F488793

General Info

Members Datasets Scaffolds Average Seq Length
1039 590 2078 440

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0094205|Ga0373935_0094205_282_1748
Length 488
Sequence MALKQQISLCPRSAARPAIDNDEETDMISRRNLIGSSAILAGVAAVSGRAQAAAIPEAVTTTSPIMQPPLVPSSGSAYQPVVTLNGWTLPWRMNGDWKEFHLVAEPVVREMAPGMKAHLWGYNGQSPGPTIECVEGDKIRIFVTNKLPEHTSVHWHGMLVPNGMDGVGGLTQPQIKPKQTFVYEFAIRKSGTFMYHPHADEMVQMAMGMMGSIVVHPRDPNLHRVDRDFVFLMSTYDIDPGSYLPKVTTMTEFNMWTWNSRVFPGIDPLVVRRGDRVRVRIGNLTMTNHPIHLHGPAFEVTCTDGGWVPESARLPEVTTDVPVGAMRAFELIADEPGDWAIHCHKSHHTMNAMGHNVKTFIGVPQRDLTKTIRKLLPDYVPMGSAGMAEMGSMEMPMPDNTLPMMTGFGQFGPIEMGGMFSVVKVREGLARDDYKDPGWYQHPSGTVAYEVKGPTPEVPRRQGSATPIHNEIEVTAVKPRNSGHSSQH

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
130 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
131 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
204 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
208 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
224 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
279 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
280 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
281 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
287 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
288 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
291 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
428 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
433 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
434 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
435 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
436 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
437 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
438 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
439 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
440 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
441 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
442 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
443 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
444 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
445 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
446 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
449 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
452 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
453 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
454 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
455 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
456 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
457 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
458 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
459 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
460 2519103095 Burkholderia sp. KJ006 Isolate Nodule
461 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
462 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
463 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
464 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
465 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
466 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
467 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
468 2643221734 Bosea sp. Root670 Isolate Unclassified
469 2643221736 Bosea sp. Root483D1 Isolate Unclassified
470 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
471 2773857925 Microvirga vignae BR3299 Isolate Unclassified
472 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
473 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
474 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
475 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
476 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
477 2818991450 Burkholderia sp. 604 Isolate Unclassified
478 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
479 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
480 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
481 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
482 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
483 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
484 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
485 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
486 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
487 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
488 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
489 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
490 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
491 2831864461 Roseateles noduli HZ7 Isolate Nodule
492 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
493 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
494 2841760612 Bosea sp. Tri-49 Isolate Nodule
495 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
496 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
497 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
498 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
499 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
500 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
501 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
502 2842694124 Methylopila sp. R-72369 Isolate Unclassified
503 2844104063 Bosea sp. Tri-39 Isolate Nodule
504 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
505 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
506 2851182111 Bosea sp. Tri-44 Isolate Nodule
507 2851246043 Bosea sp. Tri-54 Isolate Nodule
508 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
509 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
510 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
511 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
512 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
513 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
514 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
515 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
516 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
517 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
518 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
519 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
520 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
521 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
522 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
523 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
524 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
525 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
526 2885266251 Ralstonia sp. SET104 Isolate Nodule
527 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
528 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
529 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
530 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
531 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
532 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
533 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
534 2902330777 Methylobacterium sp. 2A Isolate Unclassified
535 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
536 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
537 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
538 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
539 2906610324
540 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
541 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
542 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
543 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
544 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
545 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
546 2928058823 Ralstonia sp. 1138 Isolate Unclassified
547 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
548 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
549 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
550 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
551 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
552 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
553 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
554 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
555 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
556 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
557 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
558 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
559 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
560 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
561 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
562 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
563 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
564 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
565 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
566 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
567 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
568 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
569 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
570 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
571 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
572 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
573 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
574 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
575 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
576 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
577 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
578 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
579 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
580 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
581 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
582 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
583 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
584 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
585 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
586 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
587 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
588 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
589 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
590 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.8
Metatranscriptomes 0
Isolates 13.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.73
Nodule 8.57
Rhizoplane 5.58
Rhizosphere 62.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0094205 3300035692 Bacteria 1965
2 ARcpr5oldR_c000058 3300000041 Bacteria 20592
3 JGI24741J21665_1000301 3300001915 Bacteria 14880
4 JGI24740J21852_10000177 3300001979 Bacteria 25703
5 JGI24739J22299_10012905 3300001989 Bacteria 3059
6 JGI24738J21930_10003370 3300002075 Bacteria 4049
7 JGI25156J39149_1001647 3300002705 Bacteria 9058
8 JGI25156J39149_1001928 3300002705 Bacteria 8048
9 JGI25156J39149_1003064 3300002705 Bacteria 5659
10 JGI25154J39366_1000608 3300002738 Bacteria 17171
11 JGI25151J46595_10000868 3300003187 Bacteria 23934
12 JGI25151J46595_10006764 3300003187 Bacteria 5710
13 JGI25406J46586_10000755 3300003203 Bacteria 15112
14 JGI25165J46597_1001426 3300003214 Bacteria 12856
15 JGI25153J46596_10001982 3300003215 Bacteria 12131
16 JGI25153J46596_10008991 3300003215 Bacteria 4704
17 JGI25160J50197_1002576 3300003354 Bacteria 8381
18 JGI25160J50197_1009321 3300003354 Bacteria 3654
19 Ga0055539_1000108 3300003752 Bacteria 91377
20 Ga0055533_1000072 3300003756 Bacteria 144571
21 Ga0055533_1005123 3300003756 Bacteria 2183
22 Ga0055532_1000013 3300003758 Bacteria 380677
23 Ga0055532_1000073 3300003758 Bacteria 131021
24 Ga0055525_1000562 3300003759 Bacteria 16735
25 Ga0055527_1000010 3300003760 Bacteria 380677
26 Ga0055527_1000496 3300003760 Bacteria 14079
27 Ga0055535_1000010 3300003761 Bacteria 380677
28 Ga0055535_1000055 3300003761 Bacteria 131021
29 Ga0055542_1000016 3300003762 Bacteria 380677
30 Ga0055542_1006480 3300003762 Bacteria 2497
31 Ga0055529_1000012 3300003763 Bacteria 380677
32 Ga0055529_1000149 3300003763 Bacteria 100620
33 Ga0055526_1000563 3300003771 Bacteria 29353
34 Ga0055526_1003347 3300003771 Bacteria 10240
35 Ga0055537_1000514 3300003773 Bacteria 22884
36 Ga0055524_1000263 3300003775 Bacteria 52900
37 Ga0055536_1000195 3300003781 Bacteria 49966
38 Ga0055534_1000710 3300003784 Bacteria 16303
39 Ga0055534_1000845 3300003784 Bacteria 14090
40 Ga0055534_1002985 3300003784 Bacteria 5577
41 Ga0055531_10005344 3300003794 Bacteria 7530
42 Ga0055543_1002171 3300004625 Bacteria 6750
43 Ga0065165_1000146 3300005262 Bacteria 122774
44 Ga0065165_1002972 3300005262 Bacteria 12872
45 Ga0065165_1006694 3300005262 Bacteria 5932
46 Ga0065712_10004291 3300005290 Bacteria 4082
47 Ga0065715_10100770 3300005293 Bacteria 3271
48 Ga0070658_10007876 3300005327 Bacteria 8582
49 Ga0070690_100075861 3300005330 Bacteria 2192
50 Ga0070670_100104809 3300005331 Bacteria 2436
51 Ga0070670_100181847 3300005331 Bacteria 1826
52 Ga0070680_100007778 3300005336 Bacteria 8170
53 Ga0068868_100151772 3300005338 Bacteria 1908
54 Ga0068868_100203226 3300005338 Bacteria 1652
55 Ga0070660_100000433 3300005339 Bacteria 27677
56 Ga0070660_100002743 3300005339 Bacteria 12103
57 Ga0070660_100020516 3300005339 Bacteria 4857
58 Ga0070689_100000293 3300005340 Bacteria 28993
59 Ga0070689_100009331 3300005340 Bacteria 6956
60 Ga0070689_100051335 3300005340 Bacteria 3188
61 Ga0070689_100113915 3300005340 Bacteria 2154
62 Ga0070687_100021930 3300005343 Bacteria 3011
63 Ga0070661_100000061 3300005344 Bacteria 86581
64 Ga0070668_100013880 3300005347 Bacteria 6022
65 Ga0070668_100015925 3300005347 Bacteria 5625
66 Ga0070668_100037761 3300005347 Bacteria 3690
67 Ga0070668_100156337 3300005347 Bacteria 1847
68 Ga0070675_100023675 3300005354 Bacteria 4912
69 Ga0070675_100076259 3300005354 Bacteria 2788
70 Ga0070674_100046744 3300005356 Bacteria 2963
71 Ga0070674_100055026 3300005356 Bacteria 2754
72 Ga0070673_100032102 3300005364 Bacteria 3949
73 Ga0070688_100018257 3300005365 Bacteria 4044
74 Ga0070659_100004518 3300005366 Bacteria 9937
75 Ga0070659_100004527 3300005366 Bacteria 9931
76 Ga0070659_100041385 3300005366 Bacteria 3602
77 Ga0070667_100010125 3300005367 Bacteria 7800
78 Ga0070667_100277972 3300005367 Bacteria 1503
79 Ga0070703_10006357 3300005406 Bacteria 3311
80 Ga0070709_10000624 3300005434 Bacteria 20259
81 Ga0070713_100017918 3300005436 Bacteria 5373
82 Ga0070710_10005253 3300005437 Bacteria 6136
83 Ga0070710_10007291 3300005437 Bacteria 5349
84 Ga0070711_100002089 3300005439 Bacteria 11290
85 Ga0070711_100003615 3300005439 Bacteria 9028
86 Ga0070694_100007345 3300005444 Bacteria 6719
87 Ga0070694_100008556 3300005444 Bacteria 6263
88 Ga0070663_100000521 3300005455 Bacteria 20282
89 Ga0070663_100001605 3300005455 Bacteria 12475
90 Ga0070678_100017653 3300005456 Bacteria 4602
91 Ga0070662_100002105 3300005457 Bacteria 12208
92 Ga0070707_100088868 3300005468 Bacteria 2989
93 Ga0070698_100001575 3300005471 Bacteria 25360
94 Ga0070698_100090298 3300005471 Bacteria 3047
95 Ga0070699_100176916 3300005518 Bacteria 1892
96 Ga0070679_100235521 3300005530 Bacteria 1790
97 Ga0070695_100011600 3300005545 Bacteria 5273
98 Ga0070696_100012192 3300005546 Bacteria 5759
99 Ga0070696_100090647 3300005546 Bacteria 2176
100 Ga0070693_100001738 3300005547 Bacteria 9909
101 Ga0070665_100029982 3300005548 Bacteria 5475
102 Ga0070704_100024676 3300005549 Bacteria 3948
103 Ga0070704_100083039 3300005549 Bacteria 2364
104 Ga0068855_100020522 3300005563 Bacteria 7923
105 Ga0068855_100049200 3300005563 Bacteria 4972
106 Ga0070664_100000010 3300005564 Bacteria 165664
107 Ga0070664_100181182 3300005564 Bacteria 1872
108 Ga0068854_100000077 3300005578 Bacteria 69779
109 Ga0068856_100000045 3300005614 Bacteria 110625
110 Ga0068856_100251391 3300005614 Bacteria 1783
111 Ga0068852_100020887 3300005616 Bacteria 5212
112 Ga0068852_100063909 3300005616 Bacteria 3206
113 Ga0068859_100029781 3300005617 Bacteria 5477
114 Ga0068859_100034303 3300005617 Bacteria 5094
115 Ga0068859_100147044 3300005617 Bacteria 2432
116 Ga0068864_100001259 3300005618 Bacteria 21064
117 Ga0068864_100012200 3300005618 Bacteria 7103
118 Ga0068866_10007887 3300005718 Bacteria 4468
119 Ga0068861_100011079 3300005719 Bacteria 6265
120 Ga0068863_100124957 3300005841 Bacteria 2454
121 Ga0068858_100068657 3300005842 Bacteria 3285
122 Ga0068858_100087804 3300005842 Bacteria 2892
123 Ga0068858_100169314 3300005842 Bacteria 2059
124 Ga0068860_100015316 3300005843 Bacteria 7490
125 Ga0068860_100039046 3300005843 Bacteria 4542
126 Ga0068860_100064472 3300005843 Bacteria 3480
127 Ga0068862_100042161 3300005844 Bacteria 3887
128 Ga0068862_100075639 3300005844 Bacteria 2913
129 Ga0081455_10007915 3300005937 Bacteria 11124
130 Ga0081455_10037085 3300005937 Bacteria 4333
131 Ga0081455_10048430 3300005937 Bacteria 3673
132 Ga0081455_10117195 3300005937 Bacteria 2105
133 Ga0081538_10042678 3300005981 Bacteria 2859
134 Ga0081540_1000136 3300005983 Bacteria 78663
135 Ga0081539_10000258 3300005985 Bacteria 122213
136 Ga0081539_10060966 3300005985 Bacteria 2069
137 Ga0075365_10002179 3300006038 Bacteria 9434
138 Ga0075365_10003680 3300006038 Bacteria 7958
139 Ga0075368_10005208 3300006042 Bacteria 4461
140 Ga0075368_10005705 3300006042 Bacteria 4301
141 Ga0075363_100009142 3300006048 Bacteria 4651
142 Ga0070716_100029089 3300006173 Bacteria 2984
143 Ga0070712_100007967 3300006175 Bacteria 6644
144 Ga0070712_100016198 3300006175 Bacteria 4812
145 Ga0070712_100030305 3300006175 Bacteria 3634
146 Ga0075362_10000837 3300006177 Bacteria 9239
147 Ga0075362_10002278 3300006177 Bacteria 6397
148 Ga0075362_10010948 3300006177 Bacteria 3560
149 Ga0075362_10026069 3300006177 Bacteria 2494
150 Ga0075362_10064938 3300006177 Bacteria 1657
151 Ga0075367_10000984 3300006178 Bacteria 11662
152 Ga0075367_10009875 3300006178 Bacteria 5000
153 Ga0075367_10013249 3300006178 Bacteria 4426
154 Ga0075367_10068766 3300006178 Bacteria 2125
155 Ga0075366_10001094 3300006195 Bacteria 13300
156 Ga0075366_10003081 3300006195 Bacteria 8702
157 Ga0075366_10026096 3300006195 Bacteria 3420
158 Ga0075366_10041016 3300006195 Bacteria 2739
159 Ga0075370_10000288 3300006353 Bacteria 18082
160 Ga0075370_10007447 3300006353 Bacteria 5576
161 Ga0075370_10032974 3300006353 Bacteria 2898
162 Ga0075370_10097598 3300006353 Bacteria 1699
163 Ga0075428_100001911 3300006844 Bacteria 22354
164 Ga0075428_100006782 3300006844 Bacteria 12742
165 Ga0075428_100007538 3300006844 Bacteria 12062
166 Ga0075428_100014438 3300006844 Bacteria 8774
167 Ga0075428_100017306 3300006844 Bacteria 7966
168 Ga0075430_100016282 3300006846 Bacteria 6333
169 Ga0075430_100029886 3300006846 Bacteria 4627
170 Ga0075430_100032572 3300006846 Bacteria 4424
171 Ga0075430_100042383 3300006846 Bacteria 3849
172 Ga0075431_100000109 3300006847 Bacteria 52399
173 Ga0075431_100010398 3300006847 Bacteria 9353
174 Ga0075431_100032604 3300006847 Bacteria 5368
175 Ga0075431_100041862 3300006847 Bacteria 4724
176 Ga0075431_100095718 3300006847 Bacteria 3065
177 Ga0075431_100120856 3300006847 Bacteria 2703
178 Ga0075431_100140511 3300006847 Bacteria 2489
179 Ga0075433_10019792 3300006852 Bacteria 5616
180 Ga0075434_100073986 3300006871 Bacteria 3400
181 Ga0075434_100116891 3300006871 Bacteria 2680
182 Ga0075434_100247818 3300006871 Bacteria 1801
183 Ga0075429_100013485 3300006880 Bacteria 7089
184 Ga0075429_100038510 3300006880 Bacteria 4162
185 Ga0075429_100058336 3300006880 Bacteria 3361
186 Ga0097620_100029777 3300006931 Bacteria 5477
187 Ga0097620_100034304 3300006931 Bacteria 5094
188 Ga0097620_100147047 3300006931 Bacteria 2432
189 Ga0099824_1009987 3300006942 Bacteria 11433
190 Ga0099822_1001164 3300006943 Bacteria 29500
191 Ga0099794_10000754 3300007265 Bacteria 10902
192 Ga0099794_10008193 3300007265 Bacteria 4331
193 Ga0105251_10000043 3300009011 Bacteria 113848
194 Ga0105240_10074055 3300009093 Bacteria 4204
195 Ga0105240_10075488 3300009093 Bacteria 4158
196 Ga0111539_10015467 3300009094 Bacteria 9490
197 Ga0111539_10015986 3300009094 Bacteria 9321
198 Ga0111539_10026391 3300009094 Bacteria 7102
199 Ga0111539_10030750 3300009094 Bacteria 6526
200 Ga0111539_10054491 3300009094 Bacteria 4758
201 Ga0111539_10353807 3300009094 Bacteria 1709
202 Ga0105247_10010567 3300009101 Bacteria 5576
203 Ga0105247_10016248 3300009101 Bacteria 4458
204 Ga0114129_10000425 3300009147 Bacteria 50146
205 Ga0114129_10006029 3300009147 Bacteria 17182
206 Ga0114129_10048007 3300009147 Bacteria 5998
207 Ga0114129_10053662 3300009147 Bacteria 5654
208 Ga0114129_10072501 3300009147 Bacteria 4801
209 Ga0114129_10174861 3300009147 Bacteria 2925
210 Ga0105241_10057214 3300009174 Bacteria 2990
211 Ga0105242_10061656 3300009176 Bacteria 3084
212 Ga0105248_10054999 3300009177 Bacteria 4464
213 Ga0105237_10006214 3300009545 Bacteria 13314
214 Ga0105237_10018110 3300009545 Bacteria 7292
215 Ga0105237_10020285 3300009545 Bacteria 6856
216 Ga0105249_10001301 3300009553 Bacteria 21873
217 Ga0105249_10006652 3300009553 Bacteria 10061
218 Ga0105249_10109190 3300009553 Bacteria 2613
219 Ga0105249_10232474 3300009553 Bacteria 1819
220 Ga0105239_10002128 3300010375 Bacteria 25513
221 Ga0105239_10148681 3300010375 Bacteria 2614
222 Ga0105246_10014720 3300011119 Bacteria 4925
223 Ga0105246_10026374 3300011119 Bacteria 3796
224 Ga0105246_10082198 3300011119 Bacteria 2298
225 Ga0157371_10000088 3300013102 Bacteria 145526
226 Ga0157370_10000041 3300013104 Bacteria 133912
227 Ga0157369_10013348 3300013105 Bacteria 9292
228 Ga0157369_10051699 3300013105 Bacteria 4446
229 Ga0157369_10275924 3300013105 Bacteria 1751
230 Ga0157374_10001206 3300013296 Bacteria 22110
231 Ga0157374_10057968 3300013296 Bacteria 3619
232 Ga0157378_10000806 3300013297 Bacteria 29176
233 Ga0157378_10015433 3300013297 Bacteria 6691
234 Ga0157378_10029512 3300013297 Bacteria 4842
235 Ga0157378_10057284 3300013297 Bacteria 3473
236 Ga0157378_10252654 3300013297 Bacteria 1688
237 Ga0163162_10005040 3300013306 Bacteria 12727
238 Ga0163162_10163092 3300013306 Bacteria 2352
239 Ga0157372_10000097 3300013307 Bacteria 90742
240 Ga0157372_10009707 3300013307 Bacteria 10234
241 Ga0157372_10045633 3300013307 Bacteria 4863
242 Ga0157375_10003170 3300013308 Bacteria 14282
243 Ga0157375_10022743 3300013308 Bacteria 5774
244 Ga0157375_10041747 3300013308 Bacteria 4432
245 Ga0163163_10001825 3300014325 Bacteria 17971
246 Ga0163163_10016903 3300014325 Bacteria 6792
247 Ga0163163_10018664 3300014325 Bacteria 6497
248 Ga0163163_10090748 3300014325 Bacteria 3069
249 Ga0157380_10113229 3300014326 Bacteria 2284
250 Ga0182008_10011726 3300014497 Bacteria 4650
251 Ga0157379_10032595 3300014968 Bacteria 4645
252 Ga0157379_10043463 3300014968 Bacteria 4012
253 Ga0157379_10140384 3300014968 Bacteria 2178
254 Ga0157376_10017382 3300014969 Bacteria 5485
255 Ga0157376_10023626 3300014969 Bacteria 4814
256 Ga0182006_1001721 3300015261 Bacteria 12731
257 Ga0182006_1010200 3300015261 Bacteria 4186
258 Ga0182007_10000245 3300015262 Bacteria 36521
259 Ga0182007_10003432 3300015262 Bacteria 7466
260 Ga0182007_10025471 3300015262 Bacteria 2061
261 Ga0214544_1000035 3300021320 Bacteria 146874
262 Ga0214542_1000181 3300021321 Bacteria 97233
263 Ga0214542_1021207 3300021321 Bacteria 4542
264 Ga0214545_1000094 3300021324 Bacteria 98180
265 Ga0214545_1017840 3300021324 Bacteria 6691
266 Ga0214543_1000155 3300021327 Bacteria 97353
267 Ga0214543_1022285 3300021327 Bacteria 4543
268 Ga0213873_10006536 3300021358 Bacteria 2298
269 Ga0213876_10003801 3300021384 Bacteria 8559
270 Ga0209784_100008 3300025224 Bacteria 740293
271 Ga0209784_100180 3300025224 Bacteria 52470
272 Ga0209566_100006 3300025225 Bacteria 789272
273 Ga0209566_100502 3300025225 Bacteria 27146
274 Ga0209566_101007 3300025225 Bacteria 11996
275 Ga0209674_100011 3300025226 Bacteria 997175
276 Ga0209674_100045 3300025226 Bacteria 362387
277 Ga0209674_100116 3300025226 Bacteria 135937
278 Ga0209672_100002 3300025228 Bacteria 1733325
279 Ga0209672_100128 3300025228 Bacteria 77946
280 Ga0209147_100003 3300025229 Bacteria 1733325
281 Ga0209147_100005 3300025229 Bacteria 1036530
282 Ga0209563_100016 3300025230 Bacteria 802091
283 Ga0209563_102338 3300025230 Bacteria 4340
284 Ga0209563_107023 3300025230 Bacteria 1881
285 Ga0207427_101963 3300025231 Bacteria 6290
286 Ga0209258_100007 3300025242 Bacteria 1036530
287 Ga0209258_100042 3300025242 Bacteria 380729
288 Ga0207425_1000430 3300025245 Bacteria 27743
289 Ga0207425_1004750 3300025245 Bacteria 4002
290 Ga0209646_1000027 3300025246 Bacteria 395141
291 Ga0209677_100008 3300025253 Bacteria 802091
292 Ga0209677_100403 3300025253 Bacteria 26002
293 Ga0209148_1000006 3300025254 Bacteria 1733325
294 Ga0209148_1000019 3300025254 Bacteria 748518
295 Ga0209148_1000306 3300025254 Bacteria 70293
296 Ga0209759_1000051 3300025256 Bacteria 214016
297 Ga0209759_1000618 3300025256 Bacteria 33996
298 Ga0209759_1001040 3300025256 Bacteria 18560
299 Ga0209233_1000033 3300025261 Bacteria 596094
300 Ga0209565_1000077 3300025263 Bacteria 161163
301 Ga0209565_1006364 3300025263 Bacteria 3320
302 Ga0209455_1000003 3300025272 Bacteria 1471893
303 Ga0209455_1000011 3300025272 Bacteria 947242
304 Ga0209455_1001090 3300025272 Bacteria 13361
305 Ga0209455_1003646 3300025272 Bacteria 5349
306 Ga0209130_1000659 3300025284 Bacteria 31495
307 Ga0209130_1009258 3300025284 Bacteria 2824
308 Ga0209675_1000065 3300025291 Bacteria 174791
309 Ga0209675_1000717 3300025291 Bacteria 22637
310 Ga0209675_1002555 3300025291 Bacteria 9233
311 Ga0209675_1004542 3300025291 Bacteria 6134
312 Ga0209676_1000044 3300025292 Bacteria 416215
313 Ga0209676_1007992 3300025292 Bacteria 4823
314 Ga0209025_1001105 3300025294 Bacteria 38808
315 Ga0209025_1002092 3300025294 Bacteria 22571
316 Ga0209025_1004496 3300025294 Bacteria 12063
317 Ga0209025_1010692 3300025294 Bacteria 6176
318 Ga0209564_1000080 3300025295 Bacteria 263547
319 Ga0209564_1000404 3300025295 Bacteria 76827
320 Ga0209564_1000643 3300025295 Bacteria 52864
321 Ga0209758_1000117 3300025297 Bacteria 198325
322 Ga0209758_1000131 3300025297 Bacteria 184259
323 Ga0209758_1000830 3300025297 Bacteria 43211
324 Ga0209758_1001358 3300025297 Bacteria 29324
325 Ga0209758_1001448 3300025297 Bacteria 27947
326 Ga0209758_1002033 3300025297 Bacteria 21722
327 Ga0209758_1006691 3300025297 Bacteria 8137
328 Ga0209256_1000119 3300025299 Bacteria 168215
329 Ga0209256_1000127 3300025299 Bacteria 164393
330 Ga0209256_1000540 3300025299 Bacteria 54759
331 Ga0209256_1003163 3300025299 Bacteria 11933
332 Ga0207426_1000223 3300025302 Bacteria 132636
333 Ga0207426_1015669 3300025302 Bacteria 2744
334 Ga0209051_1002766 3300025303 Bacteria 12109
335 Ga0209051_1023813 3300025303 Bacteria 2536
336 Ga0209257_1001462 3300025304 Bacteria 27887
337 Ga0209257_1021976 3300025304 Bacteria 2293
338 Ga0207713_1000240 3300025735 Bacteria 73219
339 Ga0207692_10000311 3300025898 Bacteria 16862
340 Ga0207642_10010784 3300025899 Bacteria 3237
341 Ga0207688_10062946 3300025901 Bacteria 2092
342 Ga0207647_10001239 3300025904 Bacteria 19642
343 Ga0207647_10040607 3300025904 Bacteria 2929
344 Ga0207699_10000235 3300025906 Bacteria 30984
345 Ga0207705_10007025 3300025909 Bacteria 8304
346 Ga0207684_10039772 3300025910 Bacteria 3986
347 Ga0207695_10000136 3300025913 Bacteria 217596
348 Ga0207695_10001416 3300025913 Bacteria 40402
349 Ga0207671_10014025 3300025914 Bacteria 6356
350 Ga0207693_10000511 3300025915 Bacteria 35015
351 Ga0207693_10015438 3300025915 Bacteria 6127
352 Ga0207663_10005586 3300025916 Bacteria 6348
353 Ga0207662_10053666 3300025918 Bacteria 2401
354 Ga0207662_10068706 3300025918 Bacteria 2140
355 Ga0207657_10000283 3300025919 Bacteria 54087
356 Ga0207657_10004860 3300025919 Bacteria 14154
357 Ga0207657_10024976 3300025919 Bacteria 5520
358 Ga0207657_10086255 3300025919 Bacteria 2628
359 Ga0207649_10000170 3300025920 Bacteria 53356
360 Ga0207650_10081633 3300025925 Bacteria 2453
361 Ga0207659_10014827 3300025926 Bacteria 5037
362 Ga0207659_10031257 3300025926 Bacteria 3643
363 Ga0207700_10045395 3300025928 Bacteria 3242
364 Ga0207664_10002194 3300025929 Bacteria 12852
365 Ga0207664_10080335 3300025929 Bacteria 2650
366 Ga0207690_10016405 3300025932 Bacteria 4505
367 Ga0207690_10016466 3300025932 Bacteria 4497
368 Ga0207690_10027232 3300025932 Bacteria 3611
369 Ga0207706_10011419 3300025933 Bacteria 8090
370 Ga0207706_10014980 3300025933 Bacteria 7020
371 Ga0207706_10097774 3300025933 Bacteria 2582
372 Ga0207670_10064451 3300025936 Bacteria 2512
373 Ga0207669_10055705 3300025937 Bacteria 2396
374 Ga0207665_10024072 3300025939 Bacteria 4012
375 Ga0207691_10080909 3300025940 Bacteria 2921
376 Ga0207711_10050623 3300025941 Bacteria 3556
377 Ga0207679_10000024 3300025945 Bacteria 204787
378 Ga0207712_10131763 3300025961 Bacteria 1906
379 Ga0207668_10022905 3300025972 Bacteria 4005
380 Ga0207668_10041781 3300025972 Bacteria 3101
381 Ga0207640_10000222 3300025981 Bacteria 40052
382 Ga0207677_10163970 3300026023 Bacteria 1730
383 Ga0207703_10059536 3300026035 Bacteria 3120
384 Ga0207639_10115638 3300026041 Bacteria 2194
385 Ga0207678_10000018 3300026067 Bacteria 135549
386 Ga0207678_10004543 3300026067 Bacteria 12479
387 Ga0207708_10030309 3300026075 Bacteria 4101
388 Ga0207702_10000053 3300026078 Bacteria 137538
389 Ga0207702_10207088 3300026078 Bacteria 1821
390 Ga0207641_10060074 3300026088 Bacteria 3239
391 Ga0207648_10022882 3300026089 Bacteria 5606
392 Ga0207676_10003802 3300026095 Bacteria 10677
393 Ga0207676_10023616 3300026095 Bacteria 4539
394 Ga0207674_10004403 3300026116 Bacteria 16968
395 Ga0207674_10021366 3300026116 Bacteria 6971
396 Ga0207674_10059312 3300026116 Bacteria 3873
397 Ga0207674_10089642 3300026116 Bacteria 3068
398 Ga0207675_100016049 3300026118 Bacteria 6992
399 Ga0207675_100158497 3300026118 Bacteria 2158
400 Ga0207683_10016855 3300026121 Bacteria 6216
401 Ga0209389_1000080 3300027296 Bacteria 89649
402 Ga0209389_1002359 3300027296 Bacteria 14397
403 Ga0209371_1014400 3300027312 Bacteria 2169
404 Ga0209589_1000009 3300027357 Bacteria 252104
405 Ga0209589_1000172 3300027357 Bacteria 73502
406 Ga0209969_1001223 3300027360 Bacteria 3536
407 Ga0209489_100010 3300027361 Bacteria 252139
408 Ga0209489_100027 3300027361 Bacteria 188074
409 Ga0209489_100263 3300027361 Bacteria 90260
410 Ga0209700_100017 3300027363 Bacteria 252104
411 Ga0209700_100022 3300027363 Bacteria 229977
412 Ga0209995_1002806 3300027471 Bacteria 2761
413 Ga0209999_1002232 3300027543 Bacteria 3403
414 Ga0209588_1000255 3300027671 Bacteria 14073
415 Ga0209971_1004636 3300027682 Bacteria 3261
416 Ga0209966_1010741 3300027695 Bacteria 1658
417 Ga0209813_10013075 3300027866 Bacteria 2208
418 Ga0209974_10005360 3300027876 Bacteria 4516
419 Ga0207428_10000804 3300027907 Bacteria 35481
420 Ga0207428_10020116 3300027907 Bacteria 5678
421 Ga0268266_10125048 3300028379 Bacteria 2293
422 Ga0268264_10162167 3300028381 Bacteria 2015
423 Ga0265337_1009629 3300028556 Bacteria 3436
424 Ga0265326_10003146 3300028558 Bacteria 5462
425 Ga0265334_10002686 3300028573 Bacteria 8218
426 Ga0265334_10012368 3300028573 Bacteria 3587
427 Ga0265323_10000074 3300028653 Bacteria 55925
428 Ga0265323_10001672 3300028653 Bacteria 10624
429 Ga0265322_10006236 3300028654 Bacteria 3508
430 Ga0265322_10015754 3300028654 Bacteria 2182
431 Ga0265336_10000108 3300028666 Bacteria 62876
432 Ga0265336_10000209 3300028666 Bacteria 41182
433 Ga0307515_10021366 3300028794 Bacteria 11486
434 Ga0265338_10000081 3300028800 Bacteria 176402
435 Ga0265338_10000119 3300028800 Bacteria 146599
436 Ga0265324_10005629 3300029957 Bacteria 5363
437 Ga0265324_10008978 3300029957 Bacteria 3931
438 Ga0268256_1007661 3300030500 Bacteria 3814
439 Ga0307511_10048565 3300030521 Bacteria 3450
440 Ga0265328_10000003 3300031239 Bacteria 251251
441 Ga0265328_10002830 3300031239 Bacteria 7755
442 Ga0265328_10006069 3300031239 Bacteria 5142
443 Ga0265331_10000090 3300031250 Bacteria 123628
444 Ga0265331_10000121 3300031250 Bacteria 102519
445 Ga0265331_10002374 3300031250 Bacteria 12783
446 Ga0265331_10014908 3300031250 Bacteria 4122
447 Ga0265327_10000269 3300031251 Bacteria 102772
448 Ga0265327_10009447 3300031251 Bacteria 7035
449 Ga0265327_10017013 3300031251 Bacteria 4585
450 Ga0265316_10004302 3300031344 Bacteria 14224
451 Ga0265316_10120486 3300031344 Bacteria 1982
452 Ga0307513_10151390 3300031456 Bacteria 2227
453 Ga0307509_10029764 3300031507 Bacteria 6054
454 Ga0307408_100271851 3300031548 Bacteria 1407
455 Ga0307508_10000013 3300031616 Bacteria 242867
456 Ga0307516_10085188 3300031730 Bacteria 2998
457 Ga0307405_10049419 3300031731 Bacteria 2599
458 Ga0307410_10004667 3300031852 Bacteria 7121
459 Ga0307412_10106555 3300031911 Bacteria 1993
460 Ga0307409_100057994 3300031995 Bacteria 3004
461 Ga0307409_100143813 3300031995 Bacteria 2059
462 Ga0307416_100028192 3300032002 Bacteria 4172
463 Ga0307416_100267772 3300032002 Bacteria 1675
464 Ga0307414_10010735 3300032004 Bacteria 5335
465 Ga0307414_10087150 3300032004 Bacteria 2306
466 Ga0307411_10052789 3300032005 Bacteria 2660
467 Ga0307415_100007269 3300032126 Bacteria 6048
468 Ga0307415_100045413 3300032126 Bacteria 2945
469 Ga0307507_10019891 3300033179 Bacteria 7541
470 Ga0307510_10096069 3300033180 Bacteria 2781
471 Ga0373930_0000013 3300034816 Bacteria 17272
472 Ga0373940_0001263 3300035088 Bacteria 4493
473 Ga0373923_0001943 3300035111 Bacteria 6194
474 Ga0373932_0001213 3300035112 Bacteria 7330
475 Ga0373936_0008904 3300035113 Bacteria 3783
476 Ga0373939_0001439 3300035114 Bacteria 5755
477 Ga0373941_0000286 3300035115 Bacteria 9796
478 Ga0373945_0004731 3300035116 Bacteria 4336
479 Ga0373954_0005129 3300035118 Bacteria 5655
480 Ga0373954_0015575 3300035118 Bacteria 3400
481 Ga0373956_0039072 3300035119 Bacteria 2102
482 Ga0373960_0000187 3300035121 Bacteria 11130
483 Ga0373943_0012492 3300035170 Bacteria 3825
484 Ga0373943_0028951 3300035170 Bacteria 2614
485 Ga0373943_0057982 3300035170 Bacteria 1926
486 Ga0373946_0001050 3300035171 Bacteria 9500
487 Ga0373946_0041371 3300035171 Bacteria 1890
488 Ga0373955_0012507 3300035172 Bacteria 4079
489 Ga0373962_0000661 3300035242 Bacteria 7861
490 Ga0373924_0016096 3300035410 Bacteria 2852
491 Ga0373924_0028527 3300035410 Bacteria 2225
492 Ga0373931_0021486 3300035691 Bacteria 3239
493 Ga0373935_0013207 3300035692 Bacteria 4980
494 Ga0373935_0056677 3300035692 Bacteria 2499
495 Ga0373927_0013260 3300035695 Bacteria 5479
496 Ga0373927_0025589 3300035695 Bacteria 3859
497 Ga0373927_0029201 3300035695 Bacteria 3594
498 Ga0373927_0033090 3300035695 Bacteria 3366
499 Ga0373927_0037667 3300035695 Bacteria 3142
500 Ga0373927_0057908 3300035695 Bacteria 2505
501 Ga0373933_0004960 3300035724 Bacteria 7258
502 Ga0373933_0061542 3300035724 Bacteria 2265
503 Ga0373947_0002058 3300035725 Bacteria 12264
504 Ga0373947_0225304 3300035725 Bacteria 1233
505 Ga0373937_0003814 3300036401 Bacteria 12735
506 Ga0373937_0011611 3300036401 Bacteria 7734
507 Ga0373925_0033383 3300037068 Bacteria 3792
508 Ga0373925_0057213 3300037068 Bacteria 2922
509 Ga0373925_0136097 3300037068 Bacteria 1920
510 Ga0373925_0227541 3300037068 Bacteria 1490
511 Ga0395899_0006840 3300037312 Bacteria 8833
512 Ga0395900_0000961 3300037418 Bacteria 37565
513 Ga0395900_0001715 3300037418 Bacteria 25336
514 Ga0395900_0004086 3300037418 Bacteria 15559
515 Ga0395900_0005280 3300037418 Bacteria 13542
516 Ga0395900_0070332 3300037418 Bacteria 3598
517 Ga0395900_0112986 3300037418 Bacteria 2788
518 Ga0395900_0122224 3300037418 Bacteria 2671
519 Ga0395898_0001286 3300037466 Bacteria 36883
520 Ga0395898_0069582 3300037466 Bacteria 3405
521 Ga0395898_0074903 3300037466 Bacteria 3270
522 Ga0395898_0086616 3300037466 Bacteria 3018
523 Ga0395905_0000750 3300037471 Bacteria 42802
524 Ga0395905_0007254 3300037471 Bacteria 11044
525 Ga0395905_0007921 3300037471 Bacteria 10509
526 Ga0395901_0000002 3300038443 Bacteria 761045
527 Ga0395901_0000129 3300038443 Bacteria 97842
528 Ga0395901_0007678 3300038443 Bacteria 10879
529 Ga0395901_0010131 3300038443 Bacteria 9551
530 Ga0395901_0029291 3300038443 Bacteria 5667
531 Ga0436365_0377218 3300039437 Bacteria 2166
532 Ga0436365_1921176 3300039437 Bacteria 2733
533 Ga0436361_0296858 3300039447 Bacteria 1807
534 Ga0436362_1003156 3300039453 Bacteria 3081
535 Ga0451793_1605844 3300041452 Bacteria 2137
536 Ga0439431_0013073 3300041997 Bacteria 1913
537 Ga0439441_000862 3300042001 Bacteria 3650
538 Ga0439434_0009612 3300042435 Bacteria 2845
539 Ga0466986_0014071 3300044650 Bacteria 5069
540 Ga0466969_0004495 3300044656 Bacteria 7423
541 Ga0466969_0023245 3300044656 Bacteria 3195
542 Ga0466972_0003429 3300044658 Bacteria 7864
543 Ga0466972_0021905 3300044658 Bacteria 3183
544 Ga0466978_0009550 3300044671 Bacteria 5232
545 Ga0466965_0006666 3300044683 Bacteria 5261
546 Ga0466966_0000005 3300044684 Bacteria 193939
547 Ga0466966_0000190 3300044684 Bacteria 40942
548 Ga0466961_0000030 3300044693 Bacteria 86108
549 Ga0466961_0000150 3300044693 Bacteria 47254
550 Ga0466961_0000323 3300044693 Bacteria 31571
551 Ga0466971_0002330 3300044719 Bacteria 8032
552 Ga0466970_0000990 3300044765 Bacteria 13671
553 Ga0466957_0023465 3300044842 Bacteria 3647
554 Ga0466960_0004635 3300044901 Bacteria 5391
555 Ga0466959_0000550 3300045049 Bacteria 21804
556 Ga0466959_0001295 3300045049 Bacteria 15147
557 Ga0466959_0007945 3300045049 Bacteria 7471
558 Ga0466967_0018799 3300045976 Bacteria 5536
559 Ga0466967_0023632 3300045976 Bacteria 5041
560 Ga0495592_0045180 3300046454 Bacteria 3287
561 Ga0495603_0000198 3300046455 Bacteria 31511
562 Ga0495603_0004316 3300046455 Bacteria 8477
563 Ga0495629_0000907 3300046459 Bacteria 23785
564 Ga0495629_0003844 3300046459 Bacteria 11325
565 Ga0495629_0010426 3300046459 Bacteria 6762
566 Ga0495629_0061976 3300046459 Bacteria 2614
567 Ga0495629_0068387 3300046459 Bacteria 2478
568 Ga0495638_0002275 3300046460 Bacteria 15873
569 Ga0495638_0004115 3300046460 Bacteria 11125
570 Ga0495638_0095718 3300046460 Bacteria 1783
571 Ga0495641_0004647 3300046461 Bacteria 9596
572 Ga0495641_0010355 3300046461 Bacteria 5413
573 Ga0495651_0001050 3300046462 Bacteria 21354
574 Ga0495651_0010997 3300046462 Bacteria 6963
575 Ga0495651_0016990 3300046462 Bacteria 5637
576 Ga0495653_0002378 3300046463 Bacteria 14963
577 Ga0495653_0010977 3300046463 Bacteria 7414
578 Ga0495650_0013048 3300046471 Bacteria 4422
579 Ga0495580_0004406 3300046472 Bacteria 11825
580 Ga0495580_0012093 3300046472 Bacteria 6642
581 Ga0495580_0034083 3300046472 Bacteria 3666
582 Ga0495582_0067468 3300046473 Bacteria 1977
583 Ga0495639_0000740 3300046475 Bacteria 14930
584 Ga0495662_0003919 3300046476 Bacteria 7507
585 Ga0495662_0031863 3300046476 Bacteria 2547
586 Ga0495664_0010795 3300046477 Bacteria 5136
587 Ga0495664_0053387 3300046477 Bacteria 2403
588 Ga0495664_0071029 3300046477 Bacteria 2079
589 Ga0495584_0000002 3300046491 Bacteria 512179
590 Ga0495584_0003590 3300046491 Bacteria 8465
591 Ga0495584_0038023 3300046491 Bacteria 2433
592 Ga0495585_0001719 3300046492 Bacteria 16685
593 Ga0495585_0004466 3300046492 Bacteria 9069
594 Ga0495594_0011667 3300046499 Bacteria 4569
595 Ga0495583_0000045 3300046506 Bacteria 220503
596 Ga0495608_0001717 3300046511 Bacteria 15709
597 Ga0495608_0007089 3300046511 Bacteria 7931
598 Ga0495618_0022571 3300046514 Bacteria 3887
599 Ga0495628_0000797 3300046516 Bacteria 29081
600 Ga0495628_0007197 3300046516 Bacteria 9635
601 Ga0495628_0008459 3300046516 Bacteria 8823
602 Ga0495644_0000761 3300046523 Bacteria 13262
603 Ga0495648_0000245 3300046524 Bacteria 61457
604 Ga0495648_0001381 3300046524 Bacteria 23912
605 Ga0495648_0069121 3300046524 Bacteria 2057
606 Ga0495666_0004533 3300046526 Bacteria 7019
607 Ga0495666_0008807 3300046526 Bacteria 5054
608 Ga0495652_0003013 3300046529 Bacteria 16901
609 Ga0495652_0003865 3300046529 Bacteria 14606
610 Ga0495652_0007298 3300046529 Bacteria 10199
611 Ga0495652_0068148 3300046529 Bacteria 2981
612 Ga0495665_0001368 3300046531 Bacteria 13041
613 Ga0495665_0007245 3300046531 Bacteria 5986
614 Ga0495665_0072175 3300046531 Bacteria 1818
615 Ga0495587_0004074 3300046536 Bacteria 9683
616 Ga0495587_0063522 3300046536 Bacteria 2159
617 Ga0495609_0000399 3300046538 Bacteria 36495
618 Ga0495645_0176761 3300046543 Bacteria 1465
619 Ga0495622_0000964 3300046557 Bacteria 15444
620 Ga0495622_0028114 3300046557 Bacteria 2625
621 Ga0495633_0005719 3300046558 Bacteria 7514
622 Ga0495667_0000399 3300046559 Bacteria 27814
623 Ga0495667_0005941 3300046559 Bacteria 8260
624 Ga0495656_0001938 3300046615 Bacteria 6826
625 Ga0495634_0006251 3300046642 Bacteria 9068
626 Ga0495634_0027783 3300046642 Bacteria 3934
627 Ga0495611_0001297 3300046648 Bacteria 12750
628 Ga0495625_0039995 3300046660 Bacteria 3422
629 Ga0495625_0105138 3300046660 Bacteria 1935
630 Ga0495635_0002131 3300046663 Bacteria 13431
631 Ga0495635_0007362 3300046663 Bacteria 7680
632 Ga0495659_0000355 3300046664 Bacteria 17889
633 Ga0495661_0112081 3300046665 Bacteria 1519
634 Ga0495588_0001473 3300046674 Bacteria 10107
635 Ga0495588_0002554 3300046674 Bacteria 7779
636 Ga0495588_0009828 3300046674 Bacteria 4435
637 Ga0495657_0027865 3300046675 Bacteria 3980
638 Ga0495599_0014890 3300046678 Bacteria 4817
639 Ga0495599_0017150 3300046678 Bacteria 4500
640 Ga0495599_0042553 3300046678 Bacteria 2850
641 Ga0495623_0002139 3300046679 Bacteria 13194
642 Ga0495623_0005351 3300046679 Bacteria 8405
643 Ga0495623_0013089 3300046679 Bacteria 5376
644 Ga0495623_0080153 3300046679 Bacteria 2021
645 Ga0495646_0003393 3300046680 Bacteria 9903
646 Ga0495646_0006228 3300046680 Bacteria 7566
647 Ga0495647_0001233 3300046681 Bacteria 7889
648 Ga0495647_0003460 3300046681 Bacteria 5050
649 Ga0495658_0002455 3300046683 Bacteria 9335
650 Ga0495658_0005651 3300046683 Bacteria 6145
651 Ga0495613_0006518 3300046689 Bacteria 8723
652 Ga0495624_0026934 3300046690 Bacteria 3766
653 Ga0495624_0048074 3300046690 Bacteria 2708
654 Ga0495670_0000570 3300046691 Bacteria 17593
655 Ga0495670_0001167 3300046691 Bacteria 12756
656 Ga0495670_0010137 3300046691 Bacteria 4637
657 Ga0495600_0009349 3300046809 Bacteria 6054
658 Ga0495600_0013953 3300046809 Bacteria 5062
659 Ga0495604_0001622 3300047317 Bacteria 18551
660 Ga0495604_0002733 3300047317 Bacteria 14153
661 Ga0495604_0019316 3300047317 Bacteria 5454
662 Ga0495604_0062409 3300047317 Bacteria 2847
663 Ga0495604_0174312 3300047317 Bacteria 1509
664 Ga0495636_0012554 3300047318 Bacteria 3354
665 Ga0495674_0001693 3300047319 Bacteria 21667
666 Ga0495674_0031998 3300047319 Bacteria 4774
667 Ga0495674_0052342 3300047319 Bacteria 3593
668 Ga0495672_0000019 3300047320 Bacteria 448153
669 Ga0495672_0008582 3300047320 Bacteria 7520
670 Ga0495676_0018796 3300047321 Bacteria 6091
671 Ga0495680_0001112 3300047322 Bacteria 29712
672 Ga0495680_0002992 3300047322 Bacteria 16879
673 Ga0495680_0018983 3300047322 Bacteria 5822
674 Ga0495680_0019056 3300047322 Bacteria 5807
675 Ga0495680_0077880 3300047322 Bacteria 2510
676 Ga0495687_000156 3300047443 Bacteria 103711
677 Ga0495687_010201 3300047443 Bacteria 5167
678 Ga0495685_000022 3300047447 Bacteria 71800
679 Ga0495684_0043963 3300047471 Bacteria 3420
680 Ga0495684_0044596 3300047471 Bacteria 3395
681 Ga0495686_0009424 3300047472 Bacteria 7033
682 Ga0495593_0002855 3300047673 Bacteria 10412
683 Ga0495602_0008501 3300048088 Bacteria 10722
684 Ga0495602_0009630 3300048088 Bacteria 10041
685 Ga0495602_0014490 3300048088 Bacteria 8002
686 Ga0495614_0013681 3300048089 Bacteria 3559
687 Ga0495614_0049244 3300048089 Bacteria 1806
688 Ga0496100_0001332 3300048903 Bacteria 12088
689 Ga0496101_0005688 3300048904 Bacteria 7955
690 Ga0496101_0020129 3300048904 Bacteria 4563
691 Ga0496101_0023750 3300048904 Bacteria 4238
692 Ga0496102_0021597 3300048905 Bacteria 5693
693 Ga0496102_0162113 3300048905 Bacteria 2103
694 Ga0496102_0238334 3300048905 Bacteria 1716
695 Ga0496103_0001947 3300048906 Bacteria 13343
696 Ga0496103_0095916 3300048906 Bacteria 1874
697 Ga0496104_0003334 3300048907 Bacteria 13862
698 Ga0496104_0003487 3300048907 Bacteria 13567
699 Ga0496104_0020430 3300048907 Bacteria 6070
700 Ga0496104_0039232 3300048907 Bacteria 4433
701 Ga0496105_0002473 3300048908 Bacteria 13374
702 Ga0496105_0051364 3300048908 Bacteria 3406
703 Ga0496105_0077199 3300048908 Bacteria 2751
704 Ga0496106_0001839 3300048909 Bacteria 15889
705 Ga0496106_0008884 3300048909 Bacteria 7426
706 Ga0496106_0025148 3300048909 Bacteria 4429
707 Ga0496106_0030984 3300048909 Bacteria 3987
708 Ga0496106_0031199 3300048909 Bacteria 3971
709 Ga0496106_0080955 3300048909 Bacteria 2494
710 Ga0496107_0004554 3300048910 Bacteria 9387
711 Ga0496107_0024190 3300048910 Bacteria 4296
712 Ga0496107_0047055 3300048910 Bacteria 3106
713 Ga0496108_0010906 3300048911 Bacteria 7377
714 Ga0496108_0025123 3300048911 Bacteria 4908
715 Ga0496108_0059725 3300048911 Bacteria 3207
716 Ga0496108_0131961 3300048911 Bacteria 2147
717 Ga0496109_0041164 3300048912 Bacteria 4186
718 Ga0496109_0043052 3300048912 Bacteria 4092
719 Ga0496109_0079283 3300048912 Bacteria 3025
720 Ga0496110_0003567 3300048913 Bacteria 11953
721 Ga0496110_0027400 3300048913 Bacteria 4885
722 Ga0496110_0044460 3300048913 Bacteria 3878
723 Ga0496110_0053764 3300048913 Bacteria 3541
724 Ga0496110_0063129 3300048913 Bacteria 3273
725 Ga0496110_0331186 3300048913 Bacteria 1387
726 Ga0496111_0015307 3300048914 Bacteria 5263
727 Ga0496111_0050076 3300048914 Bacteria 3012
728 Ga0496111_0062749 3300048914 Bacteria 2695
729 Ga0496111_0211361 3300048914 Bacteria 1441
730 Ga0496112_0028465 3300048915 Bacteria 5393
731 Ga0496112_0066817 3300048915 Bacteria 3548
732 Ga0496112_0221034 3300048915 Bacteria 1850
733 Ga0496113_0002600 3300048916 Bacteria 10550
734 Ga0496114_0005049 3300048917 Bacteria 10286
735 Ga0496114_0019455 3300048917 Bacteria 5501
736 Ga0496114_0031908 3300048917 Bacteria 4334
737 Ga0496114_0051318 3300048917 Bacteria 3434
738 Ga0496115_0006872 3300048918 Bacteria 8354
739 Ga0496115_0047215 3300048918 Bacteria 3443
740 Ga0496115_0080631 3300048918 Bacteria 2650
741 Ga0496115_0087713 3300048918 Bacteria 2539
742 Ga0496115_0150930 3300048918 Bacteria 1919
743 Ga0496116_0096262 3300048919 Bacteria 1784
744 Ga0496117_0021899 3300048920 Bacteria 5149
745 Ga0496117_0060543 3300048920 Bacteria 2608
746 Ga0496118_0009061 3300048921 Bacteria 10140
747 Ga0496121_0001201 3300048924 Bacteria 45377
748 Ga0496121_0007762 3300048924 Bacteria 12851
749 Ga0496121_0013955 3300048924 Bacteria 8583
750 Ga0496121_0062891 3300048924 Bacteria 3037
751 Ga0496122_0043813 3300048925 Bacteria 3501
752 Ga0496123_0011529 3300048926 Bacteria 7652
753 Ga0496124_0000916 3300048927 Bacteria 47613
754 Ga0496125_0037259 3300048928 Bacteria 4230
755 Ga0496125_0049643 3300048928 Bacteria 3484
756 Ga0496126_0027277 3300048929 Bacteria 5458
757 Ga0496126_0061185 3300048929 Bacteria 3383
758 Ga0496126_0074541 3300048929 Bacteria 3013
759 Ga0495682_0000461 3300049460 Bacteria 28071
760 Ga0501032_0004059 3300049569 Bacteria 11102
761 Ga0501032_0029992 3300049569 Bacteria 3731
762 Ga0501034_0004543 3300049571 Bacteria 15419
763 Ga0501034_0007053 3300049571 Bacteria 11987
764 Ga0501034_0024707 3300049571 Bacteria 6112
765 Ga0501034_0034415 3300049571 Bacteria 5135
766 Ga0501034_0042654 3300049571 Bacteria 4593
767 Ga0501034_0064373 3300049571 Bacteria 3681
768 Ga0501034_0345603 3300049571 Bacteria 1417
769 Ga0501036_0048707 3300049572 Bacteria 3588
770 Ga0501037_0037136 3300049573 Bacteria 3591
771 Ga0501037_0060000 3300049573 Bacteria 2774
772 Ga0501037_0086784 3300049573 Bacteria 2265
773 Ga0501038_0000519 3300049574 Bacteria 33842
774 Ga0501038_0023377 3300049574 Bacteria 5527
775 Ga0501038_0032192 3300049574 Bacteria 4628
776 Ga0501038_0042588 3300049574 Bacteria 3954
777 Ga0501038_0115316 3300049574 Bacteria 2221
778 Ga0501039_0008129 3300049575 Bacteria 7992
779 Ga0501039_0032769 3300049575 Bacteria 4007
780 Ga0501039_0111122 3300049575 Bacteria 2142
781 Ga0501039_0114707 3300049575 Bacteria 2108
782 Ga0501041_0046539 3300049577 Bacteria 2639
783 Ga0501041_0078043 3300049577 Bacteria 2038
784 Ga0501042_0005467 3300049578 Bacteria 8181
785 Ga0501043_0018549 3300049579 Bacteria 5459
786 Ga0501043_0024549 3300049579 Bacteria 4730
787 Ga0501043_0105242 3300049579 Bacteria 2217
788 Ga0501046_0000634 3300049580 Bacteria 34514
789 Ga0501047_0000606 3300049581 Bacteria 38066
790 Ga0501047_0035823 3300049581 Bacteria 4794
791 Ga0501047_0037107 3300049581 Bacteria 4712
792 Ga0501047_0092068 3300049581 Bacteria 2910
793 Ga0501047_0109858 3300049581 Bacteria 2640
794 Ga0501048_0098587 3300049582 Bacteria 2061
795 Ga0501067_0068965 3300049583 Bacteria 1958
796 Ga0501070_0007354 3300049586 Bacteria 9350
797 Ga0501070_0021296 3300049586 Bacteria 5441
798 Ga0501070_0022681 3300049586 Bacteria 5257
799 Ga0501070_0032161 3300049586 Bacteria 4391
800 Ga0501071_0057395 3300049587 Bacteria 2813
801 Ga0501071_0061169 3300049587 Bacteria 2727
802 Ga0501072_0041180 3300049588 Bacteria 3627
803 Ga0501072_0121885 3300049588 Bacteria 2077
804 Ga0501073_0090852 3300049589 Bacteria 2122
805 Ga0501075_0009946 3300049591 Bacteria 6668
806 Ga0501075_0079906 3300049591 Bacteria 2475
807 Ga0501075_0113109 3300049591 Bacteria 2064
808 Ga0501076_0062477 3300049592 Bacteria 2966
809 Ga0501077_0022454 3300049593 Bacteria 3997
810 Ga0501079_0023566 3300049741 Bacteria 4724
811 Ga0501079_0151071 3300049741 Bacteria 1811
812 Ga0501079_0200685 3300049741 Bacteria 1558
813 Ga0501080_0005028 3300049742 Bacteria 11781
814 Ga0501080_0086079 3300049742 Bacteria 2920
815 Ga0501080_0095984 3300049742 Bacteria 2752
816 Ga0501083_0025195 3300049744 Bacteria 4119
817 Ga0501083_0031467 3300049744 Bacteria 3642
818 Ga0501035_0001680 3300049822 Bacteria 22369
819 Ga0501044_0000026 3300049823 Bacteria 183624
820 Ga0501044_0001604 3300049823 Bacteria 26455
821 Ga0501044_0002258 3300049823 Bacteria 22013
822 Ga0501044_0026609 3300049823 Bacteria 6123
823 Ga0501044_0067006 3300049823 Bacteria 3659
824 Ga0501044_0218459 3300049823 Bacteria 1857
825 Ga0501045_0056608 3300049824 Bacteria 2868
826 nmdc:mga03683_935_c1 3300050489 Bacteria 8457
827 nmdc:mga0yw44_12821_c1 3300050492 Bacteria 4385
828 nmdc:mga0yw44_52191_c1 3300050492 Bacteria 2478
829 nmdc:mga0k408_9674_c1 3300050493 Bacteria 4621
830 nmdc:mga06z11_14903_c1 3300050494 Bacteria 3456
831 nmdc:mga06z11_19330_c1 3300050494 Bacteria 3130
832 nmdc:mga06z11_2106_c1 3300050494 Bacteria 7551
833 nmdc:mga04h51_5959_c1 3300050495 Bacteria 3133
834 nmdc:mga07m45_13638_c1 3300050496 Bacteria 3256
835 nmdc:mga07m45_31619_c1 3300050496 Bacteria 2934
836 nmdc:mga05p37_268_c1 3300050507 Bacteria 53897
837 nmdc:mga05p37_49281_c1 3300050507 Bacteria 5180
838 nmdc:mga05p37_66177_c1 3300050507 Bacteria 4445
839 nmdc:mga05p37_9172_c1 3300050507 Bacteria 11694
840 nmdc:mga09592_15489_c2 3300050508 Bacteria 3390
841 nmdc:mga0qj67_174964_c1 3300050509 Bacteria 1743
842 nmdc:mga0qj67_36053_c1 3300050509 Bacteria 3868
843 nmdc:mga0qj67_40961_c1 3300050509 Bacteria 3642
844 nmdc:mga06r32_101581_c1 3300050510 Bacteria 2823
845 nmdc:mga06r32_133_c1 3300050510 Bacteria 53973
846 nmdc:mga06r32_36345_c1 3300050510 Bacteria 4653
847 nmdc:mga06r32_48054_c1 3300050510 Bacteria 4078
848 nmdc:mga06r32_77889_c1 3300050510 Bacteria 3221
849 nmdc:mga08y16_21146_c1 3300050511 Bacteria 6869
850 nmdc:mga08y16_225678_c1 3300050511 Bacteria 1938
851 nmdc:mga08y16_23809_c1 3300050511 Bacteria 6466
852 nmdc:mga08y16_35014_c1 3300050511 Bacteria 5275
853 nmdc:mga0n895_377967_c1 3300050512 Bacteria 1434
854 nmdc:mga0n895_67722_c1 3300050512 Bacteria 3536
855 nmdc:mga0rr50_347455_c1 3300050513 Bacteria 1247
856 nmdc:mga0a205_206715_c1 3300050515 Bacteria 1852
857 nmdc:mga0a205_36529_c1 3300050515 Bacteria 4720
858 nmdc:mga0sz30_241_c1 3300050516 Bacteria 20970
859 Ga0495601_0001161 3300053077 Bacteria 14400
860 Ga0495601_0007136 3300053077 Bacteria 6548
861 Ga0495601_0026459 3300053077 Bacteria 3582
862 Ga0495601_0073978 3300053077 Bacteria 2179
863 Ga0495601_0144890 3300053077 Bacteria 1550
864 Ga0495612_0000874 3300053078 Bacteria 12293
865 Ga0500635_0016299 3300053080 Bacteria 2208
866 Ga0495655_0008066 3300053083 Bacteria 1987
867 Ga0495595_0000635 3300053084 Bacteria 13367
868 Ga0495595_0048791 3300053084 Bacteria 1956
869 Ga0495619_0000208 3300053085 Bacteria 42643
870 Ga0495619_0000973 3300053085 Bacteria 18754
871 Ga0495619_0007472 3300053085 Bacteria 6923
872 Ga0495619_0021670 3300053085 Bacteria 4105
873 Ga0495619_0027257 3300053085 Bacteria 3679
874 Ga0495619_0030232 3300053085 Bacteria 3505
875 Ga0495619_0075297 3300053085 Bacteria 2265
876 Ga0495619_0091610 3300053085 Bacteria 2058
877 Ga0500643_000077 3300053087 Bacteria 105070
878 Ga0500566_0000553 3300053094 Bacteria 20987
879 Ga0500640_000648 3300053095 Bacteria 9099
880 Ga0500641_0009554 3300053096 Bacteria 3488
881 Ga0500650_0050462 3300053098 Bacteria 1932
882 Ga0500556_0000030 3300053104 Bacteria 165098
883 Ga0500557_000153 3300053105 Bacteria 15793
884 Ga0500572_001050 3300053111 Bacteria 8211
885 Ga0500595_002396 3300053119 Bacteria 9364
886 Ga0500608_083199 3300053122 Bacteria 1507
887 Ga0500642_0000380 3300053130 Bacteria 14869
888 Ga0500652_014355 3300053131 Bacteria 2829
889 Ga0500655_009782 3300053133 Bacteria 1731
890 Ga0500573_0054704 3300053140 Bacteria 2291
891 Ga0500630_000937 3300053159 Bacteria 13649
892 Ga0500639_011959 3300053163 Bacteria 4552
893 Ga0500636_0000460 3300053177 Bacteria 22203
894 Ga0500636_0021067 3300053177 Bacteria 3861
895 Ga0500599_005910 3300053736 Bacteria 1549
896 Ga0500601_000174 3300053737 Bacteria 13338
897 Ga0501084_0006745 3300054114 Bacteria 9440
898 Ga0501082_0000506 3300060353 Bacteria 34564
899 Ga0501082_0057509 3300060353 Bacteria 3351
900 Ga0466962_0006222 3300061719 Bacteria 5732
901 Ga0530510_0064031 3300061734 Bacteria 2663
902 2509128095 2508501125 Bacteria 7208311
903 2511401354 2511231028 Bacteria 8046582
904 2513622205 2513237092 Bacteria 8341956
905 2513651826 2513237095 Bacteria 8976980
906 2513704737 2513237102 Bacteria 7703324
907 2515629592 2515154112 Bacteria 8294334
908 2519460935 2519103095 Bacteria 6629912
909 2585289836 2582581311 Bacteria 6763856
910 2596374300 2595698237 Bacteria 6712432
911 2597032475 2596583598 Bacteria 5251611
912 2599447754 2599185178 Bacteria 5365746
913 2617348292 2617270735 Bacteria 9163226
914 2617377433 2617270741 Bacteria 8201522
915 2643758033 2643221547 Bacteria 4740017
916 2644737157 2643221734 Bacteria 5365412
917 2644746868 2643221736 Bacteria 6608466
918 2757572363 2757320392 Bacteria 3737298
919 2774874173 2773857925 Bacteria 6472445
920 2776265242 2775506901 Bacteria 9631051
921 2817259218 2816332253 Bacteria 6764532
922 2817276086 2816332256 Bacteria 6891714
923 2817280373 2816332256 Bacteria 6891714
924 2817452443 2816332286 Bacteria 6853759
925 2818241991 2816332527 Bacteria 8933356
926 2819620050 2818991450 Bacteria 6962147
927 2824604925 2824600985 Bacteria 8488197
928 2824615264 2824609381 Bacteria 8672835
929 2824625580 2824617872 Bacteria 8814715
930 2824635147 2824626560 Bacteria 8813858
931 2824643808 2824635225 Bacteria 8785348
932 2824651120 2824644064 Bacteria 8743947
933 2824659145 2824653114 Bacteria 8493680
934 2824686083 2824679649 Bacteria 8248951
935 2824723146 2824714736 Bacteria 8717648
936 2824732441 2824723954 Bacteria 8758240
937 2824739336 2824732956 Bacteria 7810675
938 2824750226 2824746037 Bacteria 7911610
939 2824781195 2824773399 Bacteria 8360218
940 2831867132 2831864461 Bacteria 6502356
941 2835316516 2835312727 Bacteria 7413381
942 2838126739 2838122688 Bacteria 8803140
943 2841764140 2841760612 Bacteria 6454112
944 2841947660 2841941048 Bacteria 8688029
945 2841963180 2841957949 Bacteria 8652217
946 2841982662 2841974524 Bacteria 8931498
947 2841986868 2841983080 Bacteria 8395090
948 2842044728 2842038055 Bacteria 8002051
949 2842053085 2842045827 Bacteria 8006841
950 2842455146 2842454564 Bacteria 8730687
951 2842694174 2842694124 Bacteria 4063419
952 2844108405 2844104063 Bacteria 6440972
953 2844320881 2844315083 Bacteria 8138177
954 2847938367 2847930680 Bacteria 9342022
955 2851185442 2851182111 Bacteria 6047226
956 2851250575 2851246043 Bacteria 6439203
957 2857510748 2857509624 Bacteria 7472071
958 2874115168 2874109183 Bacteria 6517025
959 2874591831 2874590934 Bacteria 8299676
960 2874618786 2874612657 Bacteria 8252029
961 2874626087 2874620515 Bacteria 8290088
962 2874630851 2874628541 Bacteria 8630250
963 2874646289 2874645413 Bacteria 8214782
964 2876765834 2876761206 Bacteria 10111113
965 2876772102 2876771140 Bacteria 8287509
966 2876819375 2876818435 Bacteria 8274608
967 2879078798 2879074833 Bacteria 8279565
968 2879086047 2879083081 Bacteria 8587928
969 2879128534 2879127579 Bacteria 8294491
970 2879143874 2879142872 Bacteria 8267021
971 2881364263 2881364244 Bacteria 7710352
972 2881672799 2881665667 Bacteria 8175609
973 2882457921 2882456835 Bacteria 6863978
974 2884300153 2884298095 Bacteria 3823049
975 2885266569 2885266251 Bacteria 4796748
976 2885317252 2885312484 Bacteria 6415165
977 2885368085 2885366525 Bacteria 8326213
978 2888386259 2888378607 Bacteria 9652610
979 2888426395 2888419890 Bacteria 7857137
980 2889037104 2889033259 Bacteria 9099371
981 2900581016 2900577576 Bacteria 5438534
982 2900640174 2900634093 Bacteria 10263517
983 2902333219 2902330777 Bacteria 6395352
984 2903728048 2903727486 Bacteria 8281579
985 2904485950 2904483920 Bacteria 7545285
986 2904667561 2904666416 Bacteria 8226587
987 2906608164 2906602504 Bacteria 8295279
988 2906610554
989 2906649264 2906643746 Bacteria 8722424
990 2908782525 2908775508 Bacteria 8092255
991 2917702481 2917699015 Bacteria 7043791
992 2919527314 2919527303 Bacteria 7718827
993 2922394565 2922393267 Bacteria 8285685
994 2924716385 2924710171 Bacteria 6752351
995 2928059580 2928058823 Bacteria 5520022
996 2928110392 2928108538 Bacteria 7360024
997 2928138474 2928135762 Bacteria 7259641
998 2928505464 2928503688 Bacteria 7268108
999 2932798762 2932794094 Bacteria 7915132
1000 2935693356 2935684952 Bacteria 9590419
1001 2935720855 2935713505 Bacteria 9608509
1002 2935730658 2935722832 Bacteria 9608746
1003 2935740577 2935732158 Bacteria 9706831
1004 2935749949 2935741537 Bacteria 9707219
1005 2935759231 2935750917 Bacteria 9590372
1006 2935914842 2935908558 Bacteria 8568796
1007 2935923267 2935916978 Bacteria 9113783
1008 2935932479 2935926038 Bacteria 8601059
1009 2935941077 2935934488 Bacteria 8602579
1010 2935949030 2935942939 Bacteria 8599779
1011 2935957725 2935951376 Bacteria 8602333
1012 2935974154 2935967501 Bacteria 8603075
1013 2935981448 2935975950 Bacteria 8347125
1014 2940565243 2940556831 Bacteria 9590747
1015 2941536664 2941531003 Bacteria 7653939
1016 2977903452 2977898635 Bacteria 6675551
1017 2996390170 2996386984 Bacteria 6978667
1018 3004235717 3004232784 Bacteria 6662140
1019 3005478913 3005474847 Bacteria 9259049
1020 3005488978 3005483717 Bacteria 7877331
1021 3005507777 3005506211 Bacteria 6943378
1022 3005593973 3005587118 Bacteria 7794411
1023 3005601177 3005594810 Bacteria 8716512
1024 3005716650 3005710791 Bacteria 7622528
1025 642421004 641736151 Bacteria 7477263
1026 642593833 642555112 Bacteria 8676562
1027 642617130 642555113 Bacteria 8214658
1028 8016584039 8016583857 Bacteria 10421953
1029 8016634091 8016630954 Bacteria 9217207
1030 8019585250 8019576017 Bacteria 10049540
1031 8019620820 8019619141 Bacteria 9218857
1032 8019647502 8019638758 Bacteria 9062356
1033 8019669725 8019668869 Bacteria 8791617
1034 8019686370 8019678201 Bacteria 8863603
1035 8019692529 8019687851 Bacteria 8712826
1036 8040167768 8040167225 Bacteria 6542727
1037 8040178490 8040173305 Bacteria 6827067
1038 8055306999 8055301274 Bacteria 8587385
1039 8057533777 8057529695 Bacteria 6306553
1040 Ga0373935_0094205
1041 ARcpr5oldR_c000058
1042 JGI24741J21665_1000301
1043 JGI24740J21852_10000177
1044 JGI24739J22299_10012905
1045 JGI24738J21930_10003370
1046 JGI25156J39149_1001647
1047 JGI25156J39149_1001928
1048 JGI25156J39149_1003064
1049 JGI25154J39366_1000608
1050 JGI25151J46595_10000868
1051 JGI25151J46595_10006764
1052 JGI25406J46586_10000755
1053 JGI25165J46597_1001426
1054 JGI25153J46596_10001982
1055 JGI25153J46596_10008991
1056 JGI25160J50197_1002576
1057 JGI25160J50197_1009321
1058 Ga0055539_1000108
1059 Ga0055533_1000072
1060 Ga0055533_1005123
1061 Ga0055532_1000013
1062 Ga0055532_1000073
1063 Ga0055525_1000562
1064 Ga0055527_1000010
1065 Ga0055527_1000496
1066 Ga0055535_1000010
1067 Ga0055535_1000055
1068 Ga0055542_1000016
1069 Ga0055542_1006480
1070 Ga0055529_1000012
1071 Ga0055529_1000149
1072 Ga0055526_1000563
1073 Ga0055526_1003347
1074 Ga0055537_1000514
1075 Ga0055524_1000263
1076 Ga0055536_1000195
1077 Ga0055534_1000710
1078 Ga0055534_1000845
1079 Ga0055534_1002985
1080 Ga0055531_10005344
1081 Ga0055543_1002171
1082 Ga0065165_1000146
1083 Ga0065165_1002972
1084 Ga0065165_1006694
1085 Ga0065712_10004291
1086 Ga0065715_10100770
1087 Ga0070658_10007876
1088 Ga0070690_100075861
1089 Ga0070670_100104809
1090 Ga0070670_100181847
1091 Ga0070680_100007778
1092 Ga0068868_100151772
1093 Ga0068868_100203226
1094 Ga0070660_100000433
1095 Ga0070660_100002743
1096 Ga0070660_100020516
1097 Ga0070689_100000293
1098 Ga0070689_100009331
1099 Ga0070689_100051335
1100 Ga0070689_100113915
1101 Ga0070687_100021930
1102 Ga0070661_100000061
1103 Ga0070668_100013880
1104 Ga0070668_100015925
1105 Ga0070668_100037761
1106 Ga0070668_100156337
1107 Ga0070675_100023675
1108 Ga0070675_100076259
1109 Ga0070674_100046744
1110 Ga0070674_100055026
1111 Ga0070673_100032102
1112 Ga0070688_100018257
1113 Ga0070659_100004518
1114 Ga0070659_100004527
1115 Ga0070659_100041385
1116 Ga0070667_100010125
1117 Ga0070667_100277972
1118 Ga0070703_10006357
1119 Ga0070709_10000624
1120 Ga0070713_100017918
1121 Ga0070710_10005253
1122 Ga0070710_10007291
1123 Ga0070711_100002089
1124 Ga0070711_100003615
1125 Ga0070694_100007345
1126 Ga0070694_100008556
1127 Ga0070663_100000521
1128 Ga0070663_100001605
1129 Ga0070678_100017653
1130 Ga0070662_100002105
1131 Ga0070707_100088868
1132 Ga0070698_100001575
1133 Ga0070698_100090298
1134 Ga0070699_100176916
1135 Ga0070679_100235521
1136 Ga0070695_100011600
1137 Ga0070696_100012192
1138 Ga0070696_100090647
1139 Ga0070693_100001738
1140 Ga0070665_100029982
1141 Ga0070704_100024676
1142 Ga0070704_100083039
1143 Ga0068855_100020522
1144 Ga0068855_100049200
1145 Ga0070664_100000010
1146 Ga0070664_100181182
1147 Ga0068854_100000077
1148 Ga0068856_100000045
1149 Ga0068856_100251391
1150 Ga0068852_100020887
1151 Ga0068852_100063909
1152 Ga0068859_100029781
1153 Ga0068859_100034303
1154 Ga0068859_100147044
1155 Ga0068864_100001259
1156 Ga0068864_100012200
1157 Ga0068866_10007887
1158 Ga0068861_100011079
1159 Ga0068863_100124957
1160 Ga0068858_100068657
1161 Ga0068858_100087804
1162 Ga0068858_100169314
1163 Ga0068860_100015316
1164 Ga0068860_100039046
1165 Ga0068860_100064472
1166 Ga0068862_100042161
1167 Ga0068862_100075639
1168 Ga0081455_10007915
1169 Ga0081455_10037085
1170 Ga0081455_10048430
1171 Ga0081455_10117195
1172 Ga0081538_10042678
1173 Ga0081540_1000136
1174 Ga0081539_10000258
1175 Ga0081539_10060966
1176 Ga0075365_10002179
1177 Ga0075365_10003680
1178 Ga0075368_10005208
1179 Ga0075368_10005705
1180 Ga0075363_100009142
1181 Ga0070716_100029089
1182 Ga0070712_100007967
1183 Ga0070712_100016198
1184 Ga0070712_100030305
1185 Ga0075362_10000837
1186 Ga0075362_10002278
1187 Ga0075362_10010948
1188 Ga0075362_10026069
1189 Ga0075362_10064938
1190 Ga0075367_10000984
1191 Ga0075367_10009875
1192 Ga0075367_10013249
1193 Ga0075367_10068766
1194 Ga0075366_10001094
1195 Ga0075366_10003081
1196 Ga0075366_10026096
1197 Ga0075366_10041016
1198 Ga0075370_10000288
1199 Ga0075370_10007447
1200 Ga0075370_10032974
1201 Ga0075370_10097598
1202 Ga0075428_100001911
1203 Ga0075428_100006782
1204 Ga0075428_100007538
1205 Ga0075428_100014438
1206 Ga0075428_100017306
1207 Ga0075430_100016282
1208 Ga0075430_100029886
1209 Ga0075430_100032572
1210 Ga0075430_100042383
1211 Ga0075431_100000109
1212 Ga0075431_100010398
1213 Ga0075431_100032604
1214 Ga0075431_100041862
1215 Ga0075431_100095718
1216 Ga0075431_100120856
1217 Ga0075431_100140511
1218 Ga0075433_10019792
1219 Ga0075434_100073986
1220 Ga0075434_100116891
1221 Ga0075434_100247818
1222 Ga0075429_100013485
1223 Ga0075429_100038510
1224 Ga0075429_100058336
1225 Ga0097620_100029777
1226 Ga0097620_100034304
1227 Ga0097620_100147047
1228 Ga0099824_1009987
1229 Ga0099822_1001164
1230 Ga0099794_10000754
1231 Ga0099794_10008193
1232 Ga0105251_10000043
1233 Ga0105240_10074055
1234 Ga0105240_10075488
1235 Ga0111539_10015467
1236 Ga0111539_10015986
1237 Ga0111539_10026391
1238 Ga0111539_10030750
1239 Ga0111539_10054491
1240 Ga0111539_10353807
1241 Ga0105247_10010567
1242 Ga0105247_10016248
1243 Ga0114129_10000425
1244 Ga0114129_10006029
1245 Ga0114129_10048007
1246 Ga0114129_10053662
1247 Ga0114129_10072501
1248 Ga0114129_10174861
1249 Ga0105241_10057214
1250 Ga0105242_10061656
1251 Ga0105248_10054999
1252 Ga0105237_10006214
1253 Ga0105237_10018110
1254 Ga0105237_10020285
1255 Ga0105249_10001301
1256 Ga0105249_10006652
1257 Ga0105249_10109190
1258 Ga0105249_10232474
1259 Ga0105239_10002128
1260 Ga0105239_10148681
1261 Ga0105246_10014720
1262 Ga0105246_10026374
1263 Ga0105246_10082198
1264 Ga0157371_10000088
1265 Ga0157370_10000041
1266 Ga0157369_10013348
1267 Ga0157369_10051699
1268 Ga0157369_10275924
1269 Ga0157374_10001206
1270 Ga0157374_10057968
1271 Ga0157378_10000806
1272 Ga0157378_10015433
1273 Ga0157378_10029512
1274 Ga0157378_10057284
1275 Ga0157378_10252654
1276 Ga0163162_10005040
1277 Ga0163162_10163092
1278 Ga0157372_10000097
1279 Ga0157372_10009707
1280 Ga0157372_10045633
1281 Ga0157375_10003170
1282 Ga0157375_10022743
1283 Ga0157375_10041747
1284 Ga0163163_10001825
1285 Ga0163163_10016903
1286 Ga0163163_10018664
1287 Ga0163163_10090748
1288 Ga0157380_10113229
1289 Ga0182008_10011726
1290 Ga0157379_10032595
1291 Ga0157379_10043463
1292 Ga0157379_10140384
1293 Ga0157376_10017382
1294 Ga0157376_10023626
1295 Ga0182006_1001721
1296 Ga0182006_1010200
1297 Ga0182007_10000245
1298 Ga0182007_10003432
1299 Ga0182007_10025471
1300 Ga0214544_1000035
1301 Ga0214542_1000181
1302 Ga0214542_1021207
1303 Ga0214545_1000094
1304 Ga0214545_1017840
1305 Ga0214543_1000155
1306 Ga0214543_1022285
1307 Ga0213873_10006536
1308 Ga0213876_10003801
1309 Ga0209784_100008
1310 Ga0209784_100180
1311 Ga0209566_100006
1312 Ga0209566_100502
1313 Ga0209566_101007
1314 Ga0209674_100011
1315 Ga0209674_100045
1316 Ga0209674_100116
1317 Ga0209672_100002
1318 Ga0209672_100128
1319 Ga0209147_100003
1320 Ga0209147_100005
1321 Ga0209563_100016
1322 Ga0209563_102338
1323 Ga0209563_107023
1324 Ga0207427_101963
1325 Ga0209258_100007
1326 Ga0209258_100042
1327 Ga0207425_1000430
1328 Ga0207425_1004750
1329 Ga0209646_1000027
1330 Ga0209677_100008
1331 Ga0209677_100403
1332 Ga0209148_1000006
1333 Ga0209148_1000019
1334 Ga0209148_1000306
1335 Ga0209759_1000051
1336 Ga0209759_1000618
1337 Ga0209759_1001040
1338 Ga0209233_1000033
1339 Ga0209565_1000077
1340 Ga0209565_1006364
1341 Ga0209455_1000003
1342 Ga0209455_1000011
1343 Ga0209455_1001090
1344 Ga0209455_1003646
1345 Ga0209130_1000659
1346 Ga0209130_1009258
1347 Ga0209675_1000065
1348 Ga0209675_1000717
1349 Ga0209675_1002555
1350 Ga0209675_1004542
1351 Ga0209676_1000044
1352 Ga0209676_1007992
1353 Ga0209025_1001105
1354 Ga0209025_1002092
1355 Ga0209025_1004496
1356 Ga0209025_1010692
1357 Ga0209564_1000080
1358 Ga0209564_1000404
1359 Ga0209564_1000643
1360 Ga0209758_1000117
1361 Ga0209758_1000131
1362 Ga0209758_1000830
1363 Ga0209758_1001358
1364 Ga0209758_1001448
1365 Ga0209758_1002033
1366 Ga0209758_1006691
1367 Ga0209256_1000119
1368 Ga0209256_1000127
1369 Ga0209256_1000540
1370 Ga0209256_1003163
1371 Ga0207426_1000223
1372 Ga0207426_1015669
1373 Ga0209051_1002766
1374 Ga0209051_1023813
1375 Ga0209257_1001462
1376 Ga0209257_1021976
1377 Ga0207713_1000240
1378 Ga0207692_10000311
1379 Ga0207642_10010784
1380 Ga0207688_10062946
1381 Ga0207647_10001239
1382 Ga0207647_10040607
1383 Ga0207699_10000235
1384 Ga0207705_10007025
1385 Ga0207684_10039772
1386 Ga0207695_10000136
1387 Ga0207695_10001416
1388 Ga0207671_10014025
1389 Ga0207693_10000511
1390 Ga0207693_10015438
1391 Ga0207663_10005586
1392 Ga0207662_10053666
1393 Ga0207662_10068706
1394 Ga0207657_10000283
1395 Ga0207657_10004860
1396 Ga0207657_10024976
1397 Ga0207657_10086255
1398 Ga0207649_10000170
1399 Ga0207650_10081633
1400 Ga0207659_10014827
1401 Ga0207659_10031257
1402 Ga0207700_10045395
1403 Ga0207664_10002194
1404 Ga0207664_10080335
1405 Ga0207690_10016405
1406 Ga0207690_10016466
1407 Ga0207690_10027232
1408 Ga0207706_10011419
1409 Ga0207706_10014980
1410 Ga0207706_10097774
1411 Ga0207670_10064451
1412 Ga0207669_10055705
1413 Ga0207665_10024072
1414 Ga0207691_10080909
1415 Ga0207711_10050623
1416 Ga0207679_10000024
1417 Ga0207712_10131763
1418 Ga0207668_10022905
1419 Ga0207668_10041781
1420 Ga0207640_10000222
1421 Ga0207677_10163970
1422 Ga0207703_10059536
1423 Ga0207639_10115638
1424 Ga0207678_10000018
1425 Ga0207678_10004543
1426 Ga0207708_10030309
1427 Ga0207702_10000053
1428 Ga0207702_10207088
1429 Ga0207641_10060074
1430 Ga0207648_10022882
1431 Ga0207676_10003802
1432 Ga0207676_10023616
1433 Ga0207674_10004403
1434 Ga0207674_10021366
1435 Ga0207674_10059312
1436 Ga0207674_10089642
1437 Ga0207675_100016049
1438 Ga0207675_100158497
1439 Ga0207683_10016855
1440 Ga0209389_1000080
1441 Ga0209389_1002359
1442 Ga0209371_1014400
1443 Ga0209589_1000009
1444 Ga0209589_1000172
1445 Ga0209969_1001223
1446 Ga0209489_100010
1447 Ga0209489_100027
1448 Ga0209489_100263
1449 Ga0209700_100017
1450 Ga0209700_100022
1451 Ga0209995_1002806
1452 Ga0209999_1002232
1453 Ga0209588_1000255
1454 Ga0209971_1004636
1455 Ga0209966_1010741
1456 Ga0209813_10013075
1457 Ga0209974_10005360
1458 Ga0207428_10000804
1459 Ga0207428_10020116
1460 Ga0268266_10125048
1461 Ga0268264_10162167
1462 Ga0265337_1009629
1463 Ga0265326_10003146
1464 Ga0265334_10002686
1465 Ga0265334_10012368
1466 Ga0265323_10000074
1467 Ga0265323_10001672
1468 Ga0265322_10006236
1469 Ga0265322_10015754
1470 Ga0265336_10000108
1471 Ga0265336_10000209
1472 Ga0307515_10021366
1473 Ga0265338_10000081
1474 Ga0265338_10000119
1475 Ga0265324_10005629
1476 Ga0265324_10008978
1477 Ga0268256_1007661
1478 Ga0307511_10048565
1479 Ga0265328_10000003
1480 Ga0265328_10002830
1481 Ga0265328_10006069
1482 Ga0265331_10000090
1483 Ga0265331_10000121
1484 Ga0265331_10002374
1485 Ga0265331_10014908
1486 Ga0265327_10000269
1487 Ga0265327_10009447
1488 Ga0265327_10017013
1489 Ga0265316_10004302
1490 Ga0265316_10120486
1491 Ga0307513_10151390
1492 Ga0307509_10029764
1493 Ga0307408_100271851
1494 Ga0307508_10000013
1495 Ga0307516_10085188
1496 Ga0307405_10049419
1497 Ga0307410_10004667
1498 Ga0307412_10106555
1499 Ga0307409_100057994
1500 Ga0307409_100143813
1501 Ga0307416_100028192
1502 Ga0307416_100267772
1503 Ga0307414_10010735
1504 Ga0307414_10087150
1505 Ga0307411_10052789
1506 Ga0307415_100007269
1507 Ga0307415_100045413
1508 Ga0307507_10019891
1509 Ga0307510_10096069
1510 Ga0373930_0000013
1511 Ga0373940_0001263
1512 Ga0373923_0001943
1513 Ga0373932_0001213
1514 Ga0373936_0008904
1515 Ga0373939_0001439
1516 Ga0373941_0000286
1517 Ga0373945_0004731
1518 Ga0373954_0005129
1519 Ga0373954_0015575
1520 Ga0373956_0039072
1521 Ga0373960_0000187
1522 Ga0373943_0012492
1523 Ga0373943_0028951
1524 Ga0373943_0057982
1525 Ga0373946_0001050
1526 Ga0373946_0041371
1527 Ga0373955_0012507
1528 Ga0373962_0000661
1529 Ga0373924_0016096
1530 Ga0373924_0028527
1531 Ga0373931_0021486
1532 Ga0373935_0013207
1533 Ga0373935_0056677
1534 Ga0373927_0013260
1535 Ga0373927_0025589
1536 Ga0373927_0029201
1537 Ga0373927_0033090
1538 Ga0373927_0037667
1539 Ga0373927_0057908
1540 Ga0373933_0004960
1541 Ga0373933_0061542
1542 Ga0373947_0002058
1543 Ga0373947_0225304
1544 Ga0373937_0003814
1545 Ga0373937_0011611
1546 Ga0373925_0033383
1547 Ga0373925_0057213
1548 Ga0373925_0136097
1549 Ga0373925_0227541
1550 Ga0395899_0006840
1551 Ga0395900_0000961
1552 Ga0395900_0001715
1553 Ga0395900_0004086
1554 Ga0395900_0005280
1555 Ga0395900_0070332
1556 Ga0395900_0112986
1557 Ga0395900_0122224
1558 Ga0395898_0001286
1559 Ga0395898_0069582
1560 Ga0395898_0074903
1561 Ga0395898_0086616
1562 Ga0395905_0000750
1563 Ga0395905_0007254
1564 Ga0395905_0007921
1565 Ga0395901_0000002
1566 Ga0395901_0000129
1567 Ga0395901_0007678
1568 Ga0395901_0010131
1569 Ga0395901_0029291
1570 Ga0436365_0377218
1571 Ga0436365_1921176
1572 Ga0436361_0296858
1573 Ga0436362_1003156
1574 Ga0451793_1605844
1575 Ga0439431_0013073
1576 Ga0439441_000862
1577 Ga0439434_0009612
1578 Ga0466986_0014071
1579 Ga0466969_0004495
1580 Ga0466969_0023245
1581 Ga0466972_0003429
1582 Ga0466972_0021905
1583 Ga0466978_0009550
1584 Ga0466965_0006666
1585 Ga0466966_0000005
1586 Ga0466966_0000190
1587 Ga0466961_0000030
1588 Ga0466961_0000150
1589 Ga0466961_0000323
1590 Ga0466971_0002330
1591 Ga0466970_0000990
1592 Ga0466957_0023465
1593 Ga0466960_0004635
1594 Ga0466959_0000550
1595 Ga0466959_0001295
1596 Ga0466959_0007945
1597 Ga0466967_0018799
1598 Ga0466967_0023632
1599 Ga0495592_0045180
1600 Ga0495603_0000198
1601 Ga0495603_0004316
1602 Ga0495629_0000907
1603 Ga0495629_0003844
1604 Ga0495629_0010426
1605 Ga0495629_0061976
1606 Ga0495629_0068387
1607 Ga0495638_0002275
1608 Ga0495638_0004115
1609 Ga0495638_0095718
1610 Ga0495641_0004647
1611 Ga0495641_0010355
1612 Ga0495651_0001050
1613 Ga0495651_0010997
1614 Ga0495651_0016990
1615 Ga0495653_0002378
1616 Ga0495653_0010977
1617 Ga0495650_0013048
1618 Ga0495580_0004406
1619 Ga0495580_0012093
1620 Ga0495580_0034083
1621 Ga0495582_0067468
1622 Ga0495639_0000740
1623 Ga0495662_0003919
1624 Ga0495662_0031863
1625 Ga0495664_0010795
1626 Ga0495664_0053387
1627 Ga0495664_0071029
1628 Ga0495584_0000002
1629 Ga0495584_0003590
1630 Ga0495584_0038023
1631 Ga0495585_0001719
1632 Ga0495585_0004466
1633 Ga0495594_0011667
1634 Ga0495583_0000045
1635 Ga0495608_0001717
1636 Ga0495608_0007089
1637 Ga0495618_0022571
1638 Ga0495628_0000797
1639 Ga0495628_0007197
1640 Ga0495628_0008459
1641 Ga0495644_0000761
1642 Ga0495648_0000245
1643 Ga0495648_0001381
1644 Ga0495648_0069121
1645 Ga0495666_0004533
1646 Ga0495666_0008807
1647 Ga0495652_0003013
1648 Ga0495652_0003865
1649 Ga0495652_0007298
1650 Ga0495652_0068148
1651 Ga0495665_0001368
1652 Ga0495665_0007245
1653 Ga0495665_0072175
1654 Ga0495587_0004074
1655 Ga0495587_0063522
1656 Ga0495609_0000399
1657 Ga0495645_0176761
1658 Ga0495622_0000964
1659 Ga0495622_0028114
1660 Ga0495633_0005719
1661 Ga0495667_0000399
1662 Ga0495667_0005941
1663 Ga0495656_0001938
1664 Ga0495634_0006251
1665 Ga0495634_0027783
1666 Ga0495611_0001297
1667 Ga0495625_0039995
1668 Ga0495625_0105138
1669 Ga0495635_0002131
1670 Ga0495635_0007362
1671 Ga0495659_0000355
1672 Ga0495661_0112081
1673 Ga0495588_0001473
1674 Ga0495588_0002554
1675 Ga0495588_0009828
1676 Ga0495657_0027865
1677 Ga0495599_0014890
1678 Ga0495599_0017150
1679 Ga0495599_0042553
1680 Ga0495623_0002139
1681 Ga0495623_0005351
1682 Ga0495623_0013089
1683 Ga0495623_0080153
1684 Ga0495646_0003393
1685 Ga0495646_0006228
1686 Ga0495647_0001233
1687 Ga0495647_0003460
1688 Ga0495658_0002455
1689 Ga0495658_0005651
1690 Ga0495613_0006518
1691 Ga0495624_0026934
1692 Ga0495624_0048074
1693 Ga0495670_0000570
1694 Ga0495670_0001167
1695 Ga0495670_0010137
1696 Ga0495600_0009349
1697 Ga0495600_0013953
1698 Ga0495604_0001622
1699 Ga0495604_0002733
1700 Ga0495604_0019316
1701 Ga0495604_0062409
1702 Ga0495604_0174312
1703 Ga0495636_0012554
1704 Ga0495674_0001693
1705 Ga0495674_0031998
1706 Ga0495674_0052342
1707 Ga0495672_0000019
1708 Ga0495672_0008582
1709 Ga0495676_0018796
1710 Ga0495680_0001112
1711 Ga0495680_0002992
1712 Ga0495680_0018983
1713 Ga0495680_0019056
1714 Ga0495680_0077880
1715 Ga0495687_000156
1716 Ga0495687_010201
1717 Ga0495685_000022
1718 Ga0495684_0043963
1719 Ga0495684_0044596
1720 Ga0495686_0009424
1721 Ga0495593_0002855
1722 Ga0495602_0008501
1723 Ga0495602_0009630
1724 Ga0495602_0014490
1725 Ga0495614_0013681
1726 Ga0495614_0049244
1727 Ga0496100_0001332
1728 Ga0496101_0005688
1729 Ga0496101_0020129
1730 Ga0496101_0023750
1731 Ga0496102_0021597
1732 Ga0496102_0162113
1733 Ga0496102_0238334
1734 Ga0496103_0001947
1735 Ga0496103_0095916
1736 Ga0496104_0003334
1737 Ga0496104_0003487
1738 Ga0496104_0020430
1739 Ga0496104_0039232
1740 Ga0496105_0002473
1741 Ga0496105_0051364
1742 Ga0496105_0077199
1743 Ga0496106_0001839
1744 Ga0496106_0008884
1745 Ga0496106_0025148
1746 Ga0496106_0030984
1747 Ga0496106_0031199
1748 Ga0496106_0080955
1749 Ga0496107_0004554
1750 Ga0496107_0024190
1751 Ga0496107_0047055
1752 Ga0496108_0010906
1753 Ga0496108_0025123
1754 Ga0496108_0059725
1755 Ga0496108_0131961
1756 Ga0496109_0041164
1757 Ga0496109_0043052
1758 Ga0496109_0079283
1759 Ga0496110_0003567
1760 Ga0496110_0027400
1761 Ga0496110_0044460
1762 Ga0496110_0053764
1763 Ga0496110_0063129
1764 Ga0496110_0331186
1765 Ga0496111_0015307
1766 Ga0496111_0050076
1767 Ga0496111_0062749
1768 Ga0496111_0211361
1769 Ga0496112_0028465
1770 Ga0496112_0066817
1771 Ga0496112_0221034
1772 Ga0496113_0002600
1773 Ga0496114_0005049
1774 Ga0496114_0019455
1775 Ga0496114_0031908
1776 Ga0496114_0051318
1777 Ga0496115_0006872
1778 Ga0496115_0047215
1779 Ga0496115_0080631
1780 Ga0496115_0087713
1781 Ga0496115_0150930
1782 Ga0496116_0096262
1783 Ga0496117_0021899
1784 Ga0496117_0060543
1785 Ga0496118_0009061
1786 Ga0496121_0001201
1787 Ga0496121_0007762
1788 Ga0496121_0013955
1789 Ga0496121_0062891
1790 Ga0496122_0043813
1791 Ga0496123_0011529
1792 Ga0496124_0000916
1793 Ga0496125_0037259
1794 Ga0496125_0049643
1795 Ga0496126_0027277
1796 Ga0496126_0061185
1797 Ga0496126_0074541
1798 Ga0495682_0000461
1799 Ga0501032_0004059
1800 Ga0501032_0029992
1801 Ga0501034_0004543
1802 Ga0501034_0007053
1803 Ga0501034_0024707
1804 Ga0501034_0034415
1805 Ga0501034_0042654
1806 Ga0501034_0064373
1807 Ga0501034_0345603
1808 Ga0501036_0048707
1809 Ga0501037_0037136
1810 Ga0501037_0060000
1811 Ga0501037_0086784
1812 Ga0501038_0000519
1813 Ga0501038_0023377
1814 Ga0501038_0032192
1815 Ga0501038_0042588
1816 Ga0501038_0115316
1817 Ga0501039_0008129
1818 Ga0501039_0032769
1819 Ga0501039_0111122
1820 Ga0501039_0114707
1821 Ga0501041_0046539
1822 Ga0501041_0078043
1823 Ga0501042_0005467
1824 Ga0501043_0018549
1825 Ga0501043_0024549
1826 Ga0501043_0105242
1827 Ga0501046_0000634
1828 Ga0501047_0000606
1829 Ga0501047_0035823
1830 Ga0501047_0037107
1831 Ga0501047_0092068
1832 Ga0501047_0109858
1833 Ga0501048_0098587
1834 Ga0501067_0068965
1835 Ga0501070_0007354
1836 Ga0501070_0021296
1837 Ga0501070_0022681
1838 Ga0501070_0032161
1839 Ga0501071_0057395
1840 Ga0501071_0061169
1841 Ga0501072_0041180
1842 Ga0501072_0121885
1843 Ga0501073_0090852
1844 Ga0501075_0009946
1845 Ga0501075_0079906
1846 Ga0501075_0113109
1847 Ga0501076_0062477
1848 Ga0501077_0022454
1849 Ga0501079_0023566
1850 Ga0501079_0151071
1851 Ga0501079_0200685
1852 Ga0501080_0005028
1853 Ga0501080_0086079
1854 Ga0501080_0095984
1855 Ga0501083_0025195
1856 Ga0501083_0031467
1857 Ga0501035_0001680
1858 Ga0501044_0000026
1859 Ga0501044_0001604
1860 Ga0501044_0002258
1861 Ga0501044_0026609
1862 Ga0501044_0067006
1863 Ga0501044_0218459
1864 Ga0501045_0056608
1865 nmdc:mga03683_935_c1
1866 nmdc:mga0yw44_12821_c1
1867 nmdc:mga0yw44_52191_c1
1868 nmdc:mga0k408_9674_c1
1869 nmdc:mga06z11_14903_c1
1870 nmdc:mga06z11_19330_c1
1871 nmdc:mga06z11_2106_c1
1872 nmdc:mga04h51_5959_c1
1873 nmdc:mga07m45_13638_c1
1874 nmdc:mga07m45_31619_c1
1875 nmdc:mga05p37_268_c1
1876 nmdc:mga05p37_49281_c1
1877 nmdc:mga05p37_66177_c1
1878 nmdc:mga05p37_9172_c1
1879 nmdc:mga09592_15489_c2
1880 nmdc:mga0qj67_174964_c1
1881 nmdc:mga0qj67_36053_c1
1882 nmdc:mga0qj67_40961_c1
1883 nmdc:mga06r32_101581_c1
1884 nmdc:mga06r32_133_c1
1885 nmdc:mga06r32_36345_c1
1886 nmdc:mga06r32_48054_c1
1887 nmdc:mga06r32_77889_c1
1888 nmdc:mga08y16_21146_c1
1889 nmdc:mga08y16_225678_c1
1890 nmdc:mga08y16_23809_c1
1891 nmdc:mga08y16_35014_c1
1892 nmdc:mga0n895_377967_c1
1893 nmdc:mga0n895_67722_c1
1894 nmdc:mga0rr50_347455_c1
1895 nmdc:mga0a205_206715_c1
1896 nmdc:mga0a205_36529_c1
1897 nmdc:mga0sz30_241_c1
1898 Ga0495601_0001161
1899 Ga0495601_0007136
1900 Ga0495601_0026459
1901 Ga0495601_0073978
1902 Ga0495601_0144890
1903 Ga0495612_0000874
1904 Ga0500635_0016299
1905 Ga0495655_0008066
1906 Ga0495595_0000635
1907 Ga0495595_0048791
1908 Ga0495619_0000208
1909 Ga0495619_0000973
1910 Ga0495619_0007472
1911 Ga0495619_0021670
1912 Ga0495619_0027257
1913 Ga0495619_0030232
1914 Ga0495619_0075297
1915 Ga0495619_0091610
1916 Ga0500643_000077
1917 Ga0500566_0000553
1918 Ga0500640_000648
1919 Ga0500641_0009554
1920 Ga0500650_0050462
1921 Ga0500556_0000030
1922 Ga0500557_000153
1923 Ga0500572_001050
1924 Ga0500595_002396
1925 Ga0500608_083199
1926 Ga0500642_0000380
1927 Ga0500652_014355
1928 Ga0500655_009782
1929 Ga0500573_0054704
1930 Ga0500630_000937
1931 Ga0500639_011959
1932 Ga0500636_0000460
1933 Ga0500636_0021067
1934 Ga0500599_005910
1935 Ga0500601_000174
1936 Ga0501084_0006745
1937 Ga0501082_0000506
1938 Ga0501082_0057509
1939 Ga0466962_0006222
1940 Ga0530510_0064031
1941 2509128095
1942 2511401354
1943 2513622205
1944 2513651826
1945 2513704737
1946 2515629592
1947 2519460935
1948 2585289836
1949 2596374300
1950 2597032475
1951 2599447754
1952 2617348292
1953 2617377433
1954 2643758033
1955 2644737157
1956 2644746868
1957 2757572363
1958 2774874173
1959 2776265242
1960 2817259218
1961 2817276086
1962 2817280373
1963 2817452443
1964 2818241991
1965 2819620050
1966 2824604925
1967 2824615264
1968 2824625580
1969 2824635147
1970 2824643808
1971 2824651120
1972 2824659145
1973 2824686083
1974 2824723146
1975 2824732441
1976 2824739336
1977 2824750226
1978 2824781195
1979 2831867132
1980 2835316516
1981 2838126739
1982 2841764140
1983 2841947660
1984 2841963180
1985 2841982662
1986 2841986868
1987 2842044728
1988 2842053085
1989 2842455146
1990 2842694174
1991 2844108405
1992 2844320881
1993 2847938367
1994 2851185442
1995 2851250575
1996 2857510748
1997 2874115168
1998 2874591831
1999 2874618786
2000 2874626087
2001 2874630851
2002 2874646289
2003 2876765834
2004 2876772102
2005 2876819375
2006 2879078798
2007 2879086047
2008 2879128534
2009 2879143874
2010 2881364263
2011 2881672799
2012 2882457921
2013 2884300153
2014 2885266569
2015 2885317252
2016 2885368085
2017 2888386259
2018 2888426395
2019 2889037104
2020 2900581016
2021 2900640174
2022 2902333219
2023 2903728048
2024 2904485950
2025 2904667561
2026 2906608164
2027 2906610554
2028 2906649264
2029 2908782525
2030 2917702481
2031 2919527314
2032 2922394565
2033 2924716385
2034 2928059580
2035 2928110392
2036 2928138474
2037 2928505464
2038 2932798762
2039 2935693356
2040 2935720855
2041 2935730658
2042 2935740577
2043 2935749949
2044 2935759231
2045 2935914842
2046 2935923267
2047 2935932479
2048 2935941077
2049 2935949030
2050 2935957725
2051 2935974154
2052 2935981448
2053 2940565243
2054 2941536664
2055 2977903452
2056 2996390170
2057 3004235717
2058 3005478913
2059 3005488978
2060 3005507777
2061 3005593973
2062 3005601177
2063 3005716650
2064 642421004
2065 642593833
2066 642617130
2067 8016584039
2068 8016634091
2069 8019585250
2070 8019620820
2071 8019647502
2072 8019669725
2073 8019686370
2074 8019692529
2075 8040167768
2076 8040178490
2077 8055306999
2078 8057533777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07732

Cu-oxidase_3

Multicopper oxidase

104

220

0.95

PF07731

Cu-oxidase_2

Multicopper oxidase

239

362

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vow-assembly1.cif.gz_A crystal structure of multi-copper oxidase from pseudomonas thermotolerans 0.8693 68 304
4e9x-assembly1.cif.gz_B multicopper oxidase mglac (data3) 0.8683 68 307
3g5w-assembly2.cif.gz_F crystal structure of blue copper oxidase from nitrosomonas europaea 0.8579 70 307
4f7k-assembly2.cif.gz_B crystal structure of lac15 from a marine microbial metagenome 0.8574 72 306
5lww-assembly1.cif.gz_A crystal structure of a laccase-like multicopper oxidase mcog from aspergillus niger bound to zinc 0.8552 68 306
ID Description Score Start End Superfamily
4f7kB01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9327 72 183 2.60.40.420
af_Q9VLC3_704_914_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9098 230 307 2.60.40.420
af_I6WZK7_37_181_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9054 66 180 2.60.40.420
af_A0A0B4KF30_585_779_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.899 231 307 2.60.40.420
af_Q9VBK7_98_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8965 68 178 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A0T5NNG4-F1-model_v4 Copper oxidase 0.9753 43 290 GO:0005507
GO:0016491
AF-A0A2N0D8Y6-F1-model_v4 Copper oxidase 0.9721 40 305 GO:0005507
GO:0016491
AF-A0A531LJZ6-F1-model_v4 Copper oxidase 0.9698 42 279 GO:0005507
GO:0016491
AF-A0A1H6CFY7-F1-model_v4 deleted 0.9576 68 169
AF-E9MWA8-F1-model_v4 Laccase 0.9505 123 307 GO:0005507
GO:0016491

Map