F488981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1047 | 477 | 2094 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300046458|Ga0495591_008678|Ga0495591_008678_1491_1955 |
| Length | 154 |
| Sequence | MYRIAPFAAFGSSYNHQLLIEGLSMPKKVIIPAGTGTPIGPFVPGTTADGIVYVSGTLPFDSDNNVVHVGDAAAQTRHVLNIIKGVIESAGGTMADVTFNHVFLKNWEDYAAINAVYAEYFPGEKPARYCIQCGLVKPDALIEIASVAHIGKGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 58 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 72 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 83 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 84 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 85 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 129 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 139 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 140 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 141 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 142 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 143 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 172 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 177 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 178 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 181 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 182 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 183 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 184 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 185 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 186 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 187 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 188 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 189 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 190 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 191 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 194 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 195 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 196 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 197 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 198 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 199 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 305 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 308 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 309 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 310 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 311 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 315 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 318 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 322 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 328 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 330 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 334 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 336 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 337 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 346 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 348 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 349 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 350 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 353 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 354 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 357 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 358 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 359 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 360 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 361 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 362 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 363 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 364 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 365 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 366 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 367 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 368 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 369 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 370 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 371 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 372 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 373 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 374 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 375 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 376 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 377 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 378 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 379 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 380 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 381 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 382 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 383 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 384 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 385 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 386 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 387 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 388 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 389 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 390 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 391 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 392 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 393 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 394 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 395 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 396 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 397 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 398 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 399 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 400 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 401 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 402 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 403 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 404 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 405 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 406 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 407 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 408 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 409 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 410 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 411 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 412 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 413 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 414 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 415 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 416 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 417 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 418 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 419 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 420 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 421 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 422 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 423 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 424 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 425 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 426 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 427 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 428 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 429 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 430 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 431 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 432 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 433 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 434 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 435 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 436 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 437 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 438 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 439 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 440 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 441 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 442 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 443 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 444 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 445 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 446 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 447 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 448 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 449 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 450 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 451 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 452 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 453 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 454 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 455 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 456 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 457 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 458 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 459 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 460 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 461 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 462 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 463 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 464 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 465 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 466 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 467 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 468 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 469 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 470 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 471 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 472 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 473 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 474 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 475 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 476 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 477 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.25 |
| Metatranscriptomes | 0.1 |
| Isolates | 11.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0.1 |
| Endosphere | 20.44 |
| Nodule | 1.53 |
| Rhizoplane | 6.21 |
| Rhizosphere | 50.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495591_008678 | 3300046458 | Bacteria | 4133 |
| 2 | SwRhRL2b_contig_2020483 | 2162886007 | Bacteria | 1285 |
| 3 | SwRhRL2b_contig_605692 | 2162886007 | Bacteria | 802 |
| 4 | JGI25162J39368_1014135 | 3300002737 | Bacteria | 861 |
| 5 | JGI25152J39213_1001256 | 3300002773 | Bacteria | 11514 |
| 6 | JGI25150J39212_1000010 | 3300002774 | Bacteria | 236260 |
| 7 | JGI25151J46595_10000026 | 3300003187 | Bacteria | 211045 |
| 8 | JGI25406J46586_10064863 | 3300003203 | Bacteria | 1166 |
| 9 | JGI25165J46597_1020337 | 3300003214 | Bacteria | 870 |
| 10 | JGI25153J46596_10000590 | 3300003215 | Bacteria | 22229 |
| 11 | JGI25153J46596_10003622 | 3300003215 | Bacteria | 8574 |
| 12 | rootH1_10132492 | 3300003316 | Bacteria | 2911 |
| 13 | rootH2_10059718 | 3300003320 | Bacteria | 15347 |
| 14 | rootH2_10087853 | 3300003320 | Bacteria | 4861 |
| 15 | rootL2_10013653 | 3300003322 | Bacteria | 2027 |
| 16 | rootH1_10006414 | 3300003323 | Bacteria | 9927 |
| 17 | rootH1_10206025 | 3300003323 | Bacteria | 1386 |
| 18 | Ga0055526_1038075 | 3300003771 | Bacteria | 1246 |
| 19 | Ga0055537_1000502 | 3300003773 | Bacteria | 23608 |
| 20 | Ga0055524_1023191 | 3300003775 | Bacteria | 2005 |
| 21 | Ga0055534_1000242 | 3300003784 | Bacteria | 38891 |
| 22 | Ga0055528_1001320 | 3300003790 | Bacteria | 15517 |
| 23 | Ga0055528_1035157 | 3300003790 | Bacteria | 1221 |
| 24 | Ga0055531_10004450 | 3300003794 | Bacteria | 8524 |
| 25 | Ga0058692_1000058 | 3300003856 | Bacteria | 99195 |
| 26 | Ga0058692_1000076 | 3300003856 | Bacteria | 75166 |
| 27 | Ga0058692_1000362 | 3300003856 | Bacteria | 21935 |
| 28 | Ga0058692_1004662 | 3300003856 | Bacteria | 4036 |
| 29 | Ga0058692_1010094 | 3300003856 | Bacteria | 2348 |
| 30 | Ga0058692_1010098 | 3300003856 | Bacteria | 2348 |
| 31 | Ga0055543_1007142 | 3300004625 | Bacteria | 2614 |
| 32 | Ga0065165_1001689 | 3300005262 | Bacteria | 22273 |
| 33 | Ga0065165_1004567 | 3300005262 | Bacteria | 8454 |
| 34 | Ga0065703_1021363 | 3300005272 | Bacteria | 1273 |
| 35 | Ga0065714_10006253 | 3300005288 | Bacteria | 4029 |
| 36 | Ga0065714_10260811 | 3300005288 | Bacteria | 741 |
| 37 | Ga0065704_10000722 | 3300005289 | Bacteria | 17520 |
| 38 | Ga0065704_10004428 | 3300005289 | Bacteria | 5573 |
| 39 | Ga0065704_10006660 | 3300005289 | Bacteria | 3075 |
| 40 | Ga0065704_10087996 | 3300005289 | Bacteria | 2976 |
| 41 | Ga0065704_10111960 | 3300005289 | Bacteria | 1944 |
| 42 | Ga0070676_10600126 | 3300005328 | Bacteria | 794 |
| 43 | Ga0070666_11258153 | 3300005335 | Bacteria | 552 |
| 44 | Ga0070682_101372518 | 3300005337 | Bacteria | 603 |
| 45 | Ga0070660_101114689 | 3300005339 | Bacteria | 668 |
| 46 | Ga0070661_100318601 | 3300005344 | Bacteria | 1214 |
| 47 | Ga0070668_100001252 | 3300005347 | Bacteria | 18117 |
| 48 | Ga0070667_100000111 | 3300005367 | Bacteria | 105176 |
| 49 | Ga0070714_100619656 | 3300005435 | Bacteria | 1040 |
| 50 | Ga0070710_10348198 | 3300005437 | Bacteria | 980 |
| 51 | Ga0070711_100680376 | 3300005439 | Bacteria | 865 |
| 52 | Ga0070694_101024057 | 3300005444 | Bacteria | 686 |
| 53 | Ga0070663_100138807 | 3300005455 | Bacteria | 1853 |
| 54 | Ga0070663_100670201 | 3300005455 | Bacteria | 879 |
| 55 | Ga0070662_100084696 | 3300005457 | Bacteria | 2368 |
| 56 | Ga0070706_100455253 | 3300005467 | Bacteria | 1191 |
| 57 | Ga0070665_100049105 | 3300005548 | Bacteria | 4235 |
| 58 | Ga0070665_100228851 | 3300005548 | Bacteria | 1859 |
| 59 | Ga0070665_100617725 | 3300005548 | Bacteria | 1097 |
| 60 | Ga0068864_100568487 | 3300005618 | Bacteria | 1098 |
| 61 | Ga0068863_100008694 | 3300005841 | Bacteria | 9919 |
| 62 | Ga0068860_100000176 | 3300005843 | Bacteria | 105176 |
| 63 | Ga0068860_100134520 | 3300005843 | Bacteria | 2374 |
| 64 | Ga0068860_100353204 | 3300005843 | Bacteria | 1447 |
| 65 | Ga0068860_101254259 | 3300005843 | Bacteria | 762 |
| 66 | Ga0081455_10013447 | 3300005937 | Bacteria | 8087 |
| 67 | Ga0081539_10001642 | 3300005985 | Bacteria | 36366 |
| 68 | Ga0081539_10010459 | 3300005985 | Bacteria | 7532 |
| 69 | Ga0075365_10022409 | 3300006038 | Bacteria | 3957 |
| 70 | Ga0075365_10076612 | 3300006038 | Bacteria | 2258 |
| 71 | Ga0075365_10191551 | 3300006038 | Bacteria | 1431 |
| 72 | Ga0075368_10154439 | 3300006042 | Bacteria | 959 |
| 73 | Ga0075368_10530006 | 3300006042 | Bacteria | 528 |
| 74 | Ga0075363_100625451 | 3300006048 | Bacteria | 646 |
| 75 | Ga0075363_100691325 | 3300006048 | Bacteria | 615 |
| 76 | Ga0075364_10011159 | 3300006051 | Bacteria | 5453 |
| 77 | Ga0075364_10020445 | 3300006051 | Bacteria | 4163 |
| 78 | Ga0075364_10029099 | 3300006051 | Bacteria | 3541 |
| 79 | Ga0075364_10050371 | 3300006051 | Bacteria | 2718 |
| 80 | Ga0075364_10085687 | 3300006051 | Bacteria | 2087 |
| 81 | Ga0075364_10296173 | 3300006051 | Bacteria | 1101 |
| 82 | Ga0075364_10331026 | 3300006051 | Bacteria | 1037 |
| 83 | Ga0075364_10379985 | 3300006051 | Bacteria | 963 |
| 84 | Ga0075364_10764937 | 3300006051 | Bacteria | 659 |
| 85 | Ga0075364_10793956 | 3300006051 | Bacteria | 645 |
| 86 | Ga0075364_10996527 | 3300006051 | Bacteria | 570 |
| 87 | Ga0075432_10265897 | 3300006058 | Bacteria | 701 |
| 88 | Ga0075362_10002076 | 3300006177 | Bacteria | 6613 |
| 89 | Ga0075362_10018790 | 3300006177 | Bacteria | 2865 |
| 90 | Ga0075362_10032651 | 3300006177 | Bacteria | 2260 |
| 91 | Ga0075362_10046781 | 3300006177 | Bacteria | 1925 |
| 92 | Ga0075362_10306003 | 3300006177 | Bacteria | 789 |
| 93 | Ga0075367_10037444 | 3300006178 | Bacteria | 2819 |
| 94 | Ga0075367_10041045 | 3300006178 | Bacteria | 2704 |
| 95 | Ga0075367_10119300 | 3300006178 | Bacteria | 1624 |
| 96 | Ga0075367_10175023 | 3300006178 | Bacteria | 1337 |
| 97 | Ga0075367_10453810 | 3300006178 | Bacteria | 812 |
| 98 | Ga0075367_10513342 | 3300006178 | Bacteria | 761 |
| 99 | Ga0075369_10005321 | 3300006186 | Bacteria | 4799 |
| 100 | Ga0075369_10012237 | 3300006186 | Bacteria | 3389 |
| 101 | Ga0075369_10013788 | 3300006186 | Bacteria | 3216 |
| 102 | Ga0075369_10095193 | 3300006186 | Bacteria | 1332 |
| 103 | Ga0075369_10345690 | 3300006186 | Bacteria | 697 |
| 104 | Ga0075366_10021195 | 3300006195 | Unclassified | 3778 |
| 105 | Ga0075366_10273858 | 3300006195 | Bacteria | 1031 |
| 106 | Ga0075366_10904683 | 3300006195 | Bacteria | 550 |
| 107 | Ga0075370_10039894 | 3300006353 | Bacteria | 2647 |
| 108 | Ga0075370_10203005 | 3300006353 | Bacteria | 1169 |
| 109 | Ga0075370_10438065 | 3300006353 | Bacteria | 786 |
| 110 | Ga0068871_100871039 | 3300006358 | Bacteria | 833 |
| 111 | Ga0079104_1006009 | 3300006946 | Bacteria | 4700 |
| 112 | Ga0079104_1011871 | 3300006946 | Bacteria | 2772 |
| 113 | Ga0079104_1011876 | 3300006946 | Bacteria | 2771 |
| 114 | Ga0079104_1012532 | 3300006946 | Bacteria | 2658 |
| 115 | Ga0079104_1034418 | 3300006946 | Bacteria | 1230 |
| 116 | Ga0079104_1059619 | 3300006946 | Bacteria | 825 |
| 117 | Ga0079104_1060234 | 3300006946 | Bacteria | 820 |
| 118 | Ga0099826_10000457 | 3300006948 | Bacteria | 19647 |
| 119 | Ga0099794_10054552 | 3300007265 | Bacteria | 1930 |
| 120 | Ga0099794_10211048 | 3300007265 | Bacteria | 996 |
| 121 | Ga0105251_10000465 | 3300009011 | Bacteria | 38667 |
| 122 | Ga0105251_10000606 | 3300009011 | Bacteria | 32839 |
| 123 | Ga0105251_10001506 | 3300009011 | Bacteria | 20010 |
| 124 | Ga0105251_10001643 | 3300009011 | Bacteria | 18941 |
| 125 | Ga0105251_10005434 | 3300009011 | Bacteria | 8324 |
| 126 | Ga0105251_10008672 | 3300009011 | Bacteria | 6096 |
| 127 | Ga0105251_10009938 | 3300009011 | Bacteria | 5568 |
| 128 | Ga0105251_10021637 | 3300009011 | Bacteria | 3354 |
| 129 | Ga0105251_10107007 | 3300009011 | Bacteria | 1276 |
| 130 | Ga0105244_10000942 | 3300009036 | Bacteria | 24430 |
| 131 | Ga0105244_10001226 | 3300009036 | Bacteria | 21039 |
| 132 | Ga0105244_10001277 | 3300009036 | Bacteria | 20646 |
| 133 | Ga0105244_10002704 | 3300009036 | Bacteria | 13254 |
| 134 | Ga0105244_10009582 | 3300009036 | Bacteria | 5938 |
| 135 | Ga0105244_10018705 | 3300009036 | Bacteria | 3880 |
| 136 | Ga0105244_10039184 | 3300009036 | Bacteria | 2468 |
| 137 | Ga0105244_10087058 | 3300009036 | Bacteria | 1540 |
| 138 | Ga0105244_10115042 | 3300009036 | Bacteria | 1306 |
| 139 | Ga0105244_10146959 | 3300009036 | Bacteria | 1131 |
| 140 | Ga0105244_10150545 | 3300009036 | Bacteria | 1115 |
| 141 | Ga0105244_10599311 | 3300009036 | Bacteria | 505 |
| 142 | Ga0105250_10001600 | 3300009092 | Bacteria | 12132 |
| 143 | Ga0105250_10005696 | 3300009092 | Bacteria | 5561 |
| 144 | Ga0105250_10009361 | 3300009092 | Bacteria | 4129 |
| 145 | Ga0105250_10012703 | 3300009092 | Bacteria | 3470 |
| 146 | Ga0105250_10030647 | 3300009092 | Bacteria | 2162 |
| 147 | Ga0105250_10032752 | 3300009092 | Bacteria | 2087 |
| 148 | Ga0105250_10080016 | 3300009092 | Bacteria | 1324 |
| 149 | Ga0105240_10523173 | 3300009093 | Bacteria | 1316 |
| 150 | Ga0105240_10594556 | 3300009093 | Bacteria | 1219 |
| 151 | Ga0105240_12166780 | 3300009093 | Bacteria | 577 |
| 152 | Ga0111539_11091991 | 3300009094 | Bacteria | 927 |
| 153 | Ga0105247_10000599 | 3300009101 | Bacteria | 29233 |
| 154 | Ga0105243_10057395 | 3300009148 | Bacteria | 3099 |
| 155 | Ga0105243_11705909 | 3300009148 | Bacteria | 659 |
| 156 | Ga0105241_10000005 | 3300009174 | Bacteria | 384203 |
| 157 | Ga0105237_10570440 | 3300009545 | Bacteria | 1138 |
| 158 | Ga0105035_122872 | 3300009988 | Bacteria | 598 |
| 159 | Ga0105246_10039104 | 3300011119 | Bacteria | 3193 |
| 160 | Ga0105246_10067378 | 3300011119 | Bacteria | 2508 |
| 161 | Ga0105246_10153798 | 3300011119 | Bacteria | 1744 |
| 162 | Ga0105246_10551199 | 3300011119 | Bacteria | 988 |
| 163 | Ga0105246_10738722 | 3300011119 | Bacteria | 867 |
| 164 | Ga0105246_11213893 | 3300011119 | Bacteria | 695 |
| 165 | Ga0157336_1036166 | 3300012477 | Bacteria | 515 |
| 166 | Ga0157339_1022024 | 3300012505 | Bacteria | 685 |
| 167 | Ga0157373_10002016 | 3300013100 | Bacteria | 15393 |
| 168 | Ga0157373_10003201 | 3300013100 | Bacteria | 12384 |
| 169 | Ga0157373_10009416 | 3300013100 | Bacteria | 7214 |
| 170 | Ga0157373_10016798 | 3300013100 | Bacteria | 5335 |
| 171 | Ga0157373_10321628 | 3300013100 | Bacteria | 1100 |
| 172 | Ga0157371_10000205 | 3300013102 | Bacteria | 86623 |
| 173 | Ga0157371_10000227 | 3300013102 | Bacteria | 81890 |
| 174 | Ga0157371_10003306 | 3300013102 | Bacteria | 14752 |
| 175 | Ga0157371_10080174 | 3300013102 | Bacteria | 2312 |
| 176 | Ga0157371_10102989 | 3300013102 | Bacteria | 2026 |
| 177 | Ga0157370_10000714 | 3300013104 | Bacteria | 41629 |
| 178 | Ga0157370_10574223 | 3300013104 | Bacteria | 1033 |
| 179 | Ga0157370_10761646 | 3300013104 | Bacteria | 882 |
| 180 | Ga0157370_10951553 | 3300013104 | Bacteria | 778 |
| 181 | Ga0157369_10006972 | 3300013105 | Bacteria | 13030 |
| 182 | Ga0157369_11198339 | 3300013105 | Bacteria | 775 |
| 183 | Ga0163162_10120780 | 3300013306 | Bacteria | 2724 |
| 184 | Ga0163162_11901581 | 3300013306 | Bacteria | 681 |
| 185 | Ga0157372_10004082 | 3300013307 | Bacteria | 15656 |
| 186 | Ga0157372_10005425 | 3300013307 | Bacteria | 13553 |
| 187 | Ga0157372_10013441 | 3300013307 | Bacteria | 8745 |
| 188 | Ga0157372_10023649 | 3300013307 | Bacteria | 6665 |
| 189 | Ga0157372_10668620 | 3300013307 | Bacteria | 1209 |
| 190 | Ga0163163_11212573 | 3300014325 | Bacteria | 817 |
| 191 | Ga0182008_10009476 | 3300014497 | Bacteria | 5254 |
| 192 | Ga0182008_10082048 | 3300014497 | Bacteria | 1587 |
| 193 | Ga0182006_1017488 | 3300015261 | Bacteria | 3045 |
| 194 | Ga0182006_1020123 | 3300015261 | Bacteria | 2800 |
| 195 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 196 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 197 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 198 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 199 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 200 | Ga0163161_10004067 | 3300017792 | Bacteria | 10229 |
| 201 | Ga0163161_10574429 | 3300017792 | Bacteria | 927 |
| 202 | Ga0213872_10000790 | 3300021361 | Bacteria | 23116 |
| 203 | Ga0213872_10003376 | 3300021361 | Bacteria | 8887 |
| 204 | Ga0213872_10018711 | 3300021361 | Bacteria | 3193 |
| 205 | Ga0213872_10082389 | 3300021361 | Bacteria | 1444 |
| 206 | Ga0213872_10119754 | 3300021361 | Bacteria | 1164 |
| 207 | Ga0213876_10000016 | 3300021384 | Bacteria | 300175 |
| 208 | Ga0209760_102364 | 3300025207 | Bacteria | 1772 |
| 209 | Ga0209437_100035 | 3300025233 | Bacteria | 481110 |
| 210 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 211 | Ga0209129_1000197 | 3300025258 | Bacteria | 78908 |
| 212 | Ga0209233_1004780 | 3300025261 | Bacteria | 4564 |
| 213 | Ga0209565_1000129 | 3300025263 | Bacteria | 108787 |
| 214 | Ga0209565_1023091 | 3300025263 | Bacteria | 1281 |
| 215 | Ga0209673_1000247 | 3300025273 | Bacteria | 102817 |
| 216 | Ga0209673_1012632 | 3300025273 | Bacteria | 3389 |
| 217 | Ga0209673_1028927 | 3300025273 | Bacteria | 1774 |
| 218 | Ga0209675_1000093 | 3300025291 | Bacteria | 140158 |
| 219 | Ga0209675_1045803 | 3300025291 | Bacteria | 928 |
| 220 | Ga0209676_1054305 | 3300025292 | Bacteria | 1033 |
| 221 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 222 | Ga0209025_1005035 | 3300025294 | Bacteria | 11029 |
| 223 | Ga0209564_1010159 | 3300025295 | Bacteria | 4375 |
| 224 | Ga0209564_1010614 | 3300025295 | Bacteria | 4217 |
| 225 | Ga0209758_1000086 | 3300025297 | Bacteria | 254778 |
| 226 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 227 | Ga0209256_1003843 | 3300025299 | Bacteria | 10044 |
| 228 | Ga0209256_1040612 | 3300025299 | Bacteria | 1187 |
| 229 | Ga0209256_1062741 | 3300025299 | Bacteria | 860 |
| 230 | Ga0207426_1066296 | 3300025302 | Bacteria | 1021 |
| 231 | Ga0207426_1121371 | 3300025302 | Bacteria | 645 |
| 232 | Ga0209257_1000782 | 3300025304 | Bacteria | 46895 |
| 233 | Ga0207697_10183972 | 3300025315 | Bacteria | 916 |
| 234 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 235 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 236 | Ga0207696_1000070 | 3300025711 | Bacteria | 227242 |
| 237 | Ga0207696_1000077 | 3300025711 | Bacteria | 209611 |
| 238 | Ga0207696_1001271 | 3300025711 | Bacteria | 14110 |
| 239 | Ga0207696_1001429 | 3300025711 | Bacteria | 13000 |
| 240 | Ga0207696_1007868 | 3300025711 | Bacteria | 4133 |
| 241 | Ga0207696_1020677 | 3300025711 | Bacteria | 2118 |
| 242 | Ga0207696_1054973 | 3300025711 | Bacteria | 1130 |
| 243 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 244 | Ga0207655_1000009 | 3300025728 | Bacteria | 664676 |
| 245 | Ga0207655_1000060 | 3300025728 | Bacteria | 260572 |
| 246 | Ga0207655_1000280 | 3300025728 | Bacteria | 78923 |
| 247 | Ga0207655_1001774 | 3300025728 | Bacteria | 18829 |
| 248 | Ga0207655_1002461 | 3300025728 | Bacteria | 14998 |
| 249 | Ga0207655_1007053 | 3300025728 | Bacteria | 7356 |
| 250 | Ga0207655_1010499 | 3300025728 | Bacteria | 5606 |
| 251 | Ga0207655_1065520 | 3300025728 | Bacteria | 1378 |
| 252 | Ga0207655_1081611 | 3300025728 | Bacteria | 1165 |
| 253 | Ga0207655_1103939 | 3300025728 | Bacteria | 972 |
| 254 | Ga0207655_1113195 | 3300025728 | Bacteria | 913 |
| 255 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 256 | Ga0207713_1000040 | 3300025735 | Bacteria | 245322 |
| 257 | Ga0207713_1000119 | 3300025735 | Bacteria | 123810 |
| 258 | Ga0207713_1000147 | 3300025735 | Bacteria | 106198 |
| 259 | Ga0207713_1000153 | 3300025735 | Bacteria | 103510 |
| 260 | Ga0207713_1000993 | 3300025735 | Bacteria | 24885 |
| 261 | Ga0207713_1004074 | 3300025735 | Bacteria | 9634 |
| 262 | Ga0207713_1005107 | 3300025735 | Bacteria | 8319 |
| 263 | Ga0207713_1045892 | 3300025735 | Bacteria | 1780 |
| 264 | Ga0207713_1051234 | 3300025735 | Bacteria | 1642 |
| 265 | Ga0207713_1054877 | 3300025735 | Bacteria | 1559 |
| 266 | Ga0207713_1073424 | 3300025735 | Bacteria | 1255 |
| 267 | Ga0207710_10000236 | 3300025900 | Bacteria | 47574 |
| 268 | Ga0207680_11218947 | 3300025903 | Bacteria | 536 |
| 269 | Ga0207684_10054963 | 3300025910 | Bacteria | 3378 |
| 270 | Ga0207654_10000007 | 3300025911 | Bacteria | 384211 |
| 271 | Ga0207695_11452071 | 3300025913 | Bacteria | 566 |
| 272 | Ga0207649_10528882 | 3300025920 | Bacteria | 900 |
| 273 | Ga0207646_10705967 | 3300025922 | Bacteria | 902 |
| 274 | Ga0207681_10407093 | 3300025923 | Bacteria | 1100 |
| 275 | Ga0207700_10231389 | 3300025928 | Bacteria | 1571 |
| 276 | Ga0207706_10070663 | 3300025933 | Bacteria | 3071 |
| 277 | Ga0207709_10044570 | 3300025935 | Bacteria | 2681 |
| 278 | Ga0207709_10055556 | 3300025935 | Bacteria | 2446 |
| 279 | Ga0207709_10183174 | 3300025935 | Bacteria | 1481 |
| 280 | Ga0207709_10623418 | 3300025935 | Bacteria | 856 |
| 281 | Ga0207712_11026129 | 3300025961 | Bacteria | 732 |
| 282 | Ga0207668_10031376 | 3300025972 | Bacteria | 3499 |
| 283 | Ga0207658_10000457 | 3300025986 | Bacteria | 38291 |
| 284 | Ga0207678_10007386 | 3300026067 | Bacteria | 9729 |
| 285 | Ga0207678_11329339 | 3300026067 | Bacteria | 636 |
| 286 | Ga0207678_11650988 | 3300026067 | Bacteria | 564 |
| 287 | Ga0207641_10006656 | 3300026088 | Bacteria | 9700 |
| 288 | Ga0207676_10854850 | 3300026095 | Bacteria | 890 |
| 289 | Ga0207674_10000970 | 3300026116 | Bacteria | 37542 |
| 290 | Ga0209281_1000027 | 3300027111 | Bacteria | 463409 |
| 291 | Ga0209281_1000267 | 3300027111 | Bacteria | 100564 |
| 292 | Ga0209281_1000288 | 3300027111 | Bacteria | 93347 |
| 293 | Ga0209281_1000759 | 3300027111 | Bacteria | 31002 |
| 294 | Ga0209281_1001716 | 3300027111 | Bacteria | 11311 |
| 295 | Ga0209281_1002279 | 3300027111 | Bacteria | 8087 |
| 296 | Ga0209281_1032634 | 3300027111 | Bacteria | 920 |
| 297 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 298 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 299 | Ga0209371_1000081 | 3300027312 | Bacteria | 185440 |
| 300 | Ga0209371_1000085 | 3300027312 | Bacteria | 179586 |
| 301 | Ga0209371_1000167 | 3300027312 | Bacteria | 98922 |
| 302 | Ga0209371_1000225 | 3300027312 | Bacteria | 73767 |
| 303 | Ga0209371_1000574 | 3300027312 | Bacteria | 33236 |
| 304 | Ga0209371_1000772 | 3300027312 | Bacteria | 26570 |
| 305 | Ga0209371_1001412 | 3300027312 | Bacteria | 16457 |
| 306 | Ga0209371_1001426 | 3300027312 | Bacteria | 16286 |
| 307 | Ga0209371_1002585 | 3300027312 | Bacteria | 9955 |
| 308 | Ga0209371_1002941 | 3300027312 | Bacteria | 8883 |
| 309 | Ga0209371_1003378 | 3300027312 | Bacteria | 7829 |
| 310 | Ga0209371_1009480 | 3300027312 | Bacteria | 3090 |
| 311 | Ga0209371_1011106 | 3300027312 | Bacteria | 2701 |
| 312 | Ga0209282_1000187 | 3300027666 | Bacteria | 32999 |
| 313 | Ga0209588_1095078 | 3300027671 | Bacteria | 960 |
| 314 | Ga0209813_10142430 | 3300027866 | Bacteria | 852 |
| 315 | Ga0209974_10351328 | 3300027876 | Bacteria | 572 |
| 316 | Ga0268266_10178251 | 3300028379 | Bacteria | 1933 |
| 317 | Ga0268266_10260574 | 3300028379 | Bacteria | 1607 |
| 318 | Ga0268266_11468416 | 3300028379 | Bacteria | 657 |
| 319 | Ga0268264_10000234 | 3300028381 | Bacteria | 105863 |
| 320 | Ga0268264_10035269 | 3300028381 | Bacteria | 4118 |
| 321 | Ga0268264_10648435 | 3300028381 | Bacteria | 1045 |
| 322 | Ga0307517_10316177 | 3300028786 | Bacteria | 867 |
| 323 | Ga0307515_10110841 | 3300028794 | Bacteria | 3207 |
| 324 | Ga0307515_10136358 | 3300028794 | Bacteria | 2666 |
| 325 | Ga0307515_10181835 | 3300028794 | Bacteria | 2049 |
| 326 | Ga0265338_11023673 | 3300028800 | Bacteria | 558 |
| 327 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 328 | Ga0268256_1000048 | 3300030500 | Bacteria | 312298 |
| 329 | Ga0268256_1000092 | 3300030500 | Bacteria | 144061 |
| 330 | Ga0268256_1000124 | 3300030500 | Bacteria | 111181 |
| 331 | Ga0268256_1000179 | 3300030500 | Bacteria | 74966 |
| 332 | Ga0268256_1000180 | 3300030500 | Bacteria | 74594 |
| 333 | Ga0268256_1001190 | 3300030500 | Bacteria | 16636 |
| 334 | Ga0268256_1002218 | 3300030500 | Bacteria | 10219 |
| 335 | Ga0268256_1002603 | 3300030500 | Bacteria | 9001 |
| 336 | Ga0268256_1002925 | 3300030500 | Bacteria | 8155 |
| 337 | Ga0268256_1003568 | 3300030500 | Bacteria | 6949 |
| 338 | Ga0268256_1004734 | 3300030500 | Bacteria | 5541 |
| 339 | Ga0268256_1009863 | 3300030500 | Bacteria | 3132 |
| 340 | Ga0268256_1012017 | 3300030500 | Bacteria | 2701 |
| 341 | Ga0268256_1047696 | 3300030500 | Bacteria | 920 |
| 342 | Ga0307512_10420569 | 3300030522 | Bacteria | 552 |
| 343 | Ga0316177_1127545 | 3300030731 | Bacteria | 1216 |
| 344 | Ga0316176_1184467 | 3300030732 | Bacteria | 3251 |
| 345 | Ga0314311_1061609 | 3300030733 | Bacteria | 2119 |
| 346 | Ga0316180_1080671 | 3300030736 | Bacteria | 993 |
| 347 | Ga0316183_1094547 | 3300030742 | Bacteria | 1520 |
| 348 | Ga0316181_1035684 | 3300030744 | Bacteria | 1848 |
| 349 | Ga0316182_1063853 | 3300030745 | Bacteria | 776 |
| 350 | Ga0265316_10240578 | 3300031344 | Bacteria | 1331 |
| 351 | Ga0307513_10123475 | 3300031456 | Bacteria | 2551 |
| 352 | Ga0307513_10497360 | 3300031456 | Bacteria | 937 |
| 353 | Ga0307408_100050655 | 3300031548 | Bacteria | 2987 |
| 354 | Ga0307408_100206217 | 3300031548 | Bacteria | 1594 |
| 355 | Ga0307408_100523267 | 3300031548 | Bacteria | 1042 |
| 356 | Ga0265342_10477409 | 3300031712 | Bacteria | 638 |
| 357 | Ga0307516_10013001 | 3300031730 | Bacteria | 8917 |
| 358 | Ga0307405_10020390 | 3300031731 | Bacteria | 3703 |
| 359 | Ga0307405_10104457 | 3300031731 | Bacteria | 1906 |
| 360 | Ga0307405_10584893 | 3300031731 | Bacteria | 909 |
| 361 | Ga0307405_10952301 | 3300031731 | Bacteria | 729 |
| 362 | Ga0307413_10163768 | 3300031824 | Bacteria | 1565 |
| 363 | Ga0307410_10348116 | 3300031852 | Bacteria | 1183 |
| 364 | Ga0307406_10006937 | 3300031901 | Bacteria | 6274 |
| 365 | Ga0307406_12082559 | 3300031901 | Bacteria | 508 |
| 366 | Ga0307412_10012106 | 3300031911 | Bacteria | 5015 |
| 367 | Ga0307412_10015398 | 3300031911 | Bacteria | 4534 |
| 368 | Ga0307412_10047308 | 3300031911 | Bacteria | 2825 |
| 369 | Ga0307412_12189129 | 3300031911 | Bacteria | 514 |
| 370 | Ga0307409_100258062 | 3300031995 | Bacteria | 1598 |
| 371 | Ga0307416_100257473 | 3300032002 | Bacteria | 1703 |
| 372 | Ga0307416_100474753 | 3300032002 | Bacteria | 1309 |
| 373 | Ga0307414_10090460 | 3300032004 | Bacteria | 2271 |
| 374 | Ga0307414_10189050 | 3300032004 | Bacteria | 1664 |
| 375 | Ga0307411_10069441 | 3300032005 | Bacteria | 2379 |
| 376 | Ga0307510_10013811 | 3300033180 | Bacteria | 9573 |
| 377 | Ga0373960_0117509 | 3300035121 | Bacteria | 879 |
| 378 | Ga0373946_0116603 | 3300035171 | Bacteria | 1215 |
| 379 | Ga0373931_0088678 | 3300035691 | Bacteria | 1720 |
| 380 | Ga0373931_1093969 | 3300035691 | Bacteria | 542 |
| 381 | Ga0373927_0218827 | 3300035695 | Bacteria | 1251 |
| 382 | Ga0373927_0311517 | 3300035695 | Bacteria | 1036 |
| 383 | Ga0373927_0805858 | 3300035695 | Bacteria | 620 |
| 384 | Ga0373947_0192378 | 3300035725 | Bacteria | 1332 |
| 385 | Ga0373925_0143656 | 3300037068 | Bacteria | 1869 |
| 386 | Ga0395905_0000257 | 3300037471 | Bacteria | 79555 |
| 387 | Ga0395905_0282787 | 3300037471 | Bacteria | 1545 |
| 388 | Ga0395905_0289351 | 3300037471 | Bacteria | 1525 |
| 389 | Ga0436365_1910565 | 3300039437 | Bacteria | 475219 |
| 390 | Ga0436361_0032811 | 3300039447 | Bacteria | 2646 |
| 391 | Ga0436361_0109679 | 3300039447 | Bacteria | 3733 |
| 392 | Ga0436361_0135836 | 3300039447 | Bacteria | 2692 |
| 393 | Ga0436361_0154673 | 3300039447 | Bacteria | 28644 |
| 394 | Ga0436361_0163575 | 3300039447 | Bacteria | 625 |
| 395 | Ga0436361_0288406 | 3300039447 | Bacteria | 693 |
| 396 | Ga0436361_0573374 | 3300039447 | Bacteria | 1366 |
| 397 | Ga0436361_0651068 | 3300039447 | Bacteria | 1868 |
| 398 | Ga0436361_0670378 | 3300039447 | Bacteria | 11325 |
| 399 | Ga0436361_0897616 | 3300039447 | Bacteria | 3566 |
| 400 | Ga0436361_1086940 | 3300039447 | Bacteria | 8104 |
| 401 | Ga0439436_0029164 | 3300041404 | Bacteria | 1608 |
| 402 | Ga0439438_002824 | 3300041405 | Bacteria | 7248 |
| 403 | Ga0439438_004107 | 3300041405 | Bacteria | 5685 |
| 404 | Ga0439447_002785 | 3300041407 | Bacteria | 6303 |
| 405 | Ga0439447_006056 | 3300041407 | Bacteria | 3966 |
| 406 | Ga0439466_0000003 | 3300041411 | Bacteria | 486229 |
| 407 | Ga0439466_0179647 | 3300041411 | Bacteria | 645 |
| 408 | Ga0451802_1156189 | 3300041460 | Bacteria | 575 |
| 409 | Ga0439431_0080082 | 3300041997 | Bacteria | 880 |
| 410 | Ga0439441_001593 | 3300042001 | Bacteria | 3019 |
| 411 | Ga0439448_0008634 | 3300042005 | Bacteria | 2983 |
| 412 | Ga0439432_064634 | 3300042006 | Bacteria | 1122 |
| 413 | Ga0439432_091620 | 3300042006 | Bacteria | 914 |
| 414 | Ga0439432_145097 | 3300042006 | Bacteria | 697 |
| 415 | Ga0439432_219910 | 3300042006 | Bacteria | 548 |
| 416 | Ga0439449_0016946 | 3300042007 | Bacteria | 2735 |
| 417 | Ga0439449_0128450 | 3300042007 | Bacteria | 942 |
| 418 | Ga0439452_000286 | 3300042010 | Bacteria | 32655 |
| 419 | Ga0439452_002728 | 3300042010 | Bacteria | 6397 |
| 420 | Ga0439452_111627 | 3300042010 | Bacteria | 584 |
| 421 | Ga0439452_119921 | 3300042010 | Bacteria | 560 |
| 422 | Ga0439455_0000139 | 3300042012 | Bacteria | 7794 |
| 423 | Ga0439463_002316 | 3300042016 | Bacteria | 4863 |
| 424 | Ga0450920_010211 | 3300042122 | Bacteria | 1739 |
| 425 | Ga0450921_016919 | 3300042123 | Bacteria | 666 |
| 426 | Ga0450891_012961 | 3300042129 | Bacteria | 780 |
| 427 | Ga0450894_015602 | 3300042131 | Bacteria | 1007 |
| 428 | Ga0450900_002265 | 3300042136 | Bacteria | 2018 |
| 429 | Ga0450902_026915 | 3300042137 | Bacteria | 963 |
| 430 | Ga0450907_000522 | 3300042146 | Bacteria | 10535 |
| 431 | Ga0450910_001740 | 3300042147 | Bacteria | 2793 |
| 432 | Ga0439446_0069717 | 3300042156 | Bacteria | 1074 |
| 433 | Ga0439458_0000087 | 3300042157 | Bacteria | 17544 |
| 434 | Ga0450908_008695 | 3300042184 | Bacteria | 1898 |
| 435 | Ga0450909_012906 | 3300042185 | Bacteria | 1226 |
| 436 | Ga0439434_0002133 | 3300042435 | Bacteria | 5725 |
| 437 | Ga0439459_0075534 | 3300042438 | Bacteria | 787 |
| 438 | Ga0439459_0077365 | 3300042438 | Bacteria | 780 |
| 439 | Ga0439464_0002934 | 3300042439 | Bacteria | 4252 |
| 440 | Ga0450918_003055 | 3300042531 | Bacteria | 3128 |
| 441 | Ga0466981_0000039 | 3300044669 | Bacteria | 47011 |
| 442 | Ga0466966_0707696 | 3300044684 | Bacteria | 607 |
| 443 | Ga0466963_0472413 | 3300044694 | Bacteria | 885 |
| 444 | Ga0466971_0360643 | 3300044719 | Bacteria | 704 |
| 445 | Ga0466957_0004739 | 3300044842 | Bacteria | 7618 |
| 446 | Ga0466960_0174871 | 3300044901 | Bacteria | 1161 |
| 447 | Ga0466958_0000225 | 3300045836 | Bacteria | 21373 |
| 448 | Ga0495617_012232 | 3300046452 | Bacteria | 2923 |
| 449 | Ga0495617_059851 | 3300046452 | Bacteria | 1261 |
| 450 | Ga0495627_000126 | 3300046453 | Bacteria | 93150 |
| 451 | Ga0495627_101739 | 3300046453 | Bacteria | 819 |
| 452 | Ga0495603_0862740 | 3300046455 | Bacteria | 515 |
| 453 | Ga0495590_0039026 | 3300046457 | Bacteria | 1656 |
| 454 | Ga0495591_000014 | 3300046458 | Bacteria | 254281 |
| 455 | Ga0495591_000513 | 3300046458 | Bacteria | 30422 |
| 456 | Ga0495591_001159 | 3300046458 | Bacteria | 17260 |
| 457 | Ga0495629_0446600 | 3300046459 | Bacteria | 876 |
| 458 | Ga0495638_0001144 | 3300046460 | Bacteria | 25617 |
| 459 | Ga0495638_0068175 | 3300046460 | Bacteria | 2182 |
| 460 | Ga0495638_0097500 | 3300046460 | Bacteria | 1762 |
| 461 | Ga0495650_0000032 | 3300046471 | Bacteria | 425389 |
| 462 | Ga0495650_0005870 | 3300046471 | Bacteria | 7813 |
| 463 | Ga0495650_0072474 | 3300046471 | Bacteria | 1348 |
| 464 | Ga0495605_0000008 | 3300046474 | Bacteria | 334602 |
| 465 | Ga0495605_0062590 | 3300046474 | Bacteria | 1777 |
| 466 | Ga0495664_0860657 | 3300046477 | Bacteria | 531 |
| 467 | Ga0495584_0006356 | 3300046491 | Bacteria | 6189 |
| 468 | Ga0495584_0091753 | 3300046491 | Bacteria | 1532 |
| 469 | Ga0495585_0016763 | 3300046492 | Bacteria | 4244 |
| 470 | Ga0495594_0002037 | 3300046499 | Bacteria | 10522 |
| 471 | Ga0495596_0008742 | 3300046500 | Bacteria | 4488 |
| 472 | Ga0495596_0098184 | 3300046500 | Bacteria | 1137 |
| 473 | Ga0495607_0012995 | 3300046501 | Bacteria | 5474 |
| 474 | Ga0495607_0146892 | 3300046501 | Bacteria | 1210 |
| 475 | Ga0495607_0172942 | 3300046501 | Bacteria | 1089 |
| 476 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 477 | Ga0495583_0000039 | 3300046506 | Bacteria | 241501 |
| 478 | Ga0495583_0019768 | 3300046506 | Bacteria | 3507 |
| 479 | Ga0495606_0027092 | 3300046507 | Bacteria | 4070 |
| 480 | Ga0495606_0058565 | 3300046507 | Bacteria | 2475 |
| 481 | Ga0495606_0170422 | 3300046507 | Bacteria | 1263 |
| 482 | Ga0495610_0003131 | 3300046512 | Bacteria | 13161 |
| 483 | Ga0495610_0021139 | 3300046512 | Bacteria | 3585 |
| 484 | Ga0495610_0042835 | 3300046512 | Bacteria | 2260 |
| 485 | Ga0495616_0021460 | 3300046513 | Bacteria | 3498 |
| 486 | Ga0495616_0027628 | 3300046513 | Bacteria | 3009 |
| 487 | Ga0495616_0070236 | 3300046513 | Bacteria | 1696 |
| 488 | Ga0495620_0000031 | 3300046515 | Bacteria | 120343 |
| 489 | Ga0495620_0005635 | 3300046515 | Bacteria | 6970 |
| 490 | Ga0495620_0161484 | 3300046515 | Bacteria | 870 |
| 491 | Ga0495628_0930617 | 3300046516 | Bacteria | 602 |
| 492 | Ga0495631_0005562 | 3300046518 | Bacteria | 6586 |
| 493 | Ga0495631_0009927 | 3300046518 | Bacteria | 4733 |
| 494 | Ga0495631_0014524 | 3300046518 | Bacteria | 3799 |
| 495 | Ga0495632_0005414 | 3300046519 | Bacteria | 8443 |
| 496 | Ga0495632_0031541 | 3300046519 | Bacteria | 2738 |
| 497 | Ga0495637_0018724 | 3300046520 | Bacteria | 3208 |
| 498 | Ga0495637_0078483 | 3300046520 | Bacteria | 1320 |
| 499 | Ga0495637_0081060 | 3300046520 | Bacteria | 1294 |
| 500 | Ga0495643_0015316 | 3300046522 | Bacteria | 4534 |
| 501 | Ga0495643_0018586 | 3300046522 | Bacteria | 4036 |
| 502 | Ga0495643_0050406 | 3300046522 | Bacteria | 2242 |
| 503 | Ga0495644_0082819 | 3300046523 | Bacteria | 1209 |
| 504 | Ga0495648_0000862 | 3300046524 | Bacteria | 31961 |
| 505 | Ga0495648_0004079 | 3300046524 | Bacteria | 12605 |
| 506 | Ga0495648_0032483 | 3300046524 | Bacteria | 3423 |
| 507 | Ga0495648_0034829 | 3300046524 | Bacteria | 3271 |
| 508 | Ga0495648_0363486 | 3300046524 | Bacteria | 657 |
| 509 | Ga0495663_0024138 | 3300046525 | Bacteria | 1766 |
| 510 | Ga0495652_1136041 | 3300046529 | Bacteria | 506 |
| 511 | Ga0495654_0000019 | 3300046530 | Bacteria | 289483 |
| 512 | Ga0495654_0000052 | 3300046530 | Bacteria | 145382 |
| 513 | Ga0495654_0000133 | 3300046530 | Bacteria | 78489 |
| 514 | Ga0495654_0000543 | 3300046530 | Bacteria | 30408 |
| 515 | Ga0495654_0005804 | 3300046530 | Bacteria | 7113 |
| 516 | Ga0495654_0011354 | 3300046530 | Bacteria | 4822 |
| 517 | Ga0495654_0019891 | 3300046530 | Bacteria | 3504 |
| 518 | Ga0495609_0000031 | 3300046538 | Bacteria | 213813 |
| 519 | Ga0495597_0000352 | 3300046542 | Bacteria | 41199 |
| 520 | Ga0495597_0004022 | 3300046542 | Bacteria | 8245 |
| 521 | Ga0495622_0030240 | 3300046557 | Bacteria | 2531 |
| 522 | Ga0495622_0301506 | 3300046557 | Bacteria | 698 |
| 523 | Ga0495633_0000011 | 3300046558 | Bacteria | 268237 |
| 524 | Ga0495633_0384022 | 3300046558 | Bacteria | 635 |
| 525 | Ga0495668_0042377 | 3300046616 | Bacteria | 2534 |
| 526 | Ga0495668_0131230 | 3300046616 | Bacteria | 1371 |
| 527 | Ga0495611_0000645 | 3300046648 | Bacteria | 19981 |
| 528 | Ga0495611_0088192 | 3300046648 | Bacteria | 1432 |
| 529 | Ga0495611_0299196 | 3300046648 | Bacteria | 742 |
| 530 | Ga0495625_0000170 | 3300046660 | Bacteria | 102224 |
| 531 | Ga0495625_0000593 | 3300046660 | Bacteria | 52631 |
| 532 | Ga0495625_0004619 | 3300046660 | Bacteria | 12943 |
| 533 | Ga0495625_0102494 | 3300046660 | Bacteria | 1964 |
| 534 | Ga0495625_0471980 | 3300046660 | Bacteria | 772 |
| 535 | Ga0495661_0000021 | 3300046665 | Bacteria | 194581 |
| 536 | Ga0495661_0012909 | 3300046665 | Bacteria | 5628 |
| 537 | Ga0495588_0031234 | 3300046674 | Bacteria | 2680 |
| 538 | Ga0495588_0032753 | 3300046674 | Bacteria | 2621 |
| 539 | Ga0495588_0082766 | 3300046674 | Bacteria | 1676 |
| 540 | Ga0495658_0308940 | 3300046683 | Bacteria | 1001 |
| 541 | Ga0495624_0769877 | 3300046690 | Bacteria | 570 |
| 542 | Ga0495670_0001750 | 3300046691 | Bacteria | 10657 |
| 543 | Ga0495670_0022065 | 3300046691 | Bacteria | 3143 |
| 544 | Ga0495671_0008541 | 3300046692 | Bacteria | 5755 |
| 545 | Ga0495671_0015296 | 3300046692 | Bacteria | 4115 |
| 546 | Ga0495671_0025517 | 3300046692 | Bacteria | 3071 |
| 547 | Ga0495671_0232068 | 3300046692 | Bacteria | 892 |
| 548 | Ga0495649_0012666 | 3300046694 | Bacteria | 4894 |
| 549 | Ga0495589_0000004 | 3300046794 | Bacteria | 439891 |
| 550 | Ga0495589_0065031 | 3300046794 | Bacteria | 1788 |
| 551 | Ga0495589_0202636 | 3300046794 | Bacteria | 936 |
| 552 | Ga0495660_0000021 | 3300046810 | Bacteria | 293250 |
| 553 | Ga0495660_0002193 | 3300046810 | Bacteria | 12575 |
| 554 | Ga0495660_0056782 | 3300046810 | Bacteria | 2114 |
| 555 | Ga0495660_0160391 | 3300046810 | Bacteria | 1103 |
| 556 | Ga0495672_0000002 | 3300047320 | Bacteria | 740116 |
| 557 | Ga0495672_0000012 | 3300047320 | Bacteria | 519975 |
| 558 | Ga0495672_0000199 | 3300047320 | Bacteria | 85658 |
| 559 | Ga0495672_0001289 | 3300047320 | Bacteria | 24996 |
| 560 | Ga0495672_0062804 | 3300047320 | Bacteria | 2134 |
| 561 | Ga0495672_0171509 | 3300047320 | Bacteria | 1106 |
| 562 | Ga0495676_0111513 | 3300047321 | Bacteria | 2006 |
| 563 | Ga0495683_0000008 | 3300047323 | Bacteria | 241577 |
| 564 | Ga0495687_136321 | 3300047443 | Bacteria | 861 |
| 565 | Ga0495677_0192288 | 3300047445 | Bacteria | 792 |
| 566 | Ga0495679_000020 | 3300047446 | Bacteria | 228413 |
| 567 | Ga0495679_001481 | 3300047446 | Bacteria | 13274 |
| 568 | Ga0495679_002514 | 3300047446 | Bacteria | 9256 |
| 569 | Ga0495679_008134 | 3300047446 | Bacteria | 4293 |
| 570 | Ga0495679_030031 | 3300047446 | Bacteria | 1768 |
| 571 | Ga0495673_0000095 | 3300047469 | Bacteria | 183429 |
| 572 | Ga0495673_0000147 | 3300047469 | Bacteria | 125742 |
| 573 | Ga0495673_0000542 | 3300047469 | Bacteria | 38769 |
| 574 | Ga0495673_0000561 | 3300047469 | Bacteria | 37888 |
| 575 | Ga0495673_0022492 | 3300047469 | Bacteria | 3088 |
| 576 | Ga0495673_0075248 | 3300047469 | Bacteria | 1410 |
| 577 | Ga0495673_0191399 | 3300047469 | Bacteria | 769 |
| 578 | Ga0495681_0000688 | 3300047470 | Bacteria | 25777 |
| 579 | Ga0495681_0008051 | 3300047470 | Bacteria | 6644 |
| 580 | Ga0495681_0015367 | 3300047470 | Bacteria | 4334 |
| 581 | Ga0495681_0025691 | 3300047470 | Bacteria | 3077 |
| 582 | Ga0495681_0140372 | 3300047470 | Bacteria | 1021 |
| 583 | Ga0495686_0000088 | 3300047472 | Bacteria | 195862 |
| 584 | Ga0495686_0005411 | 3300047472 | Bacteria | 10084 |
| 585 | Ga0495686_0024236 | 3300047472 | Bacteria | 3991 |
| 586 | Ga0495686_0074223 | 3300047472 | Bacteria | 2087 |
| 587 | Ga0495686_0079847 | 3300047472 | Bacteria | 2000 |
| 588 | Ga0495686_0174634 | 3300047472 | Bacteria | 1248 |
| 589 | Ga0495686_0244610 | 3300047472 | Bacteria | 1010 |
| 590 | Ga0495686_0381440 | 3300047472 | Bacteria | 760 |
| 591 | Ga0495593_0239542 | 3300047673 | Bacteria | 909 |
| 592 | Ga0495614_0421401 | 3300048089 | Bacteria | 629 |
| 593 | Ga0495626_0043960 | 3300048091 | Bacteria | 2094 |
| 594 | Ga0495626_0143764 | 3300048091 | Bacteria | 1010 |
| 595 | Ga0496101_0000245 | 3300048904 | Bacteria | 39561 |
| 596 | Ga0496101_0066600 | 3300048904 | Bacteria | 2628 |
| 597 | Ga0496101_0437728 | 3300048904 | Bacteria | 1031 |
| 598 | Ga0496102_0004556 | 3300048905 | Bacteria | 11709 |
| 599 | Ga0496102_0087385 | 3300048905 | Bacteria | 2880 |
| 600 | Ga0496102_1532879 | 3300048905 | Bacteria | 585 |
| 601 | Ga0496103_0032158 | 3300048906 | Bacteria | 3201 |
| 602 | Ga0496103_0081389 | 3300048906 | Bacteria | 2037 |
| 603 | Ga0496103_0424713 | 3300048906 | Bacteria | 853 |
| 604 | Ga0496104_0000585 | 3300048907 | Bacteria | 31096 |
| 605 | Ga0496104_0089486 | 3300048907 | Bacteria | 2941 |
| 606 | Ga0496105_0008927 | 3300048908 | Bacteria | 7816 |
| 607 | Ga0496110_0092600 | 3300048913 | Bacteria | 2705 |
| 608 | Ga0496111_0000161 | 3300048914 | Bacteria | 30179 |
| 609 | Ga0496113_0785551 | 3300048916 | Bacteria | 757 |
| 610 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 611 | Ga0496116_0000392 | 3300048919 | Bacteria | 64036 |
| 612 | Ga0496116_0000977 | 3300048919 | Bacteria | 35099 |
| 613 | Ga0496116_0003411 | 3300048919 | Bacteria | 15717 |
| 614 | Ga0496116_0003460 | 3300048919 | Bacteria | 15569 |
| 615 | Ga0496116_0009633 | 3300048919 | Bacteria | 8217 |
| 616 | Ga0496116_0010592 | 3300048919 | Bacteria | 7711 |
| 617 | Ga0496116_0011095 | 3300048919 | Bacteria | 7493 |
| 618 | Ga0496116_0012225 | 3300048919 | Bacteria | 7021 |
| 619 | Ga0496116_0013166 | 3300048919 | Bacteria | 6692 |
| 620 | Ga0496116_0024207 | 3300048919 | Bacteria | 4496 |
| 621 | Ga0496116_0028086 | 3300048919 | Bacteria | 4082 |
| 622 | Ga0496116_0029536 | 3300048919 | Bacteria | 3950 |
| 623 | Ga0496116_0034789 | 3300048919 | Bacteria | 3547 |
| 624 | Ga0496116_0041230 | 3300048919 | Bacteria | 3169 |
| 625 | Ga0496116_0181267 | 3300048919 | Bacteria | 1127 |
| 626 | Ga0496116_0403871 | 3300048919 | Bacteria | 603 |
| 627 | Ga0496116_0407511 | 3300048919 | Bacteria | 599 |
| 628 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 629 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 630 | Ga0496117_0000436 | 3300048920 | Bacteria | 69452 |
| 631 | Ga0496117_0000486 | 3300048920 | Bacteria | 65652 |
| 632 | Ga0496117_0001974 | 3300048920 | Bacteria | 27271 |
| 633 | Ga0496117_0005286 | 3300048920 | Bacteria | 13679 |
| 634 | Ga0496117_0012239 | 3300048920 | Bacteria | 7587 |
| 635 | Ga0496117_0023548 | 3300048920 | Bacteria | 4901 |
| 636 | Ga0496117_0028588 | 3300048920 | Bacteria | 4315 |
| 637 | Ga0496117_0047355 | 3300048920 | Bacteria | 3083 |
| 638 | Ga0496117_0047638 | 3300048920 | Bacteria | 3071 |
| 639 | Ga0496117_0125294 | 3300048920 | Bacteria | 1569 |
| 640 | Ga0496117_0130981 | 3300048920 | Bacteria | 1520 |
| 641 | Ga0496117_0137123 | 3300048920 | Bacteria | 1472 |
| 642 | Ga0496117_0201362 | 3300048920 | Bacteria | 1124 |
| 643 | Ga0496117_0262975 | 3300048920 | Bacteria | 934 |
| 644 | Ga0496117_0287632 | 3300048920 | Bacteria | 877 |
| 645 | Ga0496117_0339961 | 3300048920 | Bacteria | 779 |
| 646 | Ga0496118_0000072 | 3300048921 | Bacteria | 201387 |
| 647 | Ga0496118_0000323 | 3300048921 | Bacteria | 82847 |
| 648 | Ga0496118_0000464 | 3300048921 | Bacteria | 67368 |
| 649 | Ga0496118_0003071 | 3300048921 | Bacteria | 21415 |
| 650 | Ga0496118_0007432 | 3300048921 | Bacteria | 11614 |
| 651 | Ga0496118_0016600 | 3300048921 | Bacteria | 6748 |
| 652 | Ga0496118_0025762 | 3300048921 | Bacteria | 5031 |
| 653 | Ga0496118_0029505 | 3300048921 | Bacteria | 4597 |
| 654 | Ga0496118_0031959 | 3300048921 | Bacteria | 4348 |
| 655 | Ga0496118_0033583 | 3300048921 | Bacteria | 4206 |
| 656 | Ga0496118_0052124 | 3300048921 | Bacteria | 3124 |
| 657 | Ga0496118_0056962 | 3300048921 | Bacteria | 2933 |
| 658 | Ga0496118_0077236 | 3300048921 | Bacteria | 2363 |
| 659 | Ga0496118_0096722 | 3300048921 | Bacteria | 2011 |
| 660 | Ga0496118_0164398 | 3300048921 | Bacteria | 1366 |
| 661 | Ga0496118_0193956 | 3300048921 | Bacteria | 1211 |
| 662 | Ga0496119_0000080 | 3300048922 | Bacteria | 139962 |
| 663 | Ga0496119_0000124 | 3300048922 | Bacteria | 108620 |
| 664 | Ga0496119_0001227 | 3300048922 | Bacteria | 31931 |
| 665 | Ga0496119_0003217 | 3300048922 | Bacteria | 17094 |
| 666 | Ga0496119_0006765 | 3300048922 | Bacteria | 10514 |
| 667 | Ga0496119_0010953 | 3300048922 | Bacteria | 7573 |
| 668 | Ga0496119_0038452 | 3300048922 | Bacteria | 3091 |
| 669 | Ga0496119_0047989 | 3300048922 | Bacteria | 2652 |
| 670 | Ga0496119_0061893 | 3300048922 | Bacteria | 2232 |
| 671 | Ga0496119_0061983 | 3300048922 | Bacteria | 2230 |
| 672 | Ga0496119_0062821 | 3300048922 | Bacteria | 2211 |
| 673 | Ga0496119_0065507 | 3300048922 | Bacteria | 2151 |
| 674 | Ga0496119_0091373 | 3300048922 | Bacteria | 1729 |
| 675 | Ga0496119_0114491 | 3300048922 | Bacteria | 1491 |
| 676 | Ga0496119_0219941 | 3300048922 | Bacteria | 972 |
| 677 | Ga0496119_0257678 | 3300048922 | Bacteria | 877 |
| 678 | Ga0496119_0311586 | 3300048922 | Bacteria | 773 |
| 679 | Ga0496120_0000040 | 3300048923 | Bacteria | 201554 |
| 680 | Ga0496120_0000062 | 3300048923 | Bacteria | 172365 |
| 681 | Ga0496120_0000075 | 3300048923 | Bacteria | 163540 |
| 682 | Ga0496120_0000093 | 3300048923 | Bacteria | 146905 |
| 683 | Ga0496120_0000128 | 3300048923 | Bacteria | 127855 |
| 684 | Ga0496120_0000252 | 3300048923 | Bacteria | 89838 |
| 685 | Ga0496120_0001216 | 3300048923 | Bacteria | 32539 |
| 686 | Ga0496120_0002252 | 3300048923 | Bacteria | 20156 |
| 687 | Ga0496120_0021517 | 3300048923 | Bacteria | 4075 |
| 688 | Ga0496120_0051487 | 3300048923 | Bacteria | 2351 |
| 689 | Ga0496120_0077053 | 3300048923 | Bacteria | 1815 |
| 690 | Ga0496121_0000047 | 3300048924 | Bacteria | 335768 |
| 691 | Ga0496121_0000710 | 3300048924 | Bacteria | 61765 |
| 692 | Ga0496121_0004945 | 3300048924 | Bacteria | 17485 |
| 693 | Ga0496121_0009598 | 3300048924 | Bacteria | 11087 |
| 694 | Ga0496121_0012264 | 3300048924 | Bacteria | 9381 |
| 695 | Ga0496121_0023459 | 3300048924 | Bacteria | 5940 |
| 696 | Ga0496121_0026477 | 3300048924 | Bacteria | 5462 |
| 697 | Ga0496121_0031468 | 3300048924 | Bacteria | 4846 |
| 698 | Ga0496121_0046941 | 3300048924 | Bacteria | 3690 |
| 699 | Ga0496121_0051646 | 3300048924 | Bacteria | 3460 |
| 700 | Ga0496121_0058378 | 3300048924 | Bacteria | 3190 |
| 701 | Ga0496121_0089815 | 3300048924 | Bacteria | 2403 |
| 702 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 703 | Ga0496122_0000211 | 3300048925 | Bacteria | 130145 |
| 704 | Ga0496122_0000356 | 3300048925 | Bacteria | 98548 |
| 705 | Ga0496122_0002991 | 3300048925 | Bacteria | 23011 |
| 706 | Ga0496122_0004390 | 3300048925 | Bacteria | 17562 |
| 707 | Ga0496122_0004632 | 3300048925 | Bacteria | 16911 |
| 708 | Ga0496122_0004795 | 3300048925 | Bacteria | 16537 |
| 709 | Ga0496122_0007725 | 3300048925 | Bacteria | 11838 |
| 710 | Ga0496122_0015166 | 3300048925 | Bacteria | 7384 |
| 711 | Ga0496122_0057668 | 3300048925 | Bacteria | 2882 |
| 712 | Ga0496122_0060226 | 3300048925 | Bacteria | 2797 |
| 713 | Ga0496122_0088576 | 3300048925 | Bacteria | 2120 |
| 714 | Ga0496122_0117011 | 3300048925 | Bacteria | 1731 |
| 715 | Ga0496122_0133976 | 3300048925 | Bacteria | 1566 |
| 716 | Ga0496122_0178217 | 3300048925 | Bacteria | 1271 |
| 717 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 718 | Ga0496123_0000134 | 3300048926 | Bacteria | 153219 |
| 719 | Ga0496123_0000309 | 3300048926 | Bacteria | 94366 |
| 720 | Ga0496123_0000508 | 3300048926 | Bacteria | 67759 |
| 721 | Ga0496123_0001890 | 3300048926 | Bacteria | 27331 |
| 722 | Ga0496123_0005205 | 3300048926 | Bacteria | 13219 |
| 723 | Ga0496123_0007397 | 3300048926 | Bacteria | 10365 |
| 724 | Ga0496123_0009423 | 3300048926 | Bacteria | 8796 |
| 725 | Ga0496123_0012981 | 3300048926 | Bacteria | 7038 |
| 726 | Ga0496123_0017385 | 3300048926 | Bacteria | 5788 |
| 727 | Ga0496123_0031223 | 3300048926 | Bacteria | 3880 |
| 728 | Ga0496123_0034022 | 3300048926 | Bacteria | 3658 |
| 729 | Ga0496123_0035162 | 3300048926 | Bacteria | 3575 |
| 730 | Ga0496123_0083467 | 3300048926 | Bacteria | 1931 |
| 731 | Ga0496123_0145941 | 3300048926 | Bacteria | 1285 |
| 732 | Ga0496124_0000152 | 3300048927 | Bacteria | 140118 |
| 733 | Ga0496124_0000399 | 3300048927 | Bacteria | 79230 |
| 734 | Ga0496124_0001262 | 3300048927 | Bacteria | 38513 |
| 735 | Ga0496124_0002623 | 3300048927 | Bacteria | 23151 |
| 736 | Ga0496124_0004853 | 3300048927 | Bacteria | 15467 |
| 737 | Ga0496124_0009609 | 3300048927 | Bacteria | 9911 |
| 738 | Ga0496124_0015188 | 3300048927 | Bacteria | 7394 |
| 739 | Ga0496124_0017407 | 3300048927 | Bacteria | 6772 |
| 740 | Ga0496124_0056079 | 3300048927 | Bacteria | 3325 |
| 741 | Ga0496124_0061853 | 3300048927 | Bacteria | 3136 |
| 742 | Ga0496124_0093103 | 3300048927 | Bacteria | 2453 |
| 743 | Ga0496124_0108647 | 3300048927 | Bacteria | 2236 |
| 744 | Ga0496124_0118849 | 3300048927 | Bacteria | 2115 |
| 745 | Ga0496124_0122039 | 3300048927 | Bacteria | 2081 |
| 746 | Ga0496124_0125294 | 3300048927 | Bacteria | 2047 |
| 747 | Ga0496124_0150363 | 3300048927 | Bacteria | 1827 |
| 748 | Ga0496124_0205665 | 3300048927 | Bacteria | 1493 |
| 749 | Ga0496124_0250460 | 3300048927 | Bacteria | 1310 |
| 750 | Ga0496124_0282721 | 3300048927 | Bacteria | 1208 |
| 751 | Ga0496124_0316087 | 3300048927 | Bacteria | 1120 |
| 752 | Ga0496124_0360006 | 3300048927 | Bacteria | 1025 |
| 753 | Ga0496124_0360788 | 3300048927 | Bacteria | 1024 |
| 754 | Ga0496125_0001470 | 3300048928 | Bacteria | 34097 |
| 755 | Ga0496125_0002790 | 3300048928 | Bacteria | 22082 |
| 756 | Ga0496125_0004938 | 3300048928 | Bacteria | 15090 |
| 757 | Ga0496125_0005370 | 3300048928 | Bacteria | 14292 |
| 758 | Ga0496125_0006354 | 3300048928 | Bacteria | 12817 |
| 759 | Ga0496125_0008230 | 3300048928 | Bacteria | 10962 |
| 760 | Ga0496125_0036033 | 3300048928 | Bacteria | 4327 |
| 761 | Ga0496125_0040055 | 3300048928 | Bacteria | 4024 |
| 762 | Ga0496125_0046513 | 3300048928 | Bacteria | 3639 |
| 763 | Ga0496125_0088974 | 3300048928 | Bacteria | 2324 |
| 764 | Ga0496125_0155270 | 3300048928 | Bacteria | 1565 |
| 765 | Ga0496125_0452263 | 3300048928 | Bacteria | 735 |
| 766 | Ga0496126_0002540 | 3300048929 | Bacteria | 24417 |
| 767 | Ga0496126_0004794 | 3300048929 | Bacteria | 15896 |
| 768 | Ga0496126_0016875 | 3300048929 | Bacteria | 7288 |
| 769 | Ga0496126_0053895 | 3300048929 | Bacteria | 3646 |
| 770 | Ga0496126_0057225 | 3300048929 | Bacteria | 3521 |
| 771 | Ga0496126_0086386 | 3300048929 | Bacteria | 2765 |
| 772 | Ga0496126_0088816 | 3300048929 | Bacteria | 2721 |
| 773 | Ga0496126_0099053 | 3300048929 | Bacteria | 2553 |
| 774 | Ga0496126_0140114 | 3300048929 | Bacteria | 2083 |
| 775 | Ga0496126_0149019 | 3300048929 | Bacteria | 2006 |
| 776 | Ga0496126_0362190 | 3300048929 | Bacteria | 1184 |
| 777 | Ga0496126_0460397 | 3300048929 | Bacteria | 1022 |
| 778 | Ga0496126_0647246 | 3300048929 | Bacteria | 827 |
| 779 | Ga0496126_1218309 | 3300048929 | Bacteria | 552 |
| 780 | Ga0495678_000018 | 3300049459 | Bacteria | 279747 |
| 781 | Ga0495678_000326 | 3300049459 | Bacteria | 50497 |
| 782 | Ga0495678_110528 | 3300049459 | Bacteria | 937 |
| 783 | Ga0495682_0000015 | 3300049460 | Bacteria | 235048 |
| 784 | Ga0501032_0465938 | 3300049569 | Bacteria | 809 |
| 785 | Ga0501034_0141080 | 3300049571 | Bacteria | 2389 |
| 786 | Ga0501070_0194200 | 3300049586 | Bacteria | 1668 |
| 787 | Ga0501249_003809 | 3300049679 | Bacteria | 3045 |
| 788 | Ga0501083_0432849 | 3300049744 | Bacteria | 856 |
| 789 | Ga0501241_043281 | 3300049758 | Bacteria | 877 |
| 790 | Ga0501262_000750 | 3300049759 | Bacteria | 3746 |
| 791 | Ga0501044_0518336 | 3300049823 | Bacteria | 1092 |
| 792 | nmdc:mga03683_1329_c1 | 3300050489 | Bacteria | 7325 |
| 793 | nmdc:mga03683_3528_c1 | 3300050489 | Bacteria | 5064 |
| 794 | nmdc:mga03683_93757_c1 | 3300050489 | Bacteria | 1312 |
| 795 | nmdc:mga03n38_393046_c1 | 3300050490 | Bacteria | 762 |
| 796 | nmdc:mga00v17_10053_c1 | 3300050491 | Bacteria | 5152 |
| 797 | nmdc:mga00v17_103487_c1 | 3300050491 | Bacteria | 1799 |
| 798 | nmdc:mga00v17_148956_c1 | 3300050491 | Bacteria | 1503 |
| 799 | nmdc:mga00v17_189976_c2 | 3300050491 | Bacteria | 954 |
| 800 | nmdc:mga00v17_272014_c1 | 3300050491 | Bacteria | 1099 |
| 801 | nmdc:mga00v17_34295_c1 | 3300050491 | Bacteria | 3013 |
| 802 | nmdc:mga00v17_3690_c1 | 3300050491 | Bacteria | 7909 |
| 803 | nmdc:mga00v17_588256_c1 | 3300050491 | Bacteria | 718 |
| 804 | nmdc:mga0yw44_126070_c1 | 3300050492 | Bacteria | 1654 |
| 805 | nmdc:mga0yw44_1274_c1 | 3300050492 | Bacteria | 9927 |
| 806 | nmdc:mga0yw44_27822_c1 | 3300050492 | Bacteria | 3244 |
| 807 | nmdc:mga0yw44_74860_c1 | 3300050492 | Bacteria | 2110 |
| 808 | nmdc:mga0k408_168783_c1 | 3300050493 | Bacteria | 1304 |
| 809 | nmdc:mga0k408_265294_c1 | 3300050493 | Bacteria | 1025 |
| 810 | nmdc:mga0k408_887749_c1 | 3300050493 | Bacteria | 517 |
| 811 | nmdc:mga06z11_132579_c1 | 3300050494 | Bacteria | 1401 |
| 812 | nmdc:mga06z11_168114_c2 | 3300050494 | Bacteria | 836 |
| 813 | nmdc:mga06z11_194507_c1 | 3300050494 | Bacteria | 1175 |
| 814 | nmdc:mga06z11_226551_c1 | 3300050494 | Bacteria | 1094 |
| 815 | nmdc:mga06z11_48210_c1 | 3300050494 | Bacteria | 2167 |
| 816 | nmdc:mga06z11_56372_c1 | 3300050494 | Bacteria | 2032 |
| 817 | nmdc:mga06z11_574832_c1 | 3300050494 | Bacteria | 685 |
| 818 | nmdc:mga07m45_151577_c1 | 3300050496 | Bacteria | 1345 |
| 819 | nmdc:mga07m45_2064_c1 | 3300050496 | Bacteria | 9325 |
| 820 | nmdc:mga07m45_40601_c1 | 3300050496 | Bacteria | 2604 |
| 821 | nmdc:mga07m45_750824_c1 | 3300050496 | Bacteria | 560 |
| 822 | nmdc:mga07m45_8640_c1 | 3300050496 | Bacteria | 5244 |
| 823 | nmdc:mga07m45_90266_c1 | 3300050496 | Bacteria | 1755 |
| 824 | nmdc:mga0qj67_1051278_c1 | 3300050509 | Bacteria | 637 |
| 825 | nmdc:mga08y16_870949_c1 | 3300050511 | Bacteria | 889 |
| 826 | nmdc:mga0sz30_142194_c1 | 3300050516 | Bacteria | 702 |
| 827 | nmdc:mga0sz30_222097_c1 | 3300050516 | Bacteria | 840 |
| 828 | nmdc:mga0sz30_55558_c1 | 3300050516 | Bacteria | 1685 |
| 829 | nmdc:mga0sz30_60_c1 | 3300050516 | Bacteria | 41594 |
| 830 | nmdc:mga0sz30_62982_c1 | 3300050516 | Bacteria | 1587 |
| 831 | Ga0500610_0338419 | 3300053079 | Bacteria | 643 |
| 832 | Ga0500578_0043934 | 3300053086 | Bacteria | 2868 |
| 833 | Ga0500578_0229952 | 3300053086 | Bacteria | 1124 |
| 834 | Ga0500643_022579 | 3300053087 | Bacteria | 2022 |
| 835 | Ga0500644_0009424 | 3300053088 | Bacteria | 2610 |
| 836 | Ga0500644_0030964 | 3300053088 | Bacteria | 1697 |
| 837 | Ga0500581_022193 | 3300053089 | Bacteria | 3213 |
| 838 | Ga0500646_0007763 | 3300053090 | Bacteria | 2742 |
| 839 | Ga0500646_0034444 | 3300053090 | Bacteria | 1404 |
| 840 | Ga0500646_0294073 | 3300053090 | Bacteria | 581 |
| 841 | Ga0500647_0215516 | 3300053091 | Bacteria | 863 |
| 842 | Ga0500583_0020595 | 3300053092 | Bacteria | 2726 |
| 843 | Ga0500651_0045653 | 3300053093 | Bacteria | 2756 |
| 844 | Ga0500651_0072986 | 3300053093 | Bacteria | 2133 |
| 845 | Ga0500651_0321046 | 3300053093 | Bacteria | 884 |
| 846 | Ga0500651_0332077 | 3300053093 | Bacteria | 866 |
| 847 | Ga0500566_0000811 | 3300053094 | Bacteria | 17784 |
| 848 | Ga0500566_0002995 | 3300053094 | Bacteria | 10086 |
| 849 | Ga0500641_0000487 | 3300053096 | Bacteria | 14433 |
| 850 | Ga0500641_0004126 | 3300053096 | Bacteria | 5129 |
| 851 | Ga0500650_0004938 | 3300053098 | Bacteria | 4897 |
| 852 | Ga0500554_002001 | 3300053102 | Bacteria | 3953 |
| 853 | Ga0500554_014996 | 3300053102 | Bacteria | 2013 |
| 854 | Ga0500555_051725 | 3300053103 | Bacteria | 1122 |
| 855 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 856 | Ga0500556_0005182 | 3300053104 | Bacteria | 3682 |
| 857 | Ga0500560_001783 | 3300053107 | Bacteria | 3876 |
| 858 | Ga0500562_001145 | 3300053108 | Bacteria | 6527 |
| 859 | Ga0500562_003536 | 3300053108 | Bacteria | 3917 |
| 860 | Ga0500562_120906 | 3300053108 | Bacteria | 714 |
| 861 | Ga0500569_001769 | 3300053109 | Bacteria | 4140 |
| 862 | Ga0500569_007679 | 3300053109 | Bacteria | 2432 |
| 863 | Ga0500592_000371 | 3300053116 | Bacteria | 7518 |
| 864 | Ga0500593_166623 | 3300053117 | Bacteria | 835 |
| 865 | Ga0500594_0009611 | 3300053118 | Bacteria | 2231 |
| 866 | Ga0500595_002159 | 3300053119 | Bacteria | 10004 |
| 867 | Ga0500595_029560 | 3300053119 | Bacteria | 1858 |
| 868 | Ga0500595_133611 | 3300053119 | Bacteria | 698 |
| 869 | Ga0500607_025913 | 3300053121 | Bacteria | 3263 |
| 870 | Ga0500608_000880 | 3300053122 | Bacteria | 10842 |
| 871 | Ga0500618_000285 | 3300053125 | Bacteria | 38522 |
| 872 | Ga0500618_006218 | 3300053125 | Bacteria | 3526 |
| 873 | Ga0500618_014209 | 3300053125 | Bacteria | 2039 |
| 874 | Ga0500618_063036 | 3300053125 | Bacteria | 833 |
| 875 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 876 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 877 | Ga0500652_000160 | 3300053131 | Bacteria | 25768 |
| 878 | Ga0500658_0036578 | 3300053134 | Bacteria | 1948 |
| 879 | Ga0500658_0254220 | 3300053134 | Bacteria | 807 |
| 880 | Ga0500658_0275480 | 3300053134 | Bacteria | 773 |
| 881 | Ga0500559_0000720 | 3300053136 | Bacteria | 21746 |
| 882 | Ga0500559_0003860 | 3300053136 | Bacteria | 7245 |
| 883 | Ga0500559_0055393 | 3300053136 | Bacteria | 1758 |
| 884 | Ga0500559_0189139 | 3300053136 | Bacteria | 970 |
| 885 | Ga0500568_0002010 | 3300053139 | Bacteria | 12384 |
| 886 | Ga0500568_0003440 | 3300053139 | Bacteria | 8824 |
| 887 | Ga0500568_0019147 | 3300053139 | Bacteria | 2981 |
| 888 | Ga0500573_0002805 | 3300053140 | Bacteria | 8833 |
| 889 | Ga0500573_0469929 | 3300053140 | Bacteria | 576 |
| 890 | Ga0500577_0005208 | 3300053142 | Bacteria | 3488 |
| 891 | Ga0500577_0173091 | 3300053142 | Bacteria | 924 |
| 892 | Ga0500577_0260351 | 3300053142 | Bacteria | 754 |
| 893 | Ga0500577_0414707 | 3300053142 | Bacteria | 589 |
| 894 | Ga0500586_000112 | 3300053145 | Bacteria | 14466 |
| 895 | Ga0500588_0099038 | 3300053146 | Bacteria | 1002 |
| 896 | Ga0500588_0159985 | 3300053146 | Bacteria | 819 |
| 897 | Ga0500590_008244 | 3300053148 | Bacteria | 5192 |
| 898 | Ga0500603_066757 | 3300053150 | Bacteria | 1017 |
| 899 | Ga0500604_0000031 | 3300053151 | Bacteria | 57942 |
| 900 | Ga0500604_0037128 | 3300053151 | Bacteria | 1455 |
| 901 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 902 | Ga0500616_0006857 | 3300053153 | Bacteria | 7358 |
| 903 | Ga0500619_169678 | 3300053154 | Bacteria | 739 |
| 904 | Ga0500620_262778 | 3300053155 | Bacteria | 571 |
| 905 | Ga0500622_0000644 | 3300053156 | Bacteria | 31219 |
| 906 | Ga0500622_0001425 | 3300053156 | Bacteria | 19200 |
| 907 | Ga0500622_0028461 | 3300053156 | Bacteria | 2942 |
| 908 | Ga0500622_0422237 | 3300053156 | Bacteria | 536 |
| 909 | Ga0500627_0008907 | 3300053158 | Bacteria | 3590 |
| 910 | Ga0500627_0013247 | 3300053158 | Bacteria | 3119 |
| 911 | Ga0500633_0004174 | 3300053160 | Bacteria | 3277 |
| 912 | Ga0500636_0000222 | 3300053177 | Bacteria | 30908 |
| 913 | Ga0500636_0000309 | 3300053177 | Bacteria | 26814 |
| 914 | Ga0500636_0288935 | 3300053177 | Bacteria | 814 |
| 915 | Ga0500637_0000894 | 3300053178 | Bacteria | 11997 |
| 916 | Ga0500637_0016151 | 3300053178 | Bacteria | 3975 |
| 917 | Ga0500570_155111 | 3300053724 | Bacteria | 804 |
| 918 | Ga0500611_005745 | 3300053727 | Bacteria | 1765 |
| 919 | Ga0500645_008123 | 3300053730 | Bacteria | 3607 |
| 920 | Ga0500645_015065 | 3300053730 | Bacteria | 2456 |
| 921 | Ga0500609_003976 | 3300053731 | Bacteria | 2059 |
| 922 | Ga0500601_000147 | 3300053737 | Bacteria | 14569 |
| 923 | Ga0500661_000365 | 3300055283 | Bacteria | 8344 |
| 924 | Ga0587098_056179 | 3300059604 | Bacteria | 608 |
| 925 | Ga0466962_0096479 | 3300061719 | Bacteria | 1418 |
| 926 | 2506577825 | 2506520007 | Bacteria | 5442880 |
| 927 | 2506582963 | 2506520008 | Bacteria | 5443009 |
| 928 | 2508851785 | 2508501071 | Bacteria | 5454741 |
| 929 | 2511131354 | 2510917022 | Bacteria | 6504556 |
| 930 | 2511382322 | 2511231025 | Bacteria | 5324661 |
| 931 | 2511434105 | 2511231035 | Bacteria | 5341610 |
| 932 | 2548650924 | 2547132416 | Bacteria | 4633861 |
| 933 | 2555260454 | 2554235234 | Bacteria | 5762085 |
| 934 | 2585147582 | 2582581279 | Bacteria | 4980720 |
| 935 | 2585274930 | 2582581307 | Bacteria | 6597605 |
| 936 | 2585561356 | 2585427531 | Bacteria | 6992870 |
| 937 | 2585830019 | 2585427591 | Bacteria | 5482980 |
| 938 | 2585832290 | 2585427592 | Bacteria | 5370892 |
| 939 | 2585846555 | 2585427594 | Bacteria | 6180594 |
| 940 | 2585908049 | 2585427609 | Bacteria | 6667127 |
| 941 | 2587983916 | 2585428125 | Bacteria | 6662905 |
| 942 | 2599411129 | 2599185169 | Bacteria | 5441380 |
| 943 | 2601523560 | 2600255254 | Bacteria | 5281859 |
| 944 | 2601528719 | 2600255255 | Bacteria | 5282785 |
| 945 | 2601536474 | 2600255256 | Bacteria | 5597742 |
| 946 | 2601541897 | 2600255257 | Bacteria | 5597196 |
| 947 | 2601615552 | 2600255280 | Bacteria | 5292309 |
| 948 | 2601620728 | 2600255281 | Bacteria | 5288753 |
| 949 | 2601643379 | 2600255287 | Bacteria | 5210468 |
| 950 | 2601649125 | 2600255288 | Bacteria | 5282738 |
| 951 | 2601653603 | 2600255289 | Bacteria | 5281907 |
| 952 | 2601659023 | 2600255290 | Bacteria | 5282218 |
| 953 | 2601663202 | 2600255291 | Bacteria | 5217298 |
| 954 | 2601696161 | 2600255298 | Bacteria | 5215185 |
| 955 | 2601700835 | 2600255299 | Bacteria | 5218662 |
| 956 | 2601707820 | 2600255300 | Bacteria | 5287774 |
| 957 | 2601712879 | 2600255301 | Bacteria | 5280532 |
| 958 | 2601716862 | 2600255302 | Bacteria | 5288235 |
| 959 | 2601721185 | 2600255303 | Bacteria | 5219315 |
| 960 | 2601724975 | 2600255304 | Bacteria | 5283973 |
| 961 | 2601732258 | 2600255305 | Bacteria | 5282329 |
| 962 | 2601737864 | 2600255306 | Bacteria | 5281613 |
| 963 | 2601744007 | 2600255307 | Bacteria | 5439064 |
| 964 | 2601753393 | 2600255309 | Bacteria | 5431045 |
| 965 | 2601760256 | 2600255310 | Bacteria | 5600903 |
| 966 | 2601765659 | 2600255311 | Bacteria | 5598766 |
| 967 | 2602022020 | 2600255392 | Bacteria | 5437392 |
| 968 | 2603638436 | 2602042046 | Bacteria | 5483348 |
| 969 | 2603642942 | 2602042047 | Bacteria | 4697674 |
| 970 | 2603660585 | 2602042052 | Bacteria | 5215873 |
| 971 | 2603665857 | 2602042053 | Bacteria | 5214361 |
| 972 | 2603699586 | 2602042066 | Bacteria | 4423871 |
| 973 | 2603703550 | 2602042067 | Bacteria | 4863713 |
| 974 | 2603839205 | 2602042103 | Bacteria | 5284714 |
| 975 | 2603844739 | 2602042104 | Bacteria | 5281639 |
| 976 | 2603849362 | 2602042105 | Bacteria | 5282303 |
| 977 | 2603854431 | 2602042106 | Bacteria | 5282744 |
| 978 | 2603858587 | 2602042107 | Bacteria | 6226103 |
| 979 | 2603867469 | 2602042109 | Bacteria | 5152801 |
| 980 | 2603870156 | 2602042110 | Bacteria | 5283285 |
| 981 | 2603875111 | 2602042111 | Bacteria | 5212080 |
| 982 | 2606047347 | 2603880178 | Bacteria | 5283018 |
| 983 | 2606070291 | 2603880184 | Bacteria | 5217896 |
| 984 | 2606146150 | 2603880202 | Bacteria | 5284684 |
| 985 | 2606177077 | 2603880211 | Bacteria | 5284226 |
| 986 | 2608668952 | 2608642108 | Bacteria | 4104624 |
| 987 | 2609910693 | 2609459761 | Bacteria | 5513740 |
| 988 | 2637226056 | 2636415599 | Bacteria | 5718434 |
| 989 | 2644163873 | 2643221628 | Bacteria | 5745828 |
| 990 | 2656278503 | 2654587920 | Bacteria | 5475511 |
| 991 | 2676407756 | 2675903046 | Bacteria | 5451247 |
| 992 | 2681995344 | 2681812866 | Bacteria | 4552357 |
| 993 | 2687579560 | 2687453129 | Bacteria | 4387428 |
| 994 | 2689444350 | 2687453601 | Bacteria | 5546041 |
| 995 | 2738801919 | 2738541293 | Bacteria | 7065685 |
| 996 | 2739790216 | 2739367756 | Bacteria | 4553612 |
| 997 | 2753855470 | 2751185917 | Bacteria | 4551186 |
| 998 | 2775542263 | 2775506706 | Bacteria | 4873073 |
| 999 | 2776910893 | 2775507049 | Bacteria | 6284736 |
| 1000 | 2777020582 | 2775507074 | Bacteria | 5532402 |
| 1001 | 2807177153 | 2806310673 | Bacteria | 4801221 |
| 1002 | 2813729494 | 2811995292 | Bacteria | 5303342 |
| 1003 | 2814696983 | 2814123068 | Bacteria | 5687681 |
| 1004 | 2821119281 | 2821118458 | Bacteria | 4714306 |
| 1005 | 2842680632 | 2842677519 | Bacteria | 5615038 |
| 1006 | 2844427016 | 2844425489 | Bacteria | 4854065 |
| 1007 | 2844530410 | 2844528606 | Bacteria | 4733806 |
| 1008 | 2847088174 | 2847085930 | Bacteria | 5070450 |
| 1009 | 2857526289 | 2857524615 | Bacteria | 6615449 |
| 1010 | 2861694753 | 2861691609 | Bacteria | 5628931 |
| 1011 | 2865015708 | 2865014394 | Bacteria | 4764573 |
| 1012 | 2869553702 | 2869551831 | Bacteria | 5474685 |
| 1013 | 2876602055 | 2876601092 | Bacteria | 5114497 |
| 1014 | 2881612316 | 2881609920 | Bacteria | 4405319 |
| 1015 | 2893067439 | 2893066018 | Bacteria | 6158120 |
| 1016 | 2902406070 | 2902405164 | Bacteria | 6784948 |
| 1017 | 2904437194 | 2904434214 | Bacteria | 6230908 |
| 1018 | 2904505214 | 2904504865 | Bacteria | 5152820 |
| 1019 | 2904517539 | 2904513164 | Bacteria | 5476410 |
| 1020 | 2908670723 | 2908669403 | Bacteria | 5740494 |
| 1021 | 2919073859 | 2919073203 | Bacteria | 6531949 |
| 1022 | 2919112885 | 2919108558 | Bacteria | 5897419 |
| 1023 | 2919463436 | 2919462493 | Bacteria | 5817112 |
| 1024 | 2923638906 | 2923634449 | Bacteria | 4753480 |
| 1025 | 2927834602 | 2927833300 | Bacteria | 4923934 |
| 1026 | 2928118499 | 2928115317 | Bacteria | 6477646 |
| 1027 | 2928125921 | 2928125067 | Bacteria | 5937560 |
| 1028 | 2929525933 | 2929520902 | Bacteria | 6765052 |
| 1029 | 2937543304 | 2937539931 | Bacteria | 4639830 |
| 1030 | 2939568671 | 2939568625 | Bacteria | 4542555 |
| 1031 | 2939602608 | 2939602548 | Bacteria | 4950493 |
| 1032 | 2939607981 | 2939607340 | Bacteria | 4719256 |
| 1033 | 2939644284 | 2939642701 | Bacteria | 4475280 |
| 1034 | 2945878623 | 2945874760 | Bacteria | 5527237 |
| 1035 | 2945953542 | 2945951305 | Bacteria | 4918162 |
| 1036 | 2969083068 | 2969079654 | Bacteria | 5439582 |
| 1037 | 2971824346 | 2971820967 | Bacteria | 5823634 |
| 1038 | 2978976035 | 2978975091 | Bacteria | 4704313 |
| 1039 | 2984560086 | 2984559226 | Bacteria | 5683096 |
| 1040 | 2984598168 | 2984595703 | Bacteria | 5682994 |
| 1041 | 640937353 | 640753048 | Bacteria | 5495657 |
| 1042 | 8016736434 | 8016733728 | Bacteria | 5274317 |
| 1043 | 8018225426 | 8018221730 | Bacteria | 4616064 |
| 1044 | 8019503105 | 8019499862 | Bacteria | 5169538 |
| 1045 | 8054844769 | 8054844752 | Bacteria | 4450330 |
| 1046 | 8055088594 | 8055087960 | Bacteria | 4784273 |
| 1047 | 8055094172 | 8055092621 | Bacteria | 4873875 |
| 1048 | Ga0495591_008678 | |||
| 1049 | SwRhRL2b_contig_2020483 | |||
| 1050 | SwRhRL2b_contig_605692 | |||
| 1051 | JGI25162J39368_1014135 | |||
| 1052 | JGI25152J39213_1001256 | |||
| 1053 | JGI25150J39212_1000010 | |||
| 1054 | JGI25151J46595_10000026 | |||
| 1055 | JGI25406J46586_10064863 | |||
| 1056 | JGI25165J46597_1020337 | |||
| 1057 | JGI25153J46596_10000590 | |||
| 1058 | JGI25153J46596_10003622 | |||
| 1059 | rootH1_10132492 | |||
| 1060 | rootH2_10059718 | |||
| 1061 | rootH2_10087853 | |||
| 1062 | rootL2_10013653 | |||
| 1063 | rootH1_10006414 | |||
| 1064 | rootH1_10206025 | |||
| 1065 | Ga0055526_1038075 | |||
| 1066 | Ga0055537_1000502 | |||
| 1067 | Ga0055524_1023191 | |||
| 1068 | Ga0055534_1000242 | |||
| 1069 | Ga0055528_1001320 | |||
| 1070 | Ga0055528_1035157 | |||
| 1071 | Ga0055531_10004450 | |||
| 1072 | Ga0058692_1000058 | |||
| 1073 | Ga0058692_1000076 | |||
| 1074 | Ga0058692_1000362 | |||
| 1075 | Ga0058692_1004662 | |||
| 1076 | Ga0058692_1010094 | |||
| 1077 | Ga0058692_1010098 | |||
| 1078 | Ga0055543_1007142 | |||
| 1079 | Ga0065165_1001689 | |||
| 1080 | Ga0065165_1004567 | |||
| 1081 | Ga0065703_1021363 | |||
| 1082 | Ga0065714_10006253 | |||
| 1083 | Ga0065714_10260811 | |||
| 1084 | Ga0065704_10000722 | |||
| 1085 | Ga0065704_10004428 | |||
| 1086 | Ga0065704_10006660 | |||
| 1087 | Ga0065704_10087996 | |||
| 1088 | Ga0065704_10111960 | |||
| 1089 | Ga0070676_10600126 | |||
| 1090 | Ga0070666_11258153 | |||
| 1091 | Ga0070682_101372518 | |||
| 1092 | Ga0070660_101114689 | |||
| 1093 | Ga0070661_100318601 | |||
| 1094 | Ga0070668_100001252 | |||
| 1095 | Ga0070667_100000111 | |||
| 1096 | Ga0070714_100619656 | |||
| 1097 | Ga0070710_10348198 | |||
| 1098 | Ga0070711_100680376 | |||
| 1099 | Ga0070694_101024057 | |||
| 1100 | Ga0070663_100138807 | |||
| 1101 | Ga0070663_100670201 | |||
| 1102 | Ga0070662_100084696 | |||
| 1103 | Ga0070706_100455253 | |||
| 1104 | Ga0070665_100049105 | |||
| 1105 | Ga0070665_100228851 | |||
| 1106 | Ga0070665_100617725 | |||
| 1107 | Ga0068864_100568487 | |||
| 1108 | Ga0068863_100008694 | |||
| 1109 | Ga0068860_100000176 | |||
| 1110 | Ga0068860_100134520 | |||
| 1111 | Ga0068860_100353204 | |||
| 1112 | Ga0068860_101254259 | |||
| 1113 | Ga0081455_10013447 | |||
| 1114 | Ga0081539_10001642 | |||
| 1115 | Ga0081539_10010459 | |||
| 1116 | Ga0075365_10022409 | |||
| 1117 | Ga0075365_10076612 | |||
| 1118 | Ga0075365_10191551 | |||
| 1119 | Ga0075368_10154439 | |||
| 1120 | Ga0075368_10530006 | |||
| 1121 | Ga0075363_100625451 | |||
| 1122 | Ga0075363_100691325 | |||
| 1123 | Ga0075364_10011159 | |||
| 1124 | Ga0075364_10020445 | |||
| 1125 | Ga0075364_10029099 | |||
| 1126 | Ga0075364_10050371 | |||
| 1127 | Ga0075364_10085687 | |||
| 1128 | Ga0075364_10296173 | |||
| 1129 | Ga0075364_10331026 | |||
| 1130 | Ga0075364_10379985 | |||
| 1131 | Ga0075364_10764937 | |||
| 1132 | Ga0075364_10793956 | |||
| 1133 | Ga0075364_10996527 | |||
| 1134 | Ga0075432_10265897 | |||
| 1135 | Ga0075362_10002076 | |||
| 1136 | Ga0075362_10018790 | |||
| 1137 | Ga0075362_10032651 | |||
| 1138 | Ga0075362_10046781 | |||
| 1139 | Ga0075362_10306003 | |||
| 1140 | Ga0075367_10037444 | |||
| 1141 | Ga0075367_10041045 | |||
| 1142 | Ga0075367_10119300 | |||
| 1143 | Ga0075367_10175023 | |||
| 1144 | Ga0075367_10453810 | |||
| 1145 | Ga0075367_10513342 | |||
| 1146 | Ga0075369_10005321 | |||
| 1147 | Ga0075369_10012237 | |||
| 1148 | Ga0075369_10013788 | |||
| 1149 | Ga0075369_10095193 | |||
| 1150 | Ga0075369_10345690 | |||
| 1151 | Ga0075366_10021195 | |||
| 1152 | Ga0075366_10273858 | |||
| 1153 | Ga0075366_10904683 | |||
| 1154 | Ga0075370_10039894 | |||
| 1155 | Ga0075370_10203005 | |||
| 1156 | Ga0075370_10438065 | |||
| 1157 | Ga0068871_100871039 | |||
| 1158 | Ga0079104_1006009 | |||
| 1159 | Ga0079104_1011871 | |||
| 1160 | Ga0079104_1011876 | |||
| 1161 | Ga0079104_1012532 | |||
| 1162 | Ga0079104_1034418 | |||
| 1163 | Ga0079104_1059619 | |||
| 1164 | Ga0079104_1060234 | |||
| 1165 | Ga0099826_10000457 | |||
| 1166 | Ga0099794_10054552 | |||
| 1167 | Ga0099794_10211048 | |||
| 1168 | Ga0105251_10000465 | |||
| 1169 | Ga0105251_10000606 | |||
| 1170 | Ga0105251_10001506 | |||
| 1171 | Ga0105251_10001643 | |||
| 1172 | Ga0105251_10005434 | |||
| 1173 | Ga0105251_10008672 | |||
| 1174 | Ga0105251_10009938 | |||
| 1175 | Ga0105251_10021637 | |||
| 1176 | Ga0105251_10107007 | |||
| 1177 | Ga0105244_10000942 | |||
| 1178 | Ga0105244_10001226 | |||
| 1179 | Ga0105244_10001277 | |||
| 1180 | Ga0105244_10002704 | |||
| 1181 | Ga0105244_10009582 | |||
| 1182 | Ga0105244_10018705 | |||
| 1183 | Ga0105244_10039184 | |||
| 1184 | Ga0105244_10087058 | |||
| 1185 | Ga0105244_10115042 | |||
| 1186 | Ga0105244_10146959 | |||
| 1187 | Ga0105244_10150545 | |||
| 1188 | Ga0105244_10599311 | |||
| 1189 | Ga0105250_10001600 | |||
| 1190 | Ga0105250_10005696 | |||
| 1191 | Ga0105250_10009361 | |||
| 1192 | Ga0105250_10012703 | |||
| 1193 | Ga0105250_10030647 | |||
| 1194 | Ga0105250_10032752 | |||
| 1195 | Ga0105250_10080016 | |||
| 1196 | Ga0105240_10523173 | |||
| 1197 | Ga0105240_10594556 | |||
| 1198 | Ga0105240_12166780 | |||
| 1199 | Ga0111539_11091991 | |||
| 1200 | Ga0105247_10000599 | |||
| 1201 | Ga0105243_10057395 | |||
| 1202 | Ga0105243_11705909 | |||
| 1203 | Ga0105241_10000005 | |||
| 1204 | Ga0105237_10570440 | |||
| 1205 | Ga0105035_122872 | |||
| 1206 | Ga0105246_10039104 | |||
| 1207 | Ga0105246_10067378 | |||
| 1208 | Ga0105246_10153798 | |||
| 1209 | Ga0105246_10551199 | |||
| 1210 | Ga0105246_10738722 | |||
| 1211 | Ga0105246_11213893 | |||
| 1212 | Ga0157336_1036166 | |||
| 1213 | Ga0157339_1022024 | |||
| 1214 | Ga0157373_10002016 | |||
| 1215 | Ga0157373_10003201 | |||
| 1216 | Ga0157373_10009416 | |||
| 1217 | Ga0157373_10016798 | |||
| 1218 | Ga0157373_10321628 | |||
| 1219 | Ga0157371_10000205 | |||
| 1220 | Ga0157371_10000227 | |||
| 1221 | Ga0157371_10003306 | |||
| 1222 | Ga0157371_10080174 | |||
| 1223 | Ga0157371_10102989 | |||
| 1224 | Ga0157370_10000714 | |||
| 1225 | Ga0157370_10574223 | |||
| 1226 | Ga0157370_10761646 | |||
| 1227 | Ga0157370_10951553 | |||
| 1228 | Ga0157369_10006972 | |||
| 1229 | Ga0157369_11198339 | |||
| 1230 | Ga0163162_10120780 | |||
| 1231 | Ga0163162_11901581 | |||
| 1232 | Ga0157372_10004082 | |||
| 1233 | Ga0157372_10005425 | |||
| 1234 | Ga0157372_10013441 | |||
| 1235 | Ga0157372_10023649 | |||
| 1236 | Ga0157372_10668620 | |||
| 1237 | Ga0163163_11212573 | |||
| 1238 | Ga0182008_10009476 | |||
| 1239 | Ga0182008_10082048 | |||
| 1240 | Ga0182006_1017488 | |||
| 1241 | Ga0182006_1020123 | |||
| 1242 | Ga0183366_1001 | |||
| 1243 | Ga0183370_1001 | |||
| 1244 | Ga0183369_1001 | |||
| 1245 | Ga0183368_1001 | |||
| 1246 | Ga0163161_10000001 | |||
| 1247 | Ga0163161_10004067 | |||
| 1248 | Ga0163161_10574429 | |||
| 1249 | Ga0213872_10000790 | |||
| 1250 | Ga0213872_10003376 | |||
| 1251 | Ga0213872_10018711 | |||
| 1252 | Ga0213872_10082389 | |||
| 1253 | Ga0213872_10119754 | |||
| 1254 | Ga0213876_10000016 | |||
| 1255 | Ga0209760_102364 | |||
| 1256 | Ga0209437_100035 | |||
| 1257 | Ga0207425_1000010 | |||
| 1258 | Ga0209129_1000197 | |||
| 1259 | Ga0209233_1004780 | |||
| 1260 | Ga0209565_1000129 | |||
| 1261 | Ga0209565_1023091 | |||
| 1262 | Ga0209673_1000247 | |||
| 1263 | Ga0209673_1012632 | |||
| 1264 | Ga0209673_1028927 | |||
| 1265 | Ga0209675_1000093 | |||
| 1266 | Ga0209675_1045803 | |||
| 1267 | Ga0209676_1054305 | |||
| 1268 | Ga0209025_1000022 | |||
| 1269 | Ga0209025_1005035 | |||
| 1270 | Ga0209564_1010159 | |||
| 1271 | Ga0209564_1010614 | |||
| 1272 | Ga0209758_1000086 | |||
| 1273 | Ga0209758_1000216 | |||
| 1274 | Ga0209256_1003843 | |||
| 1275 | Ga0209256_1040612 | |||
| 1276 | Ga0209256_1062741 | |||
| 1277 | Ga0207426_1066296 | |||
| 1278 | Ga0207426_1121371 | |||
| 1279 | Ga0209257_1000782 | |||
| 1280 | Ga0207697_10183972 | |||
| 1281 | Ga0207696_1000001 | |||
| 1282 | Ga0207696_1000004 | |||
| 1283 | Ga0207696_1000070 | |||
| 1284 | Ga0207696_1000077 | |||
| 1285 | Ga0207696_1001271 | |||
| 1286 | Ga0207696_1001429 | |||
| 1287 | Ga0207696_1007868 | |||
| 1288 | Ga0207696_1020677 | |||
| 1289 | Ga0207696_1054973 | |||
| 1290 | Ga0207655_1000001 | |||
| 1291 | Ga0207655_1000009 | |||
| 1292 | Ga0207655_1000060 | |||
| 1293 | Ga0207655_1000280 | |||
| 1294 | Ga0207655_1001774 | |||
| 1295 | Ga0207655_1002461 | |||
| 1296 | Ga0207655_1007053 | |||
| 1297 | Ga0207655_1010499 | |||
| 1298 | Ga0207655_1065520 | |||
| 1299 | Ga0207655_1081611 | |||
| 1300 | Ga0207655_1103939 | |||
| 1301 | Ga0207655_1113195 | |||
| 1302 | Ga0207713_1000001 | |||
| 1303 | Ga0207713_1000040 | |||
| 1304 | Ga0207713_1000119 | |||
| 1305 | Ga0207713_1000147 | |||
| 1306 | Ga0207713_1000153 | |||
| 1307 | Ga0207713_1000993 | |||
| 1308 | Ga0207713_1004074 | |||
| 1309 | Ga0207713_1005107 | |||
| 1310 | Ga0207713_1045892 | |||
| 1311 | Ga0207713_1051234 | |||
| 1312 | Ga0207713_1054877 | |||
| 1313 | Ga0207713_1073424 | |||
| 1314 | Ga0207710_10000236 | |||
| 1315 | Ga0207680_11218947 | |||
| 1316 | Ga0207684_10054963 | |||
| 1317 | Ga0207654_10000007 | |||
| 1318 | Ga0207695_11452071 | |||
| 1319 | Ga0207649_10528882 | |||
| 1320 | Ga0207646_10705967 | |||
| 1321 | Ga0207681_10407093 | |||
| 1322 | Ga0207700_10231389 | |||
| 1323 | Ga0207706_10070663 | |||
| 1324 | Ga0207709_10044570 | |||
| 1325 | Ga0207709_10055556 | |||
| 1326 | Ga0207709_10183174 | |||
| 1327 | Ga0207709_10623418 | |||
| 1328 | Ga0207712_11026129 | |||
| 1329 | Ga0207668_10031376 | |||
| 1330 | Ga0207658_10000457 | |||
| 1331 | Ga0207678_10007386 | |||
| 1332 | Ga0207678_11329339 | |||
| 1333 | Ga0207678_11650988 | |||
| 1334 | Ga0207641_10006656 | |||
| 1335 | Ga0207676_10854850 | |||
| 1336 | Ga0207674_10000970 | |||
| 1337 | Ga0209281_1000027 | |||
| 1338 | Ga0209281_1000267 | |||
| 1339 | Ga0209281_1000288 | |||
| 1340 | Ga0209281_1000759 | |||
| 1341 | Ga0209281_1001716 | |||
| 1342 | Ga0209281_1002279 | |||
| 1343 | Ga0209281_1032634 | |||
| 1344 | Ga0209371_1000001 | |||
| 1345 | Ga0209371_1000010 | |||
| 1346 | Ga0209371_1000081 | |||
| 1347 | Ga0209371_1000085 | |||
| 1348 | Ga0209371_1000167 | |||
| 1349 | Ga0209371_1000225 | |||
| 1350 | Ga0209371_1000574 | |||
| 1351 | Ga0209371_1000772 | |||
| 1352 | Ga0209371_1001412 | |||
| 1353 | Ga0209371_1001426 | |||
| 1354 | Ga0209371_1002585 | |||
| 1355 | Ga0209371_1002941 | |||
| 1356 | Ga0209371_1003378 | |||
| 1357 | Ga0209371_1009480 | |||
| 1358 | Ga0209371_1011106 | |||
| 1359 | Ga0209282_1000187 | |||
| 1360 | Ga0209588_1095078 | |||
| 1361 | Ga0209813_10142430 | |||
| 1362 | Ga0209974_10351328 | |||
| 1363 | Ga0268266_10178251 | |||
| 1364 | Ga0268266_10260574 | |||
| 1365 | Ga0268266_11468416 | |||
| 1366 | Ga0268264_10000234 | |||
| 1367 | Ga0268264_10035269 | |||
| 1368 | Ga0268264_10648435 | |||
| 1369 | Ga0307517_10316177 | |||
| 1370 | Ga0307515_10110841 | |||
| 1371 | Ga0307515_10136358 | |||
| 1372 | Ga0307515_10181835 | |||
| 1373 | Ga0265338_11023673 | |||
| 1374 | Ga0268256_1000001 | |||
| 1375 | Ga0268256_1000048 | |||
| 1376 | Ga0268256_1000092 | |||
| 1377 | Ga0268256_1000124 | |||
| 1378 | Ga0268256_1000179 | |||
| 1379 | Ga0268256_1000180 | |||
| 1380 | Ga0268256_1001190 | |||
| 1381 | Ga0268256_1002218 | |||
| 1382 | Ga0268256_1002603 | |||
| 1383 | Ga0268256_1002925 | |||
| 1384 | Ga0268256_1003568 | |||
| 1385 | Ga0268256_1004734 | |||
| 1386 | Ga0268256_1009863 | |||
| 1387 | Ga0268256_1012017 | |||
| 1388 | Ga0268256_1047696 | |||
| 1389 | Ga0307512_10420569 | |||
| 1390 | Ga0316177_1127545 | |||
| 1391 | Ga0316176_1184467 | |||
| 1392 | Ga0314311_1061609 | |||
| 1393 | Ga0316180_1080671 | |||
| 1394 | Ga0316183_1094547 | |||
| 1395 | Ga0316181_1035684 | |||
| 1396 | Ga0316182_1063853 | |||
| 1397 | Ga0265316_10240578 | |||
| 1398 | Ga0307513_10123475 | |||
| 1399 | Ga0307513_10497360 | |||
| 1400 | Ga0307408_100050655 | |||
| 1401 | Ga0307408_100206217 | |||
| 1402 | Ga0307408_100523267 | |||
| 1403 | Ga0265342_10477409 | |||
| 1404 | Ga0307516_10013001 | |||
| 1405 | Ga0307405_10020390 | |||
| 1406 | Ga0307405_10104457 | |||
| 1407 | Ga0307405_10584893 | |||
| 1408 | Ga0307405_10952301 | |||
| 1409 | Ga0307413_10163768 | |||
| 1410 | Ga0307410_10348116 | |||
| 1411 | Ga0307406_10006937 | |||
| 1412 | Ga0307406_12082559 | |||
| 1413 | Ga0307412_10012106 | |||
| 1414 | Ga0307412_10015398 | |||
| 1415 | Ga0307412_10047308 | |||
| 1416 | Ga0307412_12189129 | |||
| 1417 | Ga0307409_100258062 | |||
| 1418 | Ga0307416_100257473 | |||
| 1419 | Ga0307416_100474753 | |||
| 1420 | Ga0307414_10090460 | |||
| 1421 | Ga0307414_10189050 | |||
| 1422 | Ga0307411_10069441 | |||
| 1423 | Ga0307510_10013811 | |||
| 1424 | Ga0373960_0117509 | |||
| 1425 | Ga0373946_0116603 | |||
| 1426 | Ga0373931_0088678 | |||
| 1427 | Ga0373931_1093969 | |||
| 1428 | Ga0373927_0218827 | |||
| 1429 | Ga0373927_0311517 | |||
| 1430 | Ga0373927_0805858 | |||
| 1431 | Ga0373947_0192378 | |||
| 1432 | Ga0373925_0143656 | |||
| 1433 | Ga0395905_0000257 | |||
| 1434 | Ga0395905_0282787 | |||
| 1435 | Ga0395905_0289351 | |||
| 1436 | Ga0436365_1910565 | |||
| 1437 | Ga0436361_0032811 | |||
| 1438 | Ga0436361_0109679 | |||
| 1439 | Ga0436361_0135836 | |||
| 1440 | Ga0436361_0154673 | |||
| 1441 | Ga0436361_0163575 | |||
| 1442 | Ga0436361_0288406 | |||
| 1443 | Ga0436361_0573374 | |||
| 1444 | Ga0436361_0651068 | |||
| 1445 | Ga0436361_0670378 | |||
| 1446 | Ga0436361_0897616 | |||
| 1447 | Ga0436361_1086940 | |||
| 1448 | Ga0439436_0029164 | |||
| 1449 | Ga0439438_002824 | |||
| 1450 | Ga0439438_004107 | |||
| 1451 | Ga0439447_002785 | |||
| 1452 | Ga0439447_006056 | |||
| 1453 | Ga0439466_0000003 | |||
| 1454 | Ga0439466_0179647 | |||
| 1455 | Ga0451802_1156189 | |||
| 1456 | Ga0439431_0080082 | |||
| 1457 | Ga0439441_001593 | |||
| 1458 | Ga0439448_0008634 | |||
| 1459 | Ga0439432_064634 | |||
| 1460 | Ga0439432_091620 | |||
| 1461 | Ga0439432_145097 | |||
| 1462 | Ga0439432_219910 | |||
| 1463 | Ga0439449_0016946 | |||
| 1464 | Ga0439449_0128450 | |||
| 1465 | Ga0439452_000286 | |||
| 1466 | Ga0439452_002728 | |||
| 1467 | Ga0439452_111627 | |||
| 1468 | Ga0439452_119921 | |||
| 1469 | Ga0439455_0000139 | |||
| 1470 | Ga0439463_002316 | |||
| 1471 | Ga0450920_010211 | |||
| 1472 | Ga0450921_016919 | |||
| 1473 | Ga0450891_012961 | |||
| 1474 | Ga0450894_015602 | |||
| 1475 | Ga0450900_002265 | |||
| 1476 | Ga0450902_026915 | |||
| 1477 | Ga0450907_000522 | |||
| 1478 | Ga0450910_001740 | |||
| 1479 | Ga0439446_0069717 | |||
| 1480 | Ga0439458_0000087 | |||
| 1481 | Ga0450908_008695 | |||
| 1482 | Ga0450909_012906 | |||
| 1483 | Ga0439434_0002133 | |||
| 1484 | Ga0439459_0075534 | |||
| 1485 | Ga0439459_0077365 | |||
| 1486 | Ga0439464_0002934 | |||
| 1487 | Ga0450918_003055 | |||
| 1488 | Ga0466981_0000039 | |||
| 1489 | Ga0466966_0707696 | |||
| 1490 | Ga0466963_0472413 | |||
| 1491 | Ga0466971_0360643 | |||
| 1492 | Ga0466957_0004739 | |||
| 1493 | Ga0466960_0174871 | |||
| 1494 | Ga0466958_0000225 | |||
| 1495 | Ga0495617_012232 | |||
| 1496 | Ga0495617_059851 | |||
| 1497 | Ga0495627_000126 | |||
| 1498 | Ga0495627_101739 | |||
| 1499 | Ga0495603_0862740 | |||
| 1500 | Ga0495590_0039026 | |||
| 1501 | Ga0495591_000014 | |||
| 1502 | Ga0495591_000513 | |||
| 1503 | Ga0495591_001159 | |||
| 1504 | Ga0495629_0446600 | |||
| 1505 | Ga0495638_0001144 | |||
| 1506 | Ga0495638_0068175 | |||
| 1507 | Ga0495638_0097500 | |||
| 1508 | Ga0495650_0000032 | |||
| 1509 | Ga0495650_0005870 | |||
| 1510 | Ga0495650_0072474 | |||
| 1511 | Ga0495605_0000008 | |||
| 1512 | Ga0495605_0062590 | |||
| 1513 | Ga0495664_0860657 | |||
| 1514 | Ga0495584_0006356 | |||
| 1515 | Ga0495584_0091753 | |||
| 1516 | Ga0495585_0016763 | |||
| 1517 | Ga0495594_0002037 | |||
| 1518 | Ga0495596_0008742 | |||
| 1519 | Ga0495596_0098184 | |||
| 1520 | Ga0495607_0012995 | |||
| 1521 | Ga0495607_0146892 | |||
| 1522 | Ga0495607_0172942 | |||
| 1523 | Ga0495583_0000002 | |||
| 1524 | Ga0495583_0000039 | |||
| 1525 | Ga0495583_0019768 | |||
| 1526 | Ga0495606_0027092 | |||
| 1527 | Ga0495606_0058565 | |||
| 1528 | Ga0495606_0170422 | |||
| 1529 | Ga0495610_0003131 | |||
| 1530 | Ga0495610_0021139 | |||
| 1531 | Ga0495610_0042835 | |||
| 1532 | Ga0495616_0021460 | |||
| 1533 | Ga0495616_0027628 | |||
| 1534 | Ga0495616_0070236 | |||
| 1535 | Ga0495620_0000031 | |||
| 1536 | Ga0495620_0005635 | |||
| 1537 | Ga0495620_0161484 | |||
| 1538 | Ga0495628_0930617 | |||
| 1539 | Ga0495631_0005562 | |||
| 1540 | Ga0495631_0009927 | |||
| 1541 | Ga0495631_0014524 | |||
| 1542 | Ga0495632_0005414 | |||
| 1543 | Ga0495632_0031541 | |||
| 1544 | Ga0495637_0018724 | |||
| 1545 | Ga0495637_0078483 | |||
| 1546 | Ga0495637_0081060 | |||
| 1547 | Ga0495643_0015316 | |||
| 1548 | Ga0495643_0018586 | |||
| 1549 | Ga0495643_0050406 | |||
| 1550 | Ga0495644_0082819 | |||
| 1551 | Ga0495648_0000862 | |||
| 1552 | Ga0495648_0004079 | |||
| 1553 | Ga0495648_0032483 | |||
| 1554 | Ga0495648_0034829 | |||
| 1555 | Ga0495648_0363486 | |||
| 1556 | Ga0495663_0024138 | |||
| 1557 | Ga0495652_1136041 | |||
| 1558 | Ga0495654_0000019 | |||
| 1559 | Ga0495654_0000052 | |||
| 1560 | Ga0495654_0000133 | |||
| 1561 | Ga0495654_0000543 | |||
| 1562 | Ga0495654_0005804 | |||
| 1563 | Ga0495654_0011354 | |||
| 1564 | Ga0495654_0019891 | |||
| 1565 | Ga0495609_0000031 | |||
| 1566 | Ga0495597_0000352 | |||
| 1567 | Ga0495597_0004022 | |||
| 1568 | Ga0495622_0030240 | |||
| 1569 | Ga0495622_0301506 | |||
| 1570 | Ga0495633_0000011 | |||
| 1571 | Ga0495633_0384022 | |||
| 1572 | Ga0495668_0042377 | |||
| 1573 | Ga0495668_0131230 | |||
| 1574 | Ga0495611_0000645 | |||
| 1575 | Ga0495611_0088192 | |||
| 1576 | Ga0495611_0299196 | |||
| 1577 | Ga0495625_0000170 | |||
| 1578 | Ga0495625_0000593 | |||
| 1579 | Ga0495625_0004619 | |||
| 1580 | Ga0495625_0102494 | |||
| 1581 | Ga0495625_0471980 | |||
| 1582 | Ga0495661_0000021 | |||
| 1583 | Ga0495661_0012909 | |||
| 1584 | Ga0495588_0031234 | |||
| 1585 | Ga0495588_0032753 | |||
| 1586 | Ga0495588_0082766 | |||
| 1587 | Ga0495658_0308940 | |||
| 1588 | Ga0495624_0769877 | |||
| 1589 | Ga0495670_0001750 | |||
| 1590 | Ga0495670_0022065 | |||
| 1591 | Ga0495671_0008541 | |||
| 1592 | Ga0495671_0015296 | |||
| 1593 | Ga0495671_0025517 | |||
| 1594 | Ga0495671_0232068 | |||
| 1595 | Ga0495649_0012666 | |||
| 1596 | Ga0495589_0000004 | |||
| 1597 | Ga0495589_0065031 | |||
| 1598 | Ga0495589_0202636 | |||
| 1599 | Ga0495660_0000021 | |||
| 1600 | Ga0495660_0002193 | |||
| 1601 | Ga0495660_0056782 | |||
| 1602 | Ga0495660_0160391 | |||
| 1603 | Ga0495672_0000002 | |||
| 1604 | Ga0495672_0000012 | |||
| 1605 | Ga0495672_0000199 | |||
| 1606 | Ga0495672_0001289 | |||
| 1607 | Ga0495672_0062804 | |||
| 1608 | Ga0495672_0171509 | |||
| 1609 | Ga0495676_0111513 | |||
| 1610 | Ga0495683_0000008 | |||
| 1611 | Ga0495687_136321 | |||
| 1612 | Ga0495677_0192288 | |||
| 1613 | Ga0495679_000020 | |||
| 1614 | Ga0495679_001481 | |||
| 1615 | Ga0495679_002514 | |||
| 1616 | Ga0495679_008134 | |||
| 1617 | Ga0495679_030031 | |||
| 1618 | Ga0495673_0000095 | |||
| 1619 | Ga0495673_0000147 | |||
| 1620 | Ga0495673_0000542 | |||
| 1621 | Ga0495673_0000561 | |||
| 1622 | Ga0495673_0022492 | |||
| 1623 | Ga0495673_0075248 | |||
| 1624 | Ga0495673_0191399 | |||
| 1625 | Ga0495681_0000688 | |||
| 1626 | Ga0495681_0008051 | |||
| 1627 | Ga0495681_0015367 | |||
| 1628 | Ga0495681_0025691 | |||
| 1629 | Ga0495681_0140372 | |||
| 1630 | Ga0495686_0000088 | |||
| 1631 | Ga0495686_0005411 | |||
| 1632 | Ga0495686_0024236 | |||
| 1633 | Ga0495686_0074223 | |||
| 1634 | Ga0495686_0079847 | |||
| 1635 | Ga0495686_0174634 | |||
| 1636 | Ga0495686_0244610 | |||
| 1637 | Ga0495686_0381440 | |||
| 1638 | Ga0495593_0239542 | |||
| 1639 | Ga0495614_0421401 | |||
| 1640 | Ga0495626_0043960 | |||
| 1641 | Ga0495626_0143764 | |||
| 1642 | Ga0496101_0000245 | |||
| 1643 | Ga0496101_0066600 | |||
| 1644 | Ga0496101_0437728 | |||
| 1645 | Ga0496102_0004556 | |||
| 1646 | Ga0496102_0087385 | |||
| 1647 | Ga0496102_1532879 | |||
| 1648 | Ga0496103_0032158 | |||
| 1649 | Ga0496103_0081389 | |||
| 1650 | Ga0496103_0424713 | |||
| 1651 | Ga0496104_0000585 | |||
| 1652 | Ga0496104_0089486 | |||
| 1653 | Ga0496105_0008927 | |||
| 1654 | Ga0496110_0092600 | |||
| 1655 | Ga0496111_0000161 | |||
| 1656 | Ga0496113_0785551 | |||
| 1657 | Ga0496116_0000001 | |||
| 1658 | Ga0496116_0000392 | |||
| 1659 | Ga0496116_0000977 | |||
| 1660 | Ga0496116_0003411 | |||
| 1661 | Ga0496116_0003460 | |||
| 1662 | Ga0496116_0009633 | |||
| 1663 | Ga0496116_0010592 | |||
| 1664 | Ga0496116_0011095 | |||
| 1665 | Ga0496116_0012225 | |||
| 1666 | Ga0496116_0013166 | |||
| 1667 | Ga0496116_0024207 | |||
| 1668 | Ga0496116_0028086 | |||
| 1669 | Ga0496116_0029536 | |||
| 1670 | Ga0496116_0034789 | |||
| 1671 | Ga0496116_0041230 | |||
| 1672 | Ga0496116_0181267 | |||
| 1673 | Ga0496116_0403871 | |||
| 1674 | Ga0496116_0407511 | |||
| 1675 | Ga0496117_0000002 | |||
| 1676 | Ga0496117_0000004 | |||
| 1677 | Ga0496117_0000436 | |||
| 1678 | Ga0496117_0000486 | |||
| 1679 | Ga0496117_0001974 | |||
| 1680 | Ga0496117_0005286 | |||
| 1681 | Ga0496117_0012239 | |||
| 1682 | Ga0496117_0023548 | |||
| 1683 | Ga0496117_0028588 | |||
| 1684 | Ga0496117_0047355 | |||
| 1685 | Ga0496117_0047638 | |||
| 1686 | Ga0496117_0125294 | |||
| 1687 | Ga0496117_0130981 | |||
| 1688 | Ga0496117_0137123 | |||
| 1689 | Ga0496117_0201362 | |||
| 1690 | Ga0496117_0262975 | |||
| 1691 | Ga0496117_0287632 | |||
| 1692 | Ga0496117_0339961 | |||
| 1693 | Ga0496118_0000072 | |||
| 1694 | Ga0496118_0000323 | |||
| 1695 | Ga0496118_0000464 | |||
| 1696 | Ga0496118_0003071 | |||
| 1697 | Ga0496118_0007432 | |||
| 1698 | Ga0496118_0016600 | |||
| 1699 | Ga0496118_0025762 | |||
| 1700 | Ga0496118_0029505 | |||
| 1701 | Ga0496118_0031959 | |||
| 1702 | Ga0496118_0033583 | |||
| 1703 | Ga0496118_0052124 | |||
| 1704 | Ga0496118_0056962 | |||
| 1705 | Ga0496118_0077236 | |||
| 1706 | Ga0496118_0096722 | |||
| 1707 | Ga0496118_0164398 | |||
| 1708 | Ga0496118_0193956 | |||
| 1709 | Ga0496119_0000080 | |||
| 1710 | Ga0496119_0000124 | |||
| 1711 | Ga0496119_0001227 | |||
| 1712 | Ga0496119_0003217 | |||
| 1713 | Ga0496119_0006765 | |||
| 1714 | Ga0496119_0010953 | |||
| 1715 | Ga0496119_0038452 | |||
| 1716 | Ga0496119_0047989 | |||
| 1717 | Ga0496119_0061893 | |||
| 1718 | Ga0496119_0061983 | |||
| 1719 | Ga0496119_0062821 | |||
| 1720 | Ga0496119_0065507 | |||
| 1721 | Ga0496119_0091373 | |||
| 1722 | Ga0496119_0114491 | |||
| 1723 | Ga0496119_0219941 | |||
| 1724 | Ga0496119_0257678 | |||
| 1725 | Ga0496119_0311586 | |||
| 1726 | Ga0496120_0000040 | |||
| 1727 | Ga0496120_0000062 | |||
| 1728 | Ga0496120_0000075 | |||
| 1729 | Ga0496120_0000093 | |||
| 1730 | Ga0496120_0000128 | |||
| 1731 | Ga0496120_0000252 | |||
| 1732 | Ga0496120_0001216 | |||
| 1733 | Ga0496120_0002252 | |||
| 1734 | Ga0496120_0021517 | |||
| 1735 | Ga0496120_0051487 | |||
| 1736 | Ga0496120_0077053 | |||
| 1737 | Ga0496121_0000047 | |||
| 1738 | Ga0496121_0000710 | |||
| 1739 | Ga0496121_0004945 | |||
| 1740 | Ga0496121_0009598 | |||
| 1741 | Ga0496121_0012264 | |||
| 1742 | Ga0496121_0023459 | |||
| 1743 | Ga0496121_0026477 | |||
| 1744 | Ga0496121_0031468 | |||
| 1745 | Ga0496121_0046941 | |||
| 1746 | Ga0496121_0051646 | |||
| 1747 | Ga0496121_0058378 | |||
| 1748 | Ga0496121_0089815 | |||
| 1749 | Ga0496122_0000004 | |||
| 1750 | Ga0496122_0000211 | |||
| 1751 | Ga0496122_0000356 | |||
| 1752 | Ga0496122_0002991 | |||
| 1753 | Ga0496122_0004390 | |||
| 1754 | Ga0496122_0004632 | |||
| 1755 | Ga0496122_0004795 | |||
| 1756 | Ga0496122_0007725 | |||
| 1757 | Ga0496122_0015166 | |||
| 1758 | Ga0496122_0057668 | |||
| 1759 | Ga0496122_0060226 | |||
| 1760 | Ga0496122_0088576 | |||
| 1761 | Ga0496122_0117011 | |||
| 1762 | Ga0496122_0133976 | |||
| 1763 | Ga0496122_0178217 | |||
| 1764 | Ga0496123_0000007 | |||
| 1765 | Ga0496123_0000134 | |||
| 1766 | Ga0496123_0000309 | |||
| 1767 | Ga0496123_0000508 | |||
| 1768 | Ga0496123_0001890 | |||
| 1769 | Ga0496123_0005205 | |||
| 1770 | Ga0496123_0007397 | |||
| 1771 | Ga0496123_0009423 | |||
| 1772 | Ga0496123_0012981 | |||
| 1773 | Ga0496123_0017385 | |||
| 1774 | Ga0496123_0031223 | |||
| 1775 | Ga0496123_0034022 | |||
| 1776 | Ga0496123_0035162 | |||
| 1777 | Ga0496123_0083467 | |||
| 1778 | Ga0496123_0145941 | |||
| 1779 | Ga0496124_0000152 | |||
| 1780 | Ga0496124_0000399 | |||
| 1781 | Ga0496124_0001262 | |||
| 1782 | Ga0496124_0002623 | |||
| 1783 | Ga0496124_0004853 | |||
| 1784 | Ga0496124_0009609 | |||
| 1785 | Ga0496124_0015188 | |||
| 1786 | Ga0496124_0017407 | |||
| 1787 | Ga0496124_0056079 | |||
| 1788 | Ga0496124_0061853 | |||
| 1789 | Ga0496124_0093103 | |||
| 1790 | Ga0496124_0108647 | |||
| 1791 | Ga0496124_0118849 | |||
| 1792 | Ga0496124_0122039 | |||
| 1793 | Ga0496124_0125294 | |||
| 1794 | Ga0496124_0150363 | |||
| 1795 | Ga0496124_0205665 | |||
| 1796 | Ga0496124_0250460 | |||
| 1797 | Ga0496124_0282721 | |||
| 1798 | Ga0496124_0316087 | |||
| 1799 | Ga0496124_0360006 | |||
| 1800 | Ga0496124_0360788 | |||
| 1801 | Ga0496125_0001470 | |||
| 1802 | Ga0496125_0002790 | |||
| 1803 | Ga0496125_0004938 | |||
| 1804 | Ga0496125_0005370 | |||
| 1805 | Ga0496125_0006354 | |||
| 1806 | Ga0496125_0008230 | |||
| 1807 | Ga0496125_0036033 | |||
| 1808 | Ga0496125_0040055 | |||
| 1809 | Ga0496125_0046513 | |||
| 1810 | Ga0496125_0088974 | |||
| 1811 | Ga0496125_0155270 | |||
| 1812 | Ga0496125_0452263 | |||
| 1813 | Ga0496126_0002540 | |||
| 1814 | Ga0496126_0004794 | |||
| 1815 | Ga0496126_0016875 | |||
| 1816 | Ga0496126_0053895 | |||
| 1817 | Ga0496126_0057225 | |||
| 1818 | Ga0496126_0086386 | |||
| 1819 | Ga0496126_0088816 | |||
| 1820 | Ga0496126_0099053 | |||
| 1821 | Ga0496126_0140114 | |||
| 1822 | Ga0496126_0149019 | |||
| 1823 | Ga0496126_0362190 | |||
| 1824 | Ga0496126_0460397 | |||
| 1825 | Ga0496126_0647246 | |||
| 1826 | Ga0496126_1218309 | |||
| 1827 | Ga0495678_000018 | |||
| 1828 | Ga0495678_000326 | |||
| 1829 | Ga0495678_110528 | |||
| 1830 | Ga0495682_0000015 | |||
| 1831 | Ga0501032_0465938 | |||
| 1832 | Ga0501034_0141080 | |||
| 1833 | Ga0501070_0194200 | |||
| 1834 | Ga0501249_003809 | |||
| 1835 | Ga0501083_0432849 | |||
| 1836 | Ga0501241_043281 | |||
| 1837 | Ga0501262_000750 | |||
| 1838 | Ga0501044_0518336 | |||
| 1839 | nmdc:mga03683_1329_c1 | |||
| 1840 | nmdc:mga03683_3528_c1 | |||
| 1841 | nmdc:mga03683_93757_c1 | |||
| 1842 | nmdc:mga03n38_393046_c1 | |||
| 1843 | nmdc:mga00v17_10053_c1 | |||
| 1844 | nmdc:mga00v17_103487_c1 | |||
| 1845 | nmdc:mga00v17_148956_c1 | |||
| 1846 | nmdc:mga00v17_189976_c2 | |||
| 1847 | nmdc:mga00v17_272014_c1 | |||
| 1848 | nmdc:mga00v17_34295_c1 | |||
| 1849 | nmdc:mga00v17_3690_c1 | |||
| 1850 | nmdc:mga00v17_588256_c1 | |||
| 1851 | nmdc:mga0yw44_126070_c1 | |||
| 1852 | nmdc:mga0yw44_1274_c1 | |||
| 1853 | nmdc:mga0yw44_27822_c1 | |||
| 1854 | nmdc:mga0yw44_74860_c1 | |||
| 1855 | nmdc:mga0k408_168783_c1 | |||
| 1856 | nmdc:mga0k408_265294_c1 | |||
| 1857 | nmdc:mga0k408_887749_c1 | |||
| 1858 | nmdc:mga06z11_132579_c1 | |||
| 1859 | nmdc:mga06z11_168114_c2 | |||
| 1860 | nmdc:mga06z11_194507_c1 | |||
| 1861 | nmdc:mga06z11_226551_c1 | |||
| 1862 | nmdc:mga06z11_48210_c1 | |||
| 1863 | nmdc:mga06z11_56372_c1 | |||
| 1864 | nmdc:mga06z11_574832_c1 | |||
| 1865 | nmdc:mga07m45_151577_c1 | |||
| 1866 | nmdc:mga07m45_2064_c1 | |||
| 1867 | nmdc:mga07m45_40601_c1 | |||
| 1868 | nmdc:mga07m45_750824_c1 | |||
| 1869 | nmdc:mga07m45_8640_c1 | |||
| 1870 | nmdc:mga07m45_90266_c1 | |||
| 1871 | nmdc:mga0qj67_1051278_c1 | |||
| 1872 | nmdc:mga08y16_870949_c1 | |||
| 1873 | nmdc:mga0sz30_142194_c1 | |||
| 1874 | nmdc:mga0sz30_222097_c1 | |||
| 1875 | nmdc:mga0sz30_55558_c1 | |||
| 1876 | nmdc:mga0sz30_60_c1 | |||
| 1877 | nmdc:mga0sz30_62982_c1 | |||
| 1878 | Ga0500610_0338419 | |||
| 1879 | Ga0500578_0043934 | |||
| 1880 | Ga0500578_0229952 | |||
| 1881 | Ga0500643_022579 | |||
| 1882 | Ga0500644_0009424 | |||
| 1883 | Ga0500644_0030964 | |||
| 1884 | Ga0500581_022193 | |||
| 1885 | Ga0500646_0007763 | |||
| 1886 | Ga0500646_0034444 | |||
| 1887 | Ga0500646_0294073 | |||
| 1888 | Ga0500647_0215516 | |||
| 1889 | Ga0500583_0020595 | |||
| 1890 | Ga0500651_0045653 | |||
| 1891 | Ga0500651_0072986 | |||
| 1892 | Ga0500651_0321046 | |||
| 1893 | Ga0500651_0332077 | |||
| 1894 | Ga0500566_0000811 | |||
| 1895 | Ga0500566_0002995 | |||
| 1896 | Ga0500641_0000487 | |||
| 1897 | Ga0500641_0004126 | |||
| 1898 | Ga0500650_0004938 | |||
| 1899 | Ga0500554_002001 | |||
| 1900 | Ga0500554_014996 | |||
| 1901 | Ga0500555_051725 | |||
| 1902 | Ga0500556_0000006 | |||
| 1903 | Ga0500556_0005182 | |||
| 1904 | Ga0500560_001783 | |||
| 1905 | Ga0500562_001145 | |||
| 1906 | Ga0500562_003536 | |||
| 1907 | Ga0500562_120906 | |||
| 1908 | Ga0500569_001769 | |||
| 1909 | Ga0500569_007679 | |||
| 1910 | Ga0500592_000371 | |||
| 1911 | Ga0500593_166623 | |||
| 1912 | Ga0500594_0009611 | |||
| 1913 | Ga0500595_002159 | |||
| 1914 | Ga0500595_029560 | |||
| 1915 | Ga0500595_133611 | |||
| 1916 | Ga0500607_025913 | |||
| 1917 | Ga0500608_000880 | |||
| 1918 | Ga0500618_000285 | |||
| 1919 | Ga0500618_006218 | |||
| 1920 | Ga0500618_014209 | |||
| 1921 | Ga0500618_063036 | |||
| 1922 | Ga0500621_000001 | |||
| 1923 | Ga0500642_0000004 | |||
| 1924 | Ga0500652_000160 | |||
| 1925 | Ga0500658_0036578 | |||
| 1926 | Ga0500658_0254220 | |||
| 1927 | Ga0500658_0275480 | |||
| 1928 | Ga0500559_0000720 | |||
| 1929 | Ga0500559_0003860 | |||
| 1930 | Ga0500559_0055393 | |||
| 1931 | Ga0500559_0189139 | |||
| 1932 | Ga0500568_0002010 | |||
| 1933 | Ga0500568_0003440 | |||
| 1934 | Ga0500568_0019147 | |||
| 1935 | Ga0500573_0002805 | |||
| 1936 | Ga0500573_0469929 | |||
| 1937 | Ga0500577_0005208 | |||
| 1938 | Ga0500577_0173091 | |||
| 1939 | Ga0500577_0260351 | |||
| 1940 | Ga0500577_0414707 | |||
| 1941 | Ga0500586_000112 | |||
| 1942 | Ga0500588_0099038 | |||
| 1943 | Ga0500588_0159985 | |||
| 1944 | Ga0500590_008244 | |||
| 1945 | Ga0500603_066757 | |||
| 1946 | Ga0500604_0000031 | |||
| 1947 | Ga0500604_0037128 | |||
| 1948 | Ga0500616_0000022 | |||
| 1949 | Ga0500616_0006857 | |||
| 1950 | Ga0500619_169678 | |||
| 1951 | Ga0500620_262778 | |||
| 1952 | Ga0500622_0000644 | |||
| 1953 | Ga0500622_0001425 | |||
| 1954 | Ga0500622_0028461 | |||
| 1955 | Ga0500622_0422237 | |||
| 1956 | Ga0500627_0008907 | |||
| 1957 | Ga0500627_0013247 | |||
| 1958 | Ga0500633_0004174 | |||
| 1959 | Ga0500636_0000222 | |||
| 1960 | Ga0500636_0000309 | |||
| 1961 | Ga0500636_0288935 | |||
| 1962 | Ga0500637_0000894 | |||
| 1963 | Ga0500637_0016151 | |||
| 1964 | Ga0500570_155111 | |||
| 1965 | Ga0500611_005745 | |||
| 1966 | Ga0500645_008123 | |||
| 1967 | Ga0500645_015065 | |||
| 1968 | Ga0500609_003976 | |||
| 1969 | Ga0500601_000147 | |||
| 1970 | Ga0500661_000365 | |||
| 1971 | Ga0587098_056179 | |||
| 1972 | Ga0466962_0096479 | |||
| 1973 | 2506577825 | |||
| 1974 | 2506582963 | |||
| 1975 | 2508851785 | |||
| 1976 | 2511131354 | |||
| 1977 | 2511382322 | |||
| 1978 | 2511434105 | |||
| 1979 | 2548650924 | |||
| 1980 | 2555260454 | |||
| 1981 | 2585147582 | |||
| 1982 | 2585274930 | |||
| 1983 | 2585561356 | |||
| 1984 | 2585830019 | |||
| 1985 | 2585832290 | |||
| 1986 | 2585846555 | |||
| 1987 | 2585908049 | |||
| 1988 | 2587983916 | |||
| 1989 | 2599411129 | |||
| 1990 | 2601523560 | |||
| 1991 | 2601528719 | |||
| 1992 | 2601536474 | |||
| 1993 | 2601541897 | |||
| 1994 | 2601615552 | |||
| 1995 | 2601620728 | |||
| 1996 | 2601643379 | |||
| 1997 | 2601649125 | |||
| 1998 | 2601653603 | |||
| 1999 | 2601659023 | |||
| 2000 | 2601663202 | |||
| 2001 | 2601696161 | |||
| 2002 | 2601700835 | |||
| 2003 | 2601707820 | |||
| 2004 | 2601712879 | |||
| 2005 | 2601716862 | |||
| 2006 | 2601721185 | |||
| 2007 | 2601724975 | |||
| 2008 | 2601732258 | |||
| 2009 | 2601737864 | |||
| 2010 | 2601744007 | |||
| 2011 | 2601753393 | |||
| 2012 | 2601760256 | |||
| 2013 | 2601765659 | |||
| 2014 | 2602022020 | |||
| 2015 | 2603638436 | |||
| 2016 | 2603642942 | |||
| 2017 | 2603660585 | |||
| 2018 | 2603665857 | |||
| 2019 | 2603699586 | |||
| 2020 | 2603703550 | |||
| 2021 | 2603839205 | |||
| 2022 | 2603844739 | |||
| 2023 | 2603849362 | |||
| 2024 | 2603854431 | |||
| 2025 | 2603858587 | |||
| 2026 | 2603867469 | |||
| 2027 | 2603870156 | |||
| 2028 | 2603875111 | |||
| 2029 | 2606047347 | |||
| 2030 | 2606070291 | |||
| 2031 | 2606146150 | |||
| 2032 | 2606177077 | |||
| 2033 | 2608668952 | |||
| 2034 | 2609910693 | |||
| 2035 | 2637226056 | |||
| 2036 | 2644163873 | |||
| 2037 | 2656278503 | |||
| 2038 | 2676407756 | |||
| 2039 | 2681995344 | |||
| 2040 | 2687579560 | |||
| 2041 | 2689444350 | |||
| 2042 | 2738801919 | |||
| 2043 | 2739790216 | |||
| 2044 | 2753855470 | |||
| 2045 | 2775542263 | |||
| 2046 | 2776910893 | |||
| 2047 | 2777020582 | |||
| 2048 | 2807177153 | |||
| 2049 | 2813729494 | |||
| 2050 | 2814696983 | |||
| 2051 | 2821119281 | |||
| 2052 | 2842680632 | |||
| 2053 | 2844427016 | |||
| 2054 | 2844530410 | |||
| 2055 | 2847088174 | |||
| 2056 | 2857526289 | |||
| 2057 | 2861694753 | |||
| 2058 | 2865015708 | |||
| 2059 | 2869553702 | |||
| 2060 | 2876602055 | |||
| 2061 | 2881612316 | |||
| 2062 | 2893067439 | |||
| 2063 | 2902406070 | |||
| 2064 | 2904437194 | |||
| 2065 | 2904505214 | |||
| 2066 | 2904517539 | |||
| 2067 | 2908670723 | |||
| 2068 | 2919073859 | |||
| 2069 | 2919112885 | |||
| 2070 | 2919463436 | |||
| 2071 | 2923638906 | |||
| 2072 | 2927834602 | |||
| 2073 | 2928118499 | |||
| 2074 | 2928125921 | |||
| 2075 | 2929525933 | |||
| 2076 | 2937543304 | |||
| 2077 | 2939568671 | |||
| 2078 | 2939602608 | |||
| 2079 | 2939607981 | |||
| 2080 | 2939644284 | |||
| 2081 | 2945878623 | |||
| 2082 | 2945953542 | |||
| 2083 | 2969083068 | |||
| 2084 | 2971824346 | |||
| 2085 | 2978976035 | |||
| 2086 | 2984560086 | |||
| 2087 | 2984598168 | |||
| 2088 | 640937353 | |||
| 2089 | 8016736434 | |||
| 2090 | 8018225426 | |||
| 2091 | 8019503105 | |||
| 2092 | 8054844769 | |||
| 2093 | 8055088594 | |||
| 2094 | 8055094172 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v4d-assembly1.cif.gz_A | crystal structure of rutc protein a member of the yjgf family from e.coli | 0.9984 | 2 | 127 |
| 3v4d-assembly1.cif.gz_C | crystal structure of rutc protein a member of the yjgf family from e.coli | 0.9929 | 1 | 128 |
| 3v4d-assembly2.cif.gz_B | crystal structure of rutc protein a member of the yjgf family from e.coli | 0.9905 | 1 | 126 |
| 3v4d-assembly1.cif.gz_A | crystal structure of rutc protein a member of the yjgf family from e.coli | 0.9901 | 2 | 127 |
| 3v4d-assembly2.cif.gz_E | crystal structure of rutc protein a member of the yjgf family from e.coli | 0.9851 | 1 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFQ5_1_128_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9932 | 1 | 128 | 3.30.1330.40 |
| af_Q86I26_20_139_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9355 | 18 | 125 | 3.30.1330.40 |
| af_Q86KR5_2_129_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9303 | 1 | 127 | 3.30.1330.40 |
| 3lybC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9228 | 21 | 127 | 3.30.1330.40 |
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.919 | 4 | 125 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9CTC0-F1-model_v4 | 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) | 0.9967 | 3 | 128 |
GO:0005829
GO:0006212 GO:0016491 GO:0019239 GO:0019740 |
| AF-G8LIN5-F1-model_v4 | 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) | 0.9931 | 1 | 128 |
GO:0005829
GO:0006212 GO:0019239 GO:0019740 |
| AF-A4VQH6-F1-model_v4 | 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) | 0.9927 | 1 | 128 |
GO:0005829
GO:0006212 GO:0019239 GO:0019740 |
| AF-A0A377W6E7-F1-model_v4 | Multifunctional fusion protein [Includes: 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-); Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase)] | 0.9918 | 1 | 128 |
GO:0005829
GO:0006212 GO:0016746 GO:0016811 GO:0019239 GO:0019740 |
| AF-A0A7Y8Q233-F1-model_v4 | 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) | 0.9916 | 1 | 126 |
GO:0005829
GO:0006212 GO:0019239 GO:0019740 |