F489140

General Info

Members Datasets Scaffolds Average Seq Length
1054 623 875 167

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2824600985|2824608500
Length 196
Sequence ADDHESPKRHPPQGMGPGLRWDDSGVLGGAPSMTPLRAGILSALVTLVLDQASKLWLLNVFDLAHRGAVRVTPFFDLVLAWNIGISFGWLQNDSQAAQLALMAVKGIAVVALAIWMARSHTLLATIALGLIIGGAIGNGIDRLAYGAVVDFALFHIEIGGKTYNWYVFNLADVAIVAGVAALLYDSFLGVPAAKAP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2643221651 Afipia sp. Root123D2 Isolate Unclassified
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355199
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
38 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
49 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
54 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
55 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
56 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
59 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
60 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
61 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
62 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
63 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
64 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
65 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
66 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
72 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
73 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
74 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
75 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
76 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
77 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
78 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
79 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
80 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
81 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
82 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
83 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
84 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
85 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
86 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
87 2922368715
88 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
89 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
90 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
91 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
92 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
93 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
94 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
95 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
96 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
97 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
100 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
103 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
104 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
105 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
106 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
107 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
108 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
109 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
110 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
111 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
112 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
113 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
114 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
115 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
116 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
117 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
118 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
119 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
120 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
121 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
122 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
123 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
124 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
125 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
126 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
127 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
128 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
129 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
130 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
131 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
132 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
133 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
134 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
135 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
136 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
137 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
138 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
139 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
140 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
141 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
142 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
143 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
144 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
145 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
146 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
147 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
148 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
149 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
150 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
151 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
152 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
153 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
154 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
158 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
159 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
160 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
161 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
170 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
171 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
172 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
173 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
174 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
175 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
176 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
177 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
178 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
179 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
180 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
181 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
182 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
183 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
184 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
185 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
186 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
187 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
188 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
189 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
190 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
191 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
192 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
193 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
194 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
195 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
196 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
197 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
198 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
199 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
200 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
201 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
202 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
203 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
204 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
205 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
206 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
207 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
208 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
209 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
210 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
211 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
212 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
213 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
214 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
215 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
220 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
221 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
222 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
223 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
224 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
225 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
227 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
228 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
229 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
230 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
231 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
234 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
238 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
244 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
245 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
246 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
249 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
250 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
251 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
252 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
253 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
254 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
255 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
256 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
257 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
258 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
259 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
260 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
261 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
262 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
263 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
264 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
265 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
271 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
273 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
336 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
337 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
338 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
339 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
342 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
346 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
347 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
348 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
351 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
352 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
353 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
354 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
355 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
356 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
357 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
358 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
359 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
360 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
361 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
362 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
363 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
364 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
365 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
366 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
367 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
368 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
369 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
370 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
371 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
372 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
373 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
374 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
375 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
376 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
377 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
378 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
379 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
380 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
381 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
382 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
383 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
384 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
385 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
387 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
388 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
389 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
390 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
391 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
394 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
395 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
396 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
397 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
398 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
399 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
400 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
401 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
402 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
403 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
404 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
405 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
406 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
407 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
408 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
409 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
410 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
411 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
412 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
413 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
414 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
415 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
416 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
417 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
418 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
419 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
420 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
421 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
422 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
423 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
424 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
425 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
426 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
427 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
428 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
429 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
430 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
431 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
432 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
433 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
434 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
438 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
441 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
449 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
450 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
451 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
452 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
453 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
454 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
455 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
456 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
457 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
458 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
459 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
460 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
461 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
462 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
463 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
464 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
465 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
466 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
467 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
468 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
469 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
470 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
471 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
472 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
473 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
474 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
475 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
476 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
477 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
478 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
479 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
484 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
485 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
486 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
487 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
488 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
489 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
490 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
491 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
492 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
493 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
494 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
495 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
496 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
497 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
498 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
499 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
500 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
501 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
502 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
503 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
504 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
505 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
506 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
507 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
508 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
509 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
510 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
511 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
512 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
526 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
527 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
528 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
529 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
530 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
531 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
532 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
533 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
534 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
535 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
536 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
537 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
538 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
539 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
540 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
541 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
542 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
543 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
544 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
545 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
546 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
547 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
548 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
549 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
550 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
551 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
552 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
553 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
554 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
555 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
556 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
557 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
558 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
559 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
560 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
561 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
562 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
563 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
564 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
565 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
566 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
567 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
568 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
569 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
570 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
571 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
572 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
573 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
574 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
575 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
576 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
577 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
578 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
579 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
580 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
581 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
582 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
583 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
584 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
585 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
586 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
587 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
588 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
589 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
590 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
591 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
592 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
593 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
594 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
595 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
596 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
597 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
598 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
599 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
600 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
601 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
602 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
603 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
604 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
605 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
606 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
607 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
608 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
609 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
610 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
611 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
612 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
613 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
614 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
615 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
616 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
617 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
618 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
619 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
620 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
621 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
622 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
623 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.08
Metatranscriptomes 0.1
Isolates 16.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.9
Nodule 13.09
Rhizoplane 7.4
Rhizosphere 52.47
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001545 3300003215 Bacteria 13670
2 JGI25153J46596_10003712 3300003215 Bacteria 8429
3 JGI25153J46596_10003975 3300003215 Bacteria 8089
4 JGI25153J46596_10016779 3300003215 Bacteria 2917
5 JGI25160J50197_1003036 3300003354 Bacteria 7655
6 JGI25404J52841_10009905 3300003659 Bacteria 2044
7 JGI25404J52841_10020979 3300003659 Bacteria 1414
8 JGI25404J52841_10045704 3300003659 Bacteria 923
9 JGI25404J52841_10060183 3300003659 Bacteria 796
10 Ga0055542_1002315 3300003762 Bacteria 6550
11 Ga0055529_1039971 3300003763 Bacteria 569
12 Ga0055526_1038662 3300003771 Bacteria 1227
13 Ga0055531_10031944 3300003794 Bacteria 1731
14 Ga0065165_1009084 3300005262 Bacteria 4519
15 Ga0070683_100200130 3300005329 Bacteria 1897
16 Ga0070683_100663465 3300005329 Bacteria 998
17 Ga0070670_100522711 3300005331 Bacteria 1057
18 Ga0070670_100797797 3300005331 Bacteria 853
19 Ga0068869_100405036 3300005334 Bacteria 1123
20 Ga0070666_10377989 3300005335 Bacteria 1017
21 Ga0070680_100210780 3300005336 Bacteria 1639
22 Ga0070682_100310912 3300005337 Bacteria 1160
23 Ga0068868_101145613 3300005338 Bacteria 717
24 Ga0070661_100086294 3300005344 Bacteria 2320
25 Ga0070668_100071817 3300005347 Bacteria 2696
26 Ga0070668_100103943 3300005347 Bacteria 2254
27 Ga0070668_100145405 3300005347 Bacteria 1913
28 Ga0070668_100631157 3300005347 Bacteria 940
29 Ga0070671_100047293 3300005355 Bacteria 3578
30 Ga0070674_100716824 3300005356 Bacteria 856
31 Ga0070688_100170205 3300005365 Bacteria 1503
32 Ga0070667_100667180 3300005367 Bacteria 961
33 Ga0070709_10119514 3300005434 Bacteria 1784
34 Ga0070709_10308962 3300005434 Bacteria 1157
35 Ga0070709_10866062 3300005434 Bacteria 713
36 Ga0070714_100009317 3300005435 Bacteria 7713
37 Ga0070714_101512203 3300005435 Bacteria 656
38 Ga0070713_100111093 3300005436 Bacteria 2390
39 Ga0070710_10001623 3300005437 Bacteria 10622
40 Ga0070711_100002600 3300005439 Bacteria 10342
41 Ga0070663_100245385 3300005455 Bacteria 1415
42 Ga0070678_100130094 3300005456 Bacteria 1998
43 Ga0070678_100136192 3300005456 Bacteria 1958
44 Ga0070678_100140700 3300005456 Bacteria 1931
45 Ga0070678_100533455 3300005456 Bacteria 1040
46 Ga0070678_100990004 3300005456 Bacteria 772
47 Ga0070681_10059065 3300005458 Bacteria 3814
48 Ga0070681_10120889 3300005458 Bacteria 2554
49 Ga0070681_10576844 3300005458 Bacteria 1039
50 Ga0070699_100364648 3300005518 Bacteria 1303
51 Ga0070679_100355837 3300005530 Bacteria 1412
52 Ga0070684_100515847 3300005535 Bacteria 1108
53 Ga0068853_100096571 3300005539 Bacteria 2607
54 Ga0068853_100196899 3300005539 Bacteria 1833
55 Ga0068853_100334691 3300005539 Bacteria 1406
56 Ga0070672_100549490 3300005543 Bacteria 1003
57 Ga0070696_100439503 3300005546 Bacteria 1027
58 Ga0070693_100051061 3300005547 Bacteria 2366
59 Ga0070693_100097209 3300005547 Bacteria 1787
60 Ga0070693_100471662 3300005547 Bacteria 885
61 Ga0070665_100169276 3300005548 Bacteria 2186
62 Ga0070665_100183895 3300005548 Bacteria 2090
63 Ga0070665_101748841 3300005548 Bacteria 629
64 Ga0068855_100106562 3300005563 Bacteria 3221
65 Ga0068857_100144830 3300005577 Bacteria 2149
66 Ga0068857_100208519 3300005577 Bacteria 1782
67 Ga0068854_100754336 3300005578 Bacteria 845
68 Ga0068856_100327511 3300005614 Bacteria 1549
69 Ga0068856_100450631 3300005614 Bacteria 1308
70 Ga0068856_101738401 3300005614 Bacteria 636
71 Ga0070702_100545629 3300005615 Bacteria 860
72 Ga0068852_100035224 3300005616 Bacteria 4173
73 Ga0068852_100099846 3300005616 Bacteria 2617
74 Ga0068852_101806298 3300005616 Bacteria 634
75 Ga0068859_100256367 3300005617 Bacteria 1840
76 Ga0068859_101269473 3300005617 Bacteria 811
77 Ga0068859_101918619 3300005617 Bacteria 654
78 Ga0068864_100214742 3300005618 Bacteria 1773
79 Ga0068870_11045159 3300005840 Bacteria 585
80 Ga0068858_100096388 3300005842 Bacteria 2756
81 Ga0068858_100136471 3300005842 Bacteria 2301
82 Ga0068860_100000367 3300005843 Bacteria 59534
83 Ga0068860_100275629 3300005843 Bacteria 1643
84 Ga0068862_100481751 3300005844 Bacteria 1174
85 Ga0081455_10005963 3300005937 Bacteria 13212
86 Ga0081455_10082596 3300005937 Bacteria 2628
87 Ga0081540_1009361 3300005983 Bacteria 6756
88 Ga0081540_1017980 3300005983 Bacteria 4354
89 Ga0081540_1025360 3300005983 Bacteria 3413
90 Ga0081540_1025400 3300005983 Bacteria 3409
91 Ga0081540_1057447 3300005983 Bacteria 1882
92 Ga0081539_10023797 3300005985 Bacteria 3998
93 Ga0081539_10069314 3300005985 Bacteria 1899
94 Ga0070717_10050183 3300006028 Bacteria 3428
95 Ga0070717_10253006 3300006028 Bacteria 1557
96 Ga0070717_10350458 3300006028 Bacteria 1320
97 Ga0075365_10044781 3300006038 Bacteria 2901
98 Ga0075365_10048215 3300006038 Bacteria 2803
99 Ga0075365_10433016 3300006038 Bacteria 929
100 Ga0075368_10007086 3300006042 Bacteria 3948
101 Ga0075368_10026301 3300006042 Bacteria 2238
102 Ga0075363_100054681 3300006048 Bacteria 2136
103 Ga0075363_100216706 3300006048 Bacteria 1096
104 Ga0075363_100231412 3300006048 Bacteria 1061
105 Ga0075363_100320648 3300006048 Bacteria 902
106 Ga0075364_10349673 3300006051 Bacteria 1007
107 Ga0075364_10433616 3300006051 Bacteria 898
108 Ga0070715_10207749 3300006163 Bacteria 999
109 Ga0070716_100048505 3300006173 Bacteria 2401
110 Ga0070712_100149931 3300006175 Bacteria 1789
111 Ga0070712_100696505 3300006175 Bacteria 866
112 Ga0075362_10071498 3300006177 Bacteria 1585
113 Ga0075362_10084236 3300006177 Bacteria 1468
114 Ga0075362_10125668 3300006177 Bacteria 1217
115 Ga0075362_10278658 3300006177 Bacteria 827
116 Ga0075367_10053707 3300006178 Bacteria 2388
117 Ga0075367_10095584 3300006178 Bacteria 1812
118 Ga0075367_10924306 3300006178 Bacteria 556
119 Ga0075369_10113439 3300006186 Bacteria 1223
120 Ga0075369_10242851 3300006186 Bacteria 835
121 Ga0075369_10322707 3300006186 Bacteria 722
122 Ga0075369_10342871 3300006186 Bacteria 700
123 Ga0075366_10091150 3300006195 Bacteria 1826
124 Ga0075366_10095291 3300006195 Bacteria 1784
125 Ga0097621_100432833 3300006237 Bacteria 1182
126 Ga0075370_10024162 3300006353 Bacteria 3354
127 Ga0075370_10027287 3300006353 Bacteria 3167
128 Ga0075370_10181635 3300006353 Bacteria 1238
129 Ga0075370_10276290 3300006353 Bacteria 998
130 Ga0068871_100307152 3300006358 Bacteria 1394
131 Ga0075434_100209149 3300006871 Bacteria 1971
132 Ga0075434_100733678 3300006871 Bacteria 1005
133 Ga0075429_101236216 3300006880 Bacteria 652
134 Ga0068865_100734418 3300006881 Bacteria 846
135 Ga0075436_100709886 3300006914 Bacteria 745
136 Ga0097620_100256370 3300006931 Bacteria 1840
137 Ga0097620_100375662 3300006931 Bacteria 1517
138 Ga0097620_101269513 3300006931 Bacteria 811
139 Ga0097620_101917685 3300006931 Bacteria 654
140 Ga0099825_1051875 3300006941 Bacteria 859
141 Ga0099824_1031414 3300006942 Bacteria 2018
142 Ga0099822_1070392 3300006943 Bacteria 986
143 Ga0099823_1016181 3300006944 Bacteria 7341
144 Ga0099823_1099633 3300006944 Bacteria 898
145 Ga0075435_100341684 3300007076 Bacteria 1283
146 Ga0099794_10014948 3300007265 Bacteria 3414
147 Ga0105240_10097539 3300009093 Bacteria 3581
148 Ga0105240_10257634 3300009093 Bacteria 2014
149 Ga0105245_10035055 3300009098 Bacteria 4452
150 Ga0105245_10153537 3300009098 Bacteria 2179
151 Ga0105247_10017288 3300009101 Bacteria 4329
152 Ga0105247_10040927 3300009101 Bacteria 2834
153 Ga0105247_10155100 3300009101 Bacteria 1512
154 Ga0105247_10217410 3300009101 Bacteria 1292
155 Ga0105243_10163960 3300009148 Bacteria 1919
156 Ga0105243_11274174 3300009148 Bacteria 751
157 Ga0105241_10022979 3300009174 Bacteria 4623
158 Ga0105241_10071503 3300009174 Bacteria 2693
159 Ga0105241_10094456 3300009174 Bacteria 2365
160 Ga0105241_10357440 3300009174 Bacteria 1270
161 Ga0105241_10420292 3300009174 Bacteria 1176
162 Ga0105241_10528139 3300009174 Bacteria 1056
163 Ga0105242_10092057 3300009176 Bacteria 2554
164 Ga0105242_10571422 3300009176 Bacteria 1087
165 Ga0105242_10597086 3300009176 Bacteria 1066
166 Ga0105248_10272253 3300009177 Bacteria 1907
167 Ga0105248_10713352 3300009177 Bacteria 1132
168 Ga0105237_10036086 3300009545 Bacteria 5002
169 Ga0105237_10180282 3300009545 Bacteria 2113
170 Ga0105237_10204960 3300009545 Bacteria 1972
171 Ga0105237_10219970 3300009545 Bacteria 1899
172 Ga0105237_10459895 3300009545 Bacteria 1279
173 Ga0105238_10130744 3300009551 Bacteria 2489
174 Ga0105238_10281315 3300009551 Bacteria 1645
175 Ga0105238_10363603 3300009551 Bacteria 1437
176 Ga0105238_10381016 3300009551 Bacteria 1402
177 Ga0105238_10441472 3300009551 Bacteria 1298
178 Ga0105238_10806522 3300009551 Bacteria 954
179 Ga0105239_10078222 3300010375 Bacteria 3640
180 Ga0105239_10138528 3300010375 Bacteria 2710
181 Ga0105239_10345144 3300010375 Bacteria 1680
182 Ga0105239_10452600 3300010375 Bacteria 1456
183 Ga0105239_10839295 3300010375 Bacteria 1053
184 Ga0105239_10862669 3300010375 Bacteria 1038
185 Ga0105239_11654658 3300010375 Bacteria 741
186 Ga0105239_12273241 3300010375 Bacteria 631
187 Ga0105239_12279171 3300010375 Bacteria 630
188 Ga0105246_10062491 3300011119 Bacteria 2595
189 Ga0105246_10324616 3300011119 Bacteria 1252
190 Ga0157342_1026416 3300012507 Bacteria 707
191 Ga0157370_10117616 3300013104 Bacteria 2483
192 Ga0157374_10098280 3300013296 Bacteria 2802
193 Ga0157374_10159026 3300013296 Bacteria 2200
194 Ga0157374_11083567 3300013296 Bacteria 821
195 Ga0157378_10068602 3300013297 Bacteria 3180
196 Ga0157378_10159002 3300013297 Bacteria 2112
197 Ga0163162_10163256 3300013306 Bacteria 2350
198 Ga0163162_10416075 3300013306 Bacteria 1476
199 Ga0163162_11138511 3300013306 Bacteria 885
200 Ga0157372_10174205 3300013307 Bacteria 2490
201 Ga0157372_10655539 3300013307 Bacteria 1222
202 Ga0157375_10113699 3300013308 Bacteria 2808
203 Ga0157375_10321761 3300013308 Bacteria 1711
204 Ga0157375_11409464 3300013308 Bacteria 821
205 Ga0157375_12236816 3300013308 Bacteria 652
206 Ga0163163_10062643 3300014325 Bacteria 3686
207 Ga0163163_10107040 3300014325 Bacteria 2822
208 Ga0163163_10239356 3300014325 Bacteria 1865
209 Ga0163163_10433885 3300014325 Bacteria 1373
210 Ga0163163_11013229 3300014325 Bacteria 894
211 Ga0157380_10674945 3300014326 Bacteria 1034
212 Ga0157377_10469638 3300014745 Bacteria 873
213 Ga0157376_10004272 3300014969 Bacteria 9918
214 Ga0157376_11122562 3300014969 Bacteria 812
215 Ga0182005_1091804 3300015265 Bacteria 845
216 Ga0163161_10298534 3300017792 Bacteria 1268
217 Ga0206353_11199008 3300020082 Bacteria 2032
218 Ga0214544_1000007 3300021320 Bacteria 379989
219 Ga0214542_1000007 3300021321 Bacteria 291816
220 Ga0214545_1000006 3300021324 Bacteria 291693
221 Ga0214543_1000009 3300021327 Bacteria 384302
222 Ga0213873_10011107 3300021358 Bacteria 1918
223 Ga0213876_10002782 3300021384 Bacteria 10187
224 Ga0213876_10206921 3300021384 Bacteria 1043
225 Ga0213871_10008575 3300021441 Bacteria 2261
226 Ga0207425_1015495 3300025245 Bacteria 1709
227 Ga0209677_101642 3300025253 Bacteria 9406
228 Ga0209148_1001022 3300025254 Bacteria 17599
229 Ga0209148_1014767 3300025254 Bacteria 1376
230 Ga0209233_1002396 3300025261 Bacteria 6923
231 Ga0209233_1008190 3300025261 Bacteria 3254
232 Ga0209233_1027288 3300025261 Bacteria 1385
233 Ga0209233_1058459 3300025261 Bacteria 754
234 Ga0209455_1003787 3300025272 Bacteria 5202
235 Ga0209455_1012975 3300025272 Bacteria 1961
236 Ga0209455_1030912 3300025272 Bacteria 907
237 Ga0209564_1009562 3300025295 Bacteria 4593
238 Ga0209564_1012127 3300025295 Bacteria 3787
239 Ga0209758_1000595 3300025297 Bacteria 56364
240 Ga0209758_1000604 3300025297 Bacteria 55558
241 Ga0209758_1001332 3300025297 Bacteria 29913
242 Ga0209758_1005029 3300025297 Bacteria 10525
243 Ga0209758_1006626 3300025297 Bacteria 8204
244 Ga0209758_1107988 3300025297 Bacteria 776
245 Ga0209758_1114322 3300025297 Bacteria 741
246 Ga0209256_1005227 3300025299 Bacteria 7610
247 Ga0209256_1073616 3300025299 Bacteria 762
248 Ga0207426_1000500 3300025302 Bacteria 58181
249 Ga0207426_1002368 3300025302 Bacteria 12217
250 Ga0209257_1001217 3300025304 Bacteria 32229
251 Ga0209257_1013493 3300025304 Bacteria 3625
252 Ga0207697_10051661 3300025315 Bacteria 1699
253 Ga0207697_10061848 3300025315 Bacteria 1558
254 Ga0207696_1060702 3300025711 Bacteria 1064
255 Ga0207692_10020286 3300025898 Bacteria 3020
256 Ga0207642_10022211 3300025899 Bacteria 2512
257 Ga0207642_10368731 3300025899 Bacteria 852
258 Ga0207710_10019370 3300025900 Bacteria 2903
259 Ga0207710_10059403 3300025900 Bacteria 1731
260 Ga0207688_10133793 3300025901 Bacteria 1455
261 Ga0207688_10169394 3300025901 Bacteria 1298
262 Ga0207688_10321271 3300025901 Bacteria 950
263 Ga0207680_10209180 3300025903 Bacteria 1333
264 Ga0207647_10000809 3300025904 Bacteria 24246
265 Ga0207685_10531917 3300025905 Bacteria 623
266 Ga0207699_10047038 3300025906 Bacteria 2527
267 Ga0207699_10347838 3300025906 Bacteria 1046
268 Ga0207699_10411575 3300025906 Bacteria 964
269 Ga0207645_10094910 3300025907 Bacteria 1920
270 Ga0207645_10349114 3300025907 Bacteria 990
271 Ga0207643_10004944 3300025908 Bacteria 7132
272 Ga0207643_10099827 3300025908 Bacteria 1701
273 Ga0207643_10519980 3300025908 Bacteria 762
274 Ga0207654_10024849 3300025911 Bacteria 3225
275 Ga0207654_10042969 3300025911 Bacteria 2560
276 Ga0207654_10065125 3300025911 Bacteria 2145
277 Ga0207654_10161942 3300025911 Bacteria 1446
278 Ga0207707_10054246 3300025912 Bacteria 3489
279 Ga0207707_10163382 3300025912 Bacteria 1946
280 Ga0207695_10000123 3300025913 Bacteria 232059
281 Ga0207695_10260343 3300025913 Bacteria 1632
282 Ga0207671_10017843 3300025914 Bacteria 5460
283 Ga0207671_10156502 3300025914 Bacteria 1763
284 Ga0207671_10225088 3300025914 Bacteria 1470
285 Ga0207671_10329786 3300025914 Bacteria 1208
286 Ga0207671_10835451 3300025914 Bacteria 730
287 Ga0207693_10017479 3300025915 Bacteria 5721
288 Ga0207693_10599361 3300025915 Bacteria 858
289 Ga0207663_10093655 3300025916 Bacteria 2000
290 Ga0207663_10631438 3300025916 Bacteria 844
291 Ga0207660_10081611 3300025917 Bacteria 2377
292 Ga0207662_10100747 3300025918 Bacteria 1789
293 Ga0207657_10321217 3300025919 Bacteria 1224
294 Ga0207657_10464861 3300025919 Bacteria 992
295 Ga0207649_10054147 3300025920 Bacteria 2496
296 Ga0207652_10098834 3300025921 Bacteria 2574
297 Ga0207681_10518018 3300025923 Bacteria 978
298 Ga0207694_10120934 3300025924 Bacteria 2091
299 Ga0207694_10183233 3300025924 Bacteria 1699
300 Ga0207694_10475199 3300025924 Bacteria 1045
301 Ga0207650_10185992 3300025925 Bacteria 1657
302 Ga0207650_10257937 3300025925 Bacteria 1413
303 Ga0207659_10617647 3300025926 Bacteria 925
304 Ga0207687_10013862 3300025927 Bacteria 5265
305 Ga0207687_10128143 3300025927 Bacteria 1908
306 Ga0207687_10190187 3300025927 Bacteria 1597
307 Ga0207700_10055580 3300025928 Bacteria 2976
308 Ga0207644_10115686 3300025931 Bacteria 2034
309 Ga0207644_10138400 3300025931 Bacteria 1872
310 Ga0207690_10255795 3300025932 Bacteria 1355
311 Ga0207706_10084263 3300025933 Bacteria 2794
312 Ga0207706_10405394 3300025933 Bacteria 1182
313 Ga0207686_10307016 3300025934 Bacteria 1180
314 Ga0207709_10164080 3300025935 Bacteria 1552
315 Ga0207709_10889825 3300025935 Bacteria 723
316 Ga0207709_11022253 3300025935 Bacteria 676
317 Ga0207670_10163221 3300025936 Bacteria 1665
318 Ga0207669_10017039 3300025937 Bacteria 3714
319 Ga0207669_10418624 3300025937 Bacteria 1054
320 Ga0207704_10134148 3300025938 Bacteria 1720
321 Ga0207704_11532497 3300025938 Bacteria 572
322 Ga0207665_10010040 3300025939 Bacteria 6217
323 Ga0207691_10133924 3300025940 Bacteria 2187
324 Ga0207691_10407220 3300025940 Bacteria 1160
325 Ga0207691_11195863 3300025940 Bacteria 630
326 Ga0207711_10082496 3300025941 Bacteria 2810
327 Ga0207711_10177015 3300025941 Bacteria 1938
328 Ga0207689_10112861 3300025942 Bacteria 2234
329 Ga0207689_10136945 3300025942 Bacteria 2016
330 Ga0207661_10108866 3300025944 Bacteria 2340
331 Ga0207679_11012622 3300025945 Bacteria 761
332 Ga0207667_10022298 3300025949 Bacteria 6998
333 Ga0207667_10230284 3300025949 Bacteria 1898
334 Ga0207651_10130277 3300025960 Bacteria 1924
335 Ga0207651_10228541 3300025960 Bacteria 1509
336 Ga0207712_11678954 3300025961 Bacteria 569
337 Ga0207668_10160886 3300025972 Bacteria 1749
338 Ga0207668_10279874 3300025972 Bacteria 1367
339 Ga0207658_10185974 3300025986 Bacteria 1723
340 Ga0207658_11556876 3300025986 Bacteria 604
341 Ga0207677_10043795 3300026023 Bacteria 2978
342 Ga0207677_10138302 3300026023 Bacteria 1861
343 Ga0207703_10041071 3300026035 Bacteria 3704
344 Ga0207703_10298174 3300026035 Bacteria 1469
345 Ga0207703_10486185 3300026035 Bacteria 1157
346 Ga0207639_10177248 3300026041 Bacteria 1810
347 Ga0207639_10363851 3300026041 Bacteria 1295
348 Ga0207639_10393807 3300026041 Bacteria 1247
349 Ga0207639_10483368 3300026041 Bacteria 1129
350 Ga0207678_10070878 3300026067 Bacteria 2988
351 Ga0207678_11089251 3300026067 Bacteria 707
352 Ga0207708_10065642 3300026075 Bacteria 2775
353 Ga0207702_10442860 3300026078 Bacteria 1259
354 Ga0207702_10785019 3300026078 Bacteria 941
355 Ga0207702_11104669 3300026078 Bacteria 787
356 Ga0207702_11368565 3300026078 Bacteria 702
357 Ga0207641_10185125 3300026088 Bacteria 1910
358 Ga0207641_10469134 3300026088 Bacteria 1219
359 Ga0207641_10948065 3300026088 Bacteria 856
360 Ga0207648_10058938 3300026089 Bacteria 3348
361 Ga0207676_10242608 3300026095 Bacteria 1617
362 Ga0207676_10485069 3300026095 Bacteria 1171
363 Ga0207674_10158819 3300026116 Bacteria 2216
364 Ga0207674_10226270 3300026116 Bacteria 1819
365 Ga0207674_10710059 3300026116 Bacteria 971
366 Ga0207675_100146969 3300026118 Bacteria 2242
367 Ga0207683_10028851 3300026121 Bacteria 4801
368 Ga0207683_10125376 3300026121 Bacteria 2307
369 Ga0207683_10181102 3300026121 Bacteria 1911
370 Ga0207683_10556569 3300026121 Bacteria 1061
371 Ga0207683_10866877 3300026121 Bacteria 838
372 Ga0207698_10067853 3300026142 Bacteria 2814
373 Ga0207698_10112768 3300026142 Bacteria 2283
374 Ga0207698_10288957 3300026142 Bacteria 1520
375 Ga0207698_10350693 3300026142 Bacteria 1394
376 Ga0207698_10761890 3300026142 Bacteria 968
377 Ga0207698_10765327 3300026142 Bacteria 965
378 Ga0207698_11176026 3300026142 Bacteria 781
379 Ga0207698_11705416 3300026142 Bacteria 645
380 Ga0209389_1000019 3300027296 Bacteria 172067
381 Ga0209389_1000070 3300027296 Bacteria 97498
382 Ga0209589_1000420 3300027357 Bacteria 58471
383 Ga0209489_100033 3300027361 Bacteria 172166
384 Ga0209489_100196 3300027361 Bacteria 97498
385 Ga0209700_100012 3300027363 Bacteria 357892
386 Ga0209179_1003083 3300027512 Bacteria 2353
387 Ga0209588_1040404 3300027671 Bacteria 1505
388 Ga0209813_10048196 3300027866 Bacteria 1322
389 Ga0209813_10128294 3300027866 Bacteria 890
390 Ga0268266_10001750 3300028379 Bacteria 24844
391 Ga0268266_10005449 3300028379 Bacteria 11859
392 Ga0268266_10097894 3300028379 Bacteria 2580
393 Ga0268266_10132547 3300028379 Bacteria 2230
394 Ga0268266_10199329 3300028379 Bacteria 1831
395 Ga0268266_10256709 3300028379 Bacteria 1618
396 Ga0268266_10760568 3300028379 Bacteria 935
397 Ga0268265_11021481 3300028380 Bacteria 817
398 Ga0268264_10000042 3300028381 Bacteria 372069
399 Ga0268264_10110353 3300028381 Bacteria 2408
400 Ga0268264_10161794 3300028381 Bacteria 2017
401 Ga0265334_10107696 3300028573 Bacteria 1003
402 Ga0265318_10165207 3300028577 Bacteria 811
403 Ga0265336_10000560 3300028666 Bacteria 21132
404 Ga0307517_10178890 3300028786 Bacteria 1374
405 Ga0307517_10326417 3300028786 Bacteria 846
406 Ga0307515_10133021 3300028794 Bacteria 2724
407 Ga0265338_10000271 3300028800 Bacteria 94819
408 Ga0307511_10278380 3300030521 Bacteria 776
409 Ga0265340_10005857 3300031247 Bacteria 6802
410 Ga0265316_10214867 3300031344 Bacteria 1421
411 Ga0307513_10193740 3300031456 Bacteria 1881
412 Ga0307509_10320647 3300031507 Bacteria 1286
413 Ga0307408_100799426 3300031548 Bacteria 856
414 Ga0307508_10000019 3300031616 Bacteria 197575
415 Ga0307508_10241982 3300031616 Bacteria 1402
416 Ga0307516_10133801 3300031730 Bacteria 2256
417 Ga0307516_10161705 3300031730 Bacteria 1989
418 Ga0307413_10513134 3300031824 Bacteria 965
419 Ga0307406_10134380 3300031901 Bacteria 1741
420 Ga0307406_10147290 3300031901 Bacteria 1675
421 Ga0307412_10408302 3300031911 Bacteria 1108
422 Ga0307412_10813577 3300031911 Bacteria 812
423 Ga0307412_10984088 3300031911 Bacteria 744
424 Ga0307416_100084245 3300032002 Bacteria 2701
425 Ga0307414_10575764 3300032004 Bacteria 1007
426 Ga0307411_10695523 3300032005 Bacteria 885
427 Ga0307415_100296597 3300032126 Bacteria 1337
428 Ga0307510_10031136 3300033180 Bacteria 6032
429 Ga0373959_0021676 3300034820 Bacteria 1236
430 Ga0373938_0121312 3300034957 Bacteria 674
431 Ga0373934_0009704 3300035086 Bacteria 3610
432 Ga0373944_0106891 3300035089 Bacteria 951
433 Ga0373951_0119604 3300035091 Bacteria 716
434 Ga0373932_0021778 3300035112 Bacteria 1695
435 Ga0373939_0148781 3300035114 Bacteria 851
436 Ga0373953_0022892 3300035117 Bacteria 2361
437 Ga0373954_0011571 3300035118 Bacteria 3912
438 Ga0373956_0140481 3300035119 Bacteria 1133
439 Ga0373957_0031808 3300035120 Bacteria 1940
440 Ga0373946_0284139 3300035171 Bacteria 815
441 Ga0373946_0328360 3300035171 Bacteria 761
442 Ga0373955_0015334 3300035172 Bacteria 3749
443 Ga0373924_0006000 3300035410 Bacteria 4332
444 Ga0373931_0101514 3300035691 Bacteria 1619
445 Ga0373931_0349698 3300035691 Bacteria 925
446 Ga0373935_0183460 3300035692 Bacteria 1438
447 Ga0373935_0228053 3300035692 Bacteria 1296
448 Ga0373927_0004320 3300035695 Bacteria 9967
449 Ga0373927_0047393 3300035695 Bacteria 2780
450 Ga0373933_0021248 3300035724 Bacteria 3685
451 Ga0373937_0073767 3300036401 Bacteria 3148
452 Ga0373925_0039274 3300037068 Bacteria 3502
453 Ga0373925_0167487 3300037068 Bacteria 1733
454 Ga0373925_0400779 3300037068 Bacteria 1119
455 Ga0373925_1309624 3300037068 Bacteria 594
456 Ga0395899_0273897 3300037312 Bacteria 1150
457 Ga0395900_0178057 3300037418 Bacteria 2162
458 Ga0395900_0360121 3300037418 Bacteria 1426
459 Ga0395900_0446611 3300037418 Bacteria 1250
460 Ga0395898_0165429 3300037466 Bacteria 2115
461 Ga0395905_0004875 3300037471 Bacteria 13829
462 Ga0395905_0012983 3300037471 Bacteria 8005
463 Ga0395905_0081127 3300037471 Bacteria 3040
464 Ga0395905_0744728 3300037471 Bacteria 882
465 Ga0436364_0575905 3300037853 Bacteria 2015
466 Ga0436364_1072071 3300037853 Bacteria 1406
467 Ga0436364_1201965 3300037853 Bacteria 1293
468 Ga0395901_0007708 3300038443 Bacteria 10856
469 Ga0395901_0102845 3300038443 Bacteria 2998
470 Ga0395901_0268958 3300038443 Bacteria 1773
471 Ga0395901_0325799 3300038443 Bacteria 1589
472 Ga0395901_1078356 3300038443 Bacteria 775
473 Ga0436365_0024912 3300039437 Bacteria 3590
474 Ga0436365_0066782 3300039437 Bacteria 1047
475 Ga0436365_0198024 3300039437 Bacteria 1046
476 Ga0436365_1058179 3300039437 Bacteria 1939
477 Ga0436365_1083010 3300039437 Bacteria 744
478 Ga0436365_1145349 3300039437 Bacteria 3464
479 Ga0436365_1272860 3300039437 Bacteria 25483
480 Ga0436365_1730046 3300039437 Bacteria 3169
481 Ga0436360_0054328 3300039438 Bacteria 2054
482 Ga0436361_0244793 3300039447 Bacteria 3118
483 Ga0436363_1035359 3300039450 Bacteria 792
484 Ga0436363_1041115 3300039450 Bacteria 2834
485 Ga0436363_1501048 3300039450 Bacteria 4628
486 Ga0436362_0098915 3300039453 Bacteria 7476
487 Ga0436362_0999249 3300039453 Bacteria 2898
488 Ga0451787_264771 3300041441 Bacteria 668
489 Ga0451793_1168289 3300041452 Bacteria 566
490 Ga0451797_0551223 3300041453 Bacteria 634
491 Ga0451798_0889358 3300041458 Bacteria 579
492 Ga0451841_0822327 3300041498 Bacteria 869
493 Ga0451853_0828513 3300041512 Bacteria 882
494 Ga0439451_097863 3300042009 Bacteria 593
495 Ga0439446_0143078 3300042156 Bacteria 782
496 Ga0466972_0290874 3300044658 Bacteria 763
497 Ga0466972_0434317 3300044658 Bacteria 616
498 Ga0466965_0008749 3300044683 Bacteria 4690
499 Ga0466965_0049162 3300044683 Bacteria 2090
500 Ga0466966_0513492 3300044684 Bacteria 721
501 Ga0466963_0172797 3300044694 Bacteria 1507
502 Ga0466963_0686548 3300044694 Bacteria 722
503 Ga0466964_0638306 3300044706 Bacteria 588
504 Ga0466971_0095286 3300044719 Bacteria 1365
505 Ga0466968_0044536 3300044735 Bacteria 1881
506 Ga0466970_0174738 3300044765 Bacteria 1191
507 Ga0466957_0110450 3300044842 Bacteria 1743
508 Ga0466960_0293881 3300044901 Bacteria 914
509 Ga0466960_0766001 3300044901 Bacteria 582
510 Ga0466959_0204762 3300045049 Bacteria 1373
511 Ga0466958_0148746 3300045836 Bacteria 1477
512 Ga0466958_0692538 3300045836 Bacteria 664
513 Ga0466967_0050670 3300045976 Bacteria 3636
514 Ga0466967_0105036 3300045976 Bacteria 2587
515 Ga0495627_050768 3300046453 Bacteria 1249
516 Ga0495592_0025512 3300046454 Bacteria 4486
517 Ga0495603_0008563 3300046455 Bacteria 6182
518 Ga0495603_0036192 3300046455 Bacteria 2963
519 Ga0495629_0013615 3300046459 Bacteria 5869
520 Ga0495638_0023174 3300046460 Bacteria 4065
521 Ga0495651_0029933 3300046462 Bacteria 4245
522 Ga0495653_0036044 3300046463 Bacteria 3899
523 Ga0495580_0122657 3300046472 Bacteria 1804
524 Ga0495582_0536299 3300046473 Bacteria 677
525 Ga0495605_0029311 3300046474 Bacteria 2835
526 Ga0495605_0337569 3300046474 Bacteria 633
527 Ga0495639_0012900 3300046475 Bacteria 3606
528 Ga0495639_0079933 3300046475 Bacteria 1521
529 Ga0495639_0285222 3300046475 Bacteria 821
530 Ga0495662_0390799 3300046476 Bacteria 683
531 Ga0495584_0171270 3300046491 Bacteria 1103
532 Ga0495585_0045326 3300046492 Bacteria 2455
533 Ga0495585_0202630 3300046492 Bacteria 1009
534 Ga0495585_0406931 3300046492 Bacteria 655
535 Ga0495606_0129346 3300046507 Bacteria 1503
536 Ga0495606_0314086 3300046507 Bacteria 844
537 Ga0495608_0018003 3300046511 Bacteria 4880
538 Ga0495610_0151587 3300046512 Bacteria 988
539 Ga0495616_0050458 3300046513 Bacteria 2080
540 Ga0495616_0188975 3300046513 Bacteria 911
541 Ga0495620_0029187 3300046515 Bacteria 2556
542 Ga0495628_0084347 3300046516 Bacteria 2465
543 Ga0495632_0026711 3300046519 Bacteria 3034
544 Ga0495632_0352628 3300046519 Bacteria 647
545 Ga0495643_0004848 3300046522 Bacteria 9271
546 Ga0495643_0026039 3300046522 Bacteria 3306
547 Ga0495644_0025625 3300046523 Bacteria 2238
548 Ga0495644_0054133 3300046523 Bacteria 1507
549 Ga0495648_0066129 3300046524 Bacteria 2121
550 Ga0495648_0133827 3300046524 Bacteria 1314
551 Ga0495666_0075650 3300046526 Bacteria 1596
552 Ga0495652_0034292 3300046529 Bacteria 4424
553 Ga0495654_0093881 3300046530 Bacteria 1389
554 Ga0495640_0020771 3300046533 Bacteria 4828
555 Ga0495587_0027969 3300046536 Bacteria 3432
556 Ga0495598_0005121 3300046537 Bacteria 2886
557 Ga0495609_0138707 3300046538 Bacteria 1038
558 Ga0495609_0230566 3300046538 Bacteria 767
559 Ga0495597_0041294 3300046542 Bacteria 2061
560 Ga0495597_0139766 3300046542 Bacteria 999
561 Ga0495622_0039342 3300046557 Bacteria 2202
562 Ga0495667_0148129 3300046559 Bacteria 1511
563 Ga0495656_0010809 3300046615 Bacteria 3331
564 Ga0495656_0090884 3300046615 Bacteria 1396
565 Ga0495668_0034954 3300046616 Bacteria 2817
566 Ga0495668_0094820 3300046616 Bacteria 1633
567 Ga0495668_0119115 3300046616 Bacteria 1444
568 Ga0495668_0278050 3300046616 Bacteria 917
569 Ga0495625_0241269 3300046660 Bacteria 1176
570 Ga0495625_0271937 3300046660 Bacteria 1093
571 Ga0495625_0474228 3300046660 Bacteria 769
572 Ga0495625_0695905 3300046660 Bacteria 601
573 Ga0495635_0004740 3300046663 Bacteria 9449
574 Ga0495635_0278960 3300046663 Bacteria 1123
575 Ga0495661_0146571 3300046665 Bacteria 1279
576 Ga0495588_0085353 3300046674 Bacteria 1650
577 Ga0495657_0040814 3300046675 Bacteria 3179
578 Ga0495599_0009114 3300046678 Bacteria 6050
579 Ga0495623_0027272 3300046679 Bacteria 3673
580 Ga0495646_0101174 3300046680 Bacteria 1652
581 Ga0495646_0447170 3300046680 Bacteria 668
582 Ga0495647_0124365 3300046681 Bacteria 1088
583 Ga0495670_0505415 3300046691 Bacteria 656
584 Ga0495649_0015741 3300046694 Bacteria 4299
585 Ga0495649_0054232 3300046694 Bacteria 2168
586 Ga0495649_0162971 3300046694 Bacteria 1169
587 Ga0495589_0063663 3300046794 Bacteria 1809
588 Ga0495589_0102589 3300046794 Bacteria 1383
589 Ga0495589_0190294 3300046794 Bacteria 971
590 Ga0495600_0016248 3300046809 Bacteria 4720
591 Ga0495600_0171298 3300046809 Bacteria 1401
592 Ga0495660_0371803 3300046810 Bacteria 632
593 Ga0495604_0073874 3300047317 Bacteria 2571
594 Ga0495636_0128406 3300047318 Bacteria 1126
595 Ga0495674_0155440 3300047319 Bacteria 1916
596 Ga0495672_0018431 3300047320 Bacteria 4633
597 Ga0495672_0227717 3300047320 Bacteria 916
598 Ga0495672_0228158 3300047320 Bacteria 915
599 Ga0495680_0046199 3300047322 Bacteria 3434
600 Ga0495683_0027253 3300047323 Bacteria 2922
601 Ga0495675_0017312 3300047444 Bacteria 4566
602 Ga0495685_017436 3300047447 Bacteria 2460
603 Ga0495673_0025262 3300047469 Bacteria 2856
604 Ga0495673_0099887 3300047469 Bacteria 1174
605 Ga0495681_0281572 3300047470 Bacteria 648
606 Ga0495684_0009966 3300047471 Bacteria 7340
607 Ga0495686_0077492 3300047472 Bacteria 2035
608 Ga0495686_0091932 3300047472 Bacteria 1841
609 Ga0495686_0125430 3300047472 Bacteria 1527
610 Ga0495686_0126699 3300047472 Bacteria 1518
611 Ga0495686_0180845 3300047472 Bacteria 1222
612 Ga0495686_0283526 3300047472 Bacteria 920
613 Ga0495686_0535841 3300047472 Bacteria 613
614 Ga0495593_0013827 3300047673 Bacteria 4597
615 Ga0495593_0166671 3300047673 Bacteria 1111
616 Ga0495602_0031668 3300048088 Bacteria 4995
617 Ga0495615_0066502 3300048090 Bacteria 963
618 Ga0496100_0028982 3300048903 Bacteria 3419
619 Ga0496100_0242518 3300048903 Bacteria 1330
620 Ga0496100_0300392 3300048903 Bacteria 1201
621 Ga0496100_0482964 3300048903 Bacteria 953
622 Ga0496101_0009139 3300048904 Bacteria 6505
623 Ga0496101_0121111 3300048904 Bacteria 1978
624 Ga0496101_0164672 3300048904 Bacteria 1702
625 Ga0496101_0729660 3300048904 Bacteria 782
626 Ga0496102_0004648 3300048905 Bacteria 11622
627 Ga0496102_0028991 3300048905 Bacteria 4948
628 Ga0496102_0038354 3300048905 Bacteria 4323
629 Ga0496102_0391409 3300048905 Bacteria 1307
630 Ga0496102_0728897 3300048905 Bacteria 914
631 Ga0496102_1706541 3300048905 Bacteria 548
632 Ga0496103_0004501 3300048906 Bacteria 8444
633 Ga0496103_0014170 3300048906 Bacteria 4733
634 Ga0496103_0082966 3300048906 Bacteria 2018
635 Ga0496103_0121354 3300048906 Bacteria 1665
636 Ga0496103_0239956 3300048906 Bacteria 1166
637 Ga0496104_0025212 3300048907 Bacteria 5480
638 Ga0496104_0086445 3300048907 Bacteria 2993
639 Ga0496104_0152751 3300048907 Bacteria 2216
640 Ga0496104_0691846 3300048907 Bacteria 927
641 Ga0496105_0004610 3300048908 Bacteria 10383
642 Ga0496105_0010472 3300048908 Bacteria 7291
643 Ga0496105_0114313 3300048908 Bacteria 2226
644 Ga0496106_0000686 3300048909 Bacteria 24281
645 Ga0496106_0014778 3300048909 Bacteria 5772
646 Ga0496106_0542348 3300048909 Bacteria 933
647 Ga0496106_0656786 3300048909 Bacteria 838
648 Ga0496106_1004280 3300048909 Bacteria 656
649 Ga0496107_0002437 3300048910 Bacteria 12048
650 Ga0496107_0425198 3300048910 Bacteria 987
651 Ga0496108_0030616 3300048911 Bacteria 4459
652 Ga0496108_0067910 3300048911 Bacteria 3007
653 Ga0496108_0383370 3300048911 Bacteria 1227
654 Ga0496108_0597677 3300048911 Bacteria 962
655 Ga0496109_0003924 3300048912 Bacteria 12429
656 Ga0496109_0054969 3300048912 Bacteria 3631
657 Ga0496109_0112472 3300048912 Bacteria 2532
658 Ga0496109_0122962 3300048912 Bacteria 2418
659 Ga0496109_0347674 3300048912 Bacteria 1401
660 Ga0496109_0417796 3300048912 Bacteria 1267
661 Ga0496110_0005589 3300048913 Bacteria 9870
662 Ga0496110_0049214 3300048913 Bacteria 3696
663 Ga0496110_0241290 3300048913 Bacteria 1644
664 Ga0496110_0383155 3300048913 Bacteria 1281
665 Ga0496110_0940505 3300048913 Bacteria 771
666 Ga0496111_0007510 3300048914 Bacteria 7152
667 Ga0496111_0010019 3300048914 Bacteria 6342
668 Ga0496111_0063755 3300048914 Bacteria 2673
669 Ga0496111_0203532 3300048914 Bacteria 1471
670 Ga0496111_0744225 3300048914 Bacteria 711
671 Ga0496111_1046989 3300048914 Bacteria 583
672 Ga0496112_0000023 3300048915 Bacteria 156144
673 Ga0496112_0007998 3300048915 Bacteria 9432
674 Ga0496112_0022619 3300048915 Bacteria 5993
675 Ga0496112_0036993 3300048915 Bacteria 4763
676 Ga0496112_0142462 3300048915 Bacteria 2366
677 Ga0496112_0186224 3300048915 Bacteria 2039
678 Ga0496112_0304463 3300048915 Bacteria 1539
679 Ga0496113_0005790 3300048916 Bacteria 7750
680 Ga0496113_0012118 3300048916 Bacteria 5784
681 Ga0496113_0028000 3300048916 Bacteria 4047
682 Ga0496113_0152914 3300048916 Bacteria 1821
683 Ga0496113_0182827 3300048916 Bacteria 1662
684 Ga0496114_0008237 3300048917 Bacteria 8262
685 Ga0496114_0040502 3300048917 Bacteria 3857
686 Ga0496114_0481885 3300048917 Bacteria 1097
687 Ga0496115_0004137 3300048918 Bacteria 10474
688 Ga0496115_0009886 3300048918 Bacteria 7103
689 Ga0496115_0226615 3300048918 Bacteria 1542
690 Ga0496115_0318838 3300048918 Bacteria 1272
691 Ga0496115_0791657 3300048918 Bacteria 739
692 Ga0496116_0061378 3300048919 Bacteria 2434
693 Ga0496116_0132742 3300048919 Bacteria 1416
694 Ga0496117_0035078 3300048920 Bacteria 3771
695 Ga0496117_0059165 3300048920 Bacteria 2649
696 Ga0496117_0108529 3300048920 Bacteria 1736
697 Ga0496117_0280598 3300048920 Bacteria 892
698 Ga0496118_0002254 3300048921 Bacteria 26418
699 Ga0496118_0011526 3300048921 Bacteria 8619
700 Ga0496118_0091384 3300048921 Bacteria 2094
701 Ga0496118_0109252 3300048921 Bacteria 1841
702 Ga0496119_0141737 3300048922 Bacteria 1297
703 Ga0496119_0179815 3300048922 Bacteria 1110
704 Ga0496119_0234809 3300048922 Bacteria 931
705 Ga0496119_0291122 3300048922 Bacteria 808
706 Ga0496120_0228428 3300048923 Bacteria 885
707 Ga0496120_0261752 3300048923 Bacteria 807
708 Ga0496120_0343035 3300048923 Bacteria 673
709 Ga0496121_0000418 3300048924 Bacteria 84182
710 Ga0496121_0032083 3300048924 Bacteria 4782
711 Ga0496121_0054413 3300048924 Bacteria 3344
712 Ga0496121_0115792 3300048924 Bacteria 2035
713 Ga0496121_0212461 3300048924 Bacteria 1369
714 Ga0496121_0258504 3300048924 Bacteria 1204
715 Ga0496121_0398086 3300048924 Bacteria 903
716 Ga0496121_0511767 3300048924 Bacteria 760
717 Ga0496122_0233982 3300048925 Bacteria 1042
718 Ga0496123_0129961 3300048926 Bacteria 1397
719 Ga0496124_0001129 3300048927 Bacteria 42006
720 Ga0496124_0097302 3300048927 Bacteria 2390
721 Ga0496124_0321680 3300048927 Bacteria 1107
722 Ga0496125_0000158 3300048928 Bacteria 151273
723 Ga0496125_0001222 3300048928 Bacteria 38526
724 Ga0496125_0066546 3300048928 Bacteria 2846
725 Ga0496125_0146477 3300048928 Bacteria 1631
726 Ga0496125_0401690 3300048928 Bacteria 801
727 Ga0496126_0001668 3300048929 Bacteria 33320
728 Ga0496126_0018732 3300048929 Bacteria 6849
729 Ga0496126_0020931 3300048929 Bacteria 6401
730 Ga0496126_0033351 3300048929 Bacteria 4844
731 Ga0496126_0148025 3300048929 Bacteria 2015
732 Ga0496126_0251863 3300048929 Bacteria 1471
733 Ga0496126_0305050 3300048929 Bacteria 1312
734 Ga0496126_0329149 3300048929 Bacteria 1254
735 Ga0496126_0427584 3300048929 Bacteria 1069
736 Ga0495682_0025675 3300049460 Bacteria 2192
737 Ga0495682_0050392 3300049460 Bacteria 1515
738 Ga0501032_0090827 3300049569 Bacteria 2027
739 Ga0501032_0147391 3300049569 Bacteria 1549
740 Ga0501032_0231282 3300049569 Bacteria 1202
741 Ga0501033_0102788 3300049570 Bacteria 2084
742 Ga0501033_0203626 3300049570 Bacteria 1413
743 Ga0501033_0579114 3300049570 Bacteria 771
744 Ga0501034_1512917 3300049571 Bacteria 545
745 Ga0501036_0282354 3300049572 Bacteria 1389
746 Ga0501036_0638273 3300049572 Bacteria 882
747 Ga0501038_0352460 3300049574 Bacteria 1146
748 Ga0501038_0588485 3300049574 Bacteria 843
749 Ga0501039_0990388 3300049575 Bacteria 653
750 Ga0501043_0949468 3300049579 Bacteria 614
751 Ga0501046_0244336 3300049580 Bacteria 1323
752 Ga0501047_0016108 3300049581 Bacteria 7130
753 Ga0501047_0101596 3300049581 Bacteria 2755
754 Ga0501047_0110149 3300049581 Bacteria 2636
755 Ga0501048_0038823 3300049582 Bacteria 3417
756 Ga0501068_0197463 3300049584 Bacteria 1276
757 Ga0501069_0435329 3300049585 Bacteria 778
758 Ga0501070_0005564 3300049586 Bacteria 10744
759 Ga0501070_0208694 3300049586 Bacteria 1604
760 Ga0501070_0392522 3300049586 Bacteria 1123
761 Ga0501074_0009318 3300049590 Bacteria 7132
762 Ga0501076_0117789 3300049592 Bacteria 2150
763 Ga0501080_0138025 3300049742 Bacteria 2255
764 Ga0501083_0804066 3300049744 Bacteria 612
765 Ga0501044_0079839 3300049823 Bacteria 3314
766 Ga0501044_0173484 3300049823 Bacteria 2126
767 Ga0501044_0393994 3300049823 Bacteria 1298
768 Ga0501044_0676144 3300049823 Bacteria 919
769 nmdc:mga03683_174577_c1 3300050489 Unclassified 978
770 nmdc:mga03683_365116_c1 3300050489 Bacteria 685
771 nmdc:mga03n38_134724_c1 3300050490 Bacteria 1228
772 nmdc:mga03n38_310084_c1 3300050490 Bacteria 850
773 nmdc:mga03n38_40940_c1 3300050490 Bacteria 2016
774 nmdc:mga03n38_99218_c1 3300050490 Bacteria 1402
775 nmdc:mga00v17_128515_c1 3300050491 Bacteria 1618
776 nmdc:mga00v17_45968_c1 3300050491 Bacteria 2640
777 nmdc:mga0yw44_109719_c2 3300050492 Bacteria 1233
778 nmdc:mga0yw44_36135_c1 3300050492 Bacteria 2909
779 nmdc:mga0yw44_36870_c2 3300050492 Bacteria 1837
780 nmdc:mga0yw44_432789_c1 3300050492 Bacteria 891
781 nmdc:mga0yw44_690365_c1 3300050492 Bacteria 694
782 nmdc:mga0yw44_75742_c1 3300050492 Bacteria 2099
783 nmdc:mga0yw44_88943_c1 3300050492 Bacteria 1948
784 nmdc:mga0k408_175467_c1 3300050493 Bacteria 1278
785 nmdc:mga0k408_214694_c1 3300050493 Bacteria 1149
786 nmdc:mga0k408_469409_c1 3300050493 Bacteria 747
787 nmdc:mga0k408_61570_c1 3300050493 Bacteria 2182
788 nmdc:mga06z11_128769_c1 3300050494 Bacteria 1419
789 nmdc:mga06z11_4761_c1 3300050494 Bacteria 5368
790 nmdc:mga06z11_627598_c1 3300050494 Bacteria 654
791 nmdc:mga04h51_41115_c1 3300050495 Bacteria 1509
792 nmdc:mga04h51_59298_c1 3300050495 Bacteria 1308
793 nmdc:mga04h51_88470_c1 3300050495 Bacteria 1111
794 nmdc:mga07m45_141838_c1 3300050496 Bacteria 1392
795 nmdc:mga07m45_19452_c1 3300050496 Bacteria 3680
796 nmdc:mga07m45_239371_c1 3300050496 Bacteria 1056
797 nmdc:mga07m45_322575_c1 3300050496 Bacteria 898
798 nmdc:mga07m45_43829_c1 3300050496 Bacteria 1596
799 nmdc:mga07m45_48318_c1 3300050496 Bacteria 2393
800 nmdc:mga07m45_66829_c1 3300050496 Bacteria 2043
801 nmdc:mga07m45_70799_c1 3300050496 Bacteria 1984
802 nmdc:mga05p37_100622_c1 3300050507 Bacteria 3560
803 nmdc:mga09592_298197_c1 3300050508 Bacteria 1397
804 nmdc:mga0qj67_629016_c1 3300050509 Bacteria 857
805 nmdc:mga08y16_231865_c1 3300050511 Bacteria 1909
806 nmdc:mga0n895_509252_c1 3300050512 Bacteria 1212
807 nmdc:mga0n895_614776_c1 3300050512 Bacteria 1088
808 nmdc:mga08x19_637422_c1 3300050514 Bacteria 756
809 nmdc:mga0a205_177406_c1 3300050515 Bacteria 2025
810 nmdc:mga0sz30_105824_c1 3300050516 Bacteria 1231
811 nmdc:mga0sz30_139620_c1 3300050516 Bacteria 1070
812 nmdc:mga0sz30_75702_c1 3300050516 Bacteria 1453
813 Ga0495601_0090645 3300053077 Bacteria 1967
814 Ga0495601_0435467 3300053077 Bacteria 849
815 Ga0500610_0250074 3300053079 Bacteria 818
816 Ga0500635_0017554 3300053080 Bacteria 2146
817 Ga0495655_0028161 3300053083 Bacteria 1339
818 Ga0495595_0015913 3300053084 Bacteria 3211
819 Ga0495619_0012111 3300053085 Bacteria 5433
820 Ga0495619_0495950 3300053085 Bacteria 840
821 Ga0500578_0198420 3300053086 Bacteria 1229
822 Ga0500643_000013 3300053087 Bacteria 324296
823 Ga0500644_0027691 3300053088 Bacteria 1766
824 Ga0500647_0231044 3300053091 Bacteria 823
825 Ga0500583_0056880 3300053092 Bacteria 1834
826 Ga0500651_0111687 3300053093 Bacteria 1667
827 Ga0500566_0001097 3300053094 Bacteria 15678
828 Ga0500640_022449 3300053095 Bacteria 2727
829 Ga0500641_0011847 3300053096 Bacteria 3172
830 Ga0500641_0042629 3300053096 Bacteria 1839
831 Ga0500555_005971 3300053103 Bacteria 3454
832 Ga0500556_0039804 3300053104 Bacteria 1649
833 Ga0500557_000030 3300053105 Bacteria 76944
834 Ga0500562_006360 3300053108 Bacteria 2978
835 Ga0500569_023926 3300053109 Bacteria 1647
836 Ga0500569_177594 3300053109 Bacteria 723
837 Ga0500572_012340 3300053111 Bacteria 2092
838 Ga0500592_065714 3300053116 Bacteria 596
839 Ga0500594_0040125 3300053118 Bacteria 1276
840 Ga0500595_002867 3300053119 Bacteria 8270
841 Ga0500607_025594 3300053121 Bacteria 3282
842 Ga0500608_022223 3300053122 Bacteria 2939
843 Ga0500628_029919 3300053129 Bacteria 1174
844 Ga0500642_0000383 3300053130 Bacteria 14747
845 Ga0500642_0028004 3300053130 Bacteria 2319
846 Ga0500655_032876 3300053133 Bacteria 1002
847 Ga0500655_073864 3300053133 Bacteria 697
848 Ga0500658_0202644 3300053134 Bacteria 907
849 Ga0500559_0063419 3300053136 Bacteria 1651
850 Ga0500559_0396141 3300053136 Bacteria 642
851 Ga0500564_046420 3300053138 Bacteria 1992
852 Ga0500573_0239073 3300053140 Bacteria 943
853 Ga0500573_0440813 3300053140 Bacteria 605
854 Ga0500579_242467 3300053143 Bacteria 596
855 Ga0500588_0052558 3300053146 Bacteria 1276
856 Ga0500588_0064029 3300053146 Bacteria 1187
857 Ga0500589_091389 3300053147 Bacteria 1340
858 Ga0500590_236454 3300053148 Bacteria 739
859 Ga0500604_0062468 3300053151 Bacteria 1173
860 Ga0500622_0038670 3300053156 Bacteria 2489
861 Ga0500624_005683 3300053157 Bacteria 1665
862 Ga0500638_081150 3300053162 Bacteria 1540
863 Ga0500639_129909 3300053163 Bacteria 1195
864 Ga0500636_0001605 3300053177 Bacteria 12316
865 Ga0500636_0020415 3300053177 Bacteria 3923
866 Ga0500637_0266197 3300053178 Bacteria 950
867 Ga0500611_061758 3300053727 Bacteria 890
868 Ga0500625_093427 3300053729 Bacteria 1280
869 Ga0500645_089807 3300053730 Bacteria 872
870 Ga0500609_003839 3300053731 Bacteria 2096
871 Ga0500599_005210 3300053736 Bacteria 1628
872 Ga0500601_000369 3300053737 Bacteria 8116
873 Ga0500601_044490 3300053737 Bacteria 544
874 Ga0501082_0184978 3300060353 Bacteria 1813
875 Ga0466962_0354289 3300061719 Bacteria 731

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0049162 Ga0466965_0049162_1440_1970 147
2 3300048906 Ga0496103_0121354 Ga0496103_0121354_1145_1639 149
3 3300046615 Ga0495656_0090884 Ga0495656_0090884_792_1310 151
4 3300048905 Ga0496102_0728897 Ga0496102_0728897_49_546 151
5 3300005937 Ga0081455_10005963 Ga0081455_100059632 152
6 3300003659 JGI25404J52841_10060183 JGI25404J52841_100601832 153
7 3300006048 Ga0075363_100231412 Ga0075363_1002314122 154
8 3300005985 Ga0081539_10069314 Ga0081539_100693142 155
9 3300014969 Ga0157376_11122562 Ga0157376_111225622 155
10 3300048914 Ga0496111_0063755 Ga0496111_0063755_587_1108 155
11 3300048915 Ga0496112_0304463 Ga0496112_0304463_122_643 155
12 3300005436 Ga0070713_100111093 Ga0070713_1001110932 156
13 3300005985 Ga0081539_10023797 Ga0081539_100237972 156
14 3300006177 Ga0075362_10125668 Ga0075362_101256682 156
15 3300009545 Ga0105237_10219970 Ga0105237_102199702 156
16 3300009545 Ga0105237_10459895 Ga0105237_104598952 156
17 3300009551 Ga0105238_10130744 Ga0105238_101307443 156
18 3300009551 Ga0105238_10281315 Ga0105238_102813152 156
19 3300010375 Ga0105239_10862669 Ga0105239_108626692 156
20 3300025914 Ga0207671_10225088 Ga0207671_102250882 156
21 3300025914 Ga0207671_10329786 Ga0207671_103297862 156
22 3300026078 Ga0207702_10785019 Ga0207702_107850192 156
23 3300026142 Ga0207698_11176026 Ga0207698_111760261 156
24 3300032126 Ga0307415_100296597 Ga0307415_1002965972 156
25 3300049585 Ga0501069_0435329 Ga0501069_0435329_47_565 156
26 3300005347 Ga0070668_100145405 Ga0070668_1001454051 157
27 3300005356 Ga0070674_100716824 Ga0070674_1007168242 157
28 3300005617 Ga0068859_101269473 Ga0068859_1012694731 157
29 3300005840 Ga0068870_11045159 Ga0068870_110451591 157
30 3300005844 Ga0068862_100481751 Ga0068862_1004817512 157
31 3300006353 Ga0075370_10276290 Ga0075370_102762902 157
32 3300006880 Ga0075429_101236216 Ga0075429_1012362161 157
33 3300006931 Ga0097620_101269513 Ga0097620_1012695131 157
34 3300010375 Ga0105239_11654658 Ga0105239_116546581 157
35 3300010375 Ga0105239_12273241 Ga0105239_122732411 157
36 3300011119 Ga0105246_10324616 Ga0105246_103246162 157
37 3300014325 Ga0163163_11013229 Ga0163163_110132291 157
38 3300017792 Ga0163161_10298534 Ga0163161_102985342 157
39 3300021384 Ga0213876_10002782 Ga0213876_100027827 157
40 3300025908 Ga0207643_10004944 Ga0207643_100049442 157
41 3300025935 Ga0207709_10164080 Ga0207709_101640802 157
42 3300025942 Ga0207689_10136945 Ga0207689_101369452 157
43 3300025972 Ga0207668_10160886 Ga0207668_101608862 157
44 3300031901 Ga0307406_10147290 Ga0307406_101472903 157
45 3300032005 Ga0307411_10695523 Ga0307411_106955232 157
46 3300037853 Ga0436364_1072071 Ga0436364_1072071_198_695 157
47 3300039437 Ga0436365_1272860 Ga0436365_1272860_23901_24410 157
48 3300039450 Ga0436363_1041115 Ga0436363_1041115_216_725 157
49 3300039453 Ga0436362_0098915 Ga0436362_0098915_3316_3825 157
50 3300041452 Ga0451793_1168289 Ga0451793_1168289_22_495 157
51 3300041458 Ga0451798_0889358 Ga0451798_0889358_49_567 157
52 3300048924 Ga0496121_0258504 Ga0496121_0258504_706_1179 157
53 3300050496 nmdc:mga07m45_322575_c1 nmdc:mga07m45_322575_c1_302_796 157
54 3300050508 nmdc:mga09592_298197_c1 nmdc:mga09592_298197_c1_735_1253 157
55 3300053109 Ga0500569_023926 Ga0500569_023926_707_1201 157
56 3300009174 Ga0105241_10420292 Ga0105241_104202922 158
57 3300026088 Ga0207641_10948065 Ga0207641_109480652 158
58 3300039437 Ga0436365_1145349 Ga0436365_1145349_904_1500 158
59 3300046538 Ga0495609_0230566 Ga0495609_0230566_210_728 158
60 3300047472 Ga0495686_0126699 Ga0495686_0126699_336_854 158
61 3300005456 Ga0070678_100990004 Ga0070678_1009900041 159
62 3300026121 Ga0207683_10866877 Ga0207683_108668771 159
63 3300046794 Ga0495589_0190294 Ga0495589_0190294_372_893 159
64 3300053093 Ga0500651_0111687 Ga0500651_0111687_467_961 159
65 3300010375 Ga0105239_12279171 Ga0105239_122791711 160
66 iso_pu_bacteria 2507262055 2507511960 160
67 iso_pu_bacteria 2508501009 2508545623 160
68 iso_pu_bacteria 2508501042 2508694437 160
69 iso_pu_bacteria 2511231028 2511398051 160
70 iso_pu_bacteria 2513237092 2513627414 160
71 iso_pu_bacteria 2513237095 2513651019 160
72 iso_pu_bacteria 2513237102 2513699450 160
73 iso_pu_bacteria 2513237139 2513874421 160
74 iso_pu_bacteria 2515154112 2515624635 160
75 iso_pu_bacteria 2617270735 2617349710 160
76 iso_pu_bacteria 2617270741 2617376888 160
77 iso_pu_bacteria 2802429603 2805921015 160
78 iso_pu_bacteria 2824617872 2824625762 160
79 iso_pu_bacteria 2824626560 2824633317 160
80 iso_pu_bacteria 2824635225 2824642215 160
81 iso_pu_bacteria 2824644064 2824649563 160
82 iso_pu_bacteria 2824653114 2824660495 160
83 iso_pu_bacteria 2824661429 2824670887 160
84 iso_pu_bacteria 2824671348 2824674323 160
85 iso_pu_bacteria 2824679649 2824686392 160
86 iso_pu_bacteria 2824687955 2824690821 160
87 iso_pu_bacteria 2824696289 2824700252 160
88 iso_pu_bacteria 2824704595 2824711821 160
89 iso_pu_bacteria 2824714736 2824721721 160
90 iso_pu_bacteria 2824723954 2824731573 160
91 iso_pu_bacteria 2824732956 2824739750 160
92 iso_pu_bacteria 2824746037 2824751342 160
93 iso_pu_bacteria 2824753945 2824763133 160
94 iso_pu_bacteria 2824763712 2824771252 160
95 iso_pu_bacteria 2824773399 2824776915 160
96 iso_pu_bacteria 2838122688 2838128466 160
97 iso_pu_bacteria 2841941048 2841942326 160
98 iso_pu_bacteria 2841957949 2841960879 160
99 iso_pu_bacteria 2841983080 2841984340 160
100 iso_pu_bacteria 2844315083 2844321182 160
101 iso_pu_bacteria 2847930680 2847932233 160
102 iso_pu_bacteria 2847939898 2847943464 160
103 iso_pu_bacteria 2849076700 2849077182 160
104 iso_pu_bacteria 2857509624 2857515242 160
105 iso_pu_bacteria 2874590934 2874592155 160
106 iso_pu_bacteria 2874612657 2874617855 160
107 iso_pu_bacteria 2874628541 2874630899 160
108 iso_pu_bacteria 2874645413 2874646989 160
109 iso_pu_bacteria 2876761206 2876767506 160
110 iso_pu_bacteria 2876771140 2876772366 160
111 iso_pu_bacteria 2876818435 2876819635 160
112 iso_pu_bacteria 2879074833 2879076210 160
113 iso_pu_bacteria 2879083081 2879089362 160
114 iso_pu_bacteria 2879099564 2879106366 160
115 iso_pu_bacteria 2879127579 2879132610 160
116 iso_pu_bacteria 2879142872 2879144680 160
117 iso_pu_bacteria 2881364244 2881371058 160
118 iso_pu_bacteria 2881665667 2881669166 160
119 iso_pu_bacteria 2885366525 2885373986 160
120 iso_pu_bacteria 2885409591 2885412414 160
121 iso_pu_bacteria 2888378607 2888387464 160
122 iso_pu_bacteria 2888388044 2888391724 160
123 iso_pu_bacteria 2888419890 2888426697 160
124 iso_pu_bacteria 2903727486 2903728606 160
125 iso_pu_bacteria 2904711408 2904713760 160
126 iso_pu_bacteria 2906602504 2906607797 160
127 iso_pu_bacteria 2906626472 2906630088 160
128 iso_pu_bacteria 2906643746 2906651776 160
129 iso_pu_bacteria 2908775508 2908782786 160
130 iso_pu_bacteria 2922368715 2922370463 160
131 iso_pu_bacteria 2922393267 2922396516 160
132 iso_pu_bacteria 2929615660 2929620046 160
133 iso_pu_bacteria 2929624759 2929629359 160
134 iso_pu_bacteria 2932784394 2932789511 160
135 iso_pu_bacteria 2932794094 2932796814 160
136 iso_pu_bacteria 2932801729 2932802408 160
137 iso_pu_bacteria 2932809354 2932814982 160
138 iso_pu_bacteria 2932818245 2932824161 160
139 iso_pu_bacteria 2932828146 2932834111 160
140 iso_pu_bacteria 2933577622 2933581964 160
141 iso_pu_bacteria 2935608549 2935613401 160
142 iso_pu_bacteria 2935616580 2935623499 160
143 iso_pu_bacteria 2935638405 2935644867 160
144 iso_pu_bacteria 2935648319 2935653719 160
145 iso_pu_bacteria 2935656913 2935662468 160
146 iso_pu_bacteria 2935665750 2935671935 160
147 iso_pu_bacteria 2935675223 2935683137 160
148 iso_pu_bacteria 2935684952 2935689305 160
149 iso_pu_bacteria 2935694250 2935697435 160
150 iso_pu_bacteria 2935703347 2935711010 160
151 iso_pu_bacteria 2935713505 2935720251 160
152 iso_pu_bacteria 2935722832 2935728132 160
153 iso_pu_bacteria 2935732158 2935737271 160
154 iso_pu_bacteria 2935741537 2935746668 160
155 iso_pu_bacteria 2935750917 2935757635 160
156 iso_pu_bacteria 2935760218 2935764011 160
157 iso_pu_bacteria 2935801545 2935808599 160
158 iso_pu_bacteria 2935810662 2935817396 160
159 iso_pu_bacteria 2935819856 2935824746 160
160 iso_pu_bacteria 2935827899 2935834287 160
161 iso_pu_bacteria 2935837841 2935844870 160
162 iso_pu_bacteria 2935847175 2935851966 160
163 iso_pu_bacteria 2935855204 2935861894 160
164 iso_pu_bacteria 2935864058 2935868471 160
165 iso_pu_bacteria 2935873716 2935879245 160
166 iso_pu_bacteria 2935883170 2935887156 160
167 iso_pu_bacteria 2935908558 2935911314 160
168 iso_pu_bacteria 2935916978 2935920846 160
169 iso_pu_bacteria 2935926038 2935928343 160
170 iso_pu_bacteria 2935934488 2935937988 160
171 iso_pu_bacteria 2935942939 2935945270 160
172 iso_pu_bacteria 2935951376 2935954224 160
173 iso_pu_bacteria 2935967501 2935971508 160
174 iso_pu_bacteria 2935975950 2935982126 160
175 iso_pu_bacteria 2935984226 2935990533 160
176 iso_pu_bacteria 2935992306 2935998588 160
177 iso_pu_bacteria 2936002035 2936008951 160
178 iso_pu_bacteria 2936011229 2936016884 160
179 iso_pu_bacteria 2936019824 2936025517 160
180 iso_pu_bacteria 2936028420 2936034245 160
181 iso_pu_bacteria 2936037263 2936044193 160
182 iso_pu_bacteria 2936046547 2936052302 160
183 iso_pu_bacteria 2936055302 2936060581 160
184 iso_pu_bacteria 2940556831 2940563543 160
185 iso_pu_bacteria 2941538514 2941545236 160
186 iso_pu_bacteria 3005483717 3005490269 160
187 iso_pu_bacteria 3005587118 3005591638 160
188 iso_pu_bacteria 3005594810 3005601512 160
189 iso_pu_bacteria 3005718088 3005724213 160
190 iso_pu_bacteria 8006926726 8006928123 160
191 iso_pu_bacteria 8016583857 8016587891 160
192 iso_pu_bacteria 8016630954 8016637102 160
193 iso_pu_bacteria 8017057580 8017066123 160
194 iso_pu_bacteria 8019576017 8019578507 160
195 iso_pu_bacteria 8019586578 8019596554 160
196 iso_pu_bacteria 8019597564 8019605150 160
197 iso_pu_bacteria 8019608314 8019613391 160
198 iso_pu_bacteria 8019619141 8019624068 160
199 iso_pu_bacteria 8019629233 8019637960 160
200 iso_pu_bacteria 8019638758 8019641668 160
201 iso_pu_bacteria 8019668869 8019675411 160
202 iso_pu_bacteria 8019687851 8019695077 160
203 iso_pu_bacteria 8055742211 8055750201 160
204 iso_pu_bacteria 8056967851 8056975979 160
205 3300035086 Ga0373934_0009704 Ga0373934_0009704_851_1339 161
206 3300035117 Ga0373953_0022892 Ga0373953_0022892_169_657 161
207 3300035118 Ga0373954_0011571 Ga0373954_0011571_1731_2219 161
208 3300035119 Ga0373956_0140481 Ga0373956_0140481_153_641 161
209 3300035120 Ga0373957_0031808 Ga0373957_0031808_948_1436 161
210 3300035172 Ga0373955_0015334 Ga0373955_0015334_847_1335 161
211 3300035410 Ga0373924_0006000 Ga0373924_0006000_1285_1773 161
212 3300035724 Ga0373933_0021248 Ga0373933_0021248_2123_2611 161
213 3300036401 Ga0373937_0073767 Ga0373937_0073767_2633_3121 161
214 3300046454 Ga0495592_0025512 Ga0495592_0025512_1251_1739 161
215 3300046459 Ga0495629_0013615 Ga0495629_0013615_1372_1860 161
216 3300046462 Ga0495651_0029933 Ga0495651_0029933_1577_2065 161
217 3300046463 Ga0495653_0036044 Ga0495653_0036044_1489_1977 161
218 3300046476 Ga0495662_0390799 Ga0495662_0390799_50_538 161
219 3300046511 Ga0495608_0018003 Ga0495608_0018003_3397_3885 161
220 3300046516 Ga0495628_0084347 Ga0495628_0084347_1204_1692 161
221 3300046529 Ga0495652_0034292 Ga0495652_0034292_3364_3852 161
222 3300046533 Ga0495640_0020771 Ga0495640_0020771_1882_2370 161
223 3300046536 Ga0495587_0027969 Ga0495587_0027969_2372_2860 161
224 3300046559 Ga0495667_0148129 Ga0495667_0148129_28_516 161
225 3300046663 Ga0495635_0004740 Ga0495635_0004740_4665_5153 161
226 3300046675 Ga0495657_0040814 Ga0495657_0040814_1951_2439 161
227 3300046678 Ga0495599_0009114 Ga0495599_0009114_2057_2545 161
228 3300046679 Ga0495623_0027272 Ga0495623_0027272_2445_2933 161
229 3300046680 Ga0495646_0101174 Ga0495646_0101174_599_1087 161
230 3300046809 Ga0495600_0016248 Ga0495600_0016248_1399_1887 161
231 3300047317 Ga0495604_0073874 Ga0495604_0073874_1422_1910 161
232 3300047319 Ga0495674_0155440 Ga0495674_0155440_213_701 161
233 3300047322 Ga0495680_0046199 Ga0495680_0046199_1951_2439 161
234 3300047444 Ga0495675_0017312 Ga0495675_0017312_1707_2195 161
235 3300047471 Ga0495684_0009966 Ga0495684_0009966_3988_4476 161
236 3300047673 Ga0495593_0013827 Ga0495593_0013827_1497_1985 161
237 3300048088 Ga0495602_0031668 Ga0495602_0031668_3705_4193 161
238 3300050494 nmdc:mga06z11_128769_c1 nmdc:mga06z11_128769_c1_15_500 161
239 3300053077 Ga0495601_0090645 Ga0495601_0090645_613_1101 161
240 3300053084 Ga0495595_0015913 Ga0495595_0015913_1701_2189 161
241 3300053085 Ga0495619_0012111 Ga0495619_0012111_3260_3748 161
242 3300053140 Ga0500573_0440813 Ga0500573_0440813_11_499 161
243 iso_pu_bacteria 2524023210 2524470877 161
244 iso_pu_bacteria 2643221651 2644289845 161
245 iso_pu_bacteria 2885383462 2885390961 161
246 iso_pu_bacteria 2903768456 2903776564 161
247 iso_pu_bacteria 8006984368 8006989833 161
248 3300005329 Ga0070683_100200130 Ga0070683_1002001302 162
249 3300006177 Ga0075362_10071498 Ga0075362_100714982 162
250 3300006353 Ga0075370_10024162 Ga0075370_100241622 162
251 3300050489 nmdc:mga03683_174577_c1 nmdc:mga03683_174577_c1_248_739 162
252 3300050490 nmdc:mga03n38_134724_c1 nmdc:mga03n38_134724_c1_255_746 162
253 3300050495 nmdc:mga04h51_41115_c1 nmdc:mga04h51_41115_c1_32_523 162
254 3300050496 nmdc:mga07m45_239371_c1 nmdc:mga07m45_239371_c1_435_926 162
255 3300050496 nmdc:mga07m45_70799_c1 nmdc:mga07m45_70799_c1_1267_1758 162
256 3300005336 Ga0070680_100210780 Ga0070680_1002107802 163
257 3300005458 Ga0070681_10576844 Ga0070681_105768441 163
258 3300025912 Ga0207707_10163382 Ga0207707_101633822 163
259 3300026116 Ga0207674_10710059 Ga0207674_107100592 163
260 3300003215 JGI25153J46596_10003975 JGI25153J46596_100039759 164
261 3300003215 JGI25153J46596_10016779 JGI25153J46596_100167791 164
262 3300003354 JGI25160J50197_1003036 JGI25160J50197_10030369 164
263 3300003763 Ga0055529_1039971 Ga0055529_10399711 164
264 3300005548 Ga0070665_100169276 Ga0070665_1001692762 164
265 3300005548 Ga0070665_100183895 Ga0070665_1001838953 164
266 3300005614 Ga0068856_100450631 Ga0068856_1004506312 164
267 3300005616 Ga0068852_100035224 Ga0068852_1000352242 164
268 3300005616 Ga0068852_100099846 Ga0068852_1000998462 164
269 3300005843 Ga0068860_100000367 Ga0068860_10000036743 164
270 3300005983 Ga0081540_1009361 Ga0081540_10093612 164
271 3300006038 Ga0075365_10044781 Ga0075365_100447813 164
272 3300006051 Ga0075364_10433616 Ga0075364_104336162 164
273 3300006178 Ga0075367_10924306 Ga0075367_109243061 164
274 3300006186 Ga0075369_10322707 Ga0075369_103227072 164
275 3300006942 Ga0099824_1031414 Ga0099824_10314142 164
276 3300006943 Ga0099822_1070392 Ga0099822_10703921 164
277 3300006944 Ga0099823_1016181 Ga0099823_10161819 164
278 3300006944 Ga0099823_1099633 Ga0099823_10996332 164
279 3300009093 Ga0105240_10097539 Ga0105240_100975392 164
280 3300009101 Ga0105247_10155100 Ga0105247_101551002 164
281 3300009148 Ga0105243_10163960 Ga0105243_101639601 164
282 3300009174 Ga0105241_10022979 Ga0105241_100229793 164
283 3300009174 Ga0105241_10071503 Ga0105241_100715033 164
284 3300009545 Ga0105237_10036086 Ga0105237_100360862 164
285 3300009545 Ga0105237_10180282 Ga0105237_101802823 164
286 3300009551 Ga0105238_10441472 Ga0105238_104414722 164
287 3300011119 Ga0105246_10062491 Ga0105246_100624912 164
288 3300013296 Ga0157374_10098280 Ga0157374_100982803 164
289 3300013306 Ga0163162_10416075 Ga0163162_104160752 164
290 3300014325 Ga0163163_10107040 Ga0163163_101070402 164
291 3300014745 Ga0157377_10469638 Ga0157377_104696381 164
292 3300015265 Ga0182005_1091804 Ga0182005_10918042 164
293 3300021320 Ga0214544_1000007 Ga0214544_1000007348 164
294 3300021321 Ga0214542_1000007 Ga0214542_100000733 164
295 3300021324 Ga0214545_1000006 Ga0214545_1000006259 164
296 3300021327 Ga0214543_1000009 Ga0214543_1000009348 164
297 3300025261 Ga0209233_1008190 Ga0209233_10081902 164
298 3300025261 Ga0209233_1058459 Ga0209233_10584592 164
299 3300025272 Ga0209455_1030912 Ga0209455_10309122 164
300 3300025295 Ga0209564_1009562 Ga0209564_10095622 164
301 3300025297 Ga0209758_1001332 Ga0209758_100133220 164
302 3300025297 Ga0209758_1005029 Ga0209758_10050297 164
303 3300025297 Ga0209758_1006626 Ga0209758_10066267 164
304 3300025302 Ga0207426_1000500 Ga0207426_100050034 164
305 3300025302 Ga0207426_1002368 Ga0207426_10023689 164
306 3300025908 Ga0207643_10519980 Ga0207643_105199802 164
307 3300025911 Ga0207654_10042969 Ga0207654_100429692 164
308 3300025913 Ga0207695_10000123 Ga0207695_10000123101 164
309 3300025916 Ga0207663_10631438 Ga0207663_106314381 164
310 3300025923 Ga0207681_10518018 Ga0207681_105180182 164
311 3300025927 Ga0207687_10190187 Ga0207687_101901872 164
312 3300025933 Ga0207706_10405394 Ga0207706_104053942 164
313 3300026067 Ga0207678_10070878 Ga0207678_100708782 164
314 3300026142 Ga0207698_10067853 Ga0207698_100678532 164
315 3300027296 Ga0209389_1000019 Ga0209389_1000019138 164
316 3300027296 Ga0209389_1000070 Ga0209389_100007055 164
317 3300027357 Ga0209589_1000420 Ga0209589_100042011 164
318 3300027361 Ga0209489_100033 Ga0209489_100033137 164
319 3300027361 Ga0209489_100196 Ga0209489_10019657 164
320 3300028379 Ga0268266_10199329 Ga0268266_101993292 164
321 3300028381 Ga0268264_10000042 Ga0268264_10000042304 164
322 3300037418 Ga0395900_0360121 Ga0395900_0360121_543_1037 164
323 3300037471 Ga0395905_0004875 Ga0395905_0004875_10224_10718 164
324 3300037471 Ga0395905_0012983 Ga0395905_0012983_1808_2302 164
325 3300037471 Ga0395905_0744728 Ga0395905_0744728_55_549 164
326 3300038443 Ga0395901_0102845 Ga0395901_0102845_373_867 164
327 3300038443 Ga0395901_1078356 Ga0395901_1078356_157_651 164
328 3300039437 Ga0436365_0066782 Ga0436365_0066782_305_799 164
329 3300039437 Ga0436365_1058179 Ga0436365_1058179_87_581 164
330 3300041441 Ga0451787_264771 Ga0451787_264771_63_557 164
331 3300041498 Ga0451841_0822327 Ga0451841_0822327_325_819 164
332 3300041512 Ga0451853_0828513 Ga0451853_0828513_361_855 164
333 3300044658 Ga0466972_0290874 Ga0466972_0290874_50_544 164
334 3300044658 Ga0466972_0434317 Ga0466972_0434317_84_578 164
335 3300044683 Ga0466965_0008749 Ga0466965_0008749_2579_3073 164
336 3300044735 Ga0466968_0044536 Ga0466968_0044536_743_1237 164
337 3300044765 Ga0466970_0174738 Ga0466970_0174738_382_876 164
338 3300044901 Ga0466960_0766001 Ga0466960_0766001_76_570 164
339 3300045836 Ga0466958_0692538 Ga0466958_0692538_78_572 164
340 3300045976 Ga0466967_0050670 Ga0466967_0050670_16_510 164
341 3300046460 Ga0495638_0023174 Ga0495638_0023174_2308_2802 164
342 3300046474 Ga0495605_0029311 Ga0495605_0029311_1995_2489 164
343 3300046492 Ga0495585_0045326 Ga0495585_0045326_1529_2023 164
344 3300046522 Ga0495643_0004848 Ga0495643_0004848_5238_5732 164
345 3300046522 Ga0495643_0026039 Ga0495643_0026039_1225_1719 164
346 3300046524 Ga0495648_0066129 Ga0495648_0066129_395_889 164
347 3300046524 Ga0495648_0133827 Ga0495648_0133827_483_977 164
348 3300046542 Ga0495597_0041294 Ga0495597_0041294_1050_1544 164
349 3300046616 Ga0495668_0034954 Ga0495668_0034954_1004_1498 164
350 3300046660 Ga0495625_0241269 Ga0495625_0241269_327_821 164
351 3300046694 Ga0495649_0015741 Ga0495649_0015741_2184_2678 164
352 3300046694 Ga0495649_0162971 Ga0495649_0162971_168_662 164
353 3300046794 Ga0495589_0063663 Ga0495589_0063663_148_642 164
354 3300047323 Ga0495683_0027253 Ga0495683_0027253_397_891 164
355 3300047472 Ga0495686_0077492 Ga0495686_0077492_528_1022 164
356 3300047472 Ga0495686_0283526 Ga0495686_0283526_215_709 164
357 3300048904 Ga0496101_0729660 Ga0496101_0729660_238_732 164
358 3300048905 Ga0496102_0038354 Ga0496102_0038354_59_553 164
359 3300048906 Ga0496103_0004501 Ga0496103_0004501_5305_5799 164
360 3300048907 Ga0496104_0691846 Ga0496104_0691846_279_773 164
361 3300048908 Ga0496105_0114313 Ga0496105_0114313_37_531 164
362 3300048909 Ga0496106_0656786 Ga0496106_0656786_143_637 164
363 3300048912 Ga0496109_0112472 Ga0496109_0112472_1884_2378 164
364 3300048913 Ga0496110_0383155 Ga0496110_0383155_550_1044 164
365 3300048913 Ga0496110_0940505 Ga0496110_0940505_144_638 164
366 3300048914 Ga0496111_0744225 Ga0496111_0744225_172_666 164
367 3300048915 Ga0496112_0022619 Ga0496112_0022619_368_862 164
368 3300048916 Ga0496113_0012118 Ga0496113_0012118_5143_5637 164
369 3300048918 Ga0496115_0318838 Ga0496115_0318838_331_825 164
370 3300048919 Ga0496116_0061378 Ga0496116_0061378_69_563 164
371 3300048920 Ga0496117_0059165 Ga0496117_0059165_765_1259 164
372 3300048920 Ga0496117_0280598 Ga0496117_0280598_237_731 164
373 3300048921 Ga0496118_0091384 Ga0496118_0091384_79_573 164
374 3300048921 Ga0496118_0109252 Ga0496118_0109252_141_635 164
375 3300048922 Ga0496119_0141737 Ga0496119_0141737_297_791 164
376 3300048922 Ga0496119_0234809 Ga0496119_0234809_99_593 164
377 3300048922 Ga0496119_0291122 Ga0496119_0291122_98_592 164
378 3300048923 Ga0496120_0261752 Ga0496120_0261752_105_599 164
379 3300048924 Ga0496121_0398086 Ga0496121_0398086_110_604 164
380 3300048927 Ga0496124_0097302 Ga0496124_0097302_742_1236 164
381 3300048928 Ga0496125_0066546 Ga0496125_0066546_631_1125 164
382 3300049460 Ga0495682_0025675 Ga0495682_0025675_567_1061 164
383 3300049570 Ga0501033_0203626 Ga0501033_0203626_319_813 164
384 3300049572 Ga0501036_0638273 Ga0501036_0638273_313_807 164
385 3300049574 Ga0501038_0588485 Ga0501038_0588485_257_751 164
386 3300049575 Ga0501039_0990388 Ga0501039_0990388_122_616 164
387 3300049823 Ga0501044_0079839 Ga0501044_0079839_1208_1702 164
388 3300050492 nmdc:mga0yw44_36135_c1 nmdc:mga0yw44_36135_c1_1574_2068 164
389 3300050492 nmdc:mga0yw44_690365_c1 nmdc:mga0yw44_690365_c1_156_650 164
390 3300050493 nmdc:mga0k408_214694_c1 nmdc:mga0k408_214694_c1_181_675 164
391 3300050493 nmdc:mga0k408_61570_c1 nmdc:mga0k408_61570_c1_838_1332 164
392 3300050495 nmdc:mga04h51_88470_c1 nmdc:mga04h51_88470_c1_43_537 164
393 3300050496 nmdc:mga07m45_141838_c1 nmdc:mga07m45_141838_c1_567_1061 164
394 3300050496 nmdc:mga07m45_43829_c1 nmdc:mga07m45_43829_c1_553_1047 164
395 3300050496 nmdc:mga07m45_66829_c1 nmdc:mga07m45_66829_c1_1484_1978 164
396 3300050516 nmdc:mga0sz30_105824_c1 nmdc:mga0sz30_105824_c1_402_896 164
397 3300050516 nmdc:mga0sz30_139620_c1 nmdc:mga0sz30_139620_c1_561_1055 164
398 3300053079 Ga0500610_0250074 Ga0500610_0250074_49_543 164
399 3300053080 Ga0500635_0017554 Ga0500635_0017554_413_907 164
400 3300053083 Ga0495655_0028161 Ga0495655_0028161_390_884 164
401 3300053086 Ga0500578_0198420 Ga0500578_0198420_246_740 164
402 3300053087 Ga0500643_000013 Ga0500643_000013_283845_284339 164
403 3300053091 Ga0500647_0231044 Ga0500647_0231044_19_513 164
404 3300053092 Ga0500583_0056880 Ga0500583_0056880_1135_1629 164
405 3300053094 Ga0500566_0001097 Ga0500566_0001097_3636_4130 164
406 3300053095 Ga0500640_022449 Ga0500640_022449_1946_2440 164
407 3300053103 Ga0500555_005971 Ga0500555_005971_1901_2395 164
408 3300053104 Ga0500556_0039804 Ga0500556_0039804_356_850 164
409 3300053105 Ga0500557_000030 Ga0500557_000030_42424_42918 164
410 3300053108 Ga0500562_006360 Ga0500562_006360_899_1393 164
411 3300053109 Ga0500569_177594 Ga0500569_177594_135_629 164
412 3300053111 Ga0500572_012340 Ga0500572_012340_1391_1885 164
413 3300053121 Ga0500607_025594 Ga0500607_025594_1297_1791 164
414 3300053122 Ga0500608_022223 Ga0500608_022223_1794_2288 164
415 3300053130 Ga0500642_0000383 Ga0500642_0000383_12847_13341 164
416 3300053130 Ga0500642_0028004 Ga0500642_0028004_698_1192 164
417 3300053133 Ga0500655_032876 Ga0500655_032876_390_884 164
418 3300053136 Ga0500559_0063419 Ga0500559_0063419_1027_1521 164
419 3300053136 Ga0500559_0396141 Ga0500559_0396141_18_512 164
420 3300053138 Ga0500564_046420 Ga0500564_046420_654_1148 164
421 3300053140 Ga0500573_0239073 Ga0500573_0239073_390_884 164
422 3300053146 Ga0500588_0052558 Ga0500588_0052558_360_854 164
423 3300053148 Ga0500590_236454 Ga0500590_236454_74_568 164
424 3300053156 Ga0500622_0038670 Ga0500622_0038670_1442_1936 164
425 3300053157 Ga0500624_005683 Ga0500624_005683_258_752 164
426 3300053163 Ga0500639_129909 Ga0500639_129909_684_1178 164
427 3300053177 Ga0500636_0001605 Ga0500636_0001605_5081_5575 164
428 3300053177 Ga0500636_0020415 Ga0500636_0020415_2977_3474 164
429 3300053178 Ga0500637_0266197 Ga0500637_0266197_432_926 164
430 3300053729 Ga0500625_093427 Ga0500625_093427_58_552 164
431 3300053731 Ga0500609_003839 Ga0500609_003839_268_762 164
432 3300053736 Ga0500599_005210 Ga0500599_005210_368_862 164
433 3300053737 Ga0500601_000369 Ga0500601_000369_5596_6090 164
434 3300053737 Ga0500601_044490 Ga0500601_044490_19_513 164
435 3300003659 JGI25404J52841_10045704 JGI25404J52841_100457041 165
436 3300005434 Ga0070709_10308962 Ga0070709_103089622 165
437 3300005434 Ga0070709_10866062 Ga0070709_108660621 165
438 3300005435 Ga0070714_101512203 Ga0070714_1015122032 165
439 3300005456 Ga0070678_100140700 Ga0070678_1001407002 165
440 3300005456 Ga0070678_100533455 Ga0070678_1005334551 165
441 3300005458 Ga0070681_10120889 Ga0070681_101208892 165
442 3300005530 Ga0070679_100355837 Ga0070679_1003558372 165
443 3300005548 Ga0070665_101748841 Ga0070665_1017488412 165
444 3300005563 Ga0068855_100106562 Ga0068855_1001065622 165
445 3300005614 Ga0068856_101738401 Ga0068856_1017384012 165
446 3300005617 Ga0068859_101918619 Ga0068859_1019186192 165
447 3300005842 Ga0068858_100136471 Ga0068858_1001364712 165
448 3300005983 Ga0081540_1017980 Ga0081540_10179802 165
449 3300006048 Ga0075363_100216706 Ga0075363_1002167062 165
450 3300006048 Ga0075363_100320648 Ga0075363_1003206481 165
451 3300006175 Ga0070712_100696505 Ga0070712_1006965052 165
452 3300006177 Ga0075362_10084236 Ga0075362_100842362 165
453 3300006195 Ga0075366_10095291 Ga0075366_100952913 165
454 3300006871 Ga0075434_100733678 Ga0075434_1007336782 165
455 3300006914 Ga0075436_100709886 Ga0075436_1007098861 165
456 3300006931 Ga0097620_101917685 Ga0097620_1019176851 165
457 3300009093 Ga0105240_10257634 Ga0105240_102576343 165
458 3300009098 Ga0105245_10153537 Ga0105245_101535372 165
459 3300009101 Ga0105247_10017288 Ga0105247_100172882 165
460 3300009148 Ga0105243_11274174 Ga0105243_112741741 165
461 3300009174 Ga0105241_10357440 Ga0105241_103574402 165
462 3300009174 Ga0105241_10528139 Ga0105241_105281392 165
463 3300009176 Ga0105242_10092057 Ga0105242_100920573 165
464 3300009176 Ga0105242_10571422 Ga0105242_105714222 165
465 3300009177 Ga0105248_10272253 Ga0105248_102722532 165
466 3300009177 Ga0105248_10713352 Ga0105248_107133522 165
467 3300009551 Ga0105238_10363603 Ga0105238_103636032 165
468 3300009551 Ga0105238_10381016 Ga0105238_103810162 165
469 3300009551 Ga0105238_10806522 Ga0105238_108065222 165
470 3300010375 Ga0105239_10345144 Ga0105239_103451443 165
471 3300013104 Ga0157370_10117616 Ga0157370_101176162 165
472 3300013297 Ga0157378_10068602 Ga0157378_100686022 165
473 3300013306 Ga0163162_10163256 Ga0163162_101632562 165
474 3300013306 Ga0163162_11138511 Ga0163162_111385112 165
475 3300013307 Ga0157372_10174205 Ga0157372_101742052 165
476 3300013307 Ga0157372_10655539 Ga0157372_106555392 165
477 3300013308 Ga0157375_10113699 Ga0157375_101136992 165
478 3300013308 Ga0157375_11409464 Ga0157375_114094641 165
479 3300013308 Ga0157375_12236816 Ga0157375_122368161 165
480 3300014325 Ga0163163_10062643 Ga0163163_100626432 165
481 3300014325 Ga0163163_10239356 Ga0163163_102393562 165
482 3300014325 Ga0163163_10433885 Ga0163163_104338852 165
483 3300014326 Ga0157380_10674945 Ga0157380_106749452 165
484 3300020082 Ga0206353_11199008 Ga0206353_111990082 165
485 3300021384 Ga0213876_10206921 Ga0213876_102069212 165
486 3300025253 Ga0209677_101642 Ga0209677_1016428 165
487 3300025272 Ga0209455_1012975 Ga0209455_10129752 165
488 3300025297 Ga0209758_1114322 Ga0209758_11143221 165
489 3300025899 Ga0207642_10368731 Ga0207642_103687312 165
490 3300025906 Ga0207699_10347838 Ga0207699_103478382 165
491 3300025911 Ga0207654_10024849 Ga0207654_100248493 165
492 3300025913 Ga0207695_10260343 Ga0207695_102603432 165
493 3300025915 Ga0207693_10599361 Ga0207693_105993612 165
494 3300025921 Ga0207652_10098834 Ga0207652_100988342 165
495 3300025924 Ga0207694_10475199 Ga0207694_104751992 165
496 3300025934 Ga0207686_10307016 Ga0207686_103070162 165
497 3300025935 Ga0207709_10889825 Ga0207709_108898251 165
498 3300025941 Ga0207711_10177015 Ga0207711_101770152 165
499 3300025949 Ga0207667_10022298 Ga0207667_100222988 165
500 3300025986 Ga0207658_10185974 Ga0207658_101859742 165
501 3300026041 Ga0207639_10177248 Ga0207639_101772482 165
502 3300026041 Ga0207639_10363851 Ga0207639_103638512 165
503 3300026078 Ga0207702_11104669 Ga0207702_111046692 165
504 3300026078 Ga0207702_11368565 Ga0207702_113685651 165
505 3300026088 Ga0207641_10185125 Ga0207641_101851252 165
506 3300026121 Ga0207683_10181102 Ga0207683_101811023 165
507 3300026142 Ga0207698_10761890 Ga0207698_107618901 165
508 3300027512 Ga0209179_1003083 Ga0209179_10030833 165
509 3300028379 Ga0268266_10760568 Ga0268266_107605682 165
510 3300028573 Ga0265334_10107696 Ga0265334_101076961 165
511 3300028577 Ga0265318_10165207 Ga0265318_101652071 165
512 3300028666 Ga0265336_10000560 Ga0265336_1000056010 165
513 3300028786 Ga0307517_10326417 Ga0307517_103264172 165
514 3300028794 Ga0307515_10133021 Ga0307515_101330212 165
515 3300028800 Ga0265338_10000271 Ga0265338_1000027187 165
516 3300031247 Ga0265340_10005857 Ga0265340_100058575 165
517 3300031344 Ga0265316_10214867 Ga0265316_102148672 165
518 3300031456 Ga0307513_10193740 Ga0307513_101937402 165
519 3300031548 Ga0307408_100799426 Ga0307408_1007994261 165
520 3300031730 Ga0307516_10133801 Ga0307516_101338013 165
521 3300031730 Ga0307516_10161705 Ga0307516_101617052 165
522 3300031911 Ga0307412_10813577 Ga0307412_108135772 165
523 3300035089 Ga0373944_0106891 Ga0373944_0106891_99_596 165
524 3300035091 Ga0373951_0119604 Ga0373951_0119604_137_634 165
525 3300035112 Ga0373932_0021778 Ga0373932_0021778_251_748 165
526 3300035114 Ga0373939_0148781 Ga0373939_0148781_167_664 165
527 3300035171 Ga0373946_0328360 Ga0373946_0328360_79_576 165
528 3300035691 Ga0373931_0349698 Ga0373931_0349698_214_711 165
529 3300035692 Ga0373935_0183460 Ga0373935_0183460_83_580 165
530 3300035692 Ga0373935_0228053 Ga0373935_0228053_37_534 165
531 3300035695 Ga0373927_0004320 Ga0373927_0004320_8083_8580 165
532 3300035695 Ga0373927_0047393 Ga0373927_0047393_2201_2698 165
533 3300037068 Ga0373925_0167487 Ga0373925_0167487_430_927 165
534 3300037068 Ga0373925_0400779 Ga0373925_0400779_606_1103 165
535 3300037068 Ga0373925_1309624 Ga0373925_1309624_69_566 165
536 3300037312 Ga0395899_0273897 Ga0395899_0273897_640_1140 165
537 3300037418 Ga0395900_0178057 Ga0395900_0178057_926_1426 165
538 3300037466 Ga0395898_0165429 Ga0395898_0165429_260_757 165
539 3300037471 Ga0395905_0081127 Ga0395905_0081127_2449_2946 165
540 3300037853 Ga0436364_1201965 Ga0436364_1201965_598_1101 165
541 3300038443 Ga0395901_0007708 Ga0395901_0007708_36_536 165
542 3300038443 Ga0395901_0268958 Ga0395901_0268958_394_891 165
543 3300038443 Ga0395901_0325799 Ga0395901_0325799_718_1215 165
544 3300039437 Ga0436365_0024912 Ga0436365_0024912_2949_3446 165
545 3300039437 Ga0436365_0198024 Ga0436365_0198024_71_568 165
546 3300039437 Ga0436365_1083010 Ga0436365_1083010_24_521 165
547 3300039450 Ga0436363_1035359 Ga0436363_1035359_267_776 165
548 3300039450 Ga0436363_1501048 Ga0436363_1501048_1430_1927 165
549 3300041453 Ga0451797_0551223 Ga0451797_0551223_119_616 165
550 3300044684 Ga0466966_0513492 Ga0466966_0513492_89_586 165
551 3300044694 Ga0466963_0172797 Ga0466963_0172797_246_743 165
552 3300044694 Ga0466963_0686548 Ga0466963_0686548_187_684 165
553 3300044706 Ga0466964_0638306 Ga0466964_0638306_76_573 165
554 3300044719 Ga0466971_0095286 Ga0466971_0095286_266_763 165
555 3300044842 Ga0466957_0110450 Ga0466957_0110450_1159_1656 165
556 3300045836 Ga0466958_0148746 Ga0466958_0148746_905_1402 165
557 3300045976 Ga0466967_0105036 Ga0466967_0105036_448_945 165
558 3300046492 Ga0495585_0406931 Ga0495585_0406931_119_616 165
559 3300046519 Ga0495632_0352628 Ga0495632_0352628_57_554 165
560 3300046660 Ga0495625_0695905 Ga0495625_0695905_32_529 165
561 3300046680 Ga0495646_0447170 Ga0495646_0447170_134_631 165
562 3300047320 Ga0495672_0018431 Ga0495672_0018431_1562_2059 165
563 3300047320 Ga0495672_0227717 Ga0495672_0227717_68_568 165
564 3300047320 Ga0495672_0228158 Ga0495672_0228158_104_601 165
565 3300047469 Ga0495673_0025262 Ga0495673_0025262_2187_2684 165
566 3300047472 Ga0495686_0125430 Ga0495686_0125430_989_1489 165
567 3300047472 Ga0495686_0180845 Ga0495686_0180845_334_831 165
568 3300047472 Ga0495686_0535841 Ga0495686_0535841_28_525 165
569 3300048903 Ga0496100_0028982 Ga0496100_0028982_951_1448 165
570 3300048904 Ga0496101_0121111 Ga0496101_0121111_1418_1915 165
571 3300048905 Ga0496102_0028991 Ga0496102_0028991_1889_2386 165
572 3300048906 Ga0496103_0014170 Ga0496103_0014170_4195_4692 165
573 3300048906 Ga0496103_0082966 Ga0496103_0082966_586_1083 165
574 3300048907 Ga0496104_0025212 Ga0496104_0025212_1180_1677 165
575 3300048907 Ga0496104_0086445 Ga0496104_0086445_2022_2519 165
576 3300048907 Ga0496104_0152751 Ga0496104_0152751_1697_2194 165
577 3300048908 Ga0496105_0010472 Ga0496105_0010472_1737_2234 165
578 3300048909 Ga0496106_1004280 Ga0496106_1004280_15_512 165
579 3300048910 Ga0496107_0425198 Ga0496107_0425198_367_864 165
580 3300048911 Ga0496108_0383370 Ga0496108_0383370_132_629 165
581 3300048912 Ga0496109_0122962 Ga0496109_0122962_1864_2361 165
582 3300048912 Ga0496109_0417796 Ga0496109_0417796_723_1220 165
583 3300048913 Ga0496110_0049214 Ga0496110_0049214_1463_1960 165
584 3300048914 Ga0496111_0007510 Ga0496111_0007510_1441_1938 165
585 3300048914 Ga0496111_0203532 Ga0496111_0203532_38_535 165
586 3300048915 Ga0496112_0000023 Ga0496112_0000023_24433_24930 165
587 3300048915 Ga0496112_0007998 Ga0496112_0007998_2924_3421 165
588 3300048915 Ga0496112_0142462 Ga0496112_0142462_1156_1653 165
589 3300048916 Ga0496113_0005790 Ga0496113_0005790_1733_2230 165
590 3300048916 Ga0496113_0152914 Ga0496113_0152914_436_933 165
591 3300048917 Ga0496114_0040502 Ga0496114_0040502_3145_3642 165
592 3300048918 Ga0496115_0009886 Ga0496115_0009886_3554_4051 165
593 3300048919 Ga0496116_0132742 Ga0496116_0132742_796_1293 165
594 3300048921 Ga0496118_0011526 Ga0496118_0011526_5304_5801 165
595 3300048922 Ga0496119_0179815 Ga0496119_0179815_584_1081 165
596 3300048923 Ga0496120_0228428 Ga0496120_0228428_249_746 165
597 3300048924 Ga0496121_0032083 Ga0496121_0032083_2826_3323 165
598 3300048924 Ga0496121_0115792 Ga0496121_0115792_963_1463 165
599 3300048924 Ga0496121_0511767 Ga0496121_0511767_49_546 165
600 3300048925 Ga0496122_0233982 Ga0496122_0233982_144_641 165
601 3300048926 Ga0496123_0129961 Ga0496123_0129961_169_666 165
602 3300048927 Ga0496124_0321680 Ga0496124_0321680_566_1063 165
603 3300048928 Ga0496125_0000158 Ga0496125_0000158_7624_8121 165
604 3300048928 Ga0496125_0001222 Ga0496125_0001222_30408_30905 165
605 3300048928 Ga0496125_0146477 Ga0496125_0146477_216_713 165
606 3300048928 Ga0496125_0401690 Ga0496125_0401690_218_715 165
607 3300048929 Ga0496126_0001668 Ga0496126_0001668_3426_3923 165
608 3300048929 Ga0496126_0020931 Ga0496126_0020931_4962_5459 165
609 3300048929 Ga0496126_0305050 Ga0496126_0305050_501_998 165
610 3300049569 Ga0501032_0090827 Ga0501032_0090827_1438_1935 165
611 3300049569 Ga0501032_0147391 Ga0501032_0147391_629_1129 165
612 3300049569 Ga0501032_0231282 Ga0501032_0231282_447_944 165
613 3300049570 Ga0501033_0102788 Ga0501033_0102788_1274_1774 165
614 3300049570 Ga0501033_0579114 Ga0501033_0579114_170_667 165
615 3300049571 Ga0501034_1512917 Ga0501034_1512917_28_525 165
616 3300049572 Ga0501036_0282354 Ga0501036_0282354_23_523 165
617 3300049574 Ga0501038_0352460 Ga0501038_0352460_54_551 165
618 3300049579 Ga0501043_0949468 Ga0501043_0949468_33_530 165
619 3300049580 Ga0501046_0244336 Ga0501046_0244336_473_973 165
620 3300049581 Ga0501047_0016108 Ga0501047_0016108_6033_6530 165
621 3300049581 Ga0501047_0101596 Ga0501047_0101596_1444_1941 165
622 3300049581 Ga0501047_0110149 Ga0501047_0110149_585_1085 165
623 3300049582 Ga0501048_0038823 Ga0501048_0038823_1861_2361 165
624 3300049586 Ga0501070_0005564 Ga0501070_0005564_7721_8218 165
625 3300049586 Ga0501070_0208694 Ga0501070_0208694_377_877 165
626 3300049586 Ga0501070_0392522 Ga0501070_0392522_55_552 165
627 3300049590 Ga0501074_0009318 Ga0501074_0009318_6535_7032 165
628 3300049742 Ga0501080_0138025 Ga0501080_0138025_90_587 165
629 3300049823 Ga0501044_0173484 Ga0501044_0173484_779_1276 165
630 3300049823 Ga0501044_0393994 Ga0501044_0393994_238_735 165
631 3300049823 Ga0501044_0676144 Ga0501044_0676144_30_527 165
632 3300050490 nmdc:mga03n38_99218_c1 nmdc:mga03n38_99218_c1_565_1062 165
633 3300050492 nmdc:mga0yw44_88943_c1 nmdc:mga0yw44_88943_c1_1313_1810 165
634 3300050493 nmdc:mga0k408_175467_c1 nmdc:mga0k408_175467_c1_765_1262 165
635 3300050512 nmdc:mga0n895_614776_c1 nmdc:mga0n895_614776_c1_127_624 165
636 3300050514 nmdc:mga08x19_637422_c1 nmdc:mga08x19_637422_c1_71_568 165
637 3300053077 Ga0495601_0435467 Ga0495601_0435467_20_517 165
638 3300053096 Ga0500641_0042629 Ga0500641_0042629_1245_1742 165
639 3300053162 Ga0500638_081150 Ga0500638_081150_17_514 165
640 3300061719 Ga0466962_0354289 Ga0466962_0354289_70_567 165
641 iso_pu_bacteria 2513237101 2513697852 165
642 iso_pu_bacteria 2791355199 2793080396 165
643 iso_pu_bacteria 2874604998 2874606609 165
644 iso_pu_bacteria 2876808645 2876814477 165
645 iso_pu_bacteria 2879110137 2879112068 165
646 iso_pu_bacteria 2889033259 2889033983 165
647 iso_pu_bacteria 2922361189 2922367386 165
648 iso_pu_bacteria 2922386360 2922389915 165
649 iso_pu_bacteria 8006994254 8006998204 165
650 3300003215 JGI25153J46596_10003712 JGI25153J46596_1000371210 166
651 3300003771 Ga0055526_1038662 Ga0055526_10386622 166
652 3300003794 Ga0055531_10031944 Ga0055531_100319442 166
653 3300005262 Ga0065165_1009084 Ga0065165_10090841 166
654 3300005435 Ga0070714_100009317 Ga0070714_1000093175 166
655 3300005437 Ga0070710_10001623 Ga0070710_100016232 166
656 3300005439 Ga0070711_100002600 Ga0070711_1000026007 166
657 3300006028 Ga0070717_10350458 Ga0070717_103504582 166
658 3300006038 Ga0075365_10433016 Ga0075365_104330162 166
659 3300006173 Ga0070716_100048505 Ga0070716_1000485052 166
660 3300006175 Ga0070712_100149931 Ga0070712_1001499312 166
661 3300007265 Ga0099794_10014948 Ga0099794_100149482 166
662 3300025245 Ga0207425_1015495 Ga0207425_10154952 166
663 3300025295 Ga0209564_1012127 Ga0209564_10121272 166
664 3300025297 Ga0209758_1000595 Ga0209758_100059525 166
665 3300025299 Ga0209256_1005227 Ga0209256_10052278 166
666 3300025304 Ga0209257_1001217 Ga0209257_10012172 166
667 3300025898 Ga0207692_10020286 Ga0207692_100202862 166
668 3300025906 Ga0207699_10047038 Ga0207699_100470382 166
669 3300025915 Ga0207693_10017479 Ga0207693_100174794 166
670 3300025928 Ga0207700_10055580 Ga0207700_100555802 166
671 3300025939 Ga0207665_10010040 Ga0207665_100100405 166
672 3300048915 Ga0496112_0186224 Ga0496112_0186224_1447_1968 167
673 3300003659 JGI25404J52841_10009905 JGI25404J52841_100099052 168
674 3300003659 JGI25404J52841_10020979 JGI25404J52841_100209791 168
675 3300003762 Ga0055542_1002315 Ga0055542_10023156 168
676 3300005338 Ga0068868_101145613 Ga0068868_1011456131 168
677 3300005347 Ga0070668_100071817 Ga0070668_1000718172 168
678 3300005365 Ga0070688_100170205 Ga0070688_1001702052 168
679 3300005455 Ga0070663_100245385 Ga0070663_1002453851 168
680 3300005456 Ga0070678_100130094 Ga0070678_1001300941 168
681 3300005539 Ga0068853_100096571 Ga0068853_1000965712 168
682 3300005543 Ga0070672_100549490 Ga0070672_1005494902 168
683 3300005546 Ga0070696_100439503 Ga0070696_1004395032 168
684 3300005547 Ga0070693_100051061 Ga0070693_1000510612 168
685 3300005577 Ga0068857_100144830 Ga0068857_1001448302 168
686 3300005614 Ga0068856_100327511 Ga0068856_1003275112 168
687 3300005615 Ga0070702_100545629 Ga0070702_1005456292 168
688 3300005842 Ga0068858_100096388 Ga0068858_1000963882 168
689 3300005937 Ga0081455_10082596 Ga0081455_100825963 168
690 3300005983 Ga0081540_1025360 Ga0081540_10253602 168
691 3300005983 Ga0081540_1025400 Ga0081540_10254002 168
692 3300005983 Ga0081540_1057447 Ga0081540_10574472 168
693 3300006042 Ga0075368_10026301 Ga0075368_100263013 168
694 3300006051 Ga0075364_10349673 Ga0075364_103496731 168
695 3300006178 Ga0075367_10053707 Ga0075367_100537072 168
696 3300006186 Ga0075369_10342871 Ga0075369_103428711 168
697 3300006237 Ga0097621_100432833 Ga0097621_1004328332 168
698 3300006871 Ga0075434_100209149 Ga0075434_1002091492 168
699 3300006881 Ga0068865_100734418 Ga0068865_1007344181 168
700 3300007076 Ga0075435_100341684 Ga0075435_1003416842 168
701 3300009098 Ga0105245_10035055 Ga0105245_100350554 168
702 3300009101 Ga0105247_10217410 Ga0105247_102174101 168
703 3300009174 Ga0105241_10094456 Ga0105241_100944562 168
704 3300009176 Ga0105242_10597086 Ga0105242_105970863 168
705 3300009545 Ga0105237_10204960 Ga0105237_102049602 168
706 3300010375 Ga0105239_10078222 Ga0105239_100782222 168
707 3300012507 Ga0157342_1026416 Ga0157342_10264161 168
708 3300013296 Ga0157374_10159026 Ga0157374_101590262 168
709 3300013297 Ga0157378_10159002 Ga0157378_101590022 168
710 3300013308 Ga0157375_10321761 Ga0157375_103217612 168
711 3300025254 Ga0209148_1001022 Ga0209148_100102212 168
712 3300025261 Ga0209233_1027288 Ga0209233_10272882 168
713 3300025272 Ga0209455_1003787 Ga0209455_10037873 168
714 3300025901 Ga0207688_10169394 Ga0207688_101693941 168
715 3300025908 Ga0207643_10099827 Ga0207643_100998272 168
716 3300025911 Ga0207654_10065125 Ga0207654_100651252 168
717 3300025914 Ga0207671_10156502 Ga0207671_101565021 168
718 3300025919 Ga0207657_10321217 Ga0207657_103212172 168
719 3300025925 Ga0207650_10257937 Ga0207650_102579372 168
720 3300025927 Ga0207687_10013862 Ga0207687_100138624 168
721 3300025931 Ga0207644_10115686 Ga0207644_101156861 168
722 3300025933 Ga0207706_10084263 Ga0207706_100842632 168
723 3300025936 Ga0207670_10163221 Ga0207670_101632212 168
724 3300025940 Ga0207691_11195863 Ga0207691_111958632 168
725 3300025941 Ga0207711_10082496 Ga0207711_100824961 168
726 3300025942 Ga0207689_10112861 Ga0207689_101128612 168
727 3300025972 Ga0207668_10279874 Ga0207668_102798742 168
728 3300026023 Ga0207677_10043795 Ga0207677_100437953 168
729 3300026035 Ga0207703_10041071 Ga0207703_100410712 168
730 3300026078 Ga0207702_10442860 Ga0207702_104428602 168
731 3300026116 Ga0207674_10158819 Ga0207674_101588192 168
732 3300026121 Ga0207683_10125376 Ga0207683_101253762 168
733 3300026142 Ga0207698_10765327 Ga0207698_107653272 168
734 3300027866 Ga0209813_10128294 Ga0209813_101282941 168
735 3300028379 Ga0268266_10097894 Ga0268266_100978942 168
736 3300028381 Ga0268264_10161794 Ga0268264_101617942 168
737 3300031507 Ga0307509_10320647 Ga0307509_103206472 168
738 3300035691 Ga0373931_0101514 Ga0373931_0101514_932_1450 168
739 3300044901 Ga0466960_0293881 Ga0466960_0293881_331_861 168
740 3300048903 Ga0496100_0242518 Ga0496100_0242518_435_950 168
741 3300048909 Ga0496106_0542348 Ga0496106_0542348_71_586 168
742 3300048911 Ga0496108_0067910 Ga0496108_0067910_421_936 168
743 3300048912 Ga0496109_0054969 Ga0496109_0054969_2409_2924 168
744 3300048916 Ga0496113_0182827 Ga0496113_0182827_912_1427 168
745 3300048924 Ga0496121_0212461 Ga0496121_0212461_641_1156 168
746 3300050491 nmdc:mga00v17_128515_c1 nmdc:mga00v17_128515_c1_897_1412 168
747 3300050492 nmdc:mga0yw44_109719_c2 nmdc:mga0yw44_109719_c2_158_673 168
748 3300050493 nmdc:mga0k408_469409_c1 nmdc:mga0k408_469409_c1_81_596 168
749 3300050494 nmdc:mga06z11_627598_c1 nmdc:mga06z11_627598_c1_98_616 168
750 3300050495 nmdc:mga04h51_59298_c1 nmdc:mga04h51_59298_c1_271_786 168
751 3300050512 nmdc:mga0n895_509252_c1 nmdc:mga0n895_509252_c1_308_826 168
752 3300050515 nmdc:mga0a205_177406_c1 nmdc:mga0a205_177406_c1_1466_1981 168
753 iso_pu_bacteria 2513237141 2513887824 168
754 iso_pu_bacteria 2524023205 2524438405 168
755 iso_pu_bacteria 2744054633 2745078443 168
756 3300005329 Ga0070683_100663465 Ga0070683_1006634652 169
757 3300005331 Ga0070670_100797797 Ga0070670_1007977971 169
758 3300005337 Ga0070682_100310912 Ga0070682_1003109121 169
759 3300005347 Ga0070668_100631157 Ga0070668_1006311571 169
760 3300005434 Ga0070709_10119514 Ga0070709_101195141 169
761 3300005456 Ga0070678_100136192 Ga0070678_1001361922 169
762 3300005458 Ga0070681_10059065 Ga0070681_100590654 169
763 3300005518 Ga0070699_100364648 Ga0070699_1003646482 169
764 3300005535 Ga0070684_100515847 Ga0070684_1005158472 169
765 3300005547 Ga0070693_100471662 Ga0070693_1004716622 169
766 3300005616 Ga0068852_101806298 Ga0068852_1018062982 169
767 3300006028 Ga0070717_10050183 Ga0070717_100501832 169
768 3300006028 Ga0070717_10253006 Ga0070717_102530062 169
769 3300006163 Ga0070715_10207749 Ga0070715_102077491 169
770 3300006358 Ga0068871_100307152 Ga0068871_1003071522 169
771 3300006931 Ga0097620_100375662 Ga0097620_1003756622 169
772 3300009101 Ga0105247_10040927 Ga0105247_100409272 169
773 3300010375 Ga0105239_10138528 Ga0105239_101385283 169
774 3300010375 Ga0105239_10452600 Ga0105239_104526002 169
775 3300010375 Ga0105239_10839295 Ga0105239_108392952 169
776 3300013296 Ga0157374_11083567 Ga0157374_110835672 169
777 3300014969 Ga0157376_10004272 Ga0157376_100042728 169
778 3300025297 Ga0209758_1107988 Ga0209758_11079882 169
779 3300025315 Ga0207697_10061848 Ga0207697_100618482 169
780 3300025711 Ga0207696_1060702 Ga0207696_10607021 169
781 3300025899 Ga0207642_10022211 Ga0207642_100222112 169
782 3300025900 Ga0207710_10059403 Ga0207710_100594032 169
783 3300025901 Ga0207688_10133793 Ga0207688_101337932 169
784 3300025903 Ga0207680_10209180 Ga0207680_102091802 169
785 3300025905 Ga0207685_10531917 Ga0207685_105319171 169
786 3300025906 Ga0207699_10411575 Ga0207699_104115751 169
787 3300025907 Ga0207645_10094910 Ga0207645_100949101 169
788 3300025907 Ga0207645_10349114 Ga0207645_103491141 169
789 3300025912 Ga0207707_10054246 Ga0207707_100542462 169
790 3300025914 Ga0207671_10017843 Ga0207671_100178432 169
791 3300025916 Ga0207663_10093655 Ga0207663_100936552 169
792 3300025917 Ga0207660_10081611 Ga0207660_100816112 169
793 3300025918 Ga0207662_10100747 Ga0207662_101007472 169
794 3300025919 Ga0207657_10464861 Ga0207657_104648612 169
795 3300025920 Ga0207649_10054147 Ga0207649_100541472 169
796 3300025924 Ga0207694_10120934 Ga0207694_101209342 169
797 3300025924 Ga0207694_10183233 Ga0207694_101832332 169
798 3300025926 Ga0207659_10617647 Ga0207659_106176472 169
799 3300025927 Ga0207687_10128143 Ga0207687_101281432 169
800 3300025931 Ga0207644_10138400 Ga0207644_101384002 169
801 3300025935 Ga0207709_11022253 Ga0207709_110222532 169
802 3300025937 Ga0207669_10017039 Ga0207669_100170393 169
803 3300025937 Ga0207669_10418624 Ga0207669_104186242 169
804 3300025938 Ga0207704_10134148 Ga0207704_101341482 169
805 3300025938 Ga0207704_11532497 Ga0207704_115324971 169
806 3300025940 Ga0207691_10133924 Ga0207691_101339242 169
807 3300025940 Ga0207691_10407220 Ga0207691_104072202 169
808 3300025944 Ga0207661_10108866 Ga0207661_101088662 169
809 3300025945 Ga0207679_11012622 Ga0207679_110126221 169
810 3300025949 Ga0207667_10230284 Ga0207667_102302842 169
811 3300025960 Ga0207651_10130277 Ga0207651_101302773 169
812 3300025960 Ga0207651_10228541 Ga0207651_102285412 169
813 3300025961 Ga0207712_11678954 Ga0207712_116789541 169
814 3300025986 Ga0207658_11556876 Ga0207658_115568761 169
815 3300026023 Ga0207677_10138302 Ga0207677_101383022 169
816 3300026035 Ga0207703_10298174 Ga0207703_102981741 169
817 3300026035 Ga0207703_10486185 Ga0207703_104861851 169
818 3300026041 Ga0207639_10393807 Ga0207639_103938072 169
819 3300026067 Ga0207678_11089251 Ga0207678_110892511 169
820 3300026075 Ga0207708_10065642 Ga0207708_100656422 169
821 3300026088 Ga0207641_10469134 Ga0207641_104691342 169
822 3300026089 Ga0207648_10058938 Ga0207648_100589382 169
823 3300026095 Ga0207676_10242608 Ga0207676_102426082 169
824 3300026095 Ga0207676_10485069 Ga0207676_104850692 169
825 3300026118 Ga0207675_100146969 Ga0207675_1001469692 169
826 3300026121 Ga0207683_10028851 Ga0207683_100288514 169
827 3300026121 Ga0207683_10556569 Ga0207683_105565692 169
828 3300026142 Ga0207698_10112768 Ga0207698_101127683 169
829 3300026142 Ga0207698_10288957 Ga0207698_102889572 169
830 3300026142 Ga0207698_11705416 Ga0207698_117054161 169
831 3300027671 Ga0209588_1040404 Ga0209588_10404042 169
832 3300028379 Ga0268266_10001750 Ga0268266_1000175012 169
833 3300028379 Ga0268266_10005449 Ga0268266_100054492 169
834 3300028379 Ga0268266_10256709 Ga0268266_102567092 169
835 3300028380 Ga0268265_11021481 Ga0268265_110214811 169
836 3300028381 Ga0268264_10110353 Ga0268264_101103532 169
837 3300028786 Ga0307517_10178890 Ga0307517_101788901 169
838 3300030521 Ga0307511_10278380 Ga0307511_102783801 169
839 3300031616 Ga0307508_10000019 Ga0307508_1000001938 169
840 3300031616 Ga0307508_10241982 Ga0307508_102419822 169
841 3300031824 Ga0307413_10513134 Ga0307413_105131342 169
842 3300031901 Ga0307406_10134380 Ga0307406_101343802 169
843 3300031911 Ga0307412_10984088 Ga0307412_109840882 169
844 3300032002 Ga0307416_100084245 Ga0307416_1000842452 169
845 3300032004 Ga0307414_10575764 Ga0307414_105757641 169
846 3300033180 Ga0307510_10031136 Ga0307510_100311362 169
847 3300034820 Ga0373959_0021676 Ga0373959_0021676_60_578 169
848 3300034957 Ga0373938_0121312 Ga0373938_0121312_78_596 169
849 3300035171 Ga0373946_0284139 Ga0373946_0284139_269_790 169
850 3300037068 Ga0373925_0039274 Ga0373925_0039274_2809_3345 169
851 3300037418 Ga0395900_0446611 Ga0395900_0446611_613_1143 169
852 3300039438 Ga0436360_0054328 Ga0436360_0054328_297_824 169
853 3300042009 Ga0439451_097863 Ga0439451_097863_57_575 169
854 3300042156 Ga0439446_0143078 Ga0439446_0143078_76_594 169
855 3300046453 Ga0495627_050768 Ga0495627_050768_86_604 169
856 3300046455 Ga0495603_0008563 Ga0495603_0008563_3333_3854 169
857 3300046455 Ga0495603_0036192 Ga0495603_0036192_1592_2110 169
858 3300046472 Ga0495580_0122657 Ga0495580_0122657_15_533 169
859 3300046473 Ga0495582_0536299 Ga0495582_0536299_125_643 169
860 3300046474 Ga0495605_0337569 Ga0495605_0337569_51_569 169
861 3300046475 Ga0495639_0012900 Ga0495639_0012900_1695_2216 169
862 3300046475 Ga0495639_0079933 Ga0495639_0079933_947_1465 169
863 3300046475 Ga0495639_0285222 Ga0495639_0285222_24_545 169
864 3300046491 Ga0495584_0171270 Ga0495584_0171270_205_723 169
865 3300046492 Ga0495585_0202630 Ga0495585_0202630_45_563 169
866 3300046507 Ga0495606_0129346 Ga0495606_0129346_446_985 169
867 3300046507 Ga0495606_0314086 Ga0495606_0314086_41_559 169
868 3300046512 Ga0495610_0151587 Ga0495610_0151587_418_936 169
869 3300046513 Ga0495616_0050458 Ga0495616_0050458_1411_1929 169
870 3300046513 Ga0495616_0188975 Ga0495616_0188975_337_855 169
871 3300046515 Ga0495620_0029187 Ga0495620_0029187_1380_1898 169
872 3300046519 Ga0495632_0026711 Ga0495632_0026711_654_1172 169
873 3300046523 Ga0495644_0025625 Ga0495644_0025625_354_872 169
874 3300046523 Ga0495644_0054133 Ga0495644_0054133_282_800 169
875 3300046526 Ga0495666_0075650 Ga0495666_0075650_398_916 169
876 3300046530 Ga0495654_0093881 Ga0495654_0093881_272_790 169
877 3300046537 Ga0495598_0005121 Ga0495598_0005121_1554_2072 169
878 3300046538 Ga0495609_0138707 Ga0495609_0138707_35_553 169
879 3300046542 Ga0495597_0139766 Ga0495597_0139766_113_631 169
880 3300046557 Ga0495622_0039342 Ga0495622_0039342_164_682 169
881 3300046615 Ga0495656_0010809 Ga0495656_0010809_1781_2299 169
882 3300046616 Ga0495668_0094820 Ga0495668_0094820_420_938 169
883 3300046616 Ga0495668_0119115 Ga0495668_0119115_482_1003 169
884 3300046616 Ga0495668_0278050 Ga0495668_0278050_57_575 169
885 3300046660 Ga0495625_0271937 Ga0495625_0271937_424_942 169
886 3300046660 Ga0495625_0474228 Ga0495625_0474228_23_541 169
887 3300046663 Ga0495635_0278960 Ga0495635_0278960_277_795 169
888 3300046665 Ga0495661_0146571 Ga0495661_0146571_717_1235 169
889 3300046674 Ga0495588_0085353 Ga0495588_0085353_311_829 169
890 3300046681 Ga0495647_0124365 Ga0495647_0124365_62_583 169
891 3300046691 Ga0495670_0505415 Ga0495670_0505415_90_608 169
892 3300046694 Ga0495649_0054232 Ga0495649_0054232_984_1502 169
893 3300046794 Ga0495589_0102589 Ga0495589_0102589_429_947 169
894 3300046809 Ga0495600_0171298 Ga0495600_0171298_556_1074 169
895 3300046810 Ga0495660_0371803 Ga0495660_0371803_70_588 169
896 3300047318 Ga0495636_0128406 Ga0495636_0128406_232_750 169
897 3300047447 Ga0495685_017436 Ga0495685_017436_821_1339 169
898 3300047469 Ga0495673_0099887 Ga0495673_0099887_214_732 169
899 3300047470 Ga0495681_0281572 Ga0495681_0281572_46_564 169
900 3300047472 Ga0495686_0091932 Ga0495686_0091932_1120_1638 169
901 3300047673 Ga0495593_0166671 Ga0495593_0166671_120_638 169
902 3300048090 Ga0495615_0066502 Ga0495615_0066502_295_849 169
903 3300048903 Ga0496100_0300392 Ga0496100_0300392_666_1187 169
904 3300048903 Ga0496100_0482964 Ga0496100_0482964_269_787 169
905 3300048904 Ga0496101_0009139 Ga0496101_0009139_1505_2026 169
906 3300048904 Ga0496101_0164672 Ga0496101_0164672_92_610 169
907 3300048905 Ga0496102_0004648 Ga0496102_0004648_686_1207 169
908 3300048905 Ga0496102_0391409 Ga0496102_0391409_714_1259 169
909 3300048905 Ga0496102_1706541 Ga0496102_1706541_11_529 169
910 3300048906 Ga0496103_0239956 Ga0496103_0239956_147_665 169
911 3300048908 Ga0496105_0004610 Ga0496105_0004610_6675_7196 169
912 3300048909 Ga0496106_0000686 Ga0496106_0000686_15068_15604 169
913 3300048909 Ga0496106_0014778 Ga0496106_0014778_2674_3195 169
914 3300048910 Ga0496107_0002437 Ga0496107_0002437_6896_7417 169
915 3300048911 Ga0496108_0030616 Ga0496108_0030616_759_1280 169
916 3300048911 Ga0496108_0597677 Ga0496108_0597677_179_697 169
917 3300048912 Ga0496109_0003924 Ga0496109_0003924_5867_6388 169
918 3300048912 Ga0496109_0347674 Ga0496109_0347674_78_596 169
919 3300048913 Ga0496110_0005589 Ga0496110_0005589_7062_7583 169
920 3300048913 Ga0496110_0241290 Ga0496110_0241290_496_1014 169
921 3300048914 Ga0496111_0010019 Ga0496111_0010019_3115_3636 169
922 3300048914 Ga0496111_1046989 Ga0496111_1046989_23_541 169
923 3300048915 Ga0496112_0036993 Ga0496112_0036993_1286_1807 169
924 3300048916 Ga0496113_0028000 Ga0496113_0028000_791_1312 169
925 3300048917 Ga0496114_0008237 Ga0496114_0008237_289_810 169
926 3300048917 Ga0496114_0481885 Ga0496114_0481885_276_794 169
927 3300048918 Ga0496115_0004137 Ga0496115_0004137_451_972 169
928 3300048918 Ga0496115_0226615 Ga0496115_0226615_811_1329 169
929 3300048918 Ga0496115_0791657 Ga0496115_0791657_187_708 169
930 3300048920 Ga0496117_0035078 Ga0496117_0035078_95_631 169
931 3300048920 Ga0496117_0108529 Ga0496117_0108529_110_628 169
932 3300048921 Ga0496118_0002254 Ga0496118_0002254_15097_15633 169
933 3300048923 Ga0496120_0343035 Ga0496120_0343035_132_650 169
934 3300048924 Ga0496121_0000418 Ga0496121_0000418_59441_59977 169
935 3300048924 Ga0496121_0054413 Ga0496121_0054413_1208_1726 169
936 3300048927 Ga0496124_0001129 Ga0496124_0001129_38174_38710 169
937 3300048929 Ga0496126_0018732 Ga0496126_0018732_2115_2651 169
938 3300048929 Ga0496126_0033351 Ga0496126_0033351_850_1368 169
939 3300048929 Ga0496126_0148025 Ga0496126_0148025_135_674 169
940 3300048929 Ga0496126_0251863 Ga0496126_0251863_411_932 169
941 3300048929 Ga0496126_0329149 Ga0496126_0329149_620_1141 169
942 3300048929 Ga0496126_0427584 Ga0496126_0427584_320_838 169
943 3300049460 Ga0495682_0050392 Ga0495682_0050392_393_911 169
944 3300049584 Ga0501068_0197463 Ga0501068_0197463_55_573 169
945 3300049592 Ga0501076_0117789 Ga0501076_0117789_874_1392 169
946 3300049744 Ga0501083_0804066 Ga0501083_0804066_58_579 169
947 3300050489 nmdc:mga03683_365116_c1 nmdc:mga03683_365116_c1_10_528 169
948 3300050490 nmdc:mga03n38_310084_c1 nmdc:mga03n38_310084_c1_11_529 169
949 3300050491 nmdc:mga00v17_45968_c1 nmdc:mga00v17_45968_c1_2046_2564 169
950 3300050492 nmdc:mga0yw44_36870_c2 nmdc:mga0yw44_36870_c2_1181_1699 169
951 3300050492 nmdc:mga0yw44_75742_c1 nmdc:mga0yw44_75742_c1_1120_1638 169
952 3300050494 nmdc:mga06z11_4761_c1 nmdc:mga06z11_4761_c1_1487_2005 169
953 3300050496 nmdc:mga07m45_19452_c1 nmdc:mga07m45_19452_c1_1683_2201 169
954 3300050496 nmdc:mga07m45_48318_c1 nmdc:mga07m45_48318_c1_174_692 169
955 3300050507 nmdc:mga05p37_100622_c1 nmdc:mga05p37_100622_c1_936_1454 169
956 3300050509 nmdc:mga0qj67_629016_c1 nmdc:mga0qj67_629016_c1_317_835 169
957 3300050511 nmdc:mga08y16_231865_c1 nmdc:mga08y16_231865_c1_1303_1821 169
958 3300053085 Ga0495619_0495950 Ga0495619_0495950_311_829 169
959 3300053088 Ga0500644_0027691 Ga0500644_0027691_574_1092 169
960 3300053096 Ga0500641_0011847 Ga0500641_0011847_1183_1701 169
961 3300053116 Ga0500592_065714 Ga0500592_065714_48_569 169
962 3300053118 Ga0500594_0040125 Ga0500594_0040125_589_1107 169
963 3300053119 Ga0500595_002867 Ga0500595_002867_75_626 169
964 3300053129 Ga0500628_029919 Ga0500628_029919_140_658 169
965 3300053133 Ga0500655_073864 Ga0500655_073864_157_675 169
966 3300053134 Ga0500658_0202644 Ga0500658_0202644_357_875 169
967 3300053143 Ga0500579_242467 Ga0500579_242467_53_571 169
968 3300053146 Ga0500588_0064029 Ga0500588_0064029_636_1154 169
969 3300053147 Ga0500589_091389 Ga0500589_091389_222_740 169
970 3300053151 Ga0500604_0062468 Ga0500604_0062468_640_1158 169
971 3300053727 Ga0500611_061758 Ga0500611_061758_206_724 169
972 3300053730 Ga0500645_089807 Ga0500645_089807_333_851 169
973 3300060353 Ga0501082_0184978 Ga0501082_0184978_90_608 169
974 iso_pu_bacteria 2513237098 2513673571 169
975 iso_pu_bacteria 2513237104 2513717697 169
976 3300005539 Ga0068853_100196899 Ga0068853_1001968992 172
977 3300005547 Ga0070693_100097209 Ga0070693_1000972091 172
978 3300021358 Ga0213873_10011107 Ga0213873_100111071 172
979 3300021441 Ga0213871_10008575 Ga0213871_100085752 172
980 3300037853 Ga0436364_0575905 Ga0436364_0575905_606_1157 172
981 3300039437 Ga0436365_1730046 Ga0436365_1730046_1569_2120 172
982 3300039447 Ga0436361_0244793 Ga0436361_0244793_2110_2673 172
983 3300039453 Ga0436362_0999249 Ga0436362_0999249_2056_2619 172
984 3300045049 Ga0466959_0204762 Ga0466959_0204762_443_1006 172
985 3300050490 nmdc:mga03n38_40940_c1 nmdc:mga03n38_40940_c1_346_897 172
986 iso_pu_bacteria 2791355196 2793059553 172
987 iso_pu_bacteria 2816332527 2818242265 172
988 iso_pu_bacteria 2874620515 2874624087 172
989 iso_pu_bacteria 2904666416 2904670798 172
990 iso_pu_bacteria 2935769743 2935776504 172
991 iso_pu_bacteria 2935785616 2935789932 172
992 iso_pu_bacteria 2935793552 2935798302 172
993 iso_pu_bacteria 2935959822 2935965704 172
994 iso_pu_bacteria 3005506211 3005506828 172
995 iso_pu_bacteria 3005710791 3005717242 172
996 iso_pu_bacteria 8016530956 8016538528 172
997 iso_pu_bacteria 8016539877 8016542812 172
998 iso_pu_bacteria 8016557553 8016558892 172
999 iso_pu_bacteria 8016566248 8016568200 172
1000 iso_pu_bacteria 8016575299 8016580868 172
1001 iso_pu_bacteria 8016595262 8016596855 172
1002 iso_pu_bacteria 8016622563 8016630060 172
1003 iso_pu_bacteria 8019530166 8019538193 172
1004 iso_pu_bacteria 8019547302 8019549005 172
1005 3300006941 Ga0099825_1051875 Ga0099825_10518752 173
1006 3300025254 Ga0209148_1014767 Ga0209148_10147672 173
1007 3300025261 Ga0209233_1002396 Ga0209233_10023962 173
1008 3300027363 Ga0209700_100012 Ga0209700_100012231 173
1009 3300050492 nmdc:mga0yw44_432789_c1 nmdc:mga0yw44_432789_c1_186_740 173
1010 iso_pu_bacteria 2824600985 2824608500 173
1011 iso_pu_bacteria 2824609381 2824617505 173
1012 3300025925 Ga0207650_10185992 Ga0207650_101859922 174
1013 3300005331 Ga0070670_100522711 Ga0070670_1005227112 175
1014 3300005334 Ga0068869_100405036 Ga0068869_1004050362 175
1015 3300005335 Ga0070666_10377989 Ga0070666_103779892 175
1016 3300005344 Ga0070661_100086294 Ga0070661_1000862942 175
1017 3300005347 Ga0070668_100103943 Ga0070668_1001039431 175
1018 3300005355 Ga0070671_100047293 Ga0070671_1000472933 175
1019 3300005367 Ga0070667_100667180 Ga0070667_1006671802 175
1020 3300005539 Ga0068853_100334691 Ga0068853_1003346912 175
1021 3300005577 Ga0068857_100208519 Ga0068857_1002085192 175
1022 3300005578 Ga0068854_100754336 Ga0068854_1007543362 175
1023 3300005617 Ga0068859_100256367 Ga0068859_1002563672 175
1024 3300005618 Ga0068864_100214742 Ga0068864_1002147422 175
1025 3300005843 Ga0068860_100275629 Ga0068860_1002756292 175
1026 3300006038 Ga0075365_10048215 Ga0075365_100482152 175
1027 3300006042 Ga0075368_10007086 Ga0075368_100070862 175
1028 3300006048 Ga0075363_100054681 Ga0075363_1000546812 175
1029 3300006177 Ga0075362_10278658 Ga0075362_102786582 175
1030 3300006178 Ga0075367_10095584 Ga0075367_100955841 175
1031 3300006186 Ga0075369_10113439 Ga0075369_101134392 175
1032 3300006186 Ga0075369_10242851 Ga0075369_102428511 175
1033 3300006195 Ga0075366_10091150 Ga0075366_100911502 175
1034 3300006353 Ga0075370_10027287 Ga0075370_100272871 175
1035 3300006353 Ga0075370_10181635 Ga0075370_101816352 175
1036 3300006931 Ga0097620_100256370 Ga0097620_1002563702 175
1037 3300025299 Ga0209256_1073616 Ga0209256_10736161 175
1038 3300025304 Ga0209257_1013493 Ga0209257_10134931 175
1039 3300025315 Ga0207697_10051661 Ga0207697_100516612 175
1040 3300025900 Ga0207710_10019370 Ga0207710_100193702 175
1041 3300025901 Ga0207688_10321271 Ga0207688_103212711 175
1042 3300025904 Ga0207647_10000809 Ga0207647_1000080914 175
1043 3300025911 Ga0207654_10161942 Ga0207654_101619422 175
1044 3300025914 Ga0207671_10835451 Ga0207671_108354511 175
1045 3300025932 Ga0207690_10255795 Ga0207690_102557951 175
1046 3300026041 Ga0207639_10483368 Ga0207639_104833682 175
1047 3300026116 Ga0207674_10226270 Ga0207674_102262702 175
1048 3300026142 Ga0207698_10350693 Ga0207698_103506932 175
1049 3300027866 Ga0209813_10048196 Ga0209813_100481962 175
1050 3300028379 Ga0268266_10132547 Ga0268266_101325472 175
1051 3300050516 nmdc:mga0sz30_75702_c1 nmdc:mga0sz30_75702_c1_190_747 175
1052 3300003215 JGI25153J46596_10001545 JGI25153J46596_1000154515 176
1053 3300025297 Ga0209758_1000604 Ga0209758_100060435 176
1054 3300031911 Ga0307412_10408302 Ga0307412_104083022 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

42

188

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8498 19 167
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8416 17 170
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8342 19 163
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8339 19 167
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8112 12 165
ID Description Score Start End Superfamily
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8614 23 167 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8541 23 168 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8441 23 167 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8431 23 168 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.7484 23 168 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A1Q4BBE2-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9414 13 169 GO:0004190
GO:0005886
GO:0006508
AF-A0A651FTE1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9378 13 169 GO:0004190
GO:0005886
GO:0006508
AF-B3Q7Z4-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9359 13 176 GO:0004190
GO:0005886
GO:0006508
AF-A0A2E5BNL6-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9325 15 169 GO:0004190
GO:0005886
GO:0006508
AF-A0A7S8C8Q5-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9323 13 166 GO:0004190
GO:0005886
GO:0006508

Feature Viewer

pLDDT pTM Quality
85.32 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map