_0178057 | Ga0395900_0178057_926_1426 | 165 |
| 538 | 3300037466 | Ga0395898_0165429 | Ga0395898_0165429_260_757 | 165 |
| 539 | 3300037471 | Ga0395905_0081127 | Ga0395905_0081127_2449_2946 | 165 |
| 540 | 3300037853 | Ga0436364_1201965 | Ga0436364_1201965_598_1101 | 165 |
| 541 | 3300038443 | Ga0395901_0007708 | Ga0395901_0007708_36_536 | 165 |
| 542 | 3300038443 | Ga0395901_0268958 | Ga0395901_0268958_394_891 | 165 |
| 543 | 3300038443 | Ga0395901_0325799 | Ga0395901_0325799_718_1215 | 165 |
| 544 | 3300039437 | Ga0436365_0024912 | Ga0436365_0024912_2949_3446 | 165 |
| 545 | 3300039437 | Ga0436365_0198024 | Ga0436365_0198024_71_568 | 165 |
| 546 | 3300039437 | Ga0436365_1083010 | Ga0436365_1083010_24_521 | 165 |
| 547 | 3300039450 | Ga0436363_1035359 | Ga0436363_1035359_267_776 | 165 |
| 548 | 3300039450 | Ga0436363_1501048 | Ga0436363_1501048_1430_1927 | 165 |
| 549 | 3300041453 | Ga0451797_0551223 | Ga0451797_0551223_119_616 | 165 |
| 550 | 3300044684 | Ga0466966_0513492 | Ga0466966_0513492_89_586 | 165 |
| 551 | 3300044694 | Ga0466963_0172797 | Ga0466963_0172797_246_743 | 165 |
| 552 | 3300044694 | Ga0466963_0686548 | Ga0466963_0686548_187_684 | 165 |
| 553 | 3300044706 | Ga0466964_0638306 | Ga0466964_0638306_76_573 | 165 |
| 554 | 3300044719 | Ga0466971_0095286 | Ga0466971_0095286_266_763 | 165 |
| 555 | 3300044842 | Ga0466957_0110450 | Ga0466957_0110450_1159_1656 | 165 |
| 556 | 3300045836 | Ga0466958_0148746 | Ga0466958_0148746_905_1402 | 165 |
| 557 | 3300045976 | Ga0466967_0105036 | Ga0466967_0105036_448_945 | 165 |
| 558 | 3300046492 | Ga0495585_0406931 | Ga0495585_0406931_119_616 | 165 |
| 559 | 3300046519 | Ga0495632_0352628 | Ga0495632_0352628_57_554 | 165 |
| 560 | 3300046660 | Ga0495625_0695905 | Ga0495625_0695905_32_529 | 165 |
| 561 | 3300046680 | Ga0495646_0447170 | Ga0495646_0447170_134_631 | 165 |
| 562 | 3300047320 | Ga0495672_0018431 | Ga0495672_0018431_1562_2059 | 165 |
| 563 | 3300047320 | Ga0495672_0227717 | Ga0495672_0227717_68_568 | 165 |
| 564 | 3300047320 | Ga0495672_0228158 | Ga0495672_0228158_104_601 | 165 |
| 565 | 3300047469 | Ga0495673_0025262 | Ga0495673_0025262_2187_2684 | 165 |
| 566 | 3300047472 | Ga0495686_0125430 | Ga0495686_0125430_989_1489 | 165 |
| 567 | 3300047472 | Ga0495686_0180845 | Ga0495686_0180845_334_831 | 165 |
| 568 | 3300047472 | Ga0495686_0535841 | Ga0495686_0535841_28_525 | 165 |
| 569 | 3300048903 | Ga0496100_0028982 | Ga0496100_0028982_951_1448 | 165 |
| 570 | 3300048904 | Ga0496101_0121111 | Ga0496101_0121111_1418_1915 | 165 |
| 571 | 3300048905 | Ga0496102_0028991 | Ga0496102_0028991_1889_2386 | 165 |
| 572 | 3300048906 | Ga0496103_0014170 | Ga0496103_0014170_4195_4692 | 165 |
| 573 | 3300048906 | Ga0496103_0082966 | Ga0496103_0082966_586_1083 | 165 |
| 574 | 3300048907 | Ga0496104_0025212 | Ga0496104_0025212_1180_1677 | 165 |
| 575 | 3300048907 | Ga0496104_0086445 | Ga0496104_0086445_2022_2519 | 165 |
| 576 | 3300048907 | Ga0496104_0152751 | Ga0496104_0152751_1697_2194 | 165 |
| 577 | 3300048908 | Ga0496105_0010472 | Ga0496105_0010472_1737_2234 | 165 |
| 578 | 3300048909 | Ga0496106_1004280 | Ga0496106_1004280_15_512 | 165 |
| 579 | 3300048910 | Ga0496107_0425198 | Ga0496107_0425198_367_864 | 165 |
| 580 | 3300048911 | Ga0496108_0383370 | Ga0496108_0383370_132_629 | 165 |
| 581 | 3300048912 | Ga0496109_0122962 | Ga0496109_0122962_1864_2361 | 165 |
| 582 | 3300048912 | Ga0496109_0417796 | Ga0496109_0417796_723_1220 | 165 |
| 583 | 3300048913 | Ga0496110_0049214 | Ga0496110_0049214_1463_1960 | 165 |
| 584 | 3300048914 | Ga0496111_0007510 | Ga0496111_0007510_1441_1938 | 165 |
| 585 | 3300048914 | Ga0496111_0203532 | Ga0496111_0203532_38_535 | 165 |
| 586 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_24433_24930 | 165 |
| 587 | 3300048915 | Ga0496112_0007998 | Ga0496112_0007998_2924_3421 | 165 |
| 588 | 3300048915 | Ga0496112_0142462 | Ga0496112_0142462_1156_1653 | 165 |
| 589 | 3300048916 | Ga0496113_0005790 | Ga0496113_0005790_1733_2230 | 165 |
| 590 | 3300048916 | Ga0496113_0152914 | Ga0496113_0152914_436_933 | 165 |
| 591 | 3300048917 | Ga0496114_0040502 | Ga0496114_0040502_3145_3642 | 165 |
| 592 | 3300048918 | Ga0496115_0009886 | Ga0496115_0009886_3554_4051 | 165 |
| 593 | 3300048919 | Ga0496116_0132742 | Ga0496116_0132742_796_1293 | 165 |
| 594 | 3300048921 | Ga0496118_0011526 | Ga0496118_0011526_5304_5801 | 165 |
| 595 | 3300048922 | Ga0496119_0179815 | Ga0496119_0179815_584_1081 | 165 |
| 596 | 3300048923 | Ga0496120_0228428 | Ga0496120_0228428_249_746 | 165 |
| 597 | 3300048924 | Ga0496121_0032083 | Ga0496121_0032083_2826_3323 | 165 |
| 598 | 3300048924 | Ga0496121_0115792 | Ga0496121_0115792_963_1463 | 165 |
| 599 | 3300048924 | Ga0496121_0511767 | Ga0496121_0511767_49_546 | 165 |
| 600 | 3300048925 | Ga0496122_0233982 | Ga0496122_0233982_144_641 | 165 |
| 601 | 3300048926 | Ga0496123_0129961 | Ga0496123_0129961_169_666 | 165 |
| 602 | 3300048927 | Ga0496124_0321680 | Ga0496124_0321680_566_1063 | 165 |
| 603 | 3300048928 | Ga0496125_0000158 | Ga0496125_0000158_7624_8121 | 165 |
| 604 | 3300048928 | Ga0496125_0001222 | Ga0496125_0001222_30408_30905 | 165 |
| 605 | 3300048928 | Ga0496125_0146477 | Ga0496125_0146477_216_713 | 165 |
| 606 | 3300048928 | Ga0496125_0401690 | Ga0496125_0401690_218_715 | 165 |
| 607 | 3300048929 | Ga0496126_0001668 | Ga0496126_0001668_3426_3923 | 165 |
| 608 | 3300048929 | Ga0496126_0020931 | Ga0496126_0020931_4962_5459 | 165 |
| 609 | 3300048929 | Ga0496126_0305050 | Ga0496126_0305050_501_998 | 165 |
| 610 | 3300049569 | Ga0501032_0090827 | Ga0501032_0090827_1438_1935 | 165 |
| 611 | 3300049569 | Ga0501032_0147391 | Ga0501032_0147391_629_1129 | 165 |
| 612 | 3300049569 | Ga0501032_0231282 | Ga0501032_0231282_447_944 | 165 |
| 613 | 3300049570 | Ga0501033_0102788 | Ga0501033_0102788_1274_1774 | 165 |
| 614 | 3300049570 | Ga0501033_0579114 | Ga0501033_0579114_170_667 | 165 |
| 615 | 3300049571 | Ga0501034_1512917 | Ga0501034_1512917_28_525 | 165 |
| 616 | 3300049572 | Ga0501036_0282354 | Ga0501036_0282354_23_523 | 165 |
| 617 | 3300049574 | Ga0501038_0352460 | Ga0501038_0352460_54_551 | 165 |
| 618 | 3300049579 | Ga0501043_0949468 | Ga0501043_0949468_33_530 | 165 |
| 619 | 3300049580 | Ga0501046_0244336 | Ga0501046_0244336_473_973 | 165 |
| 620 | 3300049581 | Ga0501047_0016108 | Ga0501047_0016108_6033_6530 | 165 |
| 621 | 3300049581 | Ga0501047_0101596 | Ga0501047_0101596_1444_1941 | 165 |
| 622 | 3300049581 | Ga0501047_0110149 | Ga0501047_0110149_585_1085 | 165 |
| 623 | 3300049582 | Ga0501048_0038823 | Ga0501048_0038823_1861_2361 | 165 |
| 624 | 3300049586 | Ga0501070_0005564 | Ga0501070_0005564_7721_8218 | 165 |
| 625 | 3300049586 | Ga0501070_0208694 | Ga0501070_0208694_377_877 | 165 |
| 626 | 3300049586 | Ga0501070_0392522 | Ga0501070_0392522_55_552 | 165 |
| 627 | 3300049590 | Ga0501074_0009318 | Ga0501074_0009318_6535_7032 | 165 |
| 628 | 3300049742 | Ga0501080_0138025 | Ga0501080_0138025_90_587 | 165 |
| 629 | 3300049823 | Ga0501044_0173484 | Ga0501044_0173484_779_1276 | 165 |
| 630 | 3300049823 | Ga0501044_0393994 | Ga0501044_0393994_238_735 | 165 |
| 631 | 3300049823 | Ga0501044_0676144 | Ga0501044_0676144_30_527 | 165 |
| 632 | 3300050490 | nmdc:mga03n38_99218_c1 | nmdc:mga03n38_99218_c1_565_1062 | 165 |
| 633 | 3300050492 | nmdc:mga0yw44_88943_c1 | nmdc:mga0yw44_88943_c1_1313_1810 | 165 |
| 634 | 3300050493 | nmdc:mga0k408_175467_c1 | nmdc:mga0k408_175467_c1_765_1262 | 165 |
| 635 | 3300050512 | nmdc:mga0n895_614776_c1 | nmdc:mga0n895_614776_c1_127_624 | 165 |
| 636 | 3300050514 | nmdc:mga08x19_637422_c1 | nmdc:mga08x19_637422_c1_71_568 | 165 |
| 637 | 3300053077 | Ga0495601_0435467 | Ga0495601_0435467_20_517 | 165 |
| 638 | 3300053096 | Ga0500641_0042629 | Ga0500641_0042629_1245_1742 | 165 |
| 639 | 3300053162 | Ga0500638_081150 | Ga0500638_081150_17_514 | 165 |
| 640 | 3300061719 | Ga0466962_0354289 | Ga0466962_0354289_70_567 | 165 |
| 641 | iso_pu_bacteria | 2513237101 | 2513697852 | 165 |
| 642 | iso_pu_bacteria | 2791355199 | 2793080396 | 165 |
| 643 | iso_pu_bacteria | 2874604998 | 2874606609 | 165 |
| 644 | iso_pu_bacteria | 2876808645 | 2876814477 | 165 |
| 645 | iso_pu_bacteria | 2879110137 | 2879112068 | 165 |
| 646 | iso_pu_bacteria | 2889033259 | 2889033983 | 165 |
| 647 | iso_pu_bacteria | 2922361189 | 2922367386 | 165 |
| 648 | iso_pu_bacteria | 2922386360 | 2922389915 | 165 |
| 649 | iso_pu_bacteria | 8006994254 | 8006998204 | 165 |
| 650 | 3300003215 | JGI25153J46596_10003712 | JGI25153J46596_1000371210 | 166 |
| 651 | 3300003771 | Ga0055526_1038662 | Ga0055526_10386622 | 166 |
| 652 | 3300003794 | Ga0055531_10031944 | Ga0055531_100319442 | 166 |
| 653 | 3300005262 | Ga0065165_1009084 | Ga0065165_10090841 | 166 |
| 654 | 3300005435 | Ga0070714_100009317 | Ga0070714_1000093175 | 166 |
| 655 | 3300005437 | Ga0070710_10001623 | Ga0070710_100016232 | 166 |
| 656 | 3300005439 | Ga0070711_100002600 | Ga0070711_1000026007 | 166 |
| 657 | 3300006028 | Ga0070717_10350458 | Ga0070717_103504582 | 166 |
| 658 | 3300006038 | Ga0075365_10433016 | Ga0075365_104330162 | 166 |
| 659 | 3300006173 | Ga0070716_100048505 | Ga0070716_1000485052 | 166 |
| 660 | 3300006175 | Ga0070712_100149931 | Ga0070712_1001499312 | 166 |
| 661 | 3300007265 | Ga0099794_10014948 | Ga0099794_100149482 | 166 |
| 662 | 3300025245 | Ga0207425_1015495 | Ga0207425_10154952 | 166 |
| 663 | 3300025295 | Ga0209564_1012127 | Ga0209564_10121272 | 166 |
| 664 | 3300025297 | Ga0209758_1000595 | Ga0209758_100059525 | 166 |
| 665 | 3300025299 | Ga0209256_1005227 | Ga0209256_10052278 | 166 |
| 666 | 3300025304 | Ga0209257_1001217 | Ga0209257_10012172 | 166 |
| 667 | 3300025898 | Ga0207692_10020286 | Ga0207692_100202862 | 166 |
| 668 | 3300025906 | Ga0207699_10047038 | Ga0207699_100470382 | 166 |
| 669 | 3300025915 | Ga0207693_10017479 | Ga0207693_100174794 | 166 |
| 670 | 3300025928 | Ga0207700_10055580 | Ga0207700_100555802 | 166 |
| 671 | 3300025939 | Ga0207665_10010040 | Ga0207665_100100405 | 166 |
| 672 | 3300048915 | Ga0496112_0186224 | Ga0496112_0186224_1447_1968 | 167 |
| 673 | 3300003659 | JGI25404J52841_10009905 | JGI25404J52841_100099052 | 168 |
| 674 | 3300003659 | JGI25404J52841_10020979 | JGI25404J52841_100209791 | 168 |
| 675 | 3300003762 | Ga0055542_1002315 | Ga0055542_10023156 | 168 |
| 676 | 3300005338 | Ga0068868_101145613 | Ga0068868_1011456131 | 168 |
| 677 | 3300005347 | Ga0070668_100071817 | Ga0070668_1000718172 | 168 |
| 678 | 3300005365 | Ga0070688_100170205 | Ga0070688_1001702052 | 168 |
| 679 | 3300005455 | Ga0070663_100245385 | Ga0070663_1002453851 | 168 |
| 680 | 3300005456 | Ga0070678_100130094 | Ga0070678_1001300941 | 168 |
| 681 | 3300005539 | Ga0068853_100096571 | Ga0068853_1000965712 | 168 |
| 682 | 3300005543 | Ga0070672_100549490 | Ga0070672_1005494902 | 168 |
| 683 | 3300005546 | Ga0070696_100439503 | Ga0070696_1004395032 | 168 |
| 684 | 3300005547 | Ga0070693_100051061 | Ga0070693_1000510612 | 168 |
| 685 | 3300005577 | Ga0068857_100144830 | Ga0068857_1001448302 | 168 |
| 686 | 3300005614 | Ga0068856_100327511 | Ga0068856_1003275112 | 168 |
| 687 | 3300005615 | Ga0070702_100545629 | Ga0070702_1005456292 | 168 |
| 688 | 3300005842 | Ga0068858_100096388 | Ga0068858_1000963882 | 168 |
| 689 | 3300005937 | Ga0081455_10082596 | Ga0081455_100825963 | 168 |
| 690 | 3300005983 | Ga0081540_1025360 | Ga0081540_10253602 | 168 |
| 691 | 3300005983 | Ga0081540_1025400 | Ga0081540_10254002 | 168 |
| 692 | 3300005983 | Ga0081540_1057447 | Ga0081540_10574472 | 168 |
| 693 | 3300006042 | Ga0075368_10026301 | Ga0075368_100263013 | 168 |
| 694 | 3300006051 | Ga0075364_10349673 | Ga0075364_103496731 | 168 |
| 695 | 3300006178 | Ga0075367_10053707 | Ga0075367_100537072 | 168 |
| 696 | 3300006186 | Ga0075369_10342871 | Ga0075369_103428711 | 168 |
| 697 | 3300006237 | Ga0097621_100432833 | Ga0097621_1004328332 | 168 |
| 698 | 3300006871 | Ga0075434_100209149 | Ga0075434_1002091492 | 168 |
| 699 | 3300006881 | Ga0068865_100734418 | Ga0068865_1007344181 | 168 |
| 700 | 3300007076 | Ga0075435_100341684 | Ga0075435_1003416842 | 168 |
| 701 | 3300009098 | Ga0105245_10035055 | Ga0105245_100350554 | 168 |
| 702 | 3300009101 | Ga0105247_10217410 | Ga0105247_102174101 | 168 |
| 703 | 3300009174 | Ga0105241_10094456 | Ga0105241_100944562 | 168 |
| 704 | 3300009176 | Ga0105242_10597086 | Ga0105242_105970863 | 168 |
| 705 | 3300009545 | Ga0105237_10204960 | Ga0105237_102049602 | 168 |
| 706 | 3300010375 | Ga0105239_10078222 | Ga0105239_100782222 | 168 |
| 707 | 3300012507 | Ga0157342_1026416 | Ga0157342_10264161 | 168 |
| 708 | 3300013296 | Ga0157374_10159026 | Ga0157374_101590262 | 168 |
| 709 | 3300013297 | Ga0157378_10159002 | Ga0157378_101590022 | 168 |
| 710 | 3300013308 | Ga0157375_10321761 | Ga0157375_103217612 | 168 |
| 711 | 3300025254 | Ga0209148_1001022 | Ga0209148_100102212 | 168 |
| 712 | 3300025261 | Ga0209233_1027288 | Ga0209233_10272882 | 168 |
| 713 | 3300025272 | Ga0209455_1003787 | Ga0209455_10037873 | 168 |
| 714 | 3300025901 | Ga0207688_10169394 | Ga0207688_101693941 | 168 |
| 715 | 3300025908 | Ga0207643_10099827 | Ga0207643_100998272 | 168 |
| 716 | 3300025911 | Ga0207654_10065125 | Ga0207654_100651252 | 168 |
| 717 | 3300025914 | Ga0207671_10156502 | Ga0207671_101565021 | 168 |
| 718 | 3300025919 | Ga0207657_10321217 | Ga0207657_103212172 | 168 |
| 719 | 3300025925 | Ga0207650_10257937 | Ga0207650_102579372 | 168 |
| 720 | 3300025927 | Ga0207687_10013862 | Ga0207687_100138624 | 168 |
| 721 | 3300025931 | Ga0207644_10115686 | Ga0207644_101156861 | 168 |
| 722 | 3300025933 | Ga0207706_10084263 | Ga0207706_100842632 | 168 |
| 723 | 3300025936 | Ga0207670_10163221 | Ga0207670_101632212 | 168 |
| 724 | 3300025940 | Ga0207691_11195863 | Ga0207691_111958632 | 168 |
| 725 | 3300025941 | Ga0207711_10082496 | Ga0207711_100824961 | 168 |
| 726 | 3300025942 | Ga0207689_10112861 | Ga0207689_101128612 | 168 |
| 727 | 3300025972 | Ga0207668_10279874 | Ga0207668_102798742 | 168 |
| 728 | 3300026023 | Ga0207677_10043795 | Ga0207677_100437953 | 168 |
| 729 | 3300026035 | Ga0207703_10041071 | Ga0207703_100410712 | 168 |
| 730 | 3300026078 | Ga0207702_10442860 | Ga0207702_104428602 | 168 |
| 731 | 3300026116 | Ga0207674_10158819 | Ga0207674_101588192 | 168 |
| 732 | 3300026121 | Ga0207683_10125376 | Ga0207683_101253762 | 168 |
| 733 | 3300026142 | Ga0207698_10765327 | Ga0207698_107653272 | 168 |
| 734 | 3300027866 | Ga0209813_10128294 | Ga0209813_101282941 | 168 |
| 735 | 3300028379 | Ga0268266_10097894 | Ga0268266_100978942 | 168 |
| 736 | 3300028381 | Ga0268264_10161794 | Ga0268264_101617942 | 168 |
| 737 | 3300031507 | Ga0307509_10320647 | Ga0307509_103206472 | 168 |
| 738 | 3300035691 | Ga0373931_0101514 | Ga0373931_0101514_932_1450 | 168 |
| 739 | 3300044901 | Ga0466960_0293881 | Ga0466960_0293881_331_861 | 168 |
| 740 | 3300048903 | Ga0496100_0242518 | Ga0496100_0242518_435_950 | 168 |
| 741 | 3300048909 | Ga0496106_0542348 | Ga0496106_0542348_71_586 | 168 |
| 742 | 3300048911 | Ga0496108_0067910 | Ga0496108_0067910_421_936 | 168 |
| 743 | 3300048912 | Ga0496109_0054969 | Ga0496109_0054969_2409_2924 | 168 |
| 744 | 3300048916 | Ga0496113_0182827 | Ga0496113_0182827_912_1427 | 168 |
| 745 | 3300048924 | Ga0496121_0212461 | Ga0496121_0212461_641_1156 | 168 |
| 746 | 3300050491 | nmdc:mga00v17_128515_c1 | nmdc:mga00v17_128515_c1_897_1412 | 168 |
| 747 | 3300050492 | nmdc:mga0yw44_109719_c2 | nmdc:mga0yw44_109719_c2_158_673 | 168 |
| 748 | 3300050493 | nmdc:mga0k408_469409_c1 | nmdc:mga0k408_469409_c1_81_596 | 168 |
| 749 | 3300050494 | nmdc:mga06z11_627598_c1 | nmdc:mga06z11_627598_c1_98_616 | 168 |
| 750 | 3300050495 | nmdc:mga04h51_59298_c1 | nmdc:mga04h51_59298_c1_271_786 | 168 |
| 751 | 3300050512 | nmdc:mga0n895_509252_c1 | nmdc:mga0n895_509252_c1_308_826 | 168 |
| 752 | 3300050515 | nmdc:mga0a205_177406_c1 | nmdc:mga0a205_177406_c1_1466_1981 | 168 |
| 753 | iso_pu_bacteria | 2513237141 | 2513887824 | 168 |
| 754 | iso_pu_bacteria | 2524023205 | 2524438405 | 168 |
| 755 | iso_pu_bacteria | 2744054633 | 2745078443 | 168 |
| 756 | 3300005329 | Ga0070683_100663465 | Ga0070683_1006634652 | 169 |
| 757 | 3300005331 | Ga0070670_100797797 | Ga0070670_1007977971 | 169 |
| 758 | 3300005337 | Ga0070682_100310912 | Ga0070682_1003109121 | 169 |
| 759 | 3300005347 | Ga0070668_100631157 | Ga0070668_1006311571 | 169 |
| 760 | 3300005434 | Ga0070709_10119514 | Ga0070709_101195141 | 169 |
| 761 | 3300005456 | Ga0070678_100136192 | Ga0070678_1001361922 | 169 |
| 762 | 3300005458 | Ga0070681_10059065 | Ga0070681_100590654 | 169 |
| 763 | 3300005518 | Ga0070699_100364648 | Ga0070699_1003646482 | 169 |
| 764 | 3300005535 | Ga0070684_100515847 | Ga0070684_1005158472 | 169 |
| 765 | 3300005547 | Ga0070693_100471662 | Ga0070693_1004716622 | 169 |
| 766 | 3300005616 | Ga0068852_101806298 | Ga0068852_1018062982 | 169 |
| 767 | 3300006028 | Ga0070717_10050183 | Ga0070717_100501832 | 169 |
| 768 | 3300006028 | Ga0070717_10253006 | Ga0070717_102530062 | 169 |
| 769 | 3300006163 | Ga0070715_10207749 | Ga0070715_102077491 | 169 |
| 770 | 3300006358 | Ga0068871_100307152 | Ga0068871_1003071522 | 169 |
| 771 | 3300006931 | Ga0097620_100375662 | Ga0097620_1003756622 | 169 |
| 772 | 3300009101 | Ga0105247_10040927 | Ga0105247_100409272 | 169 |
| 773 | 3300010375 | Ga0105239_10138528 | Ga0105239_101385283 | 169 |
| 774 | 3300010375 | Ga0105239_10452600 | Ga0105239_104526002 | 169 |
| 775 | 3300010375 | Ga0105239_10839295 | Ga0105239_108392952 | 169 |
| 776 | 3300013296 | Ga0157374_11083567 | Ga0157374_110835672 | 169 |
| 777 | 3300014969 | Ga0157376_10004272 | Ga0157376_100042728 | 169 |
| 778 | 3300025297 | Ga0209758_1107988 | Ga0209758_11079882 | 169 |
| 779 | 3300025315 | Ga0207697_10061848 | Ga0207697_100618482 | 169 |
| 780 | 3300025711 | Ga0207696_1060702 | Ga0207696_10607021 | 169 |
| 781 | 3300025899 | Ga0207642_10022211 | Ga0207642_100222112 | 169 |
| 782 | 3300025900 | Ga0207710_10059403 | Ga0207710_100594032 | 169 |
| 783 | 3300025901 | Ga0207688_10133793 | Ga0207688_101337932 | 169 |
| 784 | 3300025903 | Ga0207680_10209180 | Ga0207680_102091802 | 169 |
| 785 | 3300025905 | Ga0207685_10531917 | Ga0207685_105319171 | 169 |
| 786 | 3300025906 | Ga0207699_10411575 | Ga0207699_104115751 | 169 |
| 787 | 3300025907 | Ga0207645_10094910 | Ga0207645_100949101 | 169 |
| 788 | 3300025907 | Ga0207645_10349114 | Ga0207645_103491141 | 169 |
| 789 | 3300025912 | Ga0207707_10054246 | Ga0207707_100542462 | 169 |
| 790 | 3300025914 | Ga0207671_10017843 | Ga0207671_100178432 | 169 |
| 791 | 3300025916 | Ga0207663_10093655 | Ga0207663_100936552 | 169 |
| 792 | 3300025917 | Ga0207660_10081611 | Ga0207660_100816112 | 169 |
| 793 | 3300025918 | Ga0207662_10100747 | Ga0207662_101007472 | 169 |
| 794 | 3300025919 | Ga0207657_10464861 | Ga0207657_104648612 | 169 |
| 795 | 3300025920 | Ga0207649_10054147 | Ga0207649_100541472 | 169 |
| 796 | 3300025924 | Ga0207694_10120934 | Ga0207694_101209342 | 169 |
| 797 | 3300025924 | Ga0207694_10183233 | Ga0207694_101832332 | 169 |
| 798 | 3300025926 | Ga0207659_10617647 | Ga0207659_106176472 | 169 |
| 799 | 3300025927 | Ga0207687_10128143 | Ga0207687_101281432 | 169 |
| 800 | 3300025931 | Ga0207644_10138400 | Ga0207644_101384002 | 169 |
| 801 | 3300025935 | Ga0207709_11022253 | Ga0207709_110222532 | 169 |
| 802 | 3300025937 | Ga0207669_10017039 | Ga0207669_100170393 | 169 |
| 803 | 3300025937 | Ga0207669_10418624 | Ga0207669_104186242 | 169 |
| 804 | 3300025938 | Ga0207704_10134148 | Ga0207704_101341482 | 169 |
| 805 | 3300025938 | Ga0207704_11532497 | Ga0207704_115324971 | 169 |
| 806 | 3300025940 | Ga0207691_10133924 | Ga0207691_101339242 | 169 |
| 807 | 3300025940 | Ga0207691_10407220 | Ga0207691_104072202 | 169 |
| 808 | 3300025944 | Ga0207661_10108866 | Ga0207661_101088662 | 169 |
| 809 | 3300025945 | Ga0207679_11012622 | Ga0207679_110126221 | 169 |
| 810 | 3300025949 | Ga0207667_10230284 | Ga0207667_102302842 | 169 |
| 811 | 3300025960 | Ga0207651_10130277 | Ga0207651_101302773 | 169 |
| 812 | 3300025960 | Ga0207651_10228541 | Ga0207651_102285412 | 169 |
| 813 | 3300025961 | Ga0207712_11678954 | Ga0207712_116789541 | 169 |
| 814 | 3300025986 | Ga0207658_11556876 | Ga0207658_115568761 | 169 |
| 815 | 3300026023 | Ga0207677_10138302 | Ga0207677_101383022 | 169 |
| 816 | 3300026035 | Ga0207703_10298174 | Ga0207703_102981741 | 169 |
| 817 | 3300026035 | Ga0207703_10486185 | Ga0207703_104861851 | 169 |
| 818 | 3300026041 | Ga0207639_10393807 | Ga0207639_103938072 | 169 |
| 819 | 3300026067 | Ga0207678_11089251 | Ga0207678_110892511 | 169 |
| 820 | 3300026075 | Ga0207708_10065642 | Ga0207708_100656422 | 169 |
| 821 | 3300026088 | Ga0207641_10469134 | Ga0207641_104691342 | 169 |
| 822 | 3300026089 | Ga0207648_10058938 | Ga0207648_100589382 | 169 |
| 823 | 3300026095 | Ga0207676_10242608 | Ga0207676_102426082 | 169 |
| 824 | 3300026095 | Ga0207676_10485069 | Ga0207676_104850692 | 169 |
| 825 | 3300026118 | Ga0207675_100146969 | Ga0207675_1001469692 | 169 |
| 826 | 3300026121 | Ga0207683_10028851 | Ga0207683_100288514 | 169 |
| 827 | 3300026121 | Ga0207683_10556569 | Ga0207683_105565692 | 169 |
| 828 | 3300026142 | Ga0207698_10112768 | Ga0207698_101127683 | 169 |
| 829 | 3300026142 | Ga0207698_10288957 | Ga0207698_102889572 | 169 |
| 830 | 3300026142 | Ga0207698_11705416 | Ga0207698_117054161 | 169 |
| 831 | 3300027671 | Ga0209588_1040404 | Ga0209588_10404042 | 169 |
| 832 | 3300028379 | Ga0268266_10001750 | Ga0268266_1000175012 | 169 |
| 833 | 3300028379 | Ga0268266_10005449 | Ga0268266_100054492 | 169 |
| 834 | 3300028379 | Ga0268266_10256709 | Ga0268266_102567092 | 169 |
| 835 | 3300028380 | Ga0268265_11021481 | Ga0268265_110214811 | 169 |
| 836 | 3300028381 | Ga0268264_10110353 | Ga0268264_101103532 | 169 |
| 837 | 3300028786 | Ga0307517_10178890 | Ga0307517_101788901 | 169 |
| 838 | 3300030521 | Ga0307511_10278380 | Ga0307511_102783801 | 169 |
| 839 | 3300031616 | Ga0307508_10000019 | Ga0307508_1000001938 | 169 |
| 840 | 3300031616 | Ga0307508_10241982 | Ga0307508_102419822 | 169 |
| 841 | 3300031824 | Ga0307413_10513134 | Ga0307413_105131342 | 169 |
| 842 | 3300031901 | Ga0307406_10134380 | Ga0307406_101343802 | 169 |
| 843 | 3300031911 | Ga0307412_10984088 | Ga0307412_109840882 | 169 |
| 844 | 3300032002 | Ga0307416_100084245 | Ga0307416_1000842452 | 169 |
| 845 | 3300032004 | Ga0307414_10575764 | Ga0307414_105757641 | 169 |
| 846 | 3300033180 | Ga0307510_10031136 | Ga0307510_100311362 | 169 |
| 847 | 3300034820 | Ga0373959_0021676 | Ga0373959_0021676_60_578 | 169 |
| 848 | 3300034957 | Ga0373938_0121312 | Ga0373938_0121312_78_596 | 169 |
| 849 | 3300035171 | Ga0373946_0284139 | Ga0373946_0284139_269_790 | 169 |
| 850 | 3300037068 | Ga0373925_0039274 | Ga0373925_0039274_2809_3345 | 169 |
| 851 | 3300037418 | Ga0395900_0446611 | Ga0395900_0446611_613_1143 | 169 |
| 852 | 3300039438 | Ga0436360_0054328 | Ga0436360_0054328_297_824 | 169 |
| 853 | 3300042009 | Ga0439451_097863 | Ga0439451_097863_57_575 | 169 |
| 854 | 3300042156 | Ga0439446_0143078 | Ga0439446_0143078_76_594 | 169 |
| 855 | 3300046453 | Ga0495627_050768 | Ga0495627_050768_86_604 | 169 |
| 856 | 3300046455 | Ga0495603_0008563 | Ga0495603_0008563_3333_3854 | 169 |
| 857 | 3300046455 | Ga0495603_0036192 | Ga0495603_0036192_1592_2110 | 169 |
| 858 | 3300046472 | Ga0495580_0122657 | Ga0495580_0122657_15_533 | 169 |
| 859 | 3300046473 | Ga0495582_0536299 | Ga0495582_0536299_125_643 | 169 |
| 860 | 3300046474 | Ga0495605_0337569 | Ga0495605_0337569_51_569 | 169 |
| 861 | 3300046475 | Ga0495639_0012900 | Ga0495639_0012900_1695_2216 | 169 |
| 862 | 3300046475 | Ga0495639_0079933 | Ga0495639_0079933_947_1465 | 169 |
| 863 | 3300046475 | Ga0495639_0285222 | Ga0495639_0285222_24_545 | 169 |
| 864 | 3300046491 | Ga0495584_0171270 | Ga0495584_0171270_205_723 | 169 |
| 865 | 3300046492 | Ga0495585_0202630 | Ga0495585_0202630_45_563 | 169 |
| 866 | 3300046507 | Ga0495606_0129346 | Ga0495606_0129346_446_985 | 169 |
| 867 | 3300046507 | Ga0495606_0314086 | Ga0495606_0314086_41_559 | 169 |
| 868 | 3300046512 | Ga0495610_0151587 | Ga0495610_0151587_418_936 | 169 |
| 869 | 3300046513 | Ga0495616_0050458 | Ga0495616_0050458_1411_1929 | 169 |
| 870 | 3300046513 | Ga0495616_0188975 | Ga0495616_0188975_337_855 | 169 |
| 871 | 3300046515 | Ga0495620_0029187 | Ga0495620_0029187_1380_1898 | 169 |
| 872 | 3300046519 | Ga0495632_0026711 | Ga0495632_0026711_654_1172 | 169 |
| 873 | 3300046523 | Ga0495644_0025625 | Ga0495644_0025625_354_872 | 169 |
| 874 | 3300046523 | Ga0495644_0054133 | Ga0495644_0054133_282_800 | 169 |
| 875 | 3300046526 | Ga0495666_0075650 | Ga0495666_0075650_398_916 | 169 |
| 876 | 3300046530 | Ga0495654_0093881 | Ga0495654_0093881_272_790 | 169 |
| 877 | 3300046537 | Ga0495598_0005121 | Ga0495598_0005121_1554_2072 | 169 |
| 878 | 3300046538 | Ga0495609_0138707 | Ga0495609_0138707_35_553 | 169 |
| 879 | 3300046542 | Ga0495597_0139766 | Ga0495597_0139766_113_631 | 169 |
| 880 | 3300046557 | Ga0495622_0039342 | Ga0495622_0039342_164_682 | 169 |
| 881 | 3300046615 | Ga0495656_0010809 | Ga0495656_0010809_1781_2299 | 169 |
| 882 | 3300046616 | Ga0495668_0094820 | Ga0495668_0094820_420_938 | 169 |
| 883 | 3300046616 | Ga0495668_0119115 | Ga0495668_0119115_482_1003 | 169 |
| 884 | 3300046616 | Ga0495668_0278050 | Ga0495668_0278050_57_575 | 169 |
| 885 | 3300046660 | Ga0495625_0271937 | Ga0495625_0271937_424_942 | 169 |
| 886 | 3300046660 | Ga0495625_0474228 | Ga0495625_0474228_23_541 | 169 |
| 887 | 3300046663 | Ga0495635_0278960 | Ga0495635_0278960_277_795 | 169 |
| 888 | 3300046665 | Ga0495661_0146571 | Ga0495661_0146571_717_1235 | 169 |
| 889 | 3300046674 | Ga0495588_0085353 | Ga0495588_0085353_311_829 | 169 |
| 890 | 3300046681 | Ga0495647_0124365 | Ga0495647_0124365_62_583 | 169 |
| 891 | 3300046691 | Ga0495670_0505415 | Ga0495670_0505415_90_608 | 169 |
| 892 | 3300046694 | Ga0495649_0054232 | Ga0495649_0054232_984_1502 | 169 |
| 893 | 3300046794 | Ga0495589_0102589 | Ga0495589_0102589_429_947 | 169 |
| 894 | 3300046809 | Ga0495600_0171298 | Ga0495600_0171298_556_1074 | 169 |
| 895 | 3300046810 | Ga0495660_0371803 | Ga0495660_0371803_70_588 | 169 |
| 896 | 3300047318 | Ga0495636_0128406 | Ga0495636_0128406_232_750 | 169 |
| 897 | 3300047447 | Ga0495685_017436 | Ga0495685_017436_821_1339 | 169 |
| 898 | 3300047469 | Ga0495673_0099887 | Ga0495673_0099887_214_732 | 169 |
| 899 | 3300047470 | Ga0495681_0281572 | Ga0495681_0281572_46_564 | 169 |
| 900 | 3300047472 | Ga0495686_0091932 | Ga0495686_0091932_1120_1638 | 169 |
| 901 | 3300047673 | Ga0495593_0166671 | Ga0495593_0166671_120_638 | 169 |
| 902 | 3300048090 | Ga0495615_0066502 | Ga0495615_0066502_295_849 | 169 |
| 903 | 3300048903 | Ga0496100_0300392 | Ga0496100_0300392_666_1187 | 169 |
| 904 | 3300048903 | Ga0496100_0482964 | Ga0496100_0482964_269_787 | 169 |
| 905 | 3300048904 | Ga0496101_0009139 | Ga0496101_0009139_1505_2026 | 169 |
| 906 | 3300048904 | Ga0496101_0164672 | Ga0496101_0164672_92_610 | 169 |
| 907 | 3300048905 | Ga0496102_0004648 | Ga0496102_0004648_686_1207 | 169 |
| 908 | 3300048905 | Ga0496102_0391409 | Ga0496102_0391409_714_1259 | 169 |
| 909 | 3300048905 | Ga0496102_1706541 | Ga0496102_1706541_11_529 | 169 |
| 910 | 3300048906 | Ga0496103_0239956 | Ga0496103_0239956_147_665 | 169 |
| 911 | 3300048908 | Ga0496105_0004610 | Ga0496105_0004610_6675_7196 | 169 |
| 912 | 3300048909 | Ga0496106_0000686 | Ga0496106_0000686_15068_15604 | 169 |
| 913 | 3300048909 | Ga0496106_0014778 | Ga0496106_0014778_2674_3195 | 169 |
| 914 | 3300048910 | Ga0496107_0002437 | Ga0496107_0002437_6896_7417 | 169 |
| 915 | 3300048911 | Ga0496108_0030616 | Ga0496108_0030616_759_1280 | 169 |
| 916 | 3300048911 | Ga0496108_0597677 | Ga0496108_0597677_179_697 | 169 |
| 917 | 3300048912 | Ga0496109_0003924 | Ga0496109_0003924_5867_6388 | 169 |
| 918 | 3300048912 | Ga0496109_0347674 | Ga0496109_0347674_78_596 | 169 |
| 919 | 3300048913 | Ga0496110_0005589 | Ga0496110_0005589_7062_7583 | 169 |
| 920 | 3300048913 | Ga0496110_0241290 | Ga0496110_0241290_496_1014 | 169 |
| 921 | 3300048914 | Ga0496111_0010019 | Ga0496111_0010019_3115_3636 | 169 |
| 922 | 3300048914 | Ga0496111_1046989 | Ga0496111_1046989_23_541 | 169 |
| 923 | 3300048915 | Ga0496112_0036993 | Ga0496112_0036993_1286_1807 | 169 |
| 924 | 3300048916 | Ga0496113_0028000 | Ga0496113_0028000_791_1312 | 169 |
| 925 | 3300048917 | Ga0496114_0008237 | Ga0496114_0008237_289_810 | 169 |
| 926 | 3300048917 | Ga0496114_0481885 | Ga0496114_0481885_276_794 | 169 |
| 927 | 3300048918 | Ga0496115_0004137 | Ga0496115_0004137_451_972 | 169 |
| 928 | 3300048918 | Ga0496115_0226615 | Ga0496115_0226615_811_1329 | 169 |
| 929 | 3300048918 | Ga0496115_0791657 | Ga0496115_0791657_187_708 | 169 |
| 930 | 3300048920 | Ga0496117_0035078 | Ga0496117_0035078_95_631 | 169 |
| 931 | 3300048920 | Ga0496117_0108529 | Ga0496117_0108529_110_628 | 169 |
| 932 | 3300048921 | Ga0496118_0002254 | Ga0496118_0002254_15097_15633 | 169 |
| 933 | 3300048923 | Ga0496120_0343035 | Ga0496120_0343035_132_650 | 169 |
| 934 | 3300048924 | Ga0496121_0000418 | Ga0496121_0000418_59441_59977 | 169 |
| 935 | 3300048924 | Ga0496121_0054413 | Ga0496121_0054413_1208_1726 | 169 |
| 936 | 3300048927 | Ga0496124_0001129 | Ga0496124_0001129_38174_38710 | 169 |
| 937 | 3300048929 | Ga0496126_0018732 | Ga0496126_0018732_2115_2651 | 169 |
| 938 | 3300048929 | Ga0496126_0033351 | Ga0496126_0033351_850_1368 | 169 |
| 939 | 3300048929 | Ga0496126_0148025 | Ga0496126_0148025_135_674 | 169 |
| 940 | 3300048929 | Ga0496126_0251863 | Ga0496126_0251863_411_932 | 169 |
| 941 | 3300048929 | Ga0496126_0329149 | Ga0496126_0329149_620_1141 | 169 |
| 942 | 3300048929 | Ga0496126_0427584 | Ga0496126_0427584_320_838 | 169 |
| 943 | 3300049460 | Ga0495682_0050392 | Ga0495682_0050392_393_911 | 169 |
| 944 | 3300049584 | Ga0501068_0197463 | Ga0501068_0197463_55_573 | 169 |
| 945 | 3300049592 | Ga0501076_0117789 | Ga0501076_0117789_874_1392 | 169 |
| 946 | 3300049744 | Ga0501083_0804066 | Ga0501083_0804066_58_579 | 169 |
| 947 | 3300050489 | nmdc:mga03683_365116_c1 | nmdc:mga03683_365116_c1_10_528 | 169 |
| 948 | 3300050490 | nmdc:mga03n38_310084_c1 | nmdc:mga03n38_310084_c1_11_529 | 169 |
| 949 | 3300050491 | nmdc:mga00v17_45968_c1 | nmdc:mga00v17_45968_c1_2046_2564 | 169 |
| 950 | 3300050492 | nmdc:mga0yw44_36870_c2 | nmdc:mga0yw44_36870_c2_1181_1699 | 169 |
| 951 | 3300050492 | nmdc:mga0yw44_75742_c1 | nmdc:mga0yw44_75742_c1_1120_1638 | 169 |
| 952 | 3300050494 | nmdc:mga06z11_4761_c1 | nmdc:mga06z11_4761_c1_1487_2005 | 169 |
| 953 | 3300050496 | nmdc:mga07m45_19452_c1 | nmdc:mga07m45_19452_c1_1683_2201 | 169 |
| 954 | 3300050496 | nmdc:mga07m45_48318_c1 | nmdc:mga07m45_48318_c1_174_692 | 169 |
| 955 | 3300050507 | nmdc:mga05p37_100622_c1 | nmdc:mga05p37_100622_c1_936_1454 | 169 |
| 956 | 3300050509 | nmdc:mga0qj67_629016_c1 | nmdc:mga0qj67_629016_c1_317_835 | 169 |
| 957 | 3300050511 | nmdc:mga08y16_231865_c1 | nmdc:mga08y16_231865_c1_1303_1821 | 169 |
| 958 | 3300053085 | Ga0495619_0495950 | Ga0495619_0495950_311_829 | 169 |
| 959 | 3300053088 | Ga0500644_0027691 | Ga0500644_0027691_574_1092 | 169 |
| 960 | 3300053096 | Ga0500641_0011847 | Ga0500641_0011847_1183_1701 | 169 |
| 961 | 3300053116 | Ga0500592_065714 | Ga0500592_065714_48_569 | 169 |
| 962 | 3300053118 | Ga0500594_0040125 | Ga0500594_0040125_589_1107 | 169 |
| 963 | 3300053119 | Ga0500595_002867 | Ga0500595_002867_75_626 | 169 |
| 964 | 3300053129 | Ga0500628_029919 | Ga0500628_029919_140_658 | 169 |
| 965 | 3300053133 | Ga0500655_073864 | Ga0500655_073864_157_675 | 169 |
| 966 | 3300053134 | Ga0500658_0202644 | Ga0500658_0202644_357_875 | 169 |
| 967 | 3300053143 | Ga0500579_242467 | Ga0500579_242467_53_571 | 169 |
| 968 | 3300053146 | Ga0500588_0064029 | Ga0500588_0064029_636_1154 | 169 |
| 969 | 3300053147 | Ga0500589_091389 | Ga0500589_091389_222_740 | 169 |
| 970 | 3300053151 | Ga0500604_0062468 | Ga0500604_0062468_640_1158 | 169 |
| 971 | 3300053727 | Ga0500611_061758 | Ga0500611_061758_206_724 | 169 |
| 972 | 3300053730 | Ga0500645_089807 | Ga0500645_089807_333_851 | 169 |
| 973 | 3300060353 | Ga0501082_0184978 | Ga0501082_0184978_90_608 | 169 |
| 974 | iso_pu_bacteria | 2513237098 | 2513673571 | 169 |
| 975 | iso_pu_bacteria | 2513237104 | 2513717697 | 169 |
| 976 | 3300005539 | Ga0068853_100196899 | Ga0068853_1001968992 | 172 |
| 977 | 3300005547 | Ga0070693_100097209 | Ga0070693_1000972091 | 172 |
| 978 | 3300021358 | Ga0213873_10011107 | Ga0213873_100111071 | 172 |
| 979 | 3300021441 | Ga0213871_10008575 | Ga0213871_100085752 | 172 |
| 980 | 3300037853 | Ga0436364_0575905 | Ga0436364_0575905_606_1157 | 172 |
| 981 | 3300039437 | Ga0436365_1730046 | Ga0436365_1730046_1569_2120 | 172 |
| 982 | 3300039447 | Ga0436361_0244793 | Ga0436361_0244793_2110_2673 | 172 |
| 983 | 3300039453 | Ga0436362_0999249 | Ga0436362_0999249_2056_2619 | 172 |
| 984 | 3300045049 | Ga0466959_0204762 | Ga0466959_0204762_443_1006 | 172 |
| 985 | 3300050490 | nmdc:mga03n38_40940_c1 | nmdc:mga03n38_40940_c1_346_897 | 172 |
| 986 | iso_pu_bacteria | 2791355196 | 2793059553 | 172 |
| 987 | iso_pu_bacteria | 2816332527 | 2818242265 | 172 |
| 988 | iso_pu_bacteria | 2874620515 | 2874624087 | 172 |
| 989 | iso_pu_bacteria | 2904666416 | 2904670798 | 172 |
| 990 | iso_pu_bacteria | 2935769743 | 2935776504 | 172 |
| 991 | iso_pu_bacteria | 2935785616 | 2935789932 | 172 |
| 992 | iso_pu_bacteria | 2935793552 | 2935798302 | 172 |
| 993 | iso_pu_bacteria | 2935959822 | 2935965704 | 172 |
| 994 | iso_pu_bacteria | 3005506211 | 3005506828 | 172 |
| 995 | iso_pu_bacteria | 3005710791 | 3005717242 | 172 |
| 996 | iso_pu_bacteria | 8016530956 | 8016538528 | 172 |
| 997 | iso_pu_bacteria | 8016539877 | 8016542812 | 172 |
| 998 | iso_pu_bacteria | 8016557553 | 8016558892 | 172 |
| 999 | iso_pu_bacteria | 8016566248 | 8016568200 | 172 |
| 1000 | iso_pu_bacteria | 8016575299 | 8016580868 | 172 |
| 1001 | iso_pu_bacteria | 8016595262 | 8016596855 | 172 |
| 1002 | iso_pu_bacteria | 8016622563 | 8016630060 | 172 |
| 1003 | iso_pu_bacteria | 8019530166 | 8019538193 | 172 |
| 1004 | iso_pu_bacteria | 8019547302 | 8019549005 | 172 |
| 1005 | 3300006941 | Ga0099825_1051875 | Ga0099825_10518752 | 173 |
| 1006 | 3300025254 | Ga0209148_1014767 | Ga0209148_10147672 | 173 |
| 1007 | 3300025261 | Ga0209233_1002396 | Ga0209233_10023962 | 173 |
| 1008 | 3300027363 | Ga0209700_100012 | Ga0209700_100012231 | 173 |
| 1009 | 3300050492 | nmdc:mga0yw44_432789_c1 | nmdc:mga0yw44_432789_c1_186_740 | 173 |
| 1010 | iso_pu_bacteria | 2824600985 | 2824608500 | 173 |
| 1011 | iso_pu_bacteria | 2824609381 | 2824617505 | 173 |
| 1012 | 3300025925 | Ga0207650_10185992 | Ga0207650_101859922 | 174 |
| 1013 | 3300005331 | Ga0070670_100522711 | Ga0070670_1005227112 | 175 |
| 1014 | 3300005334 | Ga0068869_100405036 | Ga0068869_1004050362 | 175 |
| 1015 | 3300005335 | Ga0070666_10377989 | Ga0070666_103779892 | 175 |
| 1016 | 3300005344 | Ga0070661_100086294 | Ga0070661_1000862942 | 175 |
| 1017 | 3300005347 | Ga0070668_100103943 | Ga0070668_1001039431 | 175 |
| 1018 | 3300005355 | Ga0070671_100047293 | Ga0070671_1000472933 | 175 |
| 1019 | 3300005367 | Ga0070667_100667180 | Ga0070667_1006671802 | 175 |
| 1020 | 3300005539 | Ga0068853_100334691 | Ga0068853_1003346912 | 175 |
| 1021 | 3300005577 | Ga0068857_100208519 | Ga0068857_1002085192 | 175 |
| 1022 | 3300005578 | Ga0068854_100754336 | Ga0068854_1007543362 | 175 |
| 1023 | 3300005617 | Ga0068859_100256367 | Ga0068859_1002563672 | 175 |
| 1024 | 3300005618 | Ga0068864_100214742 | Ga0068864_1002147422 | 175 |
| 1025 | 3300005843 | Ga0068860_100275629 | Ga0068860_1002756292 | 175 |
| 1026 | 3300006038 | Ga0075365_10048215 | Ga0075365_100482152 | 175 |
| 1027 | 3300006042 | Ga0075368_10007086 | Ga0075368_100070862 | 175 |
| 1028 | 3300006048 | Ga0075363_100054681 | Ga0075363_1000546812 | 175 |
| 1029 | 3300006177 | Ga0075362_10278658 | Ga0075362_102786582 | 175 |
| 1030 | 3300006178 | Ga0075367_10095584 | Ga0075367_100955841 | 175 |
| 1031 | 3300006186 | Ga0075369_10113439 | Ga0075369_101134392 | 175 |
| 1032 | 3300006186 | Ga0075369_10242851 | Ga0075369_102428511 | 175 |
| 1033 | 3300006195 | Ga0075366_10091150 | Ga0075366_100911502 | 175 |
| 1034 | 3300006353 | Ga0075370_10027287 | Ga0075370_100272871 | 175 |
| 1035 | 3300006353 | Ga0075370_10181635 | Ga0075370_101816352 | 175 |
| 1036 | 3300006931 | Ga0097620_100256370 | Ga0097620_1002563702 | 175 |
| 1037 | 3300025299 | Ga0209256_1073616 | Ga0209256_10736161 | 175 |
| 1038 | 3300025304 | Ga0209257_1013493 | Ga0209257_10134931 | 175 |
| 1039 | 3300025315 | Ga0207697_10051661 | Ga0207697_100516612 | 175 |
| 1040 | 3300025900 | Ga0207710_10019370 | Ga0207710_100193702 | 175 |
| 1041 | 3300025901 | Ga0207688_10321271 | Ga0207688_103212711 | 175 |
| 1042 | 3300025904 | Ga0207647_10000809 | Ga0207647_1000080914 | 175 |
| 1043 | 3300025911 | Ga0207654_10161942 | Ga0207654_101619422 | 175 |
| 1044 | 3300025914 | Ga0207671_10835451 | Ga0207671_108354511 | 175 |
| 1045 | 3300025932 | Ga0207690_10255795 | Ga0207690_102557951 | 175 |
| 1046 | 3300026041 | Ga0207639_10483368 | Ga0207639_104833682 | 175 |
| 1047 | 3300026116 | Ga0207674_10226270 | Ga0207674_102262702 | 175 |
| 1048 | 3300026142 | Ga0207698_10350693 | Ga0207698_103506932 | 175 |
| 1049 | 3300027866 | Ga0209813_10048196 | Ga0209813_100481962 | 175 |
| 1050 | 3300028379 | Ga0268266_10132547 | Ga0268266_101325472 | 175 |
| 1051 | 3300050516 | nmdc:mga0sz30_75702_c1 | nmdc:mga0sz30_75702_c1_190_747 | 175 |
| 1052 | 3300003215 | JGI25153J46596_10001545 | JGI25153J46596_1000154515 | 176 |
| 1053 | 3300025297 | Ga0209758_1000604 | Ga0209758_100060435 | 176 |
| 1054 | 3300031911 | Ga0307412_10408302 | Ga0307412_104083022 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dir-assembly4.cif.gz_D | membrane protein at 2.8 angstroms | 0.8498 | 19 | 167 |
| 6ryo-assembly1.cif.gz_A | bacterial membrane enzyme structure by the in meso method at 1.9 a resolution | 0.8416 | 17 | 170 |
| 6fms-assembly2.cif.gz_B | imisx-ep of se-lspa | 0.8342 | 19 | 163 |
| 5dir-assembly4.cif.gz_D | membrane protein at 2.8 angstroms | 0.8339 | 19 | 167 |
| 5dir-assembly2.cif.gz_B | membrane protein at 2.8 angstroms | 0.8112 | 12 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8614 | 23 | 167 | 3.90.1420.10 |
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8541 | 23 | 168 | 3.90.1420.10 |
| af_Q2FZ79_13_152_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8441 | 23 | 167 | 3.90.1420.10 |
| af_P00804_15_157_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.8431 | 23 | 168 | 3.90.1420.10 |
| af_P9WK99_39_178_3.90.1420.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain | 0.7484 | 23 | 168 | 3.90.1420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q4BBE2-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9414 | 13 | 169 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A651FTE1-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9378 | 13 | 169 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-B3Q7Z4-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9359 | 13 | 176 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A2E5BNL6-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9325 | 15 | 169 |
GO:0004190
GO:0005886 GO:0006508 |
| AF-A0A7S8C8Q5-F1-model_v4 | Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) | 0.9323 | 13 | 166 |
GO:0004190
GO:0005886 GO:0006508 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar