F488981

General Info

Members Datasets Scaffolds Average Seq Length
1047 477 2094 129

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_008678|Ga0495591_008678_1491_1955
Length 154
Sequence MYRIAPFAAFGSSYNHQLLIEGLSMPKKVIIPAGTGTPIGPFVPGTTADGIVYVSGTLPFDSDNNVVHVGDAAAQTRHVLNIIKGVIESAGGTMADVTFNHVFLKNWEDYAAINAVYAEYFPGEKPARYCIQCGLVKPDALIEIASVAHIGKGL

Samples

Sample ID Description Type Environment
1 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
72 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
83 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
84 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
85 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
143 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
183 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
184 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
185 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
186 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
187 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
188 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
189 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
190 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
199 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
290 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
306 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
307 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
308 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
309 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
314 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
315 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
318 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
321 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
322 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
327 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
328 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
329 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
334 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
335 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
336 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
339 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
342 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
345 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
348 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
349 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
353 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
354 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
357 2506520008 Serratia plymuthica AS12 Isolate Unclassified
358 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
359 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
360 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
361 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
362 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
363 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
364 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
365 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
366 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
367 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
368 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
369 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
370 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
371 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
372 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
373 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
374 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
375 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
376 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
377 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
378 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
379 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
380 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
381 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
382 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
383 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
384 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
385 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
386 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
387 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
388 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
389 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
390 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
391 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
392 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
393 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
394 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
395 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
396 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
397 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
398 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
399 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
400 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
401 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
402 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
403 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
404 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
405 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
406 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
407 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
408 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
409 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
410 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
411 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
412 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
413 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
414 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
415 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
416 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
417 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
418 2636415599 Klebsiella variicola DX120E Isolate Unclassified
419 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
420 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
421 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
422 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
423 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
424 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
425 2738541293 Rhizobium sp. GV031 Isolate Unclassified
426 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
427 2751185917 Enterobacter sp. HK169 Isolate Unclassified
428 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
429 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
430 2775507074 Klebsiella sp. D5A Isolate Unclassified
431 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
432 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
433 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
434 2821118458 Enterobacter asburiae 609 Isolate Unclassified
435 2842677519 Variovorax sp. R-72495 Isolate Unclassified
436 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
437 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
438 2847085930 Erwinia persicina B64 Isolate Bulb
439 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
440 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
441 2865014394 Pantoea sp. R-71966 Isolate Unclassified
442 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
443 2876601092 Pantoea endophytica 596 Isolate Unclassified
444 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
445 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
446 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
447 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
448 2904504865 Serratia marcescens 1822 Isolate Unclassified
449 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
450 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
451 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
452 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
453 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
454 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
455 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
456 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
457 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
458 2929520902 Variovorax beijingensis 502 Isolate Unclassified
459 2937539931 Pantoea sp. LS15 Isolate Unclassified
460 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
461 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
462 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
463 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
464 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
465 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
466 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
467 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
468 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
469 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
470 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
471 640753048 Serratia proteamaculans 568 Isolate Endosphere
472 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
473 8018221730 Enterobacter sp. CM29 Isolate Unclassified
474 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
475 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
476 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
477 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.25
Metatranscriptomes 0.1
Isolates 11.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0.1
Endosphere 20.44
Nodule 1.53
Rhizoplane 6.21
Rhizosphere 50.53
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495591_008678 3300046458 Bacteria 4133
2 SwRhRL2b_contig_2020483 2162886007 Bacteria 1285
3 SwRhRL2b_contig_605692 2162886007 Bacteria 802
4 JGI25162J39368_1014135 3300002737 Bacteria 861
5 JGI25152J39213_1001256 3300002773 Bacteria 11514
6 JGI25150J39212_1000010 3300002774 Bacteria 236260
7 JGI25151J46595_10000026 3300003187 Bacteria 211045
8 JGI25406J46586_10064863 3300003203 Bacteria 1166
9 JGI25165J46597_1020337 3300003214 Bacteria 870
10 JGI25153J46596_10000590 3300003215 Bacteria 22229
11 JGI25153J46596_10003622 3300003215 Bacteria 8574
12 rootH1_10132492 3300003316 Bacteria 2911
13 rootH2_10059718 3300003320 Bacteria 15347
14 rootH2_10087853 3300003320 Bacteria 4861
15 rootL2_10013653 3300003322 Bacteria 2027
16 rootH1_10006414 3300003323 Bacteria 9927
17 rootH1_10206025 3300003323 Bacteria 1386
18 Ga0055526_1038075 3300003771 Bacteria 1246
19 Ga0055537_1000502 3300003773 Bacteria 23608
20 Ga0055524_1023191 3300003775 Bacteria 2005
21 Ga0055534_1000242 3300003784 Bacteria 38891
22 Ga0055528_1001320 3300003790 Bacteria 15517
23 Ga0055528_1035157 3300003790 Bacteria 1221
24 Ga0055531_10004450 3300003794 Bacteria 8524
25 Ga0058692_1000058 3300003856 Bacteria 99195
26 Ga0058692_1000076 3300003856 Bacteria 75166
27 Ga0058692_1000362 3300003856 Bacteria 21935
28 Ga0058692_1004662 3300003856 Bacteria 4036
29 Ga0058692_1010094 3300003856 Bacteria 2348
30 Ga0058692_1010098 3300003856 Bacteria 2348
31 Ga0055543_1007142 3300004625 Bacteria 2614
32 Ga0065165_1001689 3300005262 Bacteria 22273
33 Ga0065165_1004567 3300005262 Bacteria 8454
34 Ga0065703_1021363 3300005272 Bacteria 1273
35 Ga0065714_10006253 3300005288 Bacteria 4029
36 Ga0065714_10260811 3300005288 Bacteria 741
37 Ga0065704_10000722 3300005289 Bacteria 17520
38 Ga0065704_10004428 3300005289 Bacteria 5573
39 Ga0065704_10006660 3300005289 Bacteria 3075
40 Ga0065704_10087996 3300005289 Bacteria 2976
41 Ga0065704_10111960 3300005289 Bacteria 1944
42 Ga0070676_10600126 3300005328 Bacteria 794
43 Ga0070666_11258153 3300005335 Bacteria 552
44 Ga0070682_101372518 3300005337 Bacteria 603
45 Ga0070660_101114689 3300005339 Bacteria 668
46 Ga0070661_100318601 3300005344 Bacteria 1214
47 Ga0070668_100001252 3300005347 Bacteria 18117
48 Ga0070667_100000111 3300005367 Bacteria 105176
49 Ga0070714_100619656 3300005435 Bacteria 1040
50 Ga0070710_10348198 3300005437 Bacteria 980
51 Ga0070711_100680376 3300005439 Bacteria 865
52 Ga0070694_101024057 3300005444 Bacteria 686
53 Ga0070663_100138807 3300005455 Bacteria 1853
54 Ga0070663_100670201 3300005455 Bacteria 879
55 Ga0070662_100084696 3300005457 Bacteria 2368
56 Ga0070706_100455253 3300005467 Bacteria 1191
57 Ga0070665_100049105 3300005548 Bacteria 4235
58 Ga0070665_100228851 3300005548 Bacteria 1859
59 Ga0070665_100617725 3300005548 Bacteria 1097
60 Ga0068864_100568487 3300005618 Bacteria 1098
61 Ga0068863_100008694 3300005841 Bacteria 9919
62 Ga0068860_100000176 3300005843 Bacteria 105176
63 Ga0068860_100134520 3300005843 Bacteria 2374
64 Ga0068860_100353204 3300005843 Bacteria 1447
65 Ga0068860_101254259 3300005843 Bacteria 762
66 Ga0081455_10013447 3300005937 Bacteria 8087
67 Ga0081539_10001642 3300005985 Bacteria 36366
68 Ga0081539_10010459 3300005985 Bacteria 7532
69 Ga0075365_10022409 3300006038 Bacteria 3957
70 Ga0075365_10076612 3300006038 Bacteria 2258
71 Ga0075365_10191551 3300006038 Bacteria 1431
72 Ga0075368_10154439 3300006042 Bacteria 959
73 Ga0075368_10530006 3300006042 Bacteria 528
74 Ga0075363_100625451 3300006048 Bacteria 646
75 Ga0075363_100691325 3300006048 Bacteria 615
76 Ga0075364_10011159 3300006051 Bacteria 5453
77 Ga0075364_10020445 3300006051 Bacteria 4163
78 Ga0075364_10029099 3300006051 Bacteria 3541
79 Ga0075364_10050371 3300006051 Bacteria 2718
80 Ga0075364_10085687 3300006051 Bacteria 2087
81 Ga0075364_10296173 3300006051 Bacteria 1101
82 Ga0075364_10331026 3300006051 Bacteria 1037
83 Ga0075364_10379985 3300006051 Bacteria 963
84 Ga0075364_10764937 3300006051 Bacteria 659
85 Ga0075364_10793956 3300006051 Bacteria 645
86 Ga0075364_10996527 3300006051 Bacteria 570
87 Ga0075432_10265897 3300006058 Bacteria 701
88 Ga0075362_10002076 3300006177 Bacteria 6613
89 Ga0075362_10018790 3300006177 Bacteria 2865
90 Ga0075362_10032651 3300006177 Bacteria 2260
91 Ga0075362_10046781 3300006177 Bacteria 1925
92 Ga0075362_10306003 3300006177 Bacteria 789
93 Ga0075367_10037444 3300006178 Bacteria 2819
94 Ga0075367_10041045 3300006178 Bacteria 2704
95 Ga0075367_10119300 3300006178 Bacteria 1624
96 Ga0075367_10175023 3300006178 Bacteria 1337
97 Ga0075367_10453810 3300006178 Bacteria 812
98 Ga0075367_10513342 3300006178 Bacteria 761
99 Ga0075369_10005321 3300006186 Bacteria 4799
100 Ga0075369_10012237 3300006186 Bacteria 3389
101 Ga0075369_10013788 3300006186 Bacteria 3216
102 Ga0075369_10095193 3300006186 Bacteria 1332
103 Ga0075369_10345690 3300006186 Bacteria 697
104 Ga0075366_10021195 3300006195 Unclassified 3778
105 Ga0075366_10273858 3300006195 Bacteria 1031
106 Ga0075366_10904683 3300006195 Bacteria 550
107 Ga0075370_10039894 3300006353 Bacteria 2647
108 Ga0075370_10203005 3300006353 Bacteria 1169
109 Ga0075370_10438065 3300006353 Bacteria 786
110 Ga0068871_100871039 3300006358 Bacteria 833
111 Ga0079104_1006009 3300006946 Bacteria 4700
112 Ga0079104_1011871 3300006946 Bacteria 2772
113 Ga0079104_1011876 3300006946 Bacteria 2771
114 Ga0079104_1012532 3300006946 Bacteria 2658
115 Ga0079104_1034418 3300006946 Bacteria 1230
116 Ga0079104_1059619 3300006946 Bacteria 825
117 Ga0079104_1060234 3300006946 Bacteria 820
118 Ga0099826_10000457 3300006948 Bacteria 19647
119 Ga0099794_10054552 3300007265 Bacteria 1930
120 Ga0099794_10211048 3300007265 Bacteria 996
121 Ga0105251_10000465 3300009011 Bacteria 38667
122 Ga0105251_10000606 3300009011 Bacteria 32839
123 Ga0105251_10001506 3300009011 Bacteria 20010
124 Ga0105251_10001643 3300009011 Bacteria 18941
125 Ga0105251_10005434 3300009011 Bacteria 8324
126 Ga0105251_10008672 3300009011 Bacteria 6096
127 Ga0105251_10009938 3300009011 Bacteria 5568
128 Ga0105251_10021637 3300009011 Bacteria 3354
129 Ga0105251_10107007 3300009011 Bacteria 1276
130 Ga0105244_10000942 3300009036 Bacteria 24430
131 Ga0105244_10001226 3300009036 Bacteria 21039
132 Ga0105244_10001277 3300009036 Bacteria 20646
133 Ga0105244_10002704 3300009036 Bacteria 13254
134 Ga0105244_10009582 3300009036 Bacteria 5938
135 Ga0105244_10018705 3300009036 Bacteria 3880
136 Ga0105244_10039184 3300009036 Bacteria 2468
137 Ga0105244_10087058 3300009036 Bacteria 1540
138 Ga0105244_10115042 3300009036 Bacteria 1306
139 Ga0105244_10146959 3300009036 Bacteria 1131
140 Ga0105244_10150545 3300009036 Bacteria 1115
141 Ga0105244_10599311 3300009036 Bacteria 505
142 Ga0105250_10001600 3300009092 Bacteria 12132
143 Ga0105250_10005696 3300009092 Bacteria 5561
144 Ga0105250_10009361 3300009092 Bacteria 4129
145 Ga0105250_10012703 3300009092 Bacteria 3470
146 Ga0105250_10030647 3300009092 Bacteria 2162
147 Ga0105250_10032752 3300009092 Bacteria 2087
148 Ga0105250_10080016 3300009092 Bacteria 1324
149 Ga0105240_10523173 3300009093 Bacteria 1316
150 Ga0105240_10594556 3300009093 Bacteria 1219
151 Ga0105240_12166780 3300009093 Bacteria 577
152 Ga0111539_11091991 3300009094 Bacteria 927
153 Ga0105247_10000599 3300009101 Bacteria 29233
154 Ga0105243_10057395 3300009148 Bacteria 3099
155 Ga0105243_11705909 3300009148 Bacteria 659
156 Ga0105241_10000005 3300009174 Bacteria 384203
157 Ga0105237_10570440 3300009545 Bacteria 1138
158 Ga0105035_122872 3300009988 Bacteria 598
159 Ga0105246_10039104 3300011119 Bacteria 3193
160 Ga0105246_10067378 3300011119 Bacteria 2508
161 Ga0105246_10153798 3300011119 Bacteria 1744
162 Ga0105246_10551199 3300011119 Bacteria 988
163 Ga0105246_10738722 3300011119 Bacteria 867
164 Ga0105246_11213893 3300011119 Bacteria 695
165 Ga0157336_1036166 3300012477 Bacteria 515
166 Ga0157339_1022024 3300012505 Bacteria 685
167 Ga0157373_10002016 3300013100 Bacteria 15393
168 Ga0157373_10003201 3300013100 Bacteria 12384
169 Ga0157373_10009416 3300013100 Bacteria 7214
170 Ga0157373_10016798 3300013100 Bacteria 5335
171 Ga0157373_10321628 3300013100 Bacteria 1100
172 Ga0157371_10000205 3300013102 Bacteria 86623
173 Ga0157371_10000227 3300013102 Bacteria 81890
174 Ga0157371_10003306 3300013102 Bacteria 14752
175 Ga0157371_10080174 3300013102 Bacteria 2312
176 Ga0157371_10102989 3300013102 Bacteria 2026
177 Ga0157370_10000714 3300013104 Bacteria 41629
178 Ga0157370_10574223 3300013104 Bacteria 1033
179 Ga0157370_10761646 3300013104 Bacteria 882
180 Ga0157370_10951553 3300013104 Bacteria 778
181 Ga0157369_10006972 3300013105 Bacteria 13030
182 Ga0157369_11198339 3300013105 Bacteria 775
183 Ga0163162_10120780 3300013306 Bacteria 2724
184 Ga0163162_11901581 3300013306 Bacteria 681
185 Ga0157372_10004082 3300013307 Bacteria 15656
186 Ga0157372_10005425 3300013307 Bacteria 13553
187 Ga0157372_10013441 3300013307 Bacteria 8745
188 Ga0157372_10023649 3300013307 Bacteria 6665
189 Ga0157372_10668620 3300013307 Bacteria 1209
190 Ga0163163_11212573 3300014325 Bacteria 817
191 Ga0182008_10009476 3300014497 Bacteria 5254
192 Ga0182008_10082048 3300014497 Bacteria 1587
193 Ga0182006_1017488 3300015261 Bacteria 3045
194 Ga0182006_1020123 3300015261 Bacteria 2800
195 Ga0183366_1001 3300015679 Bacteria 2743932
196 Ga0183370_1001 3300015680 Bacteria 2743932
197 Ga0183369_1001 3300015685 Bacteria 2743932
198 Ga0183368_1001 3300015687 Bacteria 2743932
199 Ga0163161_10000001 3300017792 Bacteria 2041488
200 Ga0163161_10004067 3300017792 Bacteria 10229
201 Ga0163161_10574429 3300017792 Bacteria 927
202 Ga0213872_10000790 3300021361 Bacteria 23116
203 Ga0213872_10003376 3300021361 Bacteria 8887
204 Ga0213872_10018711 3300021361 Bacteria 3193
205 Ga0213872_10082389 3300021361 Bacteria 1444
206 Ga0213872_10119754 3300021361 Bacteria 1164
207 Ga0213876_10000016 3300021384 Bacteria 300175
208 Ga0209760_102364 3300025207 Bacteria 1772
209 Ga0209437_100035 3300025233 Bacteria 481110
210 Ga0207425_1000010 3300025245 Bacteria 572898
211 Ga0209129_1000197 3300025258 Bacteria 78908
212 Ga0209233_1004780 3300025261 Bacteria 4564
213 Ga0209565_1000129 3300025263 Bacteria 108787
214 Ga0209565_1023091 3300025263 Bacteria 1281
215 Ga0209673_1000247 3300025273 Bacteria 102817
216 Ga0209673_1012632 3300025273 Bacteria 3389
217 Ga0209673_1028927 3300025273 Bacteria 1774
218 Ga0209675_1000093 3300025291 Bacteria 140158
219 Ga0209675_1045803 3300025291 Bacteria 928
220 Ga0209676_1054305 3300025292 Bacteria 1033
221 Ga0209025_1000022 3300025294 Bacteria 574487
222 Ga0209025_1005035 3300025294 Bacteria 11029
223 Ga0209564_1010159 3300025295 Bacteria 4375
224 Ga0209564_1010614 3300025295 Bacteria 4217
225 Ga0209758_1000086 3300025297 Bacteria 254778
226 Ga0209758_1000216 3300025297 Bacteria 125352
227 Ga0209256_1003843 3300025299 Bacteria 10044
228 Ga0209256_1040612 3300025299 Bacteria 1187
229 Ga0209256_1062741 3300025299 Bacteria 860
230 Ga0207426_1066296 3300025302 Bacteria 1021
231 Ga0207426_1121371 3300025302 Bacteria 645
232 Ga0209257_1000782 3300025304 Bacteria 46895
233 Ga0207697_10183972 3300025315 Bacteria 916
234 Ga0207696_1000001 3300025711 Bacteria 2579611
235 Ga0207696_1000004 3300025711 Bacteria 671626
236 Ga0207696_1000070 3300025711 Bacteria 227242
237 Ga0207696_1000077 3300025711 Bacteria 209611
238 Ga0207696_1001271 3300025711 Bacteria 14110
239 Ga0207696_1001429 3300025711 Bacteria 13000
240 Ga0207696_1007868 3300025711 Bacteria 4133
241 Ga0207696_1020677 3300025711 Bacteria 2118
242 Ga0207696_1054973 3300025711 Bacteria 1130
243 Ga0207655_1000001 3300025728 Bacteria 1866413
244 Ga0207655_1000009 3300025728 Bacteria 664676
245 Ga0207655_1000060 3300025728 Bacteria 260572
246 Ga0207655_1000280 3300025728 Bacteria 78923
247 Ga0207655_1001774 3300025728 Bacteria 18829
248 Ga0207655_1002461 3300025728 Bacteria 14998
249 Ga0207655_1007053 3300025728 Bacteria 7356
250 Ga0207655_1010499 3300025728 Bacteria 5606
251 Ga0207655_1065520 3300025728 Bacteria 1378
252 Ga0207655_1081611 3300025728 Bacteria 1165
253 Ga0207655_1103939 3300025728 Bacteria 972
254 Ga0207655_1113195 3300025728 Bacteria 913
255 Ga0207713_1000001 3300025735 Bacteria 2295391
256 Ga0207713_1000040 3300025735 Bacteria 245322
257 Ga0207713_1000119 3300025735 Bacteria 123810
258 Ga0207713_1000147 3300025735 Bacteria 106198
259 Ga0207713_1000153 3300025735 Bacteria 103510
260 Ga0207713_1000993 3300025735 Bacteria 24885
261 Ga0207713_1004074 3300025735 Bacteria 9634
262 Ga0207713_1005107 3300025735 Bacteria 8319
263 Ga0207713_1045892 3300025735 Bacteria 1780
264 Ga0207713_1051234 3300025735 Bacteria 1642
265 Ga0207713_1054877 3300025735 Bacteria 1559
266 Ga0207713_1073424 3300025735 Bacteria 1255
267 Ga0207710_10000236 3300025900 Bacteria 47574
268 Ga0207680_11218947 3300025903 Bacteria 536
269 Ga0207684_10054963 3300025910 Bacteria 3378
270 Ga0207654_10000007 3300025911 Bacteria 384211
271 Ga0207695_11452071 3300025913 Bacteria 566
272 Ga0207649_10528882 3300025920 Bacteria 900
273 Ga0207646_10705967 3300025922 Bacteria 902
274 Ga0207681_10407093 3300025923 Bacteria 1100
275 Ga0207700_10231389 3300025928 Bacteria 1571
276 Ga0207706_10070663 3300025933 Bacteria 3071
277 Ga0207709_10044570 3300025935 Bacteria 2681
278 Ga0207709_10055556 3300025935 Bacteria 2446
279 Ga0207709_10183174 3300025935 Bacteria 1481
280 Ga0207709_10623418 3300025935 Bacteria 856
281 Ga0207712_11026129 3300025961 Bacteria 732
282 Ga0207668_10031376 3300025972 Bacteria 3499
283 Ga0207658_10000457 3300025986 Bacteria 38291
284 Ga0207678_10007386 3300026067 Bacteria 9729
285 Ga0207678_11329339 3300026067 Bacteria 636
286 Ga0207678_11650988 3300026067 Bacteria 564
287 Ga0207641_10006656 3300026088 Bacteria 9700
288 Ga0207676_10854850 3300026095 Bacteria 890
289 Ga0207674_10000970 3300026116 Bacteria 37542
290 Ga0209281_1000027 3300027111 Bacteria 463409
291 Ga0209281_1000267 3300027111 Bacteria 100564
292 Ga0209281_1000288 3300027111 Bacteria 93347
293 Ga0209281_1000759 3300027111 Bacteria 31002
294 Ga0209281_1001716 3300027111 Bacteria 11311
295 Ga0209281_1002279 3300027111 Bacteria 8087
296 Ga0209281_1032634 3300027111 Bacteria 920
297 Ga0209371_1000001 3300027312 Bacteria 2771503
298 Ga0209371_1000010 3300027312 Bacteria 922021
299 Ga0209371_1000081 3300027312 Bacteria 185440
300 Ga0209371_1000085 3300027312 Bacteria 179586
301 Ga0209371_1000167 3300027312 Bacteria 98922
302 Ga0209371_1000225 3300027312 Bacteria 73767
303 Ga0209371_1000574 3300027312 Bacteria 33236
304 Ga0209371_1000772 3300027312 Bacteria 26570
305 Ga0209371_1001412 3300027312 Bacteria 16457
306 Ga0209371_1001426 3300027312 Bacteria 16286
307 Ga0209371_1002585 3300027312 Bacteria 9955
308 Ga0209371_1002941 3300027312 Bacteria 8883
309 Ga0209371_1003378 3300027312 Bacteria 7829
310 Ga0209371_1009480 3300027312 Bacteria 3090
311 Ga0209371_1011106 3300027312 Bacteria 2701
312 Ga0209282_1000187 3300027666 Bacteria 32999
313 Ga0209588_1095078 3300027671 Bacteria 960
314 Ga0209813_10142430 3300027866 Bacteria 852
315 Ga0209974_10351328 3300027876 Bacteria 572
316 Ga0268266_10178251 3300028379 Bacteria 1933
317 Ga0268266_10260574 3300028379 Bacteria 1607
318 Ga0268266_11468416 3300028379 Bacteria 657
319 Ga0268264_10000234 3300028381 Bacteria 105863
320 Ga0268264_10035269 3300028381 Bacteria 4118
321 Ga0268264_10648435 3300028381 Bacteria 1045
322 Ga0307517_10316177 3300028786 Bacteria 867
323 Ga0307515_10110841 3300028794 Bacteria 3207
324 Ga0307515_10136358 3300028794 Bacteria 2666
325 Ga0307515_10181835 3300028794 Bacteria 2049
326 Ga0265338_11023673 3300028800 Bacteria 558
327 Ga0268256_1000001 3300030500 Bacteria 2771065
328 Ga0268256_1000048 3300030500 Bacteria 312298
329 Ga0268256_1000092 3300030500 Bacteria 144061
330 Ga0268256_1000124 3300030500 Bacteria 111181
331 Ga0268256_1000179 3300030500 Bacteria 74966
332 Ga0268256_1000180 3300030500 Bacteria 74594
333 Ga0268256_1001190 3300030500 Bacteria 16636
334 Ga0268256_1002218 3300030500 Bacteria 10219
335 Ga0268256_1002603 3300030500 Bacteria 9001
336 Ga0268256_1002925 3300030500 Bacteria 8155
337 Ga0268256_1003568 3300030500 Bacteria 6949
338 Ga0268256_1004734 3300030500 Bacteria 5541
339 Ga0268256_1009863 3300030500 Bacteria 3132
340 Ga0268256_1012017 3300030500 Bacteria 2701
341 Ga0268256_1047696 3300030500 Bacteria 920
342 Ga0307512_10420569 3300030522 Bacteria 552
343 Ga0316177_1127545 3300030731 Bacteria 1216
344 Ga0316176_1184467 3300030732 Bacteria 3251
345 Ga0314311_1061609 3300030733 Bacteria 2119
346 Ga0316180_1080671 3300030736 Bacteria 993
347 Ga0316183_1094547 3300030742 Bacteria 1520
348 Ga0316181_1035684 3300030744 Bacteria 1848
349 Ga0316182_1063853 3300030745 Bacteria 776
350 Ga0265316_10240578 3300031344 Bacteria 1331
351 Ga0307513_10123475 3300031456 Bacteria 2551
352 Ga0307513_10497360 3300031456 Bacteria 937
353 Ga0307408_100050655 3300031548 Bacteria 2987
354 Ga0307408_100206217 3300031548 Bacteria 1594
355 Ga0307408_100523267 3300031548 Bacteria 1042
356 Ga0265342_10477409 3300031712 Bacteria 638
357 Ga0307516_10013001 3300031730 Bacteria 8917
358 Ga0307405_10020390 3300031731 Bacteria 3703
359 Ga0307405_10104457 3300031731 Bacteria 1906
360 Ga0307405_10584893 3300031731 Bacteria 909
361 Ga0307405_10952301 3300031731 Bacteria 729
362 Ga0307413_10163768 3300031824 Bacteria 1565
363 Ga0307410_10348116 3300031852 Bacteria 1183
364 Ga0307406_10006937 3300031901 Bacteria 6274
365 Ga0307406_12082559 3300031901 Bacteria 508
366 Ga0307412_10012106 3300031911 Bacteria 5015
367 Ga0307412_10015398 3300031911 Bacteria 4534
368 Ga0307412_10047308 3300031911 Bacteria 2825
369 Ga0307412_12189129 3300031911 Bacteria 514
370 Ga0307409_100258062 3300031995 Bacteria 1598
371 Ga0307416_100257473 3300032002 Bacteria 1703
372 Ga0307416_100474753 3300032002 Bacteria 1309
373 Ga0307414_10090460 3300032004 Bacteria 2271
374 Ga0307414_10189050 3300032004 Bacteria 1664
375 Ga0307411_10069441 3300032005 Bacteria 2379
376 Ga0307510_10013811 3300033180 Bacteria 9573
377 Ga0373960_0117509 3300035121 Bacteria 879
378 Ga0373946_0116603 3300035171 Bacteria 1215
379 Ga0373931_0088678 3300035691 Bacteria 1720
380 Ga0373931_1093969 3300035691 Bacteria 542
381 Ga0373927_0218827 3300035695 Bacteria 1251
382 Ga0373927_0311517 3300035695 Bacteria 1036
383 Ga0373927_0805858 3300035695 Bacteria 620
384 Ga0373947_0192378 3300035725 Bacteria 1332
385 Ga0373925_0143656 3300037068 Bacteria 1869
386 Ga0395905_0000257 3300037471 Bacteria 79555
387 Ga0395905_0282787 3300037471 Bacteria 1545
388 Ga0395905_0289351 3300037471 Bacteria 1525
389 Ga0436365_1910565 3300039437 Bacteria 475219
390 Ga0436361_0032811 3300039447 Bacteria 2646
391 Ga0436361_0109679 3300039447 Bacteria 3733
392 Ga0436361_0135836 3300039447 Bacteria 2692
393 Ga0436361_0154673 3300039447 Bacteria 28644
394 Ga0436361_0163575 3300039447 Bacteria 625
395 Ga0436361_0288406 3300039447 Bacteria 693
396 Ga0436361_0573374 3300039447 Bacteria 1366
397 Ga0436361_0651068 3300039447 Bacteria 1868
398 Ga0436361_0670378 3300039447 Bacteria 11325
399 Ga0436361_0897616 3300039447 Bacteria 3566
400 Ga0436361_1086940 3300039447 Bacteria 8104
401 Ga0439436_0029164 3300041404 Bacteria 1608
402 Ga0439438_002824 3300041405 Bacteria 7248
403 Ga0439438_004107 3300041405 Bacteria 5685
404 Ga0439447_002785 3300041407 Bacteria 6303
405 Ga0439447_006056 3300041407 Bacteria 3966
406 Ga0439466_0000003 3300041411 Bacteria 486229
407 Ga0439466_0179647 3300041411 Bacteria 645
408 Ga0451802_1156189 3300041460 Bacteria 575
409 Ga0439431_0080082 3300041997 Bacteria 880
410 Ga0439441_001593 3300042001 Bacteria 3019
411 Ga0439448_0008634 3300042005 Bacteria 2983
412 Ga0439432_064634 3300042006 Bacteria 1122
413 Ga0439432_091620 3300042006 Bacteria 914
414 Ga0439432_145097 3300042006 Bacteria 697
415 Ga0439432_219910 3300042006 Bacteria 548
416 Ga0439449_0016946 3300042007 Bacteria 2735
417 Ga0439449_0128450 3300042007 Bacteria 942
418 Ga0439452_000286 3300042010 Bacteria 32655
419 Ga0439452_002728 3300042010 Bacteria 6397
420 Ga0439452_111627 3300042010 Bacteria 584
421 Ga0439452_119921 3300042010 Bacteria 560
422 Ga0439455_0000139 3300042012 Bacteria 7794
423 Ga0439463_002316 3300042016 Bacteria 4863
424 Ga0450920_010211 3300042122 Bacteria 1739
425 Ga0450921_016919 3300042123 Bacteria 666
426 Ga0450891_012961 3300042129 Bacteria 780
427 Ga0450894_015602 3300042131 Bacteria 1007
428 Ga0450900_002265 3300042136 Bacteria 2018
429 Ga0450902_026915 3300042137 Bacteria 963
430 Ga0450907_000522 3300042146 Bacteria 10535
431 Ga0450910_001740 3300042147 Bacteria 2793
432 Ga0439446_0069717 3300042156 Bacteria 1074
433 Ga0439458_0000087 3300042157 Bacteria 17544
434 Ga0450908_008695 3300042184 Bacteria 1898
435 Ga0450909_012906 3300042185 Bacteria 1226
436 Ga0439434_0002133 3300042435 Bacteria 5725
437 Ga0439459_0075534 3300042438 Bacteria 787
438 Ga0439459_0077365 3300042438 Bacteria 780
439 Ga0439464_0002934 3300042439 Bacteria 4252
440 Ga0450918_003055 3300042531 Bacteria 3128
441 Ga0466981_0000039 3300044669 Bacteria 47011
442 Ga0466966_0707696 3300044684 Bacteria 607
443 Ga0466963_0472413 3300044694 Bacteria 885
444 Ga0466971_0360643 3300044719 Bacteria 704
445 Ga0466957_0004739 3300044842 Bacteria 7618
446 Ga0466960_0174871 3300044901 Bacteria 1161
447 Ga0466958_0000225 3300045836 Bacteria 21373
448 Ga0495617_012232 3300046452 Bacteria 2923
449 Ga0495617_059851 3300046452 Bacteria 1261
450 Ga0495627_000126 3300046453 Bacteria 93150
451 Ga0495627_101739 3300046453 Bacteria 819
452 Ga0495603_0862740 3300046455 Bacteria 515
453 Ga0495590_0039026 3300046457 Bacteria 1656
454 Ga0495591_000014 3300046458 Bacteria 254281
455 Ga0495591_000513 3300046458 Bacteria 30422
456 Ga0495591_001159 3300046458 Bacteria 17260
457 Ga0495629_0446600 3300046459 Bacteria 876
458 Ga0495638_0001144 3300046460 Bacteria 25617
459 Ga0495638_0068175 3300046460 Bacteria 2182
460 Ga0495638_0097500 3300046460 Bacteria 1762
461 Ga0495650_0000032 3300046471 Bacteria 425389
462 Ga0495650_0005870 3300046471 Bacteria 7813
463 Ga0495650_0072474 3300046471 Bacteria 1348
464 Ga0495605_0000008 3300046474 Bacteria 334602
465 Ga0495605_0062590 3300046474 Bacteria 1777
466 Ga0495664_0860657 3300046477 Bacteria 531
467 Ga0495584_0006356 3300046491 Bacteria 6189
468 Ga0495584_0091753 3300046491 Bacteria 1532
469 Ga0495585_0016763 3300046492 Bacteria 4244
470 Ga0495594_0002037 3300046499 Bacteria 10522
471 Ga0495596_0008742 3300046500 Bacteria 4488
472 Ga0495596_0098184 3300046500 Bacteria 1137
473 Ga0495607_0012995 3300046501 Bacteria 5474
474 Ga0495607_0146892 3300046501 Bacteria 1210
475 Ga0495607_0172942 3300046501 Bacteria 1089
476 Ga0495583_0000002 3300046506 Bacteria 782521
477 Ga0495583_0000039 3300046506 Bacteria 241501
478 Ga0495583_0019768 3300046506 Bacteria 3507
479 Ga0495606_0027092 3300046507 Bacteria 4070
480 Ga0495606_0058565 3300046507 Bacteria 2475
481 Ga0495606_0170422 3300046507 Bacteria 1263
482 Ga0495610_0003131 3300046512 Bacteria 13161
483 Ga0495610_0021139 3300046512 Bacteria 3585
484 Ga0495610_0042835 3300046512 Bacteria 2260
485 Ga0495616_0021460 3300046513 Bacteria 3498
486 Ga0495616_0027628 3300046513 Bacteria 3009
487 Ga0495616_0070236 3300046513 Bacteria 1696
488 Ga0495620_0000031 3300046515 Bacteria 120343
489 Ga0495620_0005635 3300046515 Bacteria 6970
490 Ga0495620_0161484 3300046515 Bacteria 870
491 Ga0495628_0930617 3300046516 Bacteria 602
492 Ga0495631_0005562 3300046518 Bacteria 6586
493 Ga0495631_0009927 3300046518 Bacteria 4733
494 Ga0495631_0014524 3300046518 Bacteria 3799
495 Ga0495632_0005414 3300046519 Bacteria 8443
496 Ga0495632_0031541 3300046519 Bacteria 2738
497 Ga0495637_0018724 3300046520 Bacteria 3208
498 Ga0495637_0078483 3300046520 Bacteria 1320
499 Ga0495637_0081060 3300046520 Bacteria 1294
500 Ga0495643_0015316 3300046522 Bacteria 4534
501 Ga0495643_0018586 3300046522 Bacteria 4036
502 Ga0495643_0050406 3300046522 Bacteria 2242
503 Ga0495644_0082819 3300046523 Bacteria 1209
504 Ga0495648_0000862 3300046524 Bacteria 31961
505 Ga0495648_0004079 3300046524 Bacteria 12605
506 Ga0495648_0032483 3300046524 Bacteria 3423
507 Ga0495648_0034829 3300046524 Bacteria 3271
508 Ga0495648_0363486 3300046524 Bacteria 657
509 Ga0495663_0024138 3300046525 Bacteria 1766
510 Ga0495652_1136041 3300046529 Bacteria 506
511 Ga0495654_0000019 3300046530 Bacteria 289483
512 Ga0495654_0000052 3300046530 Bacteria 145382
513 Ga0495654_0000133 3300046530 Bacteria 78489
514 Ga0495654_0000543 3300046530 Bacteria 30408
515 Ga0495654_0005804 3300046530 Bacteria 7113
516 Ga0495654_0011354 3300046530 Bacteria 4822
517 Ga0495654_0019891 3300046530 Bacteria 3504
518 Ga0495609_0000031 3300046538 Bacteria 213813
519 Ga0495597_0000352 3300046542 Bacteria 41199
520 Ga0495597_0004022 3300046542 Bacteria 8245
521 Ga0495622_0030240 3300046557 Bacteria 2531
522 Ga0495622_0301506 3300046557 Bacteria 698
523 Ga0495633_0000011 3300046558 Bacteria 268237
524 Ga0495633_0384022 3300046558 Bacteria 635
525 Ga0495668_0042377 3300046616 Bacteria 2534
526 Ga0495668_0131230 3300046616 Bacteria 1371
527 Ga0495611_0000645 3300046648 Bacteria 19981
528 Ga0495611_0088192 3300046648 Bacteria 1432
529 Ga0495611_0299196 3300046648 Bacteria 742
530 Ga0495625_0000170 3300046660 Bacteria 102224
531 Ga0495625_0000593 3300046660 Bacteria 52631
532 Ga0495625_0004619 3300046660 Bacteria 12943
533 Ga0495625_0102494 3300046660 Bacteria 1964
534 Ga0495625_0471980 3300046660 Bacteria 772
535 Ga0495661_0000021 3300046665 Bacteria 194581
536 Ga0495661_0012909 3300046665 Bacteria 5628
537 Ga0495588_0031234 3300046674 Bacteria 2680
538 Ga0495588_0032753 3300046674 Bacteria 2621
539 Ga0495588_0082766 3300046674 Bacteria 1676
540 Ga0495658_0308940 3300046683 Bacteria 1001
541 Ga0495624_0769877 3300046690 Bacteria 570
542 Ga0495670_0001750 3300046691 Bacteria 10657
543 Ga0495670_0022065 3300046691 Bacteria 3143
544 Ga0495671_0008541 3300046692 Bacteria 5755
545 Ga0495671_0015296 3300046692 Bacteria 4115
546 Ga0495671_0025517 3300046692 Bacteria 3071
547 Ga0495671_0232068 3300046692 Bacteria 892
548 Ga0495649_0012666 3300046694 Bacteria 4894
549 Ga0495589_0000004 3300046794 Bacteria 439891
550 Ga0495589_0065031 3300046794 Bacteria 1788
551 Ga0495589_0202636 3300046794 Bacteria 936
552 Ga0495660_0000021 3300046810 Bacteria 293250
553 Ga0495660_0002193 3300046810 Bacteria 12575
554 Ga0495660_0056782 3300046810 Bacteria 2114
555 Ga0495660_0160391 3300046810 Bacteria 1103
556 Ga0495672_0000002 3300047320 Bacteria 740116
557 Ga0495672_0000012 3300047320 Bacteria 519975
558 Ga0495672_0000199 3300047320 Bacteria 85658
559 Ga0495672_0001289 3300047320 Bacteria 24996
560 Ga0495672_0062804 3300047320 Bacteria 2134
561 Ga0495672_0171509 3300047320 Bacteria 1106
562 Ga0495676_0111513 3300047321 Bacteria 2006
563 Ga0495683_0000008 3300047323 Bacteria 241577
564 Ga0495687_136321 3300047443 Bacteria 861
565 Ga0495677_0192288 3300047445 Bacteria 792
566 Ga0495679_000020 3300047446 Bacteria 228413
567 Ga0495679_001481 3300047446 Bacteria 13274
568 Ga0495679_002514 3300047446 Bacteria 9256
569 Ga0495679_008134 3300047446 Bacteria 4293
570 Ga0495679_030031 3300047446 Bacteria 1768
571 Ga0495673_0000095 3300047469 Bacteria 183429
572 Ga0495673_0000147 3300047469 Bacteria 125742
573 Ga0495673_0000542 3300047469 Bacteria 38769
574 Ga0495673_0000561 3300047469 Bacteria 37888
575 Ga0495673_0022492 3300047469 Bacteria 3088
576 Ga0495673_0075248 3300047469 Bacteria 1410
577 Ga0495673_0191399 3300047469 Bacteria 769
578 Ga0495681_0000688 3300047470 Bacteria 25777
579 Ga0495681_0008051 3300047470 Bacteria 6644
580 Ga0495681_0015367 3300047470 Bacteria 4334
581 Ga0495681_0025691 3300047470 Bacteria 3077
582 Ga0495681_0140372 3300047470 Bacteria 1021
583 Ga0495686_0000088 3300047472 Bacteria 195862
584 Ga0495686_0005411 3300047472 Bacteria 10084
585 Ga0495686_0024236 3300047472 Bacteria 3991
586 Ga0495686_0074223 3300047472 Bacteria 2087
587 Ga0495686_0079847 3300047472 Bacteria 2000
588 Ga0495686_0174634 3300047472 Bacteria 1248
589 Ga0495686_0244610 3300047472 Bacteria 1010
590 Ga0495686_0381440 3300047472 Bacteria 760
591 Ga0495593_0239542 3300047673 Bacteria 909
592 Ga0495614_0421401 3300048089 Bacteria 629
593 Ga0495626_0043960 3300048091 Bacteria 2094
594 Ga0495626_0143764 3300048091 Bacteria 1010
595 Ga0496101_0000245 3300048904 Bacteria 39561
596 Ga0496101_0066600 3300048904 Bacteria 2628
597 Ga0496101_0437728 3300048904 Bacteria 1031
598 Ga0496102_0004556 3300048905 Bacteria 11709
599 Ga0496102_0087385 3300048905 Bacteria 2880
600 Ga0496102_1532879 3300048905 Bacteria 585
601 Ga0496103_0032158 3300048906 Bacteria 3201
602 Ga0496103_0081389 3300048906 Bacteria 2037
603 Ga0496103_0424713 3300048906 Bacteria 853
604 Ga0496104_0000585 3300048907 Bacteria 31096
605 Ga0496104_0089486 3300048907 Bacteria 2941
606 Ga0496105_0008927 3300048908 Bacteria 7816
607 Ga0496110_0092600 3300048913 Bacteria 2705
608 Ga0496111_0000161 3300048914 Bacteria 30179
609 Ga0496113_0785551 3300048916 Bacteria 757
610 Ga0496116_0000001 3300048919 Bacteria 1501681
611 Ga0496116_0000392 3300048919 Bacteria 64036
612 Ga0496116_0000977 3300048919 Bacteria 35099
613 Ga0496116_0003411 3300048919 Bacteria 15717
614 Ga0496116_0003460 3300048919 Bacteria 15569
615 Ga0496116_0009633 3300048919 Bacteria 8217
616 Ga0496116_0010592 3300048919 Bacteria 7711
617 Ga0496116_0011095 3300048919 Bacteria 7493
618 Ga0496116_0012225 3300048919 Bacteria 7021
619 Ga0496116_0013166 3300048919 Bacteria 6692
620 Ga0496116_0024207 3300048919 Bacteria 4496
621 Ga0496116_0028086 3300048919 Bacteria 4082
622 Ga0496116_0029536 3300048919 Bacteria 3950
623 Ga0496116_0034789 3300048919 Bacteria 3547
624 Ga0496116_0041230 3300048919 Bacteria 3169
625 Ga0496116_0181267 3300048919 Bacteria 1127
626 Ga0496116_0403871 3300048919 Bacteria 603
627 Ga0496116_0407511 3300048919 Bacteria 599
628 Ga0496117_0000002 3300048920 Bacteria 2483758
629 Ga0496117_0000004 3300048920 Bacteria 877131
630 Ga0496117_0000436 3300048920 Bacteria 69452
631 Ga0496117_0000486 3300048920 Bacteria 65652
632 Ga0496117_0001974 3300048920 Bacteria 27271
633 Ga0496117_0005286 3300048920 Bacteria 13679
634 Ga0496117_0012239 3300048920 Bacteria 7587
635 Ga0496117_0023548 3300048920 Bacteria 4901
636 Ga0496117_0028588 3300048920 Bacteria 4315
637 Ga0496117_0047355 3300048920 Bacteria 3083
638 Ga0496117_0047638 3300048920 Bacteria 3071
639 Ga0496117_0125294 3300048920 Bacteria 1569
640 Ga0496117_0130981 3300048920 Bacteria 1520
641 Ga0496117_0137123 3300048920 Bacteria 1472
642 Ga0496117_0201362 3300048920 Bacteria 1124
643 Ga0496117_0262975 3300048920 Bacteria 934
644 Ga0496117_0287632 3300048920 Bacteria 877
645 Ga0496117_0339961 3300048920 Bacteria 779
646 Ga0496118_0000072 3300048921 Bacteria 201387
647 Ga0496118_0000323 3300048921 Bacteria 82847
648 Ga0496118_0000464 3300048921 Bacteria 67368
649 Ga0496118_0003071 3300048921 Bacteria 21415
650 Ga0496118_0007432 3300048921 Bacteria 11614
651 Ga0496118_0016600 3300048921 Bacteria 6748
652 Ga0496118_0025762 3300048921 Bacteria 5031
653 Ga0496118_0029505 3300048921 Bacteria 4597
654 Ga0496118_0031959 3300048921 Bacteria 4348
655 Ga0496118_0033583 3300048921 Bacteria 4206
656 Ga0496118_0052124 3300048921 Bacteria 3124
657 Ga0496118_0056962 3300048921 Bacteria 2933
658 Ga0496118_0077236 3300048921 Bacteria 2363
659 Ga0496118_0096722 3300048921 Bacteria 2011
660 Ga0496118_0164398 3300048921 Bacteria 1366
661 Ga0496118_0193956 3300048921 Bacteria 1211
662 Ga0496119_0000080 3300048922 Bacteria 139962
663 Ga0496119_0000124 3300048922 Bacteria 108620
664 Ga0496119_0001227 3300048922 Bacteria 31931
665 Ga0496119_0003217 3300048922 Bacteria 17094
666 Ga0496119_0006765 3300048922 Bacteria 10514
667 Ga0496119_0010953 3300048922 Bacteria 7573
668 Ga0496119_0038452 3300048922 Bacteria 3091
669 Ga0496119_0047989 3300048922 Bacteria 2652
670 Ga0496119_0061893 3300048922 Bacteria 2232
671 Ga0496119_0061983 3300048922 Bacteria 2230
672 Ga0496119_0062821 3300048922 Bacteria 2211
673 Ga0496119_0065507 3300048922 Bacteria 2151
674 Ga0496119_0091373 3300048922 Bacteria 1729
675 Ga0496119_0114491 3300048922 Bacteria 1491
676 Ga0496119_0219941 3300048922 Bacteria 972
677 Ga0496119_0257678 3300048922 Bacteria 877
678 Ga0496119_0311586 3300048922 Bacteria 773
679 Ga0496120_0000040 3300048923 Bacteria 201554
680 Ga0496120_0000062 3300048923 Bacteria 172365
681 Ga0496120_0000075 3300048923 Bacteria 163540
682 Ga0496120_0000093 3300048923 Bacteria 146905
683 Ga0496120_0000128 3300048923 Bacteria 127855
684 Ga0496120_0000252 3300048923 Bacteria 89838
685 Ga0496120_0001216 3300048923 Bacteria 32539
686 Ga0496120_0002252 3300048923 Bacteria 20156
687 Ga0496120_0021517 3300048923 Bacteria 4075
688 Ga0496120_0051487 3300048923 Bacteria 2351
689 Ga0496120_0077053 3300048923 Bacteria 1815
690 Ga0496121_0000047 3300048924 Bacteria 335768
691 Ga0496121_0000710 3300048924 Bacteria 61765
692 Ga0496121_0004945 3300048924 Bacteria 17485
693 Ga0496121_0009598 3300048924 Bacteria 11087
694 Ga0496121_0012264 3300048924 Bacteria 9381
695 Ga0496121_0023459 3300048924 Bacteria 5940
696 Ga0496121_0026477 3300048924 Bacteria 5462
697 Ga0496121_0031468 3300048924 Bacteria 4846
698 Ga0496121_0046941 3300048924 Bacteria 3690
699 Ga0496121_0051646 3300048924 Bacteria 3460
700 Ga0496121_0058378 3300048924 Bacteria 3190
701 Ga0496121_0089815 3300048924 Bacteria 2403
702 Ga0496122_0000004 3300048925 Bacteria 645283
703 Ga0496122_0000211 3300048925 Bacteria 130145
704 Ga0496122_0000356 3300048925 Bacteria 98548
705 Ga0496122_0002991 3300048925 Bacteria 23011
706 Ga0496122_0004390 3300048925 Bacteria 17562
707 Ga0496122_0004632 3300048925 Bacteria 16911
708 Ga0496122_0004795 3300048925 Bacteria 16537
709 Ga0496122_0007725 3300048925 Bacteria 11838
710 Ga0496122_0015166 3300048925 Bacteria 7384
711 Ga0496122_0057668 3300048925 Bacteria 2882
712 Ga0496122_0060226 3300048925 Bacteria 2797
713 Ga0496122_0088576 3300048925 Bacteria 2120
714 Ga0496122_0117011 3300048925 Bacteria 1731
715 Ga0496122_0133976 3300048925 Bacteria 1566
716 Ga0496122_0178217 3300048925 Bacteria 1271
717 Ga0496123_0000007 3300048926 Bacteria 645283
718 Ga0496123_0000134 3300048926 Bacteria 153219
719 Ga0496123_0000309 3300048926 Bacteria 94366
720 Ga0496123_0000508 3300048926 Bacteria 67759
721 Ga0496123_0001890 3300048926 Bacteria 27331
722 Ga0496123_0005205 3300048926 Bacteria 13219
723 Ga0496123_0007397 3300048926 Bacteria 10365
724 Ga0496123_0009423 3300048926 Bacteria 8796
725 Ga0496123_0012981 3300048926 Bacteria 7038
726 Ga0496123_0017385 3300048926 Bacteria 5788
727 Ga0496123_0031223 3300048926 Bacteria 3880
728 Ga0496123_0034022 3300048926 Bacteria 3658
729 Ga0496123_0035162 3300048926 Bacteria 3575
730 Ga0496123_0083467 3300048926 Bacteria 1931
731 Ga0496123_0145941 3300048926 Bacteria 1285
732 Ga0496124_0000152 3300048927 Bacteria 140118
733 Ga0496124_0000399 3300048927 Bacteria 79230
734 Ga0496124_0001262 3300048927 Bacteria 38513
735 Ga0496124_0002623 3300048927 Bacteria 23151
736 Ga0496124_0004853 3300048927 Bacteria 15467
737 Ga0496124_0009609 3300048927 Bacteria 9911
738 Ga0496124_0015188 3300048927 Bacteria 7394
739 Ga0496124_0017407 3300048927 Bacteria 6772
740 Ga0496124_0056079 3300048927 Bacteria 3325
741 Ga0496124_0061853 3300048927 Bacteria 3136
742 Ga0496124_0093103 3300048927 Bacteria 2453
743 Ga0496124_0108647 3300048927 Bacteria 2236
744 Ga0496124_0118849 3300048927 Bacteria 2115
745 Ga0496124_0122039 3300048927 Bacteria 2081
746 Ga0496124_0125294 3300048927 Bacteria 2047
747 Ga0496124_0150363 3300048927 Bacteria 1827
748 Ga0496124_0205665 3300048927 Bacteria 1493
749 Ga0496124_0250460 3300048927 Bacteria 1310
750 Ga0496124_0282721 3300048927 Bacteria 1208
751 Ga0496124_0316087 3300048927 Bacteria 1120
752 Ga0496124_0360006 3300048927 Bacteria 1025
753 Ga0496124_0360788 3300048927 Bacteria 1024
754 Ga0496125_0001470 3300048928 Bacteria 34097
755 Ga0496125_0002790 3300048928 Bacteria 22082
756 Ga0496125_0004938 3300048928 Bacteria 15090
757 Ga0496125_0005370 3300048928 Bacteria 14292
758 Ga0496125_0006354 3300048928 Bacteria 12817
759 Ga0496125_0008230 3300048928 Bacteria 10962
760 Ga0496125_0036033 3300048928 Bacteria 4327
761 Ga0496125_0040055 3300048928 Bacteria 4024
762 Ga0496125_0046513 3300048928 Bacteria 3639
763 Ga0496125_0088974 3300048928 Bacteria 2324
764 Ga0496125_0155270 3300048928 Bacteria 1565
765 Ga0496125_0452263 3300048928 Bacteria 735
766 Ga0496126_0002540 3300048929 Bacteria 24417
767 Ga0496126_0004794 3300048929 Bacteria 15896
768 Ga0496126_0016875 3300048929 Bacteria 7288
769 Ga0496126_0053895 3300048929 Bacteria 3646
770 Ga0496126_0057225 3300048929 Bacteria 3521
771 Ga0496126_0086386 3300048929 Bacteria 2765
772 Ga0496126_0088816 3300048929 Bacteria 2721
773 Ga0496126_0099053 3300048929 Bacteria 2553
774 Ga0496126_0140114 3300048929 Bacteria 2083
775 Ga0496126_0149019 3300048929 Bacteria 2006
776 Ga0496126_0362190 3300048929 Bacteria 1184
777 Ga0496126_0460397 3300048929 Bacteria 1022
778 Ga0496126_0647246 3300048929 Bacteria 827
779 Ga0496126_1218309 3300048929 Bacteria 552
780 Ga0495678_000018 3300049459 Bacteria 279747
781 Ga0495678_000326 3300049459 Bacteria 50497
782 Ga0495678_110528 3300049459 Bacteria 937
783 Ga0495682_0000015 3300049460 Bacteria 235048
784 Ga0501032_0465938 3300049569 Bacteria 809
785 Ga0501034_0141080 3300049571 Bacteria 2389
786 Ga0501070_0194200 3300049586 Bacteria 1668
787 Ga0501249_003809 3300049679 Bacteria 3045
788 Ga0501083_0432849 3300049744 Bacteria 856
789 Ga0501241_043281 3300049758 Bacteria 877
790 Ga0501262_000750 3300049759 Bacteria 3746
791 Ga0501044_0518336 3300049823 Bacteria 1092
792 nmdc:mga03683_1329_c1 3300050489 Bacteria 7325
793 nmdc:mga03683_3528_c1 3300050489 Bacteria 5064
794 nmdc:mga03683_93757_c1 3300050489 Bacteria 1312
795 nmdc:mga03n38_393046_c1 3300050490 Bacteria 762
796 nmdc:mga00v17_10053_c1 3300050491 Bacteria 5152
797 nmdc:mga00v17_103487_c1 3300050491 Bacteria 1799
798 nmdc:mga00v17_148956_c1 3300050491 Bacteria 1503
799 nmdc:mga00v17_189976_c2 3300050491 Bacteria 954
800 nmdc:mga00v17_272014_c1 3300050491 Bacteria 1099
801 nmdc:mga00v17_34295_c1 3300050491 Bacteria 3013
802 nmdc:mga00v17_3690_c1 3300050491 Bacteria 7909
803 nmdc:mga00v17_588256_c1 3300050491 Bacteria 718
804 nmdc:mga0yw44_126070_c1 3300050492 Bacteria 1654
805 nmdc:mga0yw44_1274_c1 3300050492 Bacteria 9927
806 nmdc:mga0yw44_27822_c1 3300050492 Bacteria 3244
807 nmdc:mga0yw44_74860_c1 3300050492 Bacteria 2110
808 nmdc:mga0k408_168783_c1 3300050493 Bacteria 1304
809 nmdc:mga0k408_265294_c1 3300050493 Bacteria 1025
810 nmdc:mga0k408_887749_c1 3300050493 Bacteria 517
811 nmdc:mga06z11_132579_c1 3300050494 Bacteria 1401
812 nmdc:mga06z11_168114_c2 3300050494 Bacteria 836
813 nmdc:mga06z11_194507_c1 3300050494 Bacteria 1175
814 nmdc:mga06z11_226551_c1 3300050494 Bacteria 1094
815 nmdc:mga06z11_48210_c1 3300050494 Bacteria 2167
816 nmdc:mga06z11_56372_c1 3300050494 Bacteria 2032
817 nmdc:mga06z11_574832_c1 3300050494 Bacteria 685
818 nmdc:mga07m45_151577_c1 3300050496 Bacteria 1345
819 nmdc:mga07m45_2064_c1 3300050496 Bacteria 9325
820 nmdc:mga07m45_40601_c1 3300050496 Bacteria 2604
821 nmdc:mga07m45_750824_c1 3300050496 Bacteria 560
822 nmdc:mga07m45_8640_c1 3300050496 Bacteria 5244
823 nmdc:mga07m45_90266_c1 3300050496 Bacteria 1755
824 nmdc:mga0qj67_1051278_c1 3300050509 Bacteria 637
825 nmdc:mga08y16_870949_c1 3300050511 Bacteria 889
826 nmdc:mga0sz30_142194_c1 3300050516 Bacteria 702
827 nmdc:mga0sz30_222097_c1 3300050516 Bacteria 840
828 nmdc:mga0sz30_55558_c1 3300050516 Bacteria 1685
829 nmdc:mga0sz30_60_c1 3300050516 Bacteria 41594
830 nmdc:mga0sz30_62982_c1 3300050516 Bacteria 1587
831 Ga0500610_0338419 3300053079 Bacteria 643
832 Ga0500578_0043934 3300053086 Bacteria 2868
833 Ga0500578_0229952 3300053086 Bacteria 1124
834 Ga0500643_022579 3300053087 Bacteria 2022
835 Ga0500644_0009424 3300053088 Bacteria 2610
836 Ga0500644_0030964 3300053088 Bacteria 1697
837 Ga0500581_022193 3300053089 Bacteria 3213
838 Ga0500646_0007763 3300053090 Bacteria 2742
839 Ga0500646_0034444 3300053090 Bacteria 1404
840 Ga0500646_0294073 3300053090 Bacteria 581
841 Ga0500647_0215516 3300053091 Bacteria 863
842 Ga0500583_0020595 3300053092 Bacteria 2726
843 Ga0500651_0045653 3300053093 Bacteria 2756
844 Ga0500651_0072986 3300053093 Bacteria 2133
845 Ga0500651_0321046 3300053093 Bacteria 884
846 Ga0500651_0332077 3300053093 Bacteria 866
847 Ga0500566_0000811 3300053094 Bacteria 17784
848 Ga0500566_0002995 3300053094 Bacteria 10086
849 Ga0500641_0000487 3300053096 Bacteria 14433
850 Ga0500641_0004126 3300053096 Bacteria 5129
851 Ga0500650_0004938 3300053098 Bacteria 4897
852 Ga0500554_002001 3300053102 Bacteria 3953
853 Ga0500554_014996 3300053102 Bacteria 2013
854 Ga0500555_051725 3300053103 Bacteria 1122
855 Ga0500556_0000006 3300053104 Bacteria 453982
856 Ga0500556_0005182 3300053104 Bacteria 3682
857 Ga0500560_001783 3300053107 Bacteria 3876
858 Ga0500562_001145 3300053108 Bacteria 6527
859 Ga0500562_003536 3300053108 Bacteria 3917
860 Ga0500562_120906 3300053108 Bacteria 714
861 Ga0500569_001769 3300053109 Bacteria 4140
862 Ga0500569_007679 3300053109 Bacteria 2432
863 Ga0500592_000371 3300053116 Bacteria 7518
864 Ga0500593_166623 3300053117 Bacteria 835
865 Ga0500594_0009611 3300053118 Bacteria 2231
866 Ga0500595_002159 3300053119 Bacteria 10004
867 Ga0500595_029560 3300053119 Bacteria 1858
868 Ga0500595_133611 3300053119 Bacteria 698
869 Ga0500607_025913 3300053121 Bacteria 3263
870 Ga0500608_000880 3300053122 Bacteria 10842
871 Ga0500618_000285 3300053125 Bacteria 38522
872 Ga0500618_006218 3300053125 Bacteria 3526
873 Ga0500618_014209 3300053125 Bacteria 2039
874 Ga0500618_063036 3300053125 Bacteria 833
875 Ga0500621_000001 3300053126 Bacteria 1049698
876 Ga0500642_0000004 3300053130 Bacteria 433122
877 Ga0500652_000160 3300053131 Bacteria 25768
878 Ga0500658_0036578 3300053134 Bacteria 1948
879 Ga0500658_0254220 3300053134 Bacteria 807
880 Ga0500658_0275480 3300053134 Bacteria 773
881 Ga0500559_0000720 3300053136 Bacteria 21746
882 Ga0500559_0003860 3300053136 Bacteria 7245
883 Ga0500559_0055393 3300053136 Bacteria 1758
884 Ga0500559_0189139 3300053136 Bacteria 970
885 Ga0500568_0002010 3300053139 Bacteria 12384
886 Ga0500568_0003440 3300053139 Bacteria 8824
887 Ga0500568_0019147 3300053139 Bacteria 2981
888 Ga0500573_0002805 3300053140 Bacteria 8833
889 Ga0500573_0469929 3300053140 Bacteria 576
890 Ga0500577_0005208 3300053142 Bacteria 3488
891 Ga0500577_0173091 3300053142 Bacteria 924
892 Ga0500577_0260351 3300053142 Bacteria 754
893 Ga0500577_0414707 3300053142 Bacteria 589
894 Ga0500586_000112 3300053145 Bacteria 14466
895 Ga0500588_0099038 3300053146 Bacteria 1002
896 Ga0500588_0159985 3300053146 Bacteria 819
897 Ga0500590_008244 3300053148 Bacteria 5192
898 Ga0500603_066757 3300053150 Bacteria 1017
899 Ga0500604_0000031 3300053151 Bacteria 57942
900 Ga0500604_0037128 3300053151 Bacteria 1455
901 Ga0500616_0000022 3300053153 Bacteria 460463
902 Ga0500616_0006857 3300053153 Bacteria 7358
903 Ga0500619_169678 3300053154 Bacteria 739
904 Ga0500620_262778 3300053155 Bacteria 571
905 Ga0500622_0000644 3300053156 Bacteria 31219
906 Ga0500622_0001425 3300053156 Bacteria 19200
907 Ga0500622_0028461 3300053156 Bacteria 2942
908 Ga0500622_0422237 3300053156 Bacteria 536
909 Ga0500627_0008907 3300053158 Bacteria 3590
910 Ga0500627_0013247 3300053158 Bacteria 3119
911 Ga0500633_0004174 3300053160 Bacteria 3277
912 Ga0500636_0000222 3300053177 Bacteria 30908
913 Ga0500636_0000309 3300053177 Bacteria 26814
914 Ga0500636_0288935 3300053177 Bacteria 814
915 Ga0500637_0000894 3300053178 Bacteria 11997
916 Ga0500637_0016151 3300053178 Bacteria 3975
917 Ga0500570_155111 3300053724 Bacteria 804
918 Ga0500611_005745 3300053727 Bacteria 1765
919 Ga0500645_008123 3300053730 Bacteria 3607
920 Ga0500645_015065 3300053730 Bacteria 2456
921 Ga0500609_003976 3300053731 Bacteria 2059
922 Ga0500601_000147 3300053737 Bacteria 14569
923 Ga0500661_000365 3300055283 Bacteria 8344
924 Ga0587098_056179 3300059604 Bacteria 608
925 Ga0466962_0096479 3300061719 Bacteria 1418
926 2506577825 2506520007 Bacteria 5442880
927 2506582963 2506520008 Bacteria 5443009
928 2508851785 2508501071 Bacteria 5454741
929 2511131354 2510917022 Bacteria 6504556
930 2511382322 2511231025 Bacteria 5324661
931 2511434105 2511231035 Bacteria 5341610
932 2548650924 2547132416 Bacteria 4633861
933 2555260454 2554235234 Bacteria 5762085
934 2585147582 2582581279 Bacteria 4980720
935 2585274930 2582581307 Bacteria 6597605
936 2585561356 2585427531 Bacteria 6992870
937 2585830019 2585427591 Bacteria 5482980
938 2585832290 2585427592 Bacteria 5370892
939 2585846555 2585427594 Bacteria 6180594
940 2585908049 2585427609 Bacteria 6667127
941 2587983916 2585428125 Bacteria 6662905
942 2599411129 2599185169 Bacteria 5441380
943 2601523560 2600255254 Bacteria 5281859
944 2601528719 2600255255 Bacteria 5282785
945 2601536474 2600255256 Bacteria 5597742
946 2601541897 2600255257 Bacteria 5597196
947 2601615552 2600255280 Bacteria 5292309
948 2601620728 2600255281 Bacteria 5288753
949 2601643379 2600255287 Bacteria 5210468
950 2601649125 2600255288 Bacteria 5282738
951 2601653603 2600255289 Bacteria 5281907
952 2601659023 2600255290 Bacteria 5282218
953 2601663202 2600255291 Bacteria 5217298
954 2601696161 2600255298 Bacteria 5215185
955 2601700835 2600255299 Bacteria 5218662
956 2601707820 2600255300 Bacteria 5287774
957 2601712879 2600255301 Bacteria 5280532
958 2601716862 2600255302 Bacteria 5288235
959 2601721185 2600255303 Bacteria 5219315
960 2601724975 2600255304 Bacteria 5283973
961 2601732258 2600255305 Bacteria 5282329
962 2601737864 2600255306 Bacteria 5281613
963 2601744007 2600255307 Bacteria 5439064
964 2601753393 2600255309 Bacteria 5431045
965 2601760256 2600255310 Bacteria 5600903
966 2601765659 2600255311 Bacteria 5598766
967 2602022020 2600255392 Bacteria 5437392
968 2603638436 2602042046 Bacteria 5483348
969 2603642942 2602042047 Bacteria 4697674
970 2603660585 2602042052 Bacteria 5215873
971 2603665857 2602042053 Bacteria 5214361
972 2603699586 2602042066 Bacteria 4423871
973 2603703550 2602042067 Bacteria 4863713
974 2603839205 2602042103 Bacteria 5284714
975 2603844739 2602042104 Bacteria 5281639
976 2603849362 2602042105 Bacteria 5282303
977 2603854431 2602042106 Bacteria 5282744
978 2603858587 2602042107 Bacteria 6226103
979 2603867469 2602042109 Bacteria 5152801
980 2603870156 2602042110 Bacteria 5283285
981 2603875111 2602042111 Bacteria 5212080
982 2606047347 2603880178 Bacteria 5283018
983 2606070291 2603880184 Bacteria 5217896
984 2606146150 2603880202 Bacteria 5284684
985 2606177077 2603880211 Bacteria 5284226
986 2608668952 2608642108 Bacteria 4104624
987 2609910693 2609459761 Bacteria 5513740
988 2637226056 2636415599 Bacteria 5718434
989 2644163873 2643221628 Bacteria 5745828
990 2656278503 2654587920 Bacteria 5475511
991 2676407756 2675903046 Bacteria 5451247
992 2681995344 2681812866 Bacteria 4552357
993 2687579560 2687453129 Bacteria 4387428
994 2689444350 2687453601 Bacteria 5546041
995 2738801919 2738541293 Bacteria 7065685
996 2739790216 2739367756 Bacteria 4553612
997 2753855470 2751185917 Bacteria 4551186
998 2775542263 2775506706 Bacteria 4873073
999 2776910893 2775507049 Bacteria 6284736
1000 2777020582 2775507074 Bacteria 5532402
1001 2807177153 2806310673 Bacteria 4801221
1002 2813729494 2811995292 Bacteria 5303342
1003 2814696983 2814123068 Bacteria 5687681
1004 2821119281 2821118458 Bacteria 4714306
1005 2842680632 2842677519 Bacteria 5615038
1006 2844427016 2844425489 Bacteria 4854065
1007 2844530410 2844528606 Bacteria 4733806
1008 2847088174 2847085930 Bacteria 5070450
1009 2857526289 2857524615 Bacteria 6615449
1010 2861694753 2861691609 Bacteria 5628931
1011 2865015708 2865014394 Bacteria 4764573
1012 2869553702 2869551831 Bacteria 5474685
1013 2876602055 2876601092 Bacteria 5114497
1014 2881612316 2881609920 Bacteria 4405319
1015 2893067439 2893066018 Bacteria 6158120
1016 2902406070 2902405164 Bacteria 6784948
1017 2904437194 2904434214 Bacteria 6230908
1018 2904505214 2904504865 Bacteria 5152820
1019 2904517539 2904513164 Bacteria 5476410
1020 2908670723 2908669403 Bacteria 5740494
1021 2919073859 2919073203 Bacteria 6531949
1022 2919112885 2919108558 Bacteria 5897419
1023 2919463436 2919462493 Bacteria 5817112
1024 2923638906 2923634449 Bacteria 4753480
1025 2927834602 2927833300 Bacteria 4923934
1026 2928118499 2928115317 Bacteria 6477646
1027 2928125921 2928125067 Bacteria 5937560
1028 2929525933 2929520902 Bacteria 6765052
1029 2937543304 2937539931 Bacteria 4639830
1030 2939568671 2939568625 Bacteria 4542555
1031 2939602608 2939602548 Bacteria 4950493
1032 2939607981 2939607340 Bacteria 4719256
1033 2939644284 2939642701 Bacteria 4475280
1034 2945878623 2945874760 Bacteria 5527237
1035 2945953542 2945951305 Bacteria 4918162
1036 2969083068 2969079654 Bacteria 5439582
1037 2971824346 2971820967 Bacteria 5823634
1038 2978976035 2978975091 Bacteria 4704313
1039 2984560086 2984559226 Bacteria 5683096
1040 2984598168 2984595703 Bacteria 5682994
1041 640937353 640753048 Bacteria 5495657
1042 8016736434 8016733728 Bacteria 5274317
1043 8018225426 8018221730 Bacteria 4616064
1044 8019503105 8019499862 Bacteria 5169538
1045 8054844769 8054844752 Bacteria 4450330
1046 8055088594 8055087960 Bacteria 4784273
1047 8055094172 8055092621 Bacteria 4873875
1048 Ga0495591_008678
1049 SwRhRL2b_contig_2020483
1050 SwRhRL2b_contig_605692
1051 JGI25162J39368_1014135
1052 JGI25152J39213_1001256
1053 JGI25150J39212_1000010
1054 JGI25151J46595_10000026
1055 JGI25406J46586_10064863
1056 JGI25165J46597_1020337
1057 JGI25153J46596_10000590
1058 JGI25153J46596_10003622
1059 rootH1_10132492
1060 rootH2_10059718
1061 rootH2_10087853
1062 rootL2_10013653
1063 rootH1_10006414
1064 rootH1_10206025
1065 Ga0055526_1038075
1066 Ga0055537_1000502
1067 Ga0055524_1023191
1068 Ga0055534_1000242
1069 Ga0055528_1001320
1070 Ga0055528_1035157
1071 Ga0055531_10004450
1072 Ga0058692_1000058
1073 Ga0058692_1000076
1074 Ga0058692_1000362
1075 Ga0058692_1004662
1076 Ga0058692_1010094
1077 Ga0058692_1010098
1078 Ga0055543_1007142
1079 Ga0065165_1001689
1080 Ga0065165_1004567
1081 Ga0065703_1021363
1082 Ga0065714_10006253
1083 Ga0065714_10260811
1084 Ga0065704_10000722
1085 Ga0065704_10004428
1086 Ga0065704_10006660
1087 Ga0065704_10087996
1088 Ga0065704_10111960
1089 Ga0070676_10600126
1090 Ga0070666_11258153
1091 Ga0070682_101372518
1092 Ga0070660_101114689
1093 Ga0070661_100318601
1094 Ga0070668_100001252
1095 Ga0070667_100000111
1096 Ga0070714_100619656
1097 Ga0070710_10348198
1098 Ga0070711_100680376
1099 Ga0070694_101024057
1100 Ga0070663_100138807
1101 Ga0070663_100670201
1102 Ga0070662_100084696
1103 Ga0070706_100455253
1104 Ga0070665_100049105
1105 Ga0070665_100228851
1106 Ga0070665_100617725
1107 Ga0068864_100568487
1108 Ga0068863_100008694
1109 Ga0068860_100000176
1110 Ga0068860_100134520
1111 Ga0068860_100353204
1112 Ga0068860_101254259
1113 Ga0081455_10013447
1114 Ga0081539_10001642
1115 Ga0081539_10010459
1116 Ga0075365_10022409
1117 Ga0075365_10076612
1118 Ga0075365_10191551
1119 Ga0075368_10154439
1120 Ga0075368_10530006
1121 Ga0075363_100625451
1122 Ga0075363_100691325
1123 Ga0075364_10011159
1124 Ga0075364_10020445
1125 Ga0075364_10029099
1126 Ga0075364_10050371
1127 Ga0075364_10085687
1128 Ga0075364_10296173
1129 Ga0075364_10331026
1130 Ga0075364_10379985
1131 Ga0075364_10764937
1132 Ga0075364_10793956
1133 Ga0075364_10996527
1134 Ga0075432_10265897
1135 Ga0075362_10002076
1136 Ga0075362_10018790
1137 Ga0075362_10032651
1138 Ga0075362_10046781
1139 Ga0075362_10306003
1140 Ga0075367_10037444
1141 Ga0075367_10041045
1142 Ga0075367_10119300
1143 Ga0075367_10175023
1144 Ga0075367_10453810
1145 Ga0075367_10513342
1146 Ga0075369_10005321
1147 Ga0075369_10012237
1148 Ga0075369_10013788
1149 Ga0075369_10095193
1150 Ga0075369_10345690
1151 Ga0075366_10021195
1152 Ga0075366_10273858
1153 Ga0075366_10904683
1154 Ga0075370_10039894
1155 Ga0075370_10203005
1156 Ga0075370_10438065
1157 Ga0068871_100871039
1158 Ga0079104_1006009
1159 Ga0079104_1011871
1160 Ga0079104_1011876
1161 Ga0079104_1012532
1162 Ga0079104_1034418
1163 Ga0079104_1059619
1164 Ga0079104_1060234
1165 Ga0099826_10000457
1166 Ga0099794_10054552
1167 Ga0099794_10211048
1168 Ga0105251_10000465
1169 Ga0105251_10000606
1170 Ga0105251_10001506
1171 Ga0105251_10001643
1172 Ga0105251_10005434
1173 Ga0105251_10008672
1174 Ga0105251_10009938
1175 Ga0105251_10021637
1176 Ga0105251_10107007
1177 Ga0105244_10000942
1178 Ga0105244_10001226
1179 Ga0105244_10001277
1180 Ga0105244_10002704
1181 Ga0105244_10009582
1182 Ga0105244_10018705
1183 Ga0105244_10039184
1184 Ga0105244_10087058
1185 Ga0105244_10115042
1186 Ga0105244_10146959
1187 Ga0105244_10150545
1188 Ga0105244_10599311
1189 Ga0105250_10001600
1190 Ga0105250_10005696
1191 Ga0105250_10009361
1192 Ga0105250_10012703
1193 Ga0105250_10030647
1194 Ga0105250_10032752
1195 Ga0105250_10080016
1196 Ga0105240_10523173
1197 Ga0105240_10594556
1198 Ga0105240_12166780
1199 Ga0111539_11091991
1200 Ga0105247_10000599
1201 Ga0105243_10057395
1202 Ga0105243_11705909
1203 Ga0105241_10000005
1204 Ga0105237_10570440
1205 Ga0105035_122872
1206 Ga0105246_10039104
1207 Ga0105246_10067378
1208 Ga0105246_10153798
1209 Ga0105246_10551199
1210 Ga0105246_10738722
1211 Ga0105246_11213893
1212 Ga0157336_1036166
1213 Ga0157339_1022024
1214 Ga0157373_10002016
1215 Ga0157373_10003201
1216 Ga0157373_10009416
1217 Ga0157373_10016798
1218 Ga0157373_10321628
1219 Ga0157371_10000205
1220 Ga0157371_10000227
1221 Ga0157371_10003306
1222 Ga0157371_10080174
1223 Ga0157371_10102989
1224 Ga0157370_10000714
1225 Ga0157370_10574223
1226 Ga0157370_10761646
1227 Ga0157370_10951553
1228 Ga0157369_10006972
1229 Ga0157369_11198339
1230 Ga0163162_10120780
1231 Ga0163162_11901581
1232 Ga0157372_10004082
1233 Ga0157372_10005425
1234 Ga0157372_10013441
1235 Ga0157372_10023649
1236 Ga0157372_10668620
1237 Ga0163163_11212573
1238 Ga0182008_10009476
1239 Ga0182008_10082048
1240 Ga0182006_1017488
1241 Ga0182006_1020123
1242 Ga0183366_1001
1243 Ga0183370_1001
1244 Ga0183369_1001
1245 Ga0183368_1001
1246 Ga0163161_10000001
1247 Ga0163161_10004067
1248 Ga0163161_10574429
1249 Ga0213872_10000790
1250 Ga0213872_10003376
1251 Ga0213872_10018711
1252 Ga0213872_10082389
1253 Ga0213872_10119754
1254 Ga0213876_10000016
1255 Ga0209760_102364
1256 Ga0209437_100035
1257 Ga0207425_1000010
1258 Ga0209129_1000197
1259 Ga0209233_1004780
1260 Ga0209565_1000129
1261 Ga0209565_1023091
1262 Ga0209673_1000247
1263 Ga0209673_1012632
1264 Ga0209673_1028927
1265 Ga0209675_1000093
1266 Ga0209675_1045803
1267 Ga0209676_1054305
1268 Ga0209025_1000022
1269 Ga0209025_1005035
1270 Ga0209564_1010159
1271 Ga0209564_1010614
1272 Ga0209758_1000086
1273 Ga0209758_1000216
1274 Ga0209256_1003843
1275 Ga0209256_1040612
1276 Ga0209256_1062741
1277 Ga0207426_1066296
1278 Ga0207426_1121371
1279 Ga0209257_1000782
1280 Ga0207697_10183972
1281 Ga0207696_1000001
1282 Ga0207696_1000004
1283 Ga0207696_1000070
1284 Ga0207696_1000077
1285 Ga0207696_1001271
1286 Ga0207696_1001429
1287 Ga0207696_1007868
1288 Ga0207696_1020677
1289 Ga0207696_1054973
1290 Ga0207655_1000001
1291 Ga0207655_1000009
1292 Ga0207655_1000060
1293 Ga0207655_1000280
1294 Ga0207655_1001774
1295 Ga0207655_1002461
1296 Ga0207655_1007053
1297 Ga0207655_1010499
1298 Ga0207655_1065520
1299 Ga0207655_1081611
1300 Ga0207655_1103939
1301 Ga0207655_1113195
1302 Ga0207713_1000001
1303 Ga0207713_1000040
1304 Ga0207713_1000119
1305 Ga0207713_1000147
1306 Ga0207713_1000153
1307 Ga0207713_1000993
1308 Ga0207713_1004074
1309 Ga0207713_1005107
1310 Ga0207713_1045892
1311 Ga0207713_1051234
1312 Ga0207713_1054877
1313 Ga0207713_1073424
1314 Ga0207710_10000236
1315 Ga0207680_11218947
1316 Ga0207684_10054963
1317 Ga0207654_10000007
1318 Ga0207695_11452071
1319 Ga0207649_10528882
1320 Ga0207646_10705967
1321 Ga0207681_10407093
1322 Ga0207700_10231389
1323 Ga0207706_10070663
1324 Ga0207709_10044570
1325 Ga0207709_10055556
1326 Ga0207709_10183174
1327 Ga0207709_10623418
1328 Ga0207712_11026129
1329 Ga0207668_10031376
1330 Ga0207658_10000457
1331 Ga0207678_10007386
1332 Ga0207678_11329339
1333 Ga0207678_11650988
1334 Ga0207641_10006656
1335 Ga0207676_10854850
1336 Ga0207674_10000970
1337 Ga0209281_1000027
1338 Ga0209281_1000267
1339 Ga0209281_1000288
1340 Ga0209281_1000759
1341 Ga0209281_1001716
1342 Ga0209281_1002279
1343 Ga0209281_1032634
1344 Ga0209371_1000001
1345 Ga0209371_1000010
1346 Ga0209371_1000081
1347 Ga0209371_1000085
1348 Ga0209371_1000167
1349 Ga0209371_1000225
1350 Ga0209371_1000574
1351 Ga0209371_1000772
1352 Ga0209371_1001412
1353 Ga0209371_1001426
1354 Ga0209371_1002585
1355 Ga0209371_1002941
1356 Ga0209371_1003378
1357 Ga0209371_1009480
1358 Ga0209371_1011106
1359 Ga0209282_1000187
1360 Ga0209588_1095078
1361 Ga0209813_10142430
1362 Ga0209974_10351328
1363 Ga0268266_10178251
1364 Ga0268266_10260574
1365 Ga0268266_11468416
1366 Ga0268264_10000234
1367 Ga0268264_10035269
1368 Ga0268264_10648435
1369 Ga0307517_10316177
1370 Ga0307515_10110841
1371 Ga0307515_10136358
1372 Ga0307515_10181835
1373 Ga0265338_11023673
1374 Ga0268256_1000001
1375 Ga0268256_1000048
1376 Ga0268256_1000092
1377 Ga0268256_1000124
1378 Ga0268256_1000179
1379 Ga0268256_1000180
1380 Ga0268256_1001190
1381 Ga0268256_1002218
1382 Ga0268256_1002603
1383 Ga0268256_1002925
1384 Ga0268256_1003568
1385 Ga0268256_1004734
1386 Ga0268256_1009863
1387 Ga0268256_1012017
1388 Ga0268256_1047696
1389 Ga0307512_10420569
1390 Ga0316177_1127545
1391 Ga0316176_1184467
1392 Ga0314311_1061609
1393 Ga0316180_1080671
1394 Ga0316183_1094547
1395 Ga0316181_1035684
1396 Ga0316182_1063853
1397 Ga0265316_10240578
1398 Ga0307513_10123475
1399 Ga0307513_10497360
1400 Ga0307408_100050655
1401 Ga0307408_100206217
1402 Ga0307408_100523267
1403 Ga0265342_10477409
1404 Ga0307516_10013001
1405 Ga0307405_10020390
1406 Ga0307405_10104457
1407 Ga0307405_10584893
1408 Ga0307405_10952301
1409 Ga0307413_10163768
1410 Ga0307410_10348116
1411 Ga0307406_10006937
1412 Ga0307406_12082559
1413 Ga0307412_10012106
1414 Ga0307412_10015398
1415 Ga0307412_10047308
1416 Ga0307412_12189129
1417 Ga0307409_100258062
1418 Ga0307416_100257473
1419 Ga0307416_100474753
1420 Ga0307414_10090460
1421 Ga0307414_10189050
1422 Ga0307411_10069441
1423 Ga0307510_10013811
1424 Ga0373960_0117509
1425 Ga0373946_0116603
1426 Ga0373931_0088678
1427 Ga0373931_1093969
1428 Ga0373927_0218827
1429 Ga0373927_0311517
1430 Ga0373927_0805858
1431 Ga0373947_0192378
1432 Ga0373925_0143656
1433 Ga0395905_0000257
1434 Ga0395905_0282787
1435 Ga0395905_0289351
1436 Ga0436365_1910565
1437 Ga0436361_0032811
1438 Ga0436361_0109679
1439 Ga0436361_0135836
1440 Ga0436361_0154673
1441 Ga0436361_0163575
1442 Ga0436361_0288406
1443 Ga0436361_0573374
1444 Ga0436361_0651068
1445 Ga0436361_0670378
1446 Ga0436361_0897616
1447 Ga0436361_1086940
1448 Ga0439436_0029164
1449 Ga0439438_002824
1450 Ga0439438_004107
1451 Ga0439447_002785
1452 Ga0439447_006056
1453 Ga0439466_0000003
1454 Ga0439466_0179647
1455 Ga0451802_1156189
1456 Ga0439431_0080082
1457 Ga0439441_001593
1458 Ga0439448_0008634
1459 Ga0439432_064634
1460 Ga0439432_091620
1461 Ga0439432_145097
1462 Ga0439432_219910
1463 Ga0439449_0016946
1464 Ga0439449_0128450
1465 Ga0439452_000286
1466 Ga0439452_002728
1467 Ga0439452_111627
1468 Ga0439452_119921
1469 Ga0439455_0000139
1470 Ga0439463_002316
1471 Ga0450920_010211
1472 Ga0450921_016919
1473 Ga0450891_012961
1474 Ga0450894_015602
1475 Ga0450900_002265
1476 Ga0450902_026915
1477 Ga0450907_000522
1478 Ga0450910_001740
1479 Ga0439446_0069717
1480 Ga0439458_0000087
1481 Ga0450908_008695
1482 Ga0450909_012906
1483 Ga0439434_0002133
1484 Ga0439459_0075534
1485 Ga0439459_0077365
1486 Ga0439464_0002934
1487 Ga0450918_003055
1488 Ga0466981_0000039
1489 Ga0466966_0707696
1490 Ga0466963_0472413
1491 Ga0466971_0360643
1492 Ga0466957_0004739
1493 Ga0466960_0174871
1494 Ga0466958_0000225
1495 Ga0495617_012232
1496 Ga0495617_059851
1497 Ga0495627_000126
1498 Ga0495627_101739
1499 Ga0495603_0862740
1500 Ga0495590_0039026
1501 Ga0495591_000014
1502 Ga0495591_000513
1503 Ga0495591_001159
1504 Ga0495629_0446600
1505 Ga0495638_0001144
1506 Ga0495638_0068175
1507 Ga0495638_0097500
1508 Ga0495650_0000032
1509 Ga0495650_0005870
1510 Ga0495650_0072474
1511 Ga0495605_0000008
1512 Ga0495605_0062590
1513 Ga0495664_0860657
1514 Ga0495584_0006356
1515 Ga0495584_0091753
1516 Ga0495585_0016763
1517 Ga0495594_0002037
1518 Ga0495596_0008742
1519 Ga0495596_0098184
1520 Ga0495607_0012995
1521 Ga0495607_0146892
1522 Ga0495607_0172942
1523 Ga0495583_0000002
1524 Ga0495583_0000039
1525 Ga0495583_0019768
1526 Ga0495606_0027092
1527 Ga0495606_0058565
1528 Ga0495606_0170422
1529 Ga0495610_0003131
1530 Ga0495610_0021139
1531 Ga0495610_0042835
1532 Ga0495616_0021460
1533 Ga0495616_0027628
1534 Ga0495616_0070236
1535 Ga0495620_0000031
1536 Ga0495620_0005635
1537 Ga0495620_0161484
1538 Ga0495628_0930617
1539 Ga0495631_0005562
1540 Ga0495631_0009927
1541 Ga0495631_0014524
1542 Ga0495632_0005414
1543 Ga0495632_0031541
1544 Ga0495637_0018724
1545 Ga0495637_0078483
1546 Ga0495637_0081060
1547 Ga0495643_0015316
1548 Ga0495643_0018586
1549 Ga0495643_0050406
1550 Ga0495644_0082819
1551 Ga0495648_0000862
1552 Ga0495648_0004079
1553 Ga0495648_0032483
1554 Ga0495648_0034829
1555 Ga0495648_0363486
1556 Ga0495663_0024138
1557 Ga0495652_1136041
1558 Ga0495654_0000019
1559 Ga0495654_0000052
1560 Ga0495654_0000133
1561 Ga0495654_0000543
1562 Ga0495654_0005804
1563 Ga0495654_0011354
1564 Ga0495654_0019891
1565 Ga0495609_0000031
1566 Ga0495597_0000352
1567 Ga0495597_0004022
1568 Ga0495622_0030240
1569 Ga0495622_0301506
1570 Ga0495633_0000011
1571 Ga0495633_0384022
1572 Ga0495668_0042377
1573 Ga0495668_0131230
1574 Ga0495611_0000645
1575 Ga0495611_0088192
1576 Ga0495611_0299196
1577 Ga0495625_0000170
1578 Ga0495625_0000593
1579 Ga0495625_0004619
1580 Ga0495625_0102494
1581 Ga0495625_0471980
1582 Ga0495661_0000021
1583 Ga0495661_0012909
1584 Ga0495588_0031234
1585 Ga0495588_0032753
1586 Ga0495588_0082766
1587 Ga0495658_0308940
1588 Ga0495624_0769877
1589 Ga0495670_0001750
1590 Ga0495670_0022065
1591 Ga0495671_0008541
1592 Ga0495671_0015296
1593 Ga0495671_0025517
1594 Ga0495671_0232068
1595 Ga0495649_0012666
1596 Ga0495589_0000004
1597 Ga0495589_0065031
1598 Ga0495589_0202636
1599 Ga0495660_0000021
1600 Ga0495660_0002193
1601 Ga0495660_0056782
1602 Ga0495660_0160391
1603 Ga0495672_0000002
1604 Ga0495672_0000012
1605 Ga0495672_0000199
1606 Ga0495672_0001289
1607 Ga0495672_0062804
1608 Ga0495672_0171509
1609 Ga0495676_0111513
1610 Ga0495683_0000008
1611 Ga0495687_136321
1612 Ga0495677_0192288
1613 Ga0495679_000020
1614 Ga0495679_001481
1615 Ga0495679_002514
1616 Ga0495679_008134
1617 Ga0495679_030031
1618 Ga0495673_0000095
1619 Ga0495673_0000147
1620 Ga0495673_0000542
1621 Ga0495673_0000561
1622 Ga0495673_0022492
1623 Ga0495673_0075248
1624 Ga0495673_0191399
1625 Ga0495681_0000688
1626 Ga0495681_0008051
1627 Ga0495681_0015367
1628 Ga0495681_0025691
1629 Ga0495681_0140372
1630 Ga0495686_0000088
1631 Ga0495686_0005411
1632 Ga0495686_0024236
1633 Ga0495686_0074223
1634 Ga0495686_0079847
1635 Ga0495686_0174634
1636 Ga0495686_0244610
1637 Ga0495686_0381440
1638 Ga0495593_0239542
1639 Ga0495614_0421401
1640 Ga0495626_0043960
1641 Ga0495626_0143764
1642 Ga0496101_0000245
1643 Ga0496101_0066600
1644 Ga0496101_0437728
1645 Ga0496102_0004556
1646 Ga0496102_0087385
1647 Ga0496102_1532879
1648 Ga0496103_0032158
1649 Ga0496103_0081389
1650 Ga0496103_0424713
1651 Ga0496104_0000585
1652 Ga0496104_0089486
1653 Ga0496105_0008927
1654 Ga0496110_0092600
1655 Ga0496111_0000161
1656 Ga0496113_0785551
1657 Ga0496116_0000001
1658 Ga0496116_0000392
1659 Ga0496116_0000977
1660 Ga0496116_0003411
1661 Ga0496116_0003460
1662 Ga0496116_0009633
1663 Ga0496116_0010592
1664 Ga0496116_0011095
1665 Ga0496116_0012225
1666 Ga0496116_0013166
1667 Ga0496116_0024207
1668 Ga0496116_0028086
1669 Ga0496116_0029536
1670 Ga0496116_0034789
1671 Ga0496116_0041230
1672 Ga0496116_0181267
1673 Ga0496116_0403871
1674 Ga0496116_0407511
1675 Ga0496117_0000002
1676 Ga0496117_0000004
1677 Ga0496117_0000436
1678 Ga0496117_0000486
1679 Ga0496117_0001974
1680 Ga0496117_0005286
1681 Ga0496117_0012239
1682 Ga0496117_0023548
1683 Ga0496117_0028588
1684 Ga0496117_0047355
1685 Ga0496117_0047638
1686 Ga0496117_0125294
1687 Ga0496117_0130981
1688 Ga0496117_0137123
1689 Ga0496117_0201362
1690 Ga0496117_0262975
1691 Ga0496117_0287632
1692 Ga0496117_0339961
1693 Ga0496118_0000072
1694 Ga0496118_0000323
1695 Ga0496118_0000464
1696 Ga0496118_0003071
1697 Ga0496118_0007432
1698 Ga0496118_0016600
1699 Ga0496118_0025762
1700 Ga0496118_0029505
1701 Ga0496118_0031959
1702 Ga0496118_0033583
1703 Ga0496118_0052124
1704 Ga0496118_0056962
1705 Ga0496118_0077236
1706 Ga0496118_0096722
1707 Ga0496118_0164398
1708 Ga0496118_0193956
1709 Ga0496119_0000080
1710 Ga0496119_0000124
1711 Ga0496119_0001227
1712 Ga0496119_0003217
1713 Ga0496119_0006765
1714 Ga0496119_0010953
1715 Ga0496119_0038452
1716 Ga0496119_0047989
1717 Ga0496119_0061893
1718 Ga0496119_0061983
1719 Ga0496119_0062821
1720 Ga0496119_0065507
1721 Ga0496119_0091373
1722 Ga0496119_0114491
1723 Ga0496119_0219941
1724 Ga0496119_0257678
1725 Ga0496119_0311586
1726 Ga0496120_0000040
1727 Ga0496120_0000062
1728 Ga0496120_0000075
1729 Ga0496120_0000093
1730 Ga0496120_0000128
1731 Ga0496120_0000252
1732 Ga0496120_0001216
1733 Ga0496120_0002252
1734 Ga0496120_0021517
1735 Ga0496120_0051487
1736 Ga0496120_0077053
1737 Ga0496121_0000047
1738 Ga0496121_0000710
1739 Ga0496121_0004945
1740 Ga0496121_0009598
1741 Ga0496121_0012264
1742 Ga0496121_0023459
1743 Ga0496121_0026477
1744 Ga0496121_0031468
1745 Ga0496121_0046941
1746 Ga0496121_0051646
1747 Ga0496121_0058378
1748 Ga0496121_0089815
1749 Ga0496122_0000004
1750 Ga0496122_0000211
1751 Ga0496122_0000356
1752 Ga0496122_0002991
1753 Ga0496122_0004390
1754 Ga0496122_0004632
1755 Ga0496122_0004795
1756 Ga0496122_0007725
1757 Ga0496122_0015166
1758 Ga0496122_0057668
1759 Ga0496122_0060226
1760 Ga0496122_0088576
1761 Ga0496122_0117011
1762 Ga0496122_0133976
1763 Ga0496122_0178217
1764 Ga0496123_0000007
1765 Ga0496123_0000134
1766 Ga0496123_0000309
1767 Ga0496123_0000508
1768 Ga0496123_0001890
1769 Ga0496123_0005205
1770 Ga0496123_0007397
1771 Ga0496123_0009423
1772 Ga0496123_0012981
1773 Ga0496123_0017385
1774 Ga0496123_0031223
1775 Ga0496123_0034022
1776 Ga0496123_0035162
1777 Ga0496123_0083467
1778 Ga0496123_0145941
1779 Ga0496124_0000152
1780 Ga0496124_0000399
1781 Ga0496124_0001262
1782 Ga0496124_0002623
1783 Ga0496124_0004853
1784 Ga0496124_0009609
1785 Ga0496124_0015188
1786 Ga0496124_0017407
1787 Ga0496124_0056079
1788 Ga0496124_0061853
1789 Ga0496124_0093103
1790 Ga0496124_0108647
1791 Ga0496124_0118849
1792 Ga0496124_0122039
1793 Ga0496124_0125294
1794 Ga0496124_0150363
1795 Ga0496124_0205665
1796 Ga0496124_0250460
1797 Ga0496124_0282721
1798 Ga0496124_0316087
1799 Ga0496124_0360006
1800 Ga0496124_0360788
1801 Ga0496125_0001470
1802 Ga0496125_0002790
1803 Ga0496125_0004938
1804 Ga0496125_0005370
1805 Ga0496125_0006354
1806 Ga0496125_0008230
1807 Ga0496125_0036033
1808 Ga0496125_0040055
1809 Ga0496125_0046513
1810 Ga0496125_0088974
1811 Ga0496125_0155270
1812 Ga0496125_0452263
1813 Ga0496126_0002540
1814 Ga0496126_0004794
1815 Ga0496126_0016875
1816 Ga0496126_0053895
1817 Ga0496126_0057225
1818 Ga0496126_0086386
1819 Ga0496126_0088816
1820 Ga0496126_0099053
1821 Ga0496126_0140114
1822 Ga0496126_0149019
1823 Ga0496126_0362190
1824 Ga0496126_0460397
1825 Ga0496126_0647246
1826 Ga0496126_1218309
1827 Ga0495678_000018
1828 Ga0495678_000326
1829 Ga0495678_110528
1830 Ga0495682_0000015
1831 Ga0501032_0465938
1832 Ga0501034_0141080
1833 Ga0501070_0194200
1834 Ga0501249_003809
1835 Ga0501083_0432849
1836 Ga0501241_043281
1837 Ga0501262_000750
1838 Ga0501044_0518336
1839 nmdc:mga03683_1329_c1
1840 nmdc:mga03683_3528_c1
1841 nmdc:mga03683_93757_c1
1842 nmdc:mga03n38_393046_c1
1843 nmdc:mga00v17_10053_c1
1844 nmdc:mga00v17_103487_c1
1845 nmdc:mga00v17_148956_c1
1846 nmdc:mga00v17_189976_c2
1847 nmdc:mga00v17_272014_c1
1848 nmdc:mga00v17_34295_c1
1849 nmdc:mga00v17_3690_c1
1850 nmdc:mga00v17_588256_c1
1851 nmdc:mga0yw44_126070_c1
1852 nmdc:mga0yw44_1274_c1
1853 nmdc:mga0yw44_27822_c1
1854 nmdc:mga0yw44_74860_c1
1855 nmdc:mga0k408_168783_c1
1856 nmdc:mga0k408_265294_c1
1857 nmdc:mga0k408_887749_c1
1858 nmdc:mga06z11_132579_c1
1859 nmdc:mga06z11_168114_c2
1860 nmdc:mga06z11_194507_c1
1861 nmdc:mga06z11_226551_c1
1862 nmdc:mga06z11_48210_c1
1863 nmdc:mga06z11_56372_c1
1864 nmdc:mga06z11_574832_c1
1865 nmdc:mga07m45_151577_c1
1866 nmdc:mga07m45_2064_c1
1867 nmdc:mga07m45_40601_c1
1868 nmdc:mga07m45_750824_c1
1869 nmdc:mga07m45_8640_c1
1870 nmdc:mga07m45_90266_c1
1871 nmdc:mga0qj67_1051278_c1
1872 nmdc:mga08y16_870949_c1
1873 nmdc:mga0sz30_142194_c1
1874 nmdc:mga0sz30_222097_c1
1875 nmdc:mga0sz30_55558_c1
1876 nmdc:mga0sz30_60_c1
1877 nmdc:mga0sz30_62982_c1
1878 Ga0500610_0338419
1879 Ga0500578_0043934
1880 Ga0500578_0229952
1881 Ga0500643_022579
1882 Ga0500644_0009424
1883 Ga0500644_0030964
1884 Ga0500581_022193
1885 Ga0500646_0007763
1886 Ga0500646_0034444
1887 Ga0500646_0294073
1888 Ga0500647_0215516
1889 Ga0500583_0020595
1890 Ga0500651_0045653
1891 Ga0500651_0072986
1892 Ga0500651_0321046
1893 Ga0500651_0332077
1894 Ga0500566_0000811
1895 Ga0500566_0002995
1896 Ga0500641_0000487
1897 Ga0500641_0004126
1898 Ga0500650_0004938
1899 Ga0500554_002001
1900 Ga0500554_014996
1901 Ga0500555_051725
1902 Ga0500556_0000006
1903 Ga0500556_0005182
1904 Ga0500560_001783
1905 Ga0500562_001145
1906 Ga0500562_003536
1907 Ga0500562_120906
1908 Ga0500569_001769
1909 Ga0500569_007679
1910 Ga0500592_000371
1911 Ga0500593_166623
1912 Ga0500594_0009611
1913 Ga0500595_002159
1914 Ga0500595_029560
1915 Ga0500595_133611
1916 Ga0500607_025913
1917 Ga0500608_000880
1918 Ga0500618_000285
1919 Ga0500618_006218
1920 Ga0500618_014209
1921 Ga0500618_063036
1922 Ga0500621_000001
1923 Ga0500642_0000004
1924 Ga0500652_000160
1925 Ga0500658_0036578
1926 Ga0500658_0254220
1927 Ga0500658_0275480
1928 Ga0500559_0000720
1929 Ga0500559_0003860
1930 Ga0500559_0055393
1931 Ga0500559_0189139
1932 Ga0500568_0002010
1933 Ga0500568_0003440
1934 Ga0500568_0019147
1935 Ga0500573_0002805
1936 Ga0500573_0469929
1937 Ga0500577_0005208
1938 Ga0500577_0173091
1939 Ga0500577_0260351
1940 Ga0500577_0414707
1941 Ga0500586_000112
1942 Ga0500588_0099038
1943 Ga0500588_0159985
1944 Ga0500590_008244
1945 Ga0500603_066757
1946 Ga0500604_0000031
1947 Ga0500604_0037128
1948 Ga0500616_0000022
1949 Ga0500616_0006857
1950 Ga0500619_169678
1951 Ga0500620_262778
1952 Ga0500622_0000644
1953 Ga0500622_0001425
1954 Ga0500622_0028461
1955 Ga0500622_0422237
1956 Ga0500627_0008907
1957 Ga0500627_0013247
1958 Ga0500633_0004174
1959 Ga0500636_0000222
1960 Ga0500636_0000309
1961 Ga0500636_0288935
1962 Ga0500637_0000894
1963 Ga0500637_0016151
1964 Ga0500570_155111
1965 Ga0500611_005745
1966 Ga0500645_008123
1967 Ga0500645_015065
1968 Ga0500609_003976
1969 Ga0500601_000147
1970 Ga0500661_000365
1971 Ga0587098_056179
1972 Ga0466962_0096479
1973 2506577825
1974 2506582963
1975 2508851785
1976 2511131354
1977 2511382322
1978 2511434105
1979 2548650924
1980 2555260454
1981 2585147582
1982 2585274930
1983 2585561356
1984 2585830019
1985 2585832290
1986 2585846555
1987 2585908049
1988 2587983916
1989 2599411129
1990 2601523560
1991 2601528719
1992 2601536474
1993 2601541897
1994 2601615552
1995 2601620728
1996 2601643379
1997 2601649125
1998 2601653603
1999 2601659023
2000 2601663202
2001 2601696161
2002 2601700835
2003 2601707820
2004 2601712879
2005 2601716862
2006 2601721185
2007 2601724975
2008 2601732258
2009 2601737864
2010 2601744007
2011 2601753393
2012 2601760256
2013 2601765659
2014 2602022020
2015 2603638436
2016 2603642942
2017 2603660585
2018 2603665857
2019 2603699586
2020 2603703550
2021 2603839205
2022 2603844739
2023 2603849362
2024 2603854431
2025 2603858587
2026 2603867469
2027 2603870156
2028 2603875111
2029 2606047347
2030 2606070291
2031 2606146150
2032 2606177077
2033 2608668952
2034 2609910693
2035 2637226056
2036 2644163873
2037 2656278503
2038 2676407756
2039 2681995344
2040 2687579560
2041 2689444350
2042 2738801919
2043 2739790216
2044 2753855470
2045 2775542263
2046 2776910893
2047 2777020582
2048 2807177153
2049 2813729494
2050 2814696983
2051 2821119281
2052 2842680632
2053 2844427016
2054 2844530410
2055 2847088174
2056 2857526289
2057 2861694753
2058 2865015708
2059 2869553702
2060 2876602055
2061 2881612316
2062 2893067439
2063 2902406070
2064 2904437194
2065 2904505214
2066 2904517539
2067 2908670723
2068 2919073859
2069 2919112885
2070 2919463436
2071 2923638906
2072 2927834602
2073 2928118499
2074 2928125921
2075 2929525933
2076 2937543304
2077 2939568671
2078 2939602608
2079 2939607981
2080 2939644284
2081 2945878623
2082 2945953542
2083 2969083068
2084 2971824346
2085 2978976035
2086 2984560086
2087 2984598168
2088 640937353
2089 8016736434
2090 8018225426
2091 8019503105
2092 8054844769
2093 8055088594
2094 8055094172

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

35

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9984 2 127
3v4d-assembly1.cif.gz_C crystal structure of rutc protein a member of the yjgf family from e.coli 0.9929 1 128
3v4d-assembly2.cif.gz_B crystal structure of rutc protein a member of the yjgf family from e.coli 0.9905 1 126
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9901 2 127
3v4d-assembly2.cif.gz_E crystal structure of rutc protein a member of the yjgf family from e.coli 0.9851 1 128
ID Description Score Start End Superfamily
af_P0AFQ5_1_128_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9932 1 128 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9355 18 125 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9303 1 127 3.30.1330.40
3lybC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9228 21 127 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.919 4 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7Z9CTC0-F1-model_v4 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) 0.9967 3 128 GO:0005829
GO:0006212
GO:0016491
GO:0019239
GO:0019740
AF-G8LIN5-F1-model_v4 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) 0.9931 1 128 GO:0005829
GO:0006212
GO:0019239
GO:0019740
AF-A4VQH6-F1-model_v4 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) 0.9927 1 128 GO:0005829
GO:0006212
GO:0019239
GO:0019740
AF-A0A377W6E7-F1-model_v4 Multifunctional fusion protein [Includes: 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-); Putative carbamate hydrolase RutD (EC 3.5.1.-) (Aminohydrolase)] 0.9918 1 128 GO:0005829
GO:0006212
GO:0016746
GO:0016811
GO:0019239
GO:0019740
AF-A0A7Y8Q233-F1-model_v4 3-aminoacrylate deaminase RutC (3-AA deaminase) (EC 3.5.-.-) 0.9916 1 126 GO:0005829
GO:0006212
GO:0019239
GO:0019740

Map