F488540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 445 | 989 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10248924|Ga0207674_102489242 |
| Length | 411 |
| Sequence | MSASNLPDSALLRGLTQRRLGRRDALRISGLSALGAALAACGVQGKATPGANLSAAPDVVSKFWTGKAKVGHVDFASWPLYMDPKHPQLKQFTKETGIKVNYDVFDSNEVLQTKLLAGNTGYDVVVPSASFLETQIKAGVFQKLDRSKLPNWKNLDPEILRRLALHDPGNEYAVNHMWGTTSLGYNVKKIKAIDPNAPVDSWNMIFDPKEISKFKSCGVSVLDAPDEVIGIALAYLGRDPNSEKDDDLKAAEDLLMKIRPSIRMIHSSQYIDSLANGDICLSLGWSGDVLQAKSRAEEAKQGVDIALSVPKEGTIIWFDMYAIPADAPHPDNAHAFINYMMRPDVAAANSDFVHYANGNAASLQLIDPAVRNDPGVYPPKETMDKLFPNLAHSPEYTRKMNRVWTRFTTGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 15 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 16 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 17 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 18 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 19 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 20 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 21 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 22 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 23 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 24 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 25 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 26 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 27 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 28 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 29 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 30 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 31 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 32 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 33 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 34 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 35 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 36 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 37 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 38 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 39 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 117 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 154 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 253 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 265 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 270 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 271 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 272 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 273 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 274 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 275 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 276 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 277 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 278 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 279 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 280 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 376 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 377 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 378 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 379 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 380 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 381 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 384 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 387 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 388 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 395 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 396 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 435 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 440 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 443 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 444 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 445 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 0.29 |
| Isolates | 3.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 1.56 |
| Rhizoplane | 4.38 |
| Rhizosphere | 89.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_16 | 2124908027 | Bacteria | 42770 |
| 2 | SwRhRL2b_contig_953756 | 2162886007 | Bacteria | 6740 |
| 3 | LJNas_1001711 | 3300000546 | Bacteria | 2966 |
| 4 | Ga0055530_10012102 | 3300003791 | Bacteria | 3036 |
| 5 | Ga0065714_10000072 | 3300005288 | Bacteria | 12678 |
| 6 | Ga0065714_10005237 | 3300005288 | Bacteria | 5203 |
| 7 | Ga0065714_10066226 | 3300005288 | Bacteria | 7325 |
| 8 | Ga0065714_10067131 | 3300005288 | Bacteria | 5852 |
| 9 | Ga0065714_10075957 | 3300005288 | Bacteria | 2844 |
| 10 | Ga0065704_10000383 | 3300005289 | Bacteria | 25333 |
| 11 | Ga0065712_10008655 | 3300005290 | Bacteria | 3770 |
| 12 | Ga0065712_10070719 | 3300005290 | Bacteria | 5763 |
| 13 | Ga0065712_10097359 | 3300005290 | Bacteria | 2153 |
| 14 | Ga0065715_10005206 | 3300005293 | Bacteria | 4027 |
| 15 | Ga0065715_10179943 | 3300005293 | Bacteria | 1484 |
| 16 | Ga0065707_10086325 | 3300005295 | Bacteria | 5532 |
| 17 | Ga0065707_10171212 | 3300005295 | Unclassified | 1467 |
| 18 | Ga0070676_10016552 | 3300005328 | Bacteria | 4078 |
| 19 | Ga0070676_10026332 | 3300005328 | Bacteria | 3292 |
| 20 | Ga0070676_10080007 | 3300005328 | Bacteria | 1980 |
| 21 | Ga0070683_100058980 | 3300005329 | Bacteria | 3566 |
| 22 | Ga0070690_100003222 | 3300005330 | Bacteria | 8903 |
| 23 | Ga0070690_100004347 | 3300005330 | Bacteria | 7857 |
| 24 | Ga0070690_100057243 | 3300005330 | Bacteria | 2501 |
| 25 | Ga0070670_100156086 | 3300005331 | Bacteria | 1976 |
| 26 | Ga0068869_100012109 | 3300005334 | Bacteria | 5686 |
| 27 | Ga0070666_10000962 | 3300005335 | Bacteria | 17567 |
| 28 | Ga0070666_10011348 | 3300005335 | Bacteria | 5590 |
| 29 | Ga0070666_10121936 | 3300005335 | Bacteria | 1808 |
| 30 | Ga0070680_100013082 | 3300005336 | Bacteria | 6459 |
| 31 | Ga0070680_100035452 | 3300005336 | Bacteria | 4028 |
| 32 | Ga0070680_100083582 | 3300005336 | Bacteria | 2636 |
| 33 | Ga0068868_100004028 | 3300005338 | Bacteria | 10248 |
| 34 | Ga0068868_100049291 | 3300005338 | Bacteria | 3305 |
| 35 | Ga0070689_100003911 | 3300005340 | Bacteria | 9982 |
| 36 | Ga0070687_100009013 | 3300005343 | Bacteria | 4255 |
| 37 | Ga0070687_100049552 | 3300005343 | Bacteria | 2165 |
| 38 | Ga0070661_100006248 | 3300005344 | Bacteria | 8219 |
| 39 | Ga0070668_100278649 | 3300005347 | Bacteria | 1396 |
| 40 | Ga0070669_100005076 | 3300005353 | Bacteria | 9515 |
| 41 | Ga0070669_100013419 | 3300005353 | Bacteria | 5826 |
| 42 | Ga0070669_100056750 | 3300005353 | Bacteria | 2871 |
| 43 | Ga0070669_100076753 | 3300005353 | Bacteria | 2481 |
| 44 | Ga0070675_100001269 | 3300005354 | Bacteria | 18440 |
| 45 | Ga0070675_100182374 | 3300005354 | Bacteria | 1815 |
| 46 | Ga0070671_100001534 | 3300005355 | Bacteria | 17343 |
| 47 | Ga0070674_100009909 | 3300005356 | Bacteria | 5735 |
| 48 | Ga0070673_100082082 | 3300005364 | Bacteria | 2616 |
| 49 | Ga0070673_100170866 | 3300005364 | Bacteria | 1855 |
| 50 | Ga0070688_100032026 | 3300005365 | Bacteria | 3167 |
| 51 | Ga0070659_100158956 | 3300005366 | Bacteria | 1847 |
| 52 | Ga0070667_100003021 | 3300005367 | Bacteria | 14456 |
| 53 | Ga0070667_100114387 | 3300005367 | Bacteria | 2343 |
| 54 | Ga0070709_10007519 | 3300005434 | Bacteria | 5977 |
| 55 | Ga0070709_10035426 | 3300005434 | Bacteria | 3033 |
| 56 | Ga0070714_100006553 | 3300005435 | Bacteria | 9004 |
| 57 | Ga0070714_100098538 | 3300005435 | Bacteria | 2572 |
| 58 | Ga0070713_100012067 | 3300005436 | Bacteria | 6326 |
| 59 | Ga0070713_100056713 | 3300005436 | Bacteria | 3258 |
| 60 | Ga0070713_100136448 | 3300005436 | Bacteria | 2168 |
| 61 | Ga0070713_100194413 | 3300005436 | Bacteria | 1829 |
| 62 | Ga0070711_100002860 | 3300005439 | Bacteria | 9931 |
| 63 | Ga0070711_100079964 | 3300005439 | Bacteria | 2326 |
| 64 | Ga0070711_100182802 | 3300005439 | Bacteria | 1606 |
| 65 | Ga0070694_100226894 | 3300005444 | Bacteria | 1404 |
| 66 | Ga0070678_100001008 | 3300005456 | Bacteria | 14634 |
| 67 | Ga0070662_100003902 | 3300005457 | Bacteria | 9349 |
| 68 | Ga0070662_100014075 | 3300005457 | Bacteria | 5335 |
| 69 | Ga0070662_100017390 | 3300005457 | Bacteria | 4848 |
| 70 | Ga0070662_100028108 | 3300005457 | Bacteria | 3911 |
| 71 | Ga0070681_10001577 | 3300005458 | Bacteria | 20233 |
| 72 | Ga0070681_10001582 | 3300005458 | Bacteria | 20207 |
| 73 | Ga0070681_10022982 | 3300005458 | Bacteria | 6267 |
| 74 | Ga0070681_10024376 | 3300005458 | Bacteria | 6090 |
| 75 | Ga0070681_10104148 | 3300005458 | Bacteria | 2780 |
| 76 | Ga0068867_100022954 | 3300005459 | Bacteria | 4464 |
| 77 | Ga0068867_100027329 | 3300005459 | Bacteria | 4099 |
| 78 | Ga0070698_100092786 | 3300005471 | Bacteria | 3000 |
| 79 | Ga0070699_100023197 | 3300005518 | Bacteria | 5347 |
| 80 | Ga0070699_100245641 | 3300005518 | Bacteria | 1599 |
| 81 | Ga0070679_100000469 | 3300005530 | Bacteria | 34407 |
| 82 | Ga0070679_100025516 | 3300005530 | Bacteria | 5801 |
| 83 | Ga0070679_100034185 | 3300005530 | Bacteria | 5037 |
| 84 | Ga0070679_100133096 | 3300005530 | Bacteria | 2467 |
| 85 | Ga0070684_100000389 | 3300005535 | Bacteria | 30433 |
| 86 | Ga0068853_100235807 | 3300005539 | Bacteria | 1675 |
| 87 | Ga0070672_100004629 | 3300005543 | Bacteria | 9012 |
| 88 | Ga0070672_100011940 | 3300005543 | Bacteria | 6072 |
| 89 | Ga0070672_100047307 | 3300005543 | Bacteria | 3337 |
| 90 | Ga0070672_100291995 | 3300005543 | Bacteria | 1380 |
| 91 | Ga0070695_100001122 | 3300005545 | Bacteria | 14667 |
| 92 | Ga0070696_100000233 | 3300005546 | Bacteria | 33711 |
| 93 | Ga0070696_100059238 | 3300005546 | Bacteria | 2676 |
| 94 | Ga0070696_100069992 | 3300005546 | Bacteria | 2467 |
| 95 | Ga0070693_100066758 | 3300005547 | Bacteria | 2106 |
| 96 | Ga0070665_100002122 | 3300005548 | Bacteria | 22146 |
| 97 | Ga0070665_100006304 | 3300005548 | Bacteria | 12110 |
| 98 | Ga0070665_100027331 | 3300005548 | Bacteria | 5747 |
| 99 | Ga0070665_100077491 | 3300005548 | Bacteria | 3331 |
| 100 | Ga0070704_100007227 | 3300005549 | Bacteria | 6604 |
| 101 | Ga0068855_100001482 | 3300005563 | Bacteria | 29366 |
| 102 | Ga0068855_100001944 | 3300005563 | Bacteria | 25660 |
| 103 | Ga0068855_100020801 | 3300005563 | Bacteria | 7868 |
| 104 | Ga0068855_100032489 | 3300005563 | Bacteria | 6231 |
| 105 | Ga0070664_100002633 | 3300005564 | Bacteria | 14471 |
| 106 | Ga0068857_100013260 | 3300005577 | Bacteria | 7179 |
| 107 | Ga0068857_100091965 | 3300005577 | Bacteria | 2716 |
| 108 | Ga0068854_100276653 | 3300005578 | Bacteria | 1350 |
| 109 | Ga0068856_100008652 | 3300005614 | Bacteria | 9902 |
| 110 | Ga0070702_100034486 | 3300005615 | Bacteria | 2790 |
| 111 | Ga0068859_100008619 | 3300005617 | Bacteria | 10304 |
| 112 | Ga0068859_100043274 | 3300005617 | Bacteria | 4526 |
| 113 | Ga0068859_100109922 | 3300005617 | Bacteria | 2818 |
| 114 | Ga0068864_100004892 | 3300005618 | Bacteria | 10973 |
| 115 | Ga0068866_10008386 | 3300005718 | Bacteria | 4354 |
| 116 | Ga0068861_100014206 | 3300005719 | Bacteria | 5586 |
| 117 | Ga0068861_100023752 | 3300005719 | Bacteria | 4426 |
| 118 | Ga0068861_100084466 | 3300005719 | Bacteria | 2492 |
| 119 | Ga0068861_100111892 | 3300005719 | Bacteria | 2189 |
| 120 | Ga0068861_100318503 | 3300005719 | Bacteria | 1354 |
| 121 | Ga0068870_10088817 | 3300005840 | Bacteria | 1724 |
| 122 | Ga0068863_100005440 | 3300005841 | Bacteria | 12546 |
| 123 | Ga0068863_100011401 | 3300005841 | Bacteria | 8601 |
| 124 | Ga0068858_100012168 | 3300005842 | Bacteria | 8112 |
| 125 | Ga0068858_100019147 | 3300005842 | Bacteria | 6404 |
| 126 | Ga0068858_100326704 | 3300005842 | Bacteria | 1467 |
| 127 | Ga0068858_100391105 | 3300005842 | Bacteria | 1335 |
| 128 | Ga0068860_100004196 | 3300005843 | Bacteria | 14770 |
| 129 | Ga0068860_100007155 | 3300005843 | Bacteria | 11163 |
| 130 | Ga0068860_100021474 | 3300005843 | Bacteria | 6251 |
| 131 | Ga0068862_100004849 | 3300005844 | Bacteria | 11328 |
| 132 | Ga0068862_100042263 | 3300005844 | Bacteria | 3882 |
| 133 | Ga0070717_10296058 | 3300006028 | Bacteria | 1438 |
| 134 | Ga0075364_10000792 | 3300006051 | Bacteria | 16666 |
| 135 | Ga0075432_10002709 | 3300006058 | Bacteria | 5924 |
| 136 | Ga0075432_10004298 | 3300006058 | Bacteria | 4850 |
| 137 | Ga0070715_10003057 | 3300006163 | Bacteria | 5248 |
| 138 | Ga0070716_100000449 | 3300006173 | Bacteria | 17023 |
| 139 | Ga0070716_100042537 | 3300006173 | Bacteria | 2536 |
| 140 | Ga0070712_100007685 | 3300006175 | Bacteria | 6742 |
| 141 | Ga0070712_100159298 | 3300006175 | Bacteria | 1741 |
| 142 | Ga0070712_100216295 | 3300006175 | Bacteria | 1514 |
| 143 | Ga0075362_10007547 | 3300006177 | Bacteria | 4125 |
| 144 | Ga0097621_100031096 | 3300006237 | Bacteria | 4233 |
| 145 | Ga0097621_100091567 | 3300006237 | Bacteria | 2545 |
| 146 | Ga0068871_100058698 | 3300006358 | Bacteria | 3133 |
| 147 | Ga0068871_100186058 | 3300006358 | Bacteria | 1787 |
| 148 | Ga0068871_100203953 | 3300006358 | Bacteria | 1708 |
| 149 | Ga0068871_100321155 | 3300006358 | Bacteria | 1363 |
| 150 | Ga0075428_100010582 | 3300006844 | Bacteria | 10252 |
| 151 | Ga0075428_100068346 | 3300006844 | Bacteria | 3886 |
| 152 | Ga0075428_100116803 | 3300006844 | Bacteria | 2906 |
| 153 | Ga0075428_100151919 | 3300006844 | Bacteria | 2515 |
| 154 | Ga0075430_100007468 | 3300006846 | Bacteria | 9227 |
| 155 | Ga0075430_100031773 | 3300006846 | Bacteria | 4481 |
| 156 | Ga0075430_100053905 | 3300006846 | Bacteria | 3385 |
| 157 | Ga0075431_100007866 | 3300006847 | Bacteria | 10627 |
| 158 | Ga0075431_100009924 | 3300006847 | Bacteria | 9565 |
| 159 | Ga0075431_100081783 | 3300006847 | Bacteria | 3335 |
| 160 | Ga0075431_100335748 | 3300006847 | Bacteria | 1521 |
| 161 | Ga0075429_100034978 | 3300006880 | Bacteria | 4366 |
| 162 | Ga0075429_100044334 | 3300006880 | Bacteria | 3870 |
| 163 | Ga0068865_100000735 | 3300006881 | Bacteria | 18419 |
| 164 | Ga0097620_100008619 | 3300006931 | Bacteria | 10304 |
| 165 | Ga0097620_100043275 | 3300006931 | Bacteria | 4526 |
| 166 | Ga0097620_100109919 | 3300006931 | Bacteria | 2818 |
| 167 | Ga0079104_1000068 | 3300006946 | Bacteria | 154984 |
| 168 | Ga0099826_10083695 | 3300006948 | Bacteria | 1977 |
| 169 | Ga0075435_100010333 | 3300007076 | Bacteria | 6823 |
| 170 | Ga0099794_10059459 | 3300007265 | Bacteria | 1854 |
| 171 | Ga0099795_10000022 | 3300007788 | Bacteria | 52585 |
| 172 | Ga0105251_10009643 | 3300009011 | Bacteria | 5682 |
| 173 | Ga0105244_10006047 | 3300009036 | Bacteria | 7930 |
| 174 | Ga0105244_10030412 | 3300009036 | Bacteria | 2874 |
| 175 | Ga0105250_10006223 | 3300009092 | Bacteria | 5239 |
| 176 | Ga0105250_10061266 | 3300009092 | Bacteria | 1513 |
| 177 | Ga0105250_10061724 | 3300009092 | Bacteria | 1507 |
| 178 | Ga0105240_10002127 | 3300009093 | Bacteria | 32338 |
| 179 | Ga0105240_10002705 | 3300009093 | Bacteria | 28172 |
| 180 | Ga0105240_10003826 | 3300009093 | Bacteria | 23268 |
| 181 | Ga0105240_10024889 | 3300009093 | Bacteria | 7880 |
| 182 | Ga0105240_10032775 | 3300009093 | Bacteria | 6721 |
| 183 | Ga0105240_10130983 | 3300009093 | Bacteria | 3008 |
| 184 | Ga0105240_10328419 | 3300009093 | Bacteria | 1741 |
| 185 | Ga0111539_10033108 | 3300009094 | Bacteria | 6275 |
| 186 | Ga0111539_10076554 | 3300009094 | Bacteria | 3939 |
| 187 | Ga0111539_10077583 | 3300009094 | Bacteria | 3910 |
| 188 | Ga0111539_10201499 | 3300009094 | Bacteria | 2321 |
| 189 | Ga0111539_10267558 | 3300009094 | Bacteria | 1990 |
| 190 | Ga0111539_10564067 | 3300009094 | Bacteria | 1326 |
| 191 | Ga0105245_10007920 | 3300009098 | Bacteria | 9291 |
| 192 | Ga0105245_10023209 | 3300009098 | Bacteria | 5445 |
| 193 | Ga0105247_10012409 | 3300009101 | Bacteria | 5117 |
| 194 | Ga0105247_10111901 | 3300009101 | Bacteria | 1758 |
| 195 | Ga0105247_10121127 | 3300009101 | Bacteria | 1695 |
| 196 | Ga0114129_10000367 | 3300009147 | Bacteria | 52338 |
| 197 | Ga0114129_10087255 | 3300009147 | Bacteria | 4327 |
| 198 | Ga0114129_10447332 | 3300009147 | Bacteria | 1695 |
| 199 | Ga0105243_10027562 | 3300009148 | Bacteria | 4353 |
| 200 | Ga0105243_10041735 | 3300009148 | Bacteria | 3588 |
| 201 | Ga0105241_10007997 | 3300009174 | Bacteria | 7778 |
| 202 | Ga0105242_10005298 | 3300009176 | Bacteria | 9957 |
| 203 | Ga0105242_10082584 | 3300009176 | Bacteria | 2689 |
| 204 | Ga0105242_10321662 | 3300009176 | Bacteria | 1419 |
| 205 | Ga0105248_10001404 | 3300009177 | Bacteria | 26898 |
| 206 | Ga0105248_10005489 | 3300009177 | Bacteria | 13923 |
| 207 | Ga0105237_10008371 | 3300009545 | Bacteria | 11215 |
| 208 | Ga0105237_10127911 | 3300009545 | Bacteria | 2534 |
| 209 | Ga0105238_10005376 | 3300009551 | Bacteria | 12659 |
| 210 | Ga0105238_10006381 | 3300009551 | Bacteria | 11732 |
| 211 | Ga0105238_10161450 | 3300009551 | Bacteria | 2216 |
| 212 | Ga0105249_10184405 | 3300009553 | Bacteria | 2033 |
| 213 | Ga0099796_10000025 | 3300010159 | Bacteria | 37858 |
| 214 | Ga0105239_10005723 | 3300010375 | Bacteria | 14518 |
| 215 | Ga0105239_10052494 | 3300010375 | Bacteria | 4471 |
| 216 | Ga0105239_10216510 | 3300010375 | Bacteria | 2147 |
| 217 | Ga0105246_10006341 | 3300011119 | Bacteria | 7222 |
| 218 | Ga0157370_10001472 | 3300013104 | Bacteria | 29117 |
| 219 | Ga0157369_10065057 | 3300013105 | Bacteria | 3926 |
| 220 | Ga0157369_10297375 | 3300013105 | Bacteria | 1680 |
| 221 | Ga0157374_10007656 | 3300013296 | Bacteria | 9220 |
| 222 | Ga0157374_10014556 | 3300013296 | Bacteria | 6885 |
| 223 | Ga0157374_10156555 | 3300013296 | Bacteria | 2218 |
| 224 | Ga0157374_10308818 | 3300013296 | Bacteria | 1565 |
| 225 | Ga0157374_10376833 | 3300013296 | Bacteria | 1413 |
| 226 | Ga0157378_10004873 | 3300013297 | Bacteria | 11772 |
| 227 | Ga0157378_10122887 | 3300013297 | Bacteria | 2395 |
| 228 | Ga0157378_10152685 | 3300013297 | Bacteria | 2153 |
| 229 | Ga0163162_10020035 | 3300013306 | Bacteria | 6569 |
| 230 | Ga0163162_10067923 | 3300013306 | Bacteria | 3616 |
| 231 | Ga0163162_10111624 | 3300013306 | Bacteria | 2832 |
| 232 | Ga0163162_10126118 | 3300013306 | Bacteria | 2666 |
| 233 | Ga0157375_10010708 | 3300013308 | Bacteria | 8080 |
| 234 | Ga0157375_10018198 | 3300013308 | Bacteria | 6367 |
| 235 | Ga0157375_10039263 | 3300013308 | Bacteria | 4555 |
| 236 | Ga0157375_10087488 | 3300013308 | Bacteria | 3168 |
| 237 | Ga0163163_10000485 | 3300014325 | Bacteria | 35984 |
| 238 | Ga0163163_10025005 | 3300014325 | Bacteria | 5688 |
| 239 | Ga0163163_10101260 | 3300014325 | Bacteria | 2903 |
| 240 | Ga0163163_10109176 | 3300014325 | Bacteria | 2794 |
| 241 | Ga0163163_10259556 | 3300014325 | Bacteria | 1788 |
| 242 | Ga0157380_10025900 | 3300014326 | Bacteria | 4450 |
| 243 | Ga0157380_10031338 | 3300014326 | Bacteria | 4081 |
| 244 | Ga0157380_10137624 | 3300014326 | Unclassified | 2093 |
| 245 | Ga0182008_10000655 | 3300014497 | Bacteria | 25237 |
| 246 | Ga0157377_10040514 | 3300014745 | Bacteria | 2580 |
| 247 | Ga0157377_10106531 | 3300014745 | Bacteria | 1679 |
| 248 | Ga0157379_10006630 | 3300014968 | Bacteria | 9989 |
| 249 | Ga0157379_10009851 | 3300014968 | Bacteria | 8327 |
| 250 | Ga0157379_10060155 | 3300014968 | Bacteria | 3396 |
| 251 | Ga0157379_10160111 | 3300014968 | Bacteria | 2032 |
| 252 | Ga0157376_10014926 | 3300014969 | Bacteria | 5852 |
| 253 | Ga0157376_10129844 | 3300014969 | Bacteria | 2247 |
| 254 | Ga0157376_10296935 | 3300014969 | Bacteria | 1528 |
| 255 | Ga0182005_1001019 | 3300015265 | Bacteria | 11956 |
| 256 | Ga0182005_1001549 | 3300015265 | Bacteria | 9106 |
| 257 | Ga0182005_1005470 | 3300015265 | Bacteria | 3964 |
| 258 | Ga0182005_1006564 | 3300015265 | Bacteria | 3540 |
| 259 | Ga0163161_10000986 | 3300017792 | Bacteria | 21775 |
| 260 | Ga0163161_10012623 | 3300017792 | Bacteria | 5869 |
| 261 | Ga0163161_10036963 | 3300017792 | Bacteria | 3499 |
| 262 | Ga0163161_10072485 | 3300017792 | Bacteria | 2522 |
| 263 | Ga0163161_10081043 | 3300017792 | Bacteria | 2389 |
| 264 | Ga0213874_10025026 | 3300021377 | Bacteria | 1680 |
| 265 | Ga0213871_10024524 | 3300021441 | Bacteria | 1528 |
| 266 | Ga0209676_1003062 | 3300025292 | Bacteria | 10785 |
| 267 | Ga0209050_1000229 | 3300025298 | Bacteria | 123110 |
| 268 | Ga0207696_1001869 | 3300025711 | Bacteria | 10797 |
| 269 | Ga0207696_1005521 | 3300025711 | Bacteria | 5233 |
| 270 | Ga0207655_1002567 | 3300025728 | Bacteria | 14523 |
| 271 | Ga0207655_1035489 | 3300025728 | Bacteria | 2225 |
| 272 | Ga0207713_1007553 | 3300025735 | Bacteria | 6388 |
| 273 | Ga0207713_1007696 | 3300025735 | Bacteria | 6300 |
| 274 | Ga0207713_1007941 | 3300025735 | Bacteria | 6182 |
| 275 | Ga0207692_10069265 | 3300025898 | Bacteria | 1853 |
| 276 | Ga0207642_10012317 | 3300025899 | Bacteria | 3084 |
| 277 | Ga0207688_10003915 | 3300025901 | Bacteria | 8118 |
| 278 | Ga0207680_10020513 | 3300025903 | Bacteria | 3559 |
| 279 | Ga0207699_10009239 | 3300025906 | Bacteria | 4899 |
| 280 | Ga0207699_10019729 | 3300025906 | Bacteria | 3601 |
| 281 | Ga0207699_10047568 | 3300025906 | Bacteria | 2516 |
| 282 | Ga0207645_10001223 | 3300025907 | Bacteria | 21174 |
| 283 | Ga0207645_10008199 | 3300025907 | Bacteria | 7310 |
| 284 | Ga0207645_10020611 | 3300025907 | Bacteria | 4312 |
| 285 | Ga0207645_10031001 | 3300025907 | Bacteria | 3444 |
| 286 | Ga0207643_10015755 | 3300025908 | Bacteria | 4117 |
| 287 | Ga0207643_10054417 | 3300025908 | Bacteria | 2275 |
| 288 | Ga0207654_10059460 | 3300025911 | Bacteria | 2229 |
| 289 | Ga0207707_10000122 | 3300025912 | Bacteria | 80159 |
| 290 | Ga0207707_10010048 | 3300025912 | Bacteria | 8208 |
| 291 | Ga0207707_10026203 | 3300025912 | Bacteria | 5096 |
| 292 | Ga0207707_10036563 | 3300025912 | Bacteria | 4292 |
| 293 | Ga0207707_10051542 | 3300025912 | Bacteria | 3584 |
| 294 | Ga0207695_10003540 | 3300025913 | Bacteria | 21874 |
| 295 | Ga0207695_10009529 | 3300025913 | Bacteria | 12008 |
| 296 | Ga0207695_10024867 | 3300025913 | Bacteria | 6721 |
| 297 | Ga0207695_10076336 | 3300025913 | Bacteria | 3406 |
| 298 | Ga0207695_10224006 | 3300025913 | Bacteria | 1787 |
| 299 | Ga0207695_10282383 | 3300025913 | Bacteria | 1554 |
| 300 | Ga0207671_10023246 | 3300025914 | Bacteria | 4676 |
| 301 | Ga0207671_10150432 | 3300025914 | Bacteria | 1798 |
| 302 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 303 | Ga0207693_10018817 | 3300025915 | Bacteria | 5496 |
| 304 | Ga0207693_10067420 | 3300025915 | Bacteria | 2802 |
| 305 | Ga0207663_10014494 | 3300025916 | Bacteria | 4317 |
| 306 | Ga0207663_10068245 | 3300025916 | Bacteria | 2283 |
| 307 | Ga0207663_10103380 | 3300025916 | Bacteria | 1918 |
| 308 | Ga0207660_10004896 | 3300025917 | Bacteria | 8723 |
| 309 | Ga0207660_10125130 | 3300025917 | Bacteria | 1951 |
| 310 | Ga0207662_10017279 | 3300025918 | Bacteria | 4079 |
| 311 | Ga0207662_10049888 | 3300025918 | Bacteria | 2484 |
| 312 | Ga0207649_10015857 | 3300025920 | Bacteria | 4237 |
| 313 | Ga0207652_10000613 | 3300025921 | Bacteria | 35518 |
| 314 | Ga0207652_10054368 | 3300025921 | Bacteria | 3442 |
| 315 | Ga0207681_10023771 | 3300025923 | Bacteria | 3924 |
| 316 | Ga0207681_10035475 | 3300025923 | Bacteria | 3286 |
| 317 | Ga0207681_10115901 | 3300025923 | Bacteria | 1956 |
| 318 | Ga0207694_10003403 | 3300025924 | Bacteria | 12669 |
| 319 | Ga0207650_10151323 | 3300025925 | Bacteria | 1831 |
| 320 | Ga0207700_10019447 | 3300025928 | Bacteria | 4588 |
| 321 | Ga0207664_10002133 | 3300025929 | Bacteria | 13018 |
| 322 | Ga0207664_10092412 | 3300025929 | Bacteria | 2483 |
| 323 | Ga0207644_10054804 | 3300025931 | Bacteria | 2872 |
| 324 | Ga0207706_10004326 | 3300025933 | Bacteria | 13333 |
| 325 | Ga0207706_10011127 | 3300025933 | Bacteria | 8199 |
| 326 | Ga0207706_10022865 | 3300025933 | Bacteria | 5610 |
| 327 | Ga0207706_10049227 | 3300025933 | Bacteria | 3725 |
| 328 | Ga0207706_10123377 | 3300025933 | Bacteria | 2279 |
| 329 | Ga0207686_10012915 | 3300025934 | Bacteria | 4606 |
| 330 | Ga0207709_10100092 | 3300025935 | Bacteria | 1914 |
| 331 | Ga0207670_10018344 | 3300025936 | Bacteria | 4252 |
| 332 | Ga0207704_10004318 | 3300025938 | Bacteria | 6496 |
| 333 | Ga0207704_10026508 | 3300025938 | Bacteria | 3181 |
| 334 | Ga0207665_10000587 | 3300025939 | Bacteria | 24539 |
| 335 | Ga0207691_10001448 | 3300025940 | Bacteria | 23639 |
| 336 | Ga0207691_10003491 | 3300025940 | Bacteria | 15299 |
| 337 | Ga0207691_10025122 | 3300025940 | Bacteria | 5596 |
| 338 | Ga0207691_10063046 | 3300025940 | Bacteria | 3362 |
| 339 | Ga0207691_10089162 | 3300025940 | Bacteria | 2766 |
| 340 | Ga0207711_10010034 | 3300025941 | Bacteria | 7872 |
| 341 | Ga0207711_10069829 | 3300025941 | Bacteria | 3046 |
| 342 | Ga0207689_10002923 | 3300025942 | Bacteria | 15774 |
| 343 | Ga0207689_10119325 | 3300025942 | Bacteria | 2170 |
| 344 | Ga0207679_10004598 | 3300025945 | Bacteria | 8586 |
| 345 | Ga0207667_10000798 | 3300025949 | Bacteria | 40876 |
| 346 | Ga0207667_10004634 | 3300025949 | Bacteria | 16866 |
| 347 | Ga0207667_10010115 | 3300025949 | Bacteria | 11052 |
| 348 | Ga0207667_10045147 | 3300025949 | Bacteria | 4668 |
| 349 | Ga0207651_10065531 | 3300025960 | Bacteria | 2548 |
| 350 | Ga0207712_10135138 | 3300025961 | Bacteria | 1885 |
| 351 | Ga0207668_10018342 | 3300025972 | Bacteria | 4401 |
| 352 | Ga0207658_10015483 | 3300025986 | Bacteria | 5231 |
| 353 | Ga0207658_10033045 | 3300025986 | Bacteria | 3687 |
| 354 | Ga0207658_10102880 | 3300025986 | Bacteria | 2241 |
| 355 | Ga0207677_10011599 | 3300026023 | Bacteria | 5032 |
| 356 | Ga0207703_10013397 | 3300026035 | Bacteria | 6391 |
| 357 | Ga0207703_10020264 | 3300026035 | Bacteria | 5200 |
| 358 | Ga0207703_10034034 | 3300026035 | Bacteria | 4041 |
| 359 | Ga0207639_10187658 | 3300026041 | Bacteria | 1764 |
| 360 | Ga0207702_10014159 | 3300026078 | Bacteria | 6624 |
| 361 | Ga0207702_10050952 | 3300026078 | Bacteria | 3497 |
| 362 | Ga0207641_10010458 | 3300026088 | Bacteria | 7625 |
| 363 | Ga0207641_10013892 | 3300026088 | Bacteria | 6604 |
| 364 | Ga0207641_10107192 | 3300026088 | Bacteria | 2471 |
| 365 | Ga0207648_10003080 | 3300026089 | Bacteria | 17612 |
| 366 | Ga0207648_10017129 | 3300026089 | Bacteria | 6604 |
| 367 | Ga0207648_10031254 | 3300026089 | Bacteria | 4707 |
| 368 | Ga0207676_10000965 | 3300026095 | Bacteria | 22224 |
| 369 | Ga0207676_10162691 | 3300026095 | Bacteria | 1935 |
| 370 | Ga0207674_10019239 | 3300026116 | Bacteria | 7402 |
| 371 | Ga0207674_10038183 | 3300026116 | Bacteria | 4989 |
| 372 | Ga0207674_10106883 | 3300026116 | Bacteria | 2775 |
| 373 | Ga0207674_10123226 | 3300026116 | Bacteria | 2558 |
| 374 | Ga0207674_10248924 | 3300026116 | Bacteria | 1724 |
| 375 | Ga0207675_100011407 | 3300026118 | Bacteria | 8317 |
| 376 | Ga0207675_100021455 | 3300026118 | Bacteria | 6016 |
| 377 | Ga0207675_100021604 | 3300026118 | Bacteria | 5994 |
| 378 | Ga0207675_100025193 | 3300026118 | Bacteria | 5536 |
| 379 | Ga0207675_100044724 | 3300026118 | Bacteria | 4138 |
| 380 | Ga0207675_100120239 | 3300026118 | Bacteria | 2485 |
| 381 | Ga0207683_10004897 | 3300026121 | Bacteria | 11526 |
| 382 | Ga0207683_10015951 | 3300026121 | Bacteria | 6394 |
| 383 | Ga0209281_1000168 | 3300027111 | Bacteria | 155116 |
| 384 | Ga0209179_1000130 | 3300027512 | Bacteria | 8124 |
| 385 | Ga0209968_1002478 | 3300027526 | Bacteria | 2791 |
| 386 | Ga0210002_1000931 | 3300027617 | Bacteria | 4034 |
| 387 | Ga0209983_1003838 | 3300027665 | Bacteria | 3184 |
| 388 | Ga0209971_1001319 | 3300027682 | Bacteria | 6164 |
| 389 | Ga0209966_1008616 | 3300027695 | Bacteria | 1813 |
| 390 | Ga0209998_10003556 | 3300027717 | Bacteria | 3396 |
| 391 | Ga0209974_10000854 | 3300027876 | Bacteria | 10513 |
| 392 | Ga0209974_10000908 | 3300027876 | Bacteria | 10305 |
| 393 | Ga0209974_10015078 | 3300027876 | Bacteria | 2566 |
| 394 | Ga0207428_10007665 | 3300027907 | Bacteria | 9826 |
| 395 | Ga0207428_10031774 | 3300027907 | Bacteria | 4350 |
| 396 | Ga0207428_10037263 | 3300027907 | Bacteria | 3958 |
| 397 | Ga0207428_10054420 | 3300027907 | Bacteria | 3188 |
| 398 | Ga0207428_10175028 | 3300027907 | Bacteria | 1624 |
| 399 | Ga0265356_1002354 | 3300028017 | Bacteria | 2543 |
| 400 | Ga0268266_10001602 | 3300028379 | Bacteria | 26388 |
| 401 | Ga0268266_10078755 | 3300028379 | Bacteria | 2868 |
| 402 | Ga0268265_10004447 | 3300028380 | Bacteria | 9730 |
| 403 | Ga0268265_10010052 | 3300028380 | Bacteria | 6389 |
| 404 | Ga0268265_10027069 | 3300028380 | Bacteria | 4087 |
| 405 | Ga0268265_10081988 | 3300028380 | Bacteria | 2549 |
| 406 | Ga0268264_10008436 | 3300028381 | Bacteria | 8568 |
| 407 | Ga0265326_10003138 | 3300028558 | Bacteria | 5468 |
| 408 | Ga0265319_1034522 | 3300028563 | Bacteria | 1739 |
| 409 | Ga0265334_10010215 | 3300028573 | Bacteria | 3960 |
| 410 | Ga0265318_10001836 | 3300028577 | Bacteria | 12018 |
| 411 | Ga0265338_10027362 | 3300028800 | Bacteria | 5722 |
| 412 | Ga0265770_1000007 | 3300030878 | Bacteria | 20558 |
| 413 | Ga0265771_1000279 | 3300031010 | Bacteria | 1680 |
| 414 | Ga0265330_10004483 | 3300031235 | Bacteria | 7083 |
| 415 | Ga0265332_10003174 | 3300031238 | Bacteria | 8001 |
| 416 | Ga0265328_10001169 | 3300031239 | Bacteria | 12122 |
| 417 | Ga0265328_10001255 | 3300031239 | Bacteria | 11736 |
| 418 | Ga0265325_10014663 | 3300031241 | Bacteria | 4422 |
| 419 | Ga0265329_10002693 | 3300031242 | Bacteria | 7987 |
| 420 | Ga0265340_10031574 | 3300031247 | Bacteria | 2648 |
| 421 | Ga0265316_10087366 | 3300031344 | Bacteria | 2382 |
| 422 | Ga0307513_10300521 | 3300031456 | Bacteria | 1372 |
| 423 | Ga0307509_10002372 | 3300031507 | Bacteria | 30641 |
| 424 | Ga0307408_100167094 | 3300031548 | Bacteria | 1753 |
| 425 | Ga0316579_10006989 | 3300031691 | Bacteria | 4637 |
| 426 | Ga0265314_10005988 | 3300031711 | Bacteria | 10844 |
| 427 | Ga0316576_10016733 | 3300031727 | Bacteria | 4964 |
| 428 | Ga0316578_10032798 | 3300031728 | Bacteria | 2970 |
| 429 | Ga0307516_10003963 | 3300031730 | Bacteria | 18595 |
| 430 | Ga0316577_10012050 | 3300031733 | Bacteria | 4700 |
| 431 | Ga0307406_10054867 | 3300031901 | Bacteria | 2545 |
| 432 | Ga0307407_10026194 | 3300031903 | Bacteria | 3085 |
| 433 | Ga0307412_10083076 | 3300031911 | Bacteria | 2219 |
| 434 | Ga0307409_100002517 | 3300031995 | Bacteria | 9603 |
| 435 | Ga0307416_100022288 | 3300032002 | Bacteria | 4569 |
| 436 | Ga0307416_100373857 | 3300032002 | Bacteria | 1452 |
| 437 | Ga0307415_100040526 | 3300032126 | Bacteria | 3086 |
| 438 | Ga0307415_100125851 | 3300032126 | Bacteria | 1931 |
| 439 | Ga0316583_10043007 | 3300032133 | Bacteria | 1596 |
| 440 | Ga0316585_10009072 | 3300032137 | Bacteria | 2894 |
| 441 | Ga0316585_10026871 | 3300032137 | Bacteria | 1793 |
| 442 | Ga0316588_1029669 | 3300033528 | Bacteria | 1280 |
| 443 | Ga0373934_0021534 | 3300035086 | Bacteria | 2483 |
| 444 | Ga0373946_0018068 | 3300035171 | Bacteria | 2703 |
| 445 | Ga0316574_0015922 | 3300035398 | Bacteria | 4370 |
| 446 | Ga0316574_0082030 | 3300035398 | Bacteria | 2048 |
| 447 | Ga0316574_0148528 | 3300035398 | Bacteria | 1511 |
| 448 | Ga0373927_0006326 | 3300035695 | Bacteria | 8071 |
| 449 | Ga0373927_0009759 | 3300035695 | Bacteria | 6436 |
| 450 | Ga0373947_0088407 | 3300035725 | Bacteria | 1928 |
| 451 | Ga0316582_0053540 | 3300036647 | Bacteria | 2567 |
| 452 | Ga0373925_0005652 | 3300037068 | Bacteria | 9305 |
| 453 | Ga0237819_01035 | 3300038705 | Bacteria | 8308 |
| 454 | Ga0436360_0255389 | 3300039438 | Bacteria | 5832 |
| 455 | Ga0436360_0257108 | 3300039438 | Bacteria | 2602 |
| 456 | Ga0436363_0564042 | 3300039450 | Bacteria | 1560 |
| 457 | Ga0436363_0826655 | 3300039450 | Bacteria | 1865 |
| 458 | Ga0436362_0359256 | 3300039453 | Bacteria | 3298 |
| 459 | Ga0439438_000155 | 3300041405 | Bacteria | 31230 |
| 460 | Ga0439438_006304 | 3300041405 | Bacteria | 4211 |
| 461 | Ga0439447_000840 | 3300041407 | Bacteria | 11258 |
| 462 | Ga0439447_007663 | 3300041407 | Bacteria | 3401 |
| 463 | Ga0439466_0001516 | 3300041411 | Bacteria | 9079 |
| 464 | Ga0439466_0010091 | 3300041411 | Bacteria | 3512 |
| 465 | Ga0439466_0015719 | 3300041411 | Bacteria | 2748 |
| 466 | Ga0439432_014891 | 3300042006 | Bacteria | 2629 |
| 467 | Ga0439451_001251 | 3300042009 | Bacteria | 5025 |
| 468 | Ga0439452_001295 | 3300042010 | Bacteria | 10559 |
| 469 | Ga0439456_000015 | 3300042013 | Bacteria | 66691 |
| 470 | Ga0450920_000277 | 3300042122 | Bacteria | 7716 |
| 471 | Ga0450922_000055 | 3300042124 | Bacteria | 10075 |
| 472 | Ga0450896_005081 | 3300042133 | Bacteria | 1792 |
| 473 | Ga0450902_000197 | 3300042137 | Bacteria | 7063 |
| 474 | Ga0450902_000877 | 3300042137 | Bacteria | 3916 |
| 475 | Ga0450903_001073 | 3300042138 | Bacteria | 5210 |
| 476 | Ga0450904_000756 | 3300042139 | Bacteria | 5594 |
| 477 | Ga0450905_003315 | 3300042142 | Bacteria | 2113 |
| 478 | Ga0450906_011247 | 3300042145 | Bacteria | 1677 |
| 479 | Ga0450907_000997 | 3300042146 | Bacteria | 6667 |
| 480 | Ga0451577_0013334 | 3300042876 | Bacteria | 7697 |
| 481 | Ga0451577_0062323 | 3300042876 | Bacteria | 3326 |
| 482 | Ga0451577_0112387 | 3300042876 | Bacteria | 2438 |
| 483 | Ga0466969_0002997 | 3300044656 | Bacteria | 8993 |
| 484 | Ga0466969_0003345 | 3300044656 | Bacteria | 8536 |
| 485 | Ga0466969_0053179 | 3300044656 | Bacteria | 1988 |
| 486 | Ga0466966_0004455 | 3300044684 | Bacteria | 9235 |
| 487 | Ga0466966_0087835 | 3300044684 | Bacteria | 1932 |
| 488 | Ga0466961_0001050 | 3300044693 | Bacteria | 17009 |
| 489 | Ga0466964_0022702 | 3300044706 | Bacteria | 2436 |
| 490 | Ga0453684_0167831 | 3300044712 | Bacteria | 2589 |
| 491 | Ga0466971_0009912 | 3300044719 | Bacteria | 4161 |
| 492 | Ga0466970_0007100 | 3300044765 | Bacteria | 5603 |
| 493 | Ga0466957_0004657 | 3300044842 | Bacteria | 7664 |
| 494 | Ga0466959_0035356 | 3300045049 | Bacteria | 3696 |
| 495 | Ga0466959_0060878 | 3300045049 | Bacteria | 2746 |
| 496 | Ga0466959_0144119 | 3300045049 | Bacteria | 1681 |
| 497 | Ga0451576_0023197 | 3300045051 | Bacteria | 6722 |
| 498 | Ga0451576_0077150 | 3300045051 | Bacteria | 3467 |
| 499 | Ga0451576_0079861 | 3300045051 | Bacteria | 3404 |
| 500 | Ga0495617_000474 | 3300046452 | Bacteria | 21327 |
| 501 | Ga0495617_003460 | 3300046452 | Bacteria | 5939 |
| 502 | Ga0495617_003692 | 3300046452 | Bacteria | 5708 |
| 503 | Ga0495617_004104 | 3300046452 | Bacteria | 5348 |
| 504 | Ga0495617_006049 | 3300046452 | Bacteria | 4262 |
| 505 | Ga0495617_012387 | 3300046452 | Bacteria | 2905 |
| 506 | Ga0495617_061351 | 3300046452 | Bacteria | 1243 |
| 507 | Ga0495627_000534 | 3300046453 | Bacteria | 31440 |
| 508 | Ga0495627_000640 | 3300046453 | Bacteria | 27419 |
| 509 | Ga0495627_007012 | 3300046453 | Bacteria | 4369 |
| 510 | Ga0495627_012974 | 3300046453 | Bacteria | 2941 |
| 511 | Ga0495627_052243 | 3300046453 | Bacteria | 1226 |
| 512 | Ga0495592_0005399 | 3300046454 | Bacteria | 9435 |
| 513 | Ga0495603_0001283 | 3300046455 | Bacteria | 14634 |
| 514 | Ga0495603_0005913 | 3300046455 | Bacteria | 7313 |
| 515 | Ga0495590_0000130 | 3300046457 | Bacteria | 44477 |
| 516 | Ga0495590_0003711 | 3300046457 | Bacteria | 6217 |
| 517 | Ga0495590_0005128 | 3300046457 | Bacteria | 5212 |
| 518 | Ga0495590_0010681 | 3300046457 | Bacteria | 3441 |
| 519 | Ga0495591_000021 | 3300046458 | Bacteria | 203554 |
| 520 | Ga0495591_000150 | 3300046458 | Bacteria | 73568 |
| 521 | Ga0495591_000273 | 3300046458 | Bacteria | 48617 |
| 522 | Ga0495591_002178 | 3300046458 | Bacteria | 11216 |
| 523 | Ga0495591_002505 | 3300046458 | Bacteria | 10150 |
| 524 | Ga0495591_007189 | 3300046458 | Bacteria | 4769 |
| 525 | Ga0495591_008436 | 3300046458 | Bacteria | 4220 |
| 526 | Ga0495591_009648 | 3300046458 | Bacteria | 3815 |
| 527 | Ga0495629_0000490 | 3300046459 | Bacteria | 33122 |
| 528 | Ga0495629_0013707 | 3300046459 | Bacteria | 5850 |
| 529 | Ga0495629_0111232 | 3300046459 | Bacteria | 1910 |
| 530 | Ga0495638_0000947 | 3300046460 | Bacteria | 29436 |
| 531 | Ga0495638_0001168 | 3300046460 | Bacteria | 25231 |
| 532 | Ga0495638_0001991 | 3300046460 | Bacteria | 17423 |
| 533 | Ga0495638_0002314 | 3300046460 | Bacteria | 15692 |
| 534 | Ga0495638_0003073 | 3300046460 | Bacteria | 13255 |
| 535 | Ga0495638_0005036 | 3300046460 | Bacteria | 9915 |
| 536 | Ga0495638_0007477 | 3300046460 | Bacteria | 7829 |
| 537 | Ga0495638_0008564 | 3300046460 | Bacteria | 7239 |
| 538 | Ga0495638_0009288 | 3300046460 | Bacteria | 6911 |
| 539 | Ga0495638_0009651 | 3300046460 | Bacteria | 6751 |
| 540 | Ga0495638_0018895 | 3300046460 | Bacteria | 4568 |
| 541 | Ga0495638_0020025 | 3300046460 | Bacteria | 4422 |
| 542 | Ga0495638_0028419 | 3300046460 | Bacteria | 3612 |
| 543 | Ga0495638_0115045 | 3300046460 | Bacteria | 1594 |
| 544 | Ga0495641_0012212 | 3300046461 | Bacteria | 4821 |
| 545 | Ga0495653_0070080 | 3300046463 | Bacteria | 2624 |
| 546 | Ga0495650_0003285 | 3300046471 | Bacteria | 11957 |
| 547 | Ga0495650_0004517 | 3300046471 | Bacteria | 9500 |
| 548 | Ga0495650_0005241 | 3300046471 | Bacteria | 8506 |
| 549 | Ga0495650_0009160 | 3300046471 | Bacteria | 5669 |
| 550 | Ga0495650_0022637 | 3300046471 | Bacteria | 3010 |
| 551 | Ga0495580_0002317 | 3300046472 | Bacteria | 16600 |
| 552 | Ga0495580_0097407 | 3300046472 | Bacteria | 2046 |
| 553 | Ga0495580_0131295 | 3300046472 | Bacteria | 1737 |
| 554 | Ga0495582_0003939 | 3300046473 | Bacteria | 8341 |
| 555 | Ga0495582_0010605 | 3300046473 | Bacteria | 5069 |
| 556 | Ga0495605_0000480 | 3300046474 | Bacteria | 35032 |
| 557 | Ga0495605_0002173 | 3300046474 | Bacteria | 12250 |
| 558 | Ga0495605_0002997 | 3300046474 | Bacteria | 10199 |
| 559 | Ga0495605_0006888 | 3300046474 | Bacteria | 6491 |
| 560 | Ga0495639_0004319 | 3300046475 | Bacteria | 6095 |
| 561 | Ga0495639_0005800 | 3300046475 | Bacteria | 5314 |
| 562 | Ga0495639_0022287 | 3300046475 | Bacteria | 2778 |
| 563 | Ga0495584_0000067 | 3300046491 | Bacteria | 73689 |
| 564 | Ga0495584_0000917 | 3300046491 | Bacteria | 18791 |
| 565 | Ga0495584_0001601 | 3300046491 | Bacteria | 13348 |
| 566 | Ga0495584_0020071 | 3300046491 | Bacteria | 3394 |
| 567 | Ga0495584_0083289 | 3300046491 | Bacteria | 1610 |
| 568 | Ga0495585_0000030 | 3300046492 | Bacteria | 145184 |
| 569 | Ga0495585_0000056 | 3300046492 | Bacteria | 113739 |
| 570 | Ga0495585_0000335 | 3300046492 | Bacteria | 45891 |
| 571 | Ga0495585_0000871 | 3300046492 | Bacteria | 25767 |
| 572 | Ga0495585_0003232 | 3300046492 | Bacteria | 11116 |
| 573 | Ga0495585_0003534 | 3300046492 | Bacteria | 10511 |
| 574 | Ga0495585_0005465 | 3300046492 | Bacteria | 8005 |
| 575 | Ga0495585_0006863 | 3300046492 | Bacteria | 7022 |
| 576 | Ga0495585_0062042 | 3300046492 | Bacteria | 2053 |
| 577 | Ga0495594_0001605 | 3300046499 | Bacteria | 11772 |
| 578 | Ga0495594_0002194 | 3300046499 | Bacteria | 10147 |
| 579 | Ga0495596_0000012 | 3300046500 | Bacteria | 125996 |
| 580 | Ga0495596_0006906 | 3300046500 | Bacteria | 5172 |
| 581 | Ga0495607_0001305 | 3300046501 | Bacteria | 22209 |
| 582 | Ga0495607_0006997 | 3300046501 | Bacteria | 7853 |
| 583 | Ga0495607_0012999 | 3300046501 | Bacteria | 5473 |
| 584 | Ga0495607_0014897 | 3300046501 | Bacteria | 5053 |
| 585 | Ga0495607_0020256 | 3300046501 | Bacteria | 4209 |
| 586 | Ga0495583_0000112 | 3300046506 | Bacteria | 138078 |
| 587 | Ga0495583_0003028 | 3300046506 | Bacteria | 13394 |
| 588 | Ga0495583_0004042 | 3300046506 | Bacteria | 10794 |
| 589 | Ga0495606_0002318 | 3300046507 | Bacteria | 22431 |
| 590 | Ga0495606_0004165 | 3300046507 | Bacteria | 14658 |
| 591 | Ga0495606_0007763 | 3300046507 | Bacteria | 9494 |
| 592 | Ga0495606_0009647 | 3300046507 | Bacteria | 8131 |
| 593 | Ga0495606_0083686 | 3300046507 | Bacteria | 1977 |
| 594 | Ga0495610_0003225 | 3300046512 | Bacteria | 12903 |
| 595 | Ga0495610_0003495 | 3300046512 | Bacteria | 12221 |
| 596 | Ga0495610_0004389 | 3300046512 | Bacteria | 10438 |
| 597 | Ga0495610_0004415 | 3300046512 | Bacteria | 10403 |
| 598 | Ga0495610_0010870 | 3300046512 | Bacteria | 5619 |
| 599 | Ga0495610_0014754 | 3300046512 | Bacteria | 4574 |
| 600 | Ga0495610_0017503 | 3300046512 | Bacteria | 4083 |
| 601 | Ga0495610_0030494 | 3300046512 | Bacteria | 2825 |
| 602 | Ga0495616_0000251 | 3300046513 | Bacteria | 43349 |
| 603 | Ga0495616_0001505 | 3300046513 | Bacteria | 16092 |
| 604 | Ga0495616_0003694 | 3300046513 | Bacteria | 9775 |
| 605 | Ga0495616_0006088 | 3300046513 | Bacteria | 7354 |
| 606 | Ga0495616_0011509 | 3300046513 | Bacteria | 5063 |
| 607 | Ga0495616_0020835 | 3300046513 | Bacteria | 3561 |
| 608 | Ga0495616_0048391 | 3300046513 | Bacteria | 2137 |
| 609 | Ga0495620_0000860 | 3300046515 | Bacteria | 18785 |
| 610 | Ga0495620_0003461 | 3300046515 | Bacteria | 9033 |
| 611 | Ga0495620_0004610 | 3300046515 | Bacteria | 7747 |
| 612 | Ga0495620_0009266 | 3300046515 | Bacteria | 5242 |
| 613 | Ga0495630_0003131 | 3300046517 | Bacteria | 11476 |
| 614 | Ga0495630_0022286 | 3300046517 | Bacteria | 4679 |
| 615 | Ga0495631_0000002 | 3300046518 | Bacteria | 178694 |
| 616 | Ga0495631_0005996 | 3300046518 | Bacteria | 6321 |
| 617 | Ga0495631_0008277 | 3300046518 | Bacteria | 5243 |
| 618 | Ga0495632_0002079 | 3300046519 | Bacteria | 15668 |
| 619 | Ga0495632_0003562 | 3300046519 | Bacteria | 10990 |
| 620 | Ga0495632_0004142 | 3300046519 | Bacteria | 9959 |
| 621 | Ga0495632_0004772 | 3300046519 | Bacteria | 9129 |
| 622 | Ga0495632_0005080 | 3300046519 | Bacteria | 8801 |
| 623 | Ga0495632_0006324 | 3300046519 | Bacteria | 7641 |
| 624 | Ga0495632_0007608 | 3300046519 | Bacteria | 6776 |
| 625 | Ga0495632_0008901 | 3300046519 | Bacteria | 6099 |
| 626 | Ga0495632_0009802 | 3300046519 | Bacteria | 5736 |
| 627 | Ga0495632_0014646 | 3300046519 | Bacteria | 4428 |
| 628 | Ga0495632_0077697 | 3300046519 | Bacteria | 1587 |
| 629 | Ga0495632_0096544 | 3300046519 | Bacteria | 1396 |
| 630 | Ga0495637_0000246 | 3300046520 | Bacteria | 42500 |
| 631 | Ga0495637_0001056 | 3300046520 | Bacteria | 17210 |
| 632 | Ga0495637_0002226 | 3300046520 | Bacteria | 10798 |
| 633 | Ga0495637_0003199 | 3300046520 | Bacteria | 8740 |
| 634 | Ga0495637_0003357 | 3300046520 | Bacteria | 8514 |
| 635 | Ga0495637_0004380 | 3300046520 | Bacteria | 7321 |
| 636 | Ga0495637_0013128 | 3300046520 | Bacteria | 3939 |
| 637 | Ga0495643_0004092 | 3300046522 | Bacteria | 10388 |
| 638 | Ga0495643_0010664 | 3300046522 | Bacteria | 5646 |
| 639 | Ga0495644_0000025 | 3300046523 | Bacteria | 75756 |
| 640 | Ga0495644_0000545 | 3300046523 | Bacteria | 15914 |
| 641 | Ga0495648_0000246 | 3300046524 | Bacteria | 61159 |
| 642 | Ga0495648_0000981 | 3300046524 | Bacteria | 29447 |
| 643 | Ga0495648_0001566 | 3300046524 | Bacteria | 22326 |
| 644 | Ga0495648_0002585 | 3300046524 | Bacteria | 16582 |
| 645 | Ga0495648_0007688 | 3300046524 | Bacteria | 8592 |
| 646 | Ga0495648_0015779 | 3300046524 | Bacteria | 5464 |
| 647 | Ga0495648_0026386 | 3300046524 | Bacteria | 3912 |
| 648 | Ga0495648_0034013 | 3300046524 | Bacteria | 3323 |
| 649 | Ga0495666_0002299 | 3300046526 | Bacteria | 9524 |
| 650 | Ga0495666_0006761 | 3300046526 | Bacteria | 5765 |
| 651 | Ga0495666_0035650 | 3300046526 | Bacteria | 2424 |
| 652 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 653 | Ga0495642_0000245 | 3300046528 | Bacteria | 30611 |
| 654 | Ga0495654_0000225 | 3300046530 | Bacteria | 52679 |
| 655 | Ga0495654_0003093 | 3300046530 | Bacteria | 10351 |
| 656 | Ga0495654_0003282 | 3300046530 | Bacteria | 9979 |
| 657 | Ga0495654_0004064 | 3300046530 | Bacteria | 8786 |
| 658 | Ga0495654_0007273 | 3300046530 | Bacteria | 6202 |
| 659 | Ga0495654_0011129 | 3300046530 | Bacteria | 4884 |
| 660 | Ga0495654_0017099 | 3300046530 | Bacteria | 3818 |
| 661 | Ga0495654_0033827 | 3300046530 | Bacteria | 2584 |
| 662 | Ga0495654_0042546 | 3300046530 | Bacteria | 2254 |
| 663 | Ga0495654_0043339 | 3300046530 | Bacteria | 2230 |
| 664 | Ga0495586_0026747 | 3300046535 | Bacteria | 3087 |
| 665 | Ga0495586_0033140 | 3300046535 | Bacteria | 2772 |
| 666 | Ga0495587_0000989 | 3300046536 | Bacteria | 18668 |
| 667 | Ga0495587_0005793 | 3300046536 | Bacteria | 8045 |
| 668 | Ga0495609_0004230 | 3300046538 | Bacteria | 7930 |
| 669 | Ga0495609_0006067 | 3300046538 | Bacteria | 6222 |
| 670 | Ga0495609_0008112 | 3300046538 | Bacteria | 5170 |
| 671 | Ga0495621_0001365 | 3300046539 | Bacteria | 6314 |
| 672 | Ga0495597_0001245 | 3300046542 | Bacteria | 18852 |
| 673 | Ga0495597_0001251 | 3300046542 | Bacteria | 18767 |
| 674 | Ga0495597_0005566 | 3300046542 | Bacteria | 6649 |
| 675 | Ga0495597_0008380 | 3300046542 | Bacteria | 5182 |
| 676 | Ga0495597_0015109 | 3300046542 | Bacteria | 3660 |
| 677 | Ga0495597_0015948 | 3300046542 | Bacteria | 3552 |
| 678 | Ga0495597_0021618 | 3300046542 | Bacteria | 2989 |
| 679 | Ga0495645_0018444 | 3300046543 | Bacteria | 5011 |
| 680 | Ga0495645_0133200 | 3300046543 | Bacteria | 1740 |
| 681 | Ga0495622_0004166 | 3300046557 | Bacteria | 6746 |
| 682 | Ga0495622_0005166 | 3300046557 | Bacteria | 6051 |
| 683 | Ga0495622_0007233 | 3300046557 | Bacteria | 5153 |
| 684 | Ga0495622_0008458 | 3300046557 | Bacteria | 4764 |
| 685 | Ga0495633_0000612 | 3300046558 | Bacteria | 33866 |
| 686 | Ga0495633_0005129 | 3300046558 | Bacteria | 8125 |
| 687 | Ga0495656_0004477 | 3300046615 | Bacteria | 4790 |
| 688 | Ga0495656_0014077 | 3300046615 | Bacteria | 2991 |
| 689 | Ga0495668_0000728 | 3300046616 | Bacteria | 39499 |
| 690 | Ga0495668_0001396 | 3300046616 | Bacteria | 23512 |
| 691 | Ga0495668_0011121 | 3300046616 | Bacteria | 5407 |
| 692 | Ga0495634_0000572 | 3300046642 | Bacteria | 35710 |
| 693 | Ga0495634_0006857 | 3300046642 | Bacteria | 8617 |
| 694 | Ga0495634_0011150 | 3300046642 | Bacteria | 6555 |
| 695 | Ga0495611_0002819 | 3300046648 | Bacteria | 7775 |
| 696 | Ga0495625_0000838 | 3300046660 | Bacteria | 42224 |
| 697 | Ga0495625_0001956 | 3300046660 | Bacteria | 23279 |
| 698 | Ga0495625_0012219 | 3300046660 | Bacteria | 6964 |
| 699 | Ga0495625_0018882 | 3300046660 | Bacteria | 5368 |
| 700 | Ga0495625_0034474 | 3300046660 | Bacteria | 3736 |
| 701 | Ga0495625_0053431 | 3300046660 | Bacteria | 2889 |
| 702 | Ga0495625_0081578 | 3300046660 | Bacteria | 2251 |
| 703 | Ga0495625_0097604 | 3300046660 | Bacteria | 2022 |
| 704 | Ga0495635_0000115 | 3300046663 | Bacteria | 47781 |
| 705 | Ga0495635_0000594 | 3300046663 | Bacteria | 23281 |
| 706 | Ga0495635_0060343 | 3300046663 | Bacteria | 2607 |
| 707 | Ga0495635_0196965 | 3300046663 | Bacteria | 1367 |
| 708 | Ga0495659_0000208 | 3300046664 | Bacteria | 25391 |
| 709 | Ga0495659_0035154 | 3300046664 | Bacteria | 1765 |
| 710 | Ga0495661_0000100 | 3300046665 | Bacteria | 104957 |
| 711 | Ga0495661_0004882 | 3300046665 | Bacteria | 9600 |
| 712 | Ga0495661_0030206 | 3300046665 | Bacteria | 3453 |
| 713 | Ga0495661_0034374 | 3300046665 | Bacteria | 3190 |
| 714 | Ga0495661_0071738 | 3300046665 | Bacteria | 2022 |
| 715 | Ga0495661_0076183 | 3300046665 | Bacteria | 1947 |
| 716 | Ga0495661_0148413 | 3300046665 | Bacteria | 1268 |
| 717 | Ga0495588_0005387 | 3300046674 | Bacteria | 5689 |
| 718 | Ga0495588_0006858 | 3300046674 | Bacteria | 5159 |
| 719 | Ga0495588_0024007 | 3300046674 | Bacteria | 3025 |
| 720 | Ga0495588_0089190 | 3300046674 | Bacteria | 1614 |
| 721 | Ga0495623_0004300 | 3300046679 | Bacteria | 9372 |
| 722 | Ga0495646_0003836 | 3300046680 | Bacteria | 9393 |
| 723 | Ga0495646_0007178 | 3300046680 | Bacteria | 7075 |
| 724 | Ga0495647_0006055 | 3300046681 | Bacteria | 3986 |
| 725 | Ga0495658_0012040 | 3300046683 | Bacteria | 4369 |
| 726 | Ga0495658_0012173 | 3300046683 | Bacteria | 4347 |
| 727 | Ga0495658_0022014 | 3300046683 | Bacteria | 3367 |
| 728 | Ga0495613_0001100 | 3300046689 | Bacteria | 20643 |
| 729 | Ga0495613_0007322 | 3300046689 | Bacteria | 8217 |
| 730 | Ga0495613_0008530 | 3300046689 | Bacteria | 7605 |
| 731 | Ga0495613_0011859 | 3300046689 | Bacteria | 6476 |
| 732 | Ga0495613_0014931 | 3300046689 | Bacteria | 5763 |
| 733 | Ga0495624_0000975 | 3300046690 | Bacteria | 22598 |
| 734 | Ga0495670_0000596 | 3300046691 | Bacteria | 17241 |
| 735 | Ga0495670_0010570 | 3300046691 | Bacteria | 4536 |
| 736 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 737 | Ga0495671_0000459 | 3300046692 | Bacteria | 31939 |
| 738 | Ga0495671_0000814 | 3300046692 | Bacteria | 22295 |
| 739 | Ga0495671_0001652 | 3300046692 | Bacteria | 14603 |
| 740 | Ga0495671_0004212 | 3300046692 | Bacteria | 8659 |
| 741 | Ga0495671_0004620 | 3300046692 | Bacteria | 8178 |
| 742 | Ga0495671_0010838 | 3300046692 | Bacteria | 5039 |
| 743 | Ga0495671_0013033 | 3300046692 | Bacteria | 4521 |
| 744 | Ga0495671_0014481 | 3300046692 | Bacteria | 4243 |
| 745 | Ga0495671_0100446 | 3300046692 | Bacteria | 1414 |
| 746 | Ga0495649_0000404 | 3300046694 | Bacteria | 37432 |
| 747 | Ga0495649_0003432 | 3300046694 | Bacteria | 10695 |
| 748 | Ga0495649_0004074 | 3300046694 | Bacteria | 9614 |
| 749 | Ga0495649_0005118 | 3300046694 | Bacteria | 8414 |
| 750 | Ga0495649_0010434 | 3300046694 | Bacteria | 5477 |
| 751 | Ga0495649_0010488 | 3300046694 | Bacteria | 5464 |
| 752 | Ga0495649_0010623 | 3300046694 | Bacteria | 5424 |
| 753 | Ga0495649_0012992 | 3300046694 | Bacteria | 4820 |
| 754 | Ga0495589_0002746 | 3300046794 | Bacteria | 9739 |
| 755 | Ga0495589_0002978 | 3300046794 | Bacteria | 9333 |
| 756 | Ga0495589_0003332 | 3300046794 | Bacteria | 8718 |
| 757 | Ga0495589_0004860 | 3300046794 | Bacteria | 7129 |
| 758 | Ga0495589_0010325 | 3300046794 | Bacteria | 4849 |
| 759 | Ga0495589_0011597 | 3300046794 | Bacteria | 4575 |
| 760 | Ga0495660_0003045 | 3300046810 | Bacteria | 10458 |
| 761 | Ga0495660_0005353 | 3300046810 | Bacteria | 7684 |
| 762 | Ga0495660_0006453 | 3300046810 | Bacteria | 6937 |
| 763 | Ga0495660_0014849 | 3300046810 | Bacteria | 4503 |
| 764 | Ga0495660_0015082 | 3300046810 | Bacteria | 4468 |
| 765 | Ga0495660_0018297 | 3300046810 | Bacteria | 4027 |
| 766 | Ga0495660_0018860 | 3300046810 | Bacteria | 3961 |
| 767 | Ga0495660_0038757 | 3300046810 | Bacteria | 2648 |
| 768 | Ga0495660_0046073 | 3300046810 | Bacteria | 2392 |
| 769 | Ga0495581_0000838 | 3300047315 | Bacteria | 16367 |
| 770 | Ga0495604_0001248 | 3300047317 | Bacteria | 20850 |
| 771 | Ga0495604_0021351 | 3300047317 | Bacteria | 5168 |
| 772 | Ga0495674_0005618 | 3300047319 | Bacteria | 12021 |
| 773 | Ga0495672_0000185 | 3300047320 | Bacteria | 90160 |
| 774 | Ga0495672_0000247 | 3300047320 | Bacteria | 75920 |
| 775 | Ga0495672_0002156 | 3300047320 | Bacteria | 18395 |
| 776 | Ga0495672_0002436 | 3300047320 | Bacteria | 17130 |
| 777 | Ga0495672_0003437 | 3300047320 | Bacteria | 13558 |
| 778 | Ga0495672_0006184 | 3300047320 | Bacteria | 9337 |
| 779 | Ga0495672_0006235 | 3300047320 | Bacteria | 9300 |
| 780 | Ga0495672_0008726 | 3300047320 | Bacteria | 7433 |
| 781 | Ga0495672_0014421 | 3300047320 | Bacteria | 5412 |
| 782 | Ga0495672_0059405 | 3300047320 | Bacteria | 2212 |
| 783 | Ga0495672_0069994 | 3300047320 | Bacteria | 1989 |
| 784 | Ga0495676_0007185 | 3300047321 | Bacteria | 10215 |
| 785 | Ga0495676_0177801 | 3300047321 | Bacteria | 1493 |
| 786 | Ga0495680_0000029 | 3300047322 | Bacteria | 112033 |
| 787 | Ga0495680_0019446 | 3300047322 | Bacteria | 5732 |
| 788 | Ga0495680_0019504 | 3300047322 | Bacteria | 5720 |
| 789 | Ga0495680_0115936 | 3300047322 | Bacteria | 1981 |
| 790 | Ga0495683_0000037 | 3300047323 | Bacteria | 140632 |
| 791 | Ga0495683_0000674 | 3300047323 | Bacteria | 25217 |
| 792 | Ga0495683_0006806 | 3300047323 | Bacteria | 6212 |
| 793 | Ga0495683_0009191 | 3300047323 | Bacteria | 5267 |
| 794 | Ga0495683_0014115 | 3300047323 | Bacteria | 4162 |
| 795 | Ga0495683_0100629 | 3300047323 | Bacteria | 1390 |
| 796 | Ga0495683_0118524 | 3300047323 | Bacteria | 1258 |
| 797 | Ga0495675_0004640 | 3300047444 | Bacteria | 8349 |
| 798 | Ga0495677_0001883 | 3300047445 | Bacteria | 8384 |
| 799 | Ga0495679_000336 | 3300047446 | Bacteria | 37066 |
| 800 | Ga0495679_000402 | 3300047446 | Bacteria | 32396 |
| 801 | Ga0495679_001939 | 3300047446 | Bacteria | 11047 |
| 802 | Ga0495679_003604 | 3300047446 | Bacteria | 7393 |
| 803 | Ga0495679_004478 | 3300047446 | Bacteria | 6425 |
| 804 | Ga0495685_044248 | 3300047447 | Bacteria | 1518 |
| 805 | Ga0495673_0000093 | 3300047469 | Bacteria | 185841 |
| 806 | Ga0495673_0000184 | 3300047469 | Bacteria | 101002 |
| 807 | Ga0495673_0000760 | 3300047469 | Bacteria | 30610 |
| 808 | Ga0495673_0003126 | 3300047469 | Bacteria | 11084 |
| 809 | Ga0495673_0008563 | 3300047469 | Bacteria | 5734 |
| 810 | Ga0495673_0014513 | 3300047469 | Bacteria | 4093 |
| 811 | Ga0495673_0023907 | 3300047469 | Bacteria | 2962 |
| 812 | Ga0495681_0000082 | 3300047470 | Bacteria | 83609 |
| 813 | Ga0495681_0000156 | 3300047470 | Bacteria | 57235 |
| 814 | Ga0495681_0001246 | 3300047470 | Bacteria | 19318 |
| 815 | Ga0495681_0004206 | 3300047470 | Bacteria | 9870 |
| 816 | Ga0495681_0006108 | 3300047470 | Bacteria | 7958 |
| 817 | Ga0495681_0007287 | 3300047470 | Bacteria | 7097 |
| 818 | Ga0495681_0010952 | 3300047470 | Bacteria | 5445 |
| 819 | Ga0495681_0014931 | 3300047470 | Bacteria | 4425 |
| 820 | Ga0495684_0005960 | 3300047471 | Bacteria | 9468 |
| 821 | Ga0495686_0000789 | 3300047472 | Bacteria | 41293 |
| 822 | Ga0495686_0009134 | 3300047472 | Bacteria | 7181 |
| 823 | Ga0495686_0045490 | 3300047472 | Bacteria | 2777 |
| 824 | Ga0495686_0181060 | 3300047472 | Bacteria | 1221 |
| 825 | Ga0495593_0008525 | 3300047673 | Bacteria | 5959 |
| 826 | Ga0495593_0086790 | 3300047673 | Bacteria | 1613 |
| 827 | Ga0495602_0001183 | 3300048088 | Bacteria | 25616 |
| 828 | Ga0495602_0048266 | 3300048088 | Bacteria | 3828 |
| 829 | Ga0495626_0000087 | 3300048091 | Bacteria | 122878 |
| 830 | Ga0495626_0000331 | 3300048091 | Bacteria | 50083 |
| 831 | Ga0495626_0000525 | 3300048091 | Bacteria | 38289 |
| 832 | Ga0495626_0003549 | 3300048091 | Bacteria | 9956 |
| 833 | Ga0495626_0004136 | 3300048091 | Bacteria | 9007 |
| 834 | Ga0495626_0006636 | 3300048091 | Bacteria | 6560 |
| 835 | Ga0495626_0010989 | 3300048091 | Bacteria | 4804 |
| 836 | Ga0496100_0003273 | 3300048903 | Bacteria | 8417 |
| 837 | Ga0496101_0014908 | 3300048904 | Bacteria | 5230 |
| 838 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 839 | Ga0496102_0006064 | 3300048905 | Bacteria | 10305 |
| 840 | Ga0496102_0172769 | 3300048905 | Bacteria | 2034 |
| 841 | Ga0496102_0188412 | 3300048905 | Bacteria | 1944 |
| 842 | Ga0496102_0293371 | 3300048905 | Bacteria | 1533 |
| 843 | Ga0496103_0000755 | 3300048906 | Bacteria | 23849 |
| 844 | Ga0496103_0039847 | 3300048906 | Bacteria | 2887 |
| 845 | Ga0496103_0085825 | 3300048906 | Bacteria | 1984 |
| 846 | Ga0496104_0007070 | 3300048907 | Bacteria | 9899 |
| 847 | Ga0496104_0032491 | 3300048907 | Bacteria | 4857 |
| 848 | Ga0496104_0045553 | 3300048907 | Bacteria | 4126 |
| 849 | Ga0496104_0250296 | 3300048907 | Bacteria | 1684 |
| 850 | Ga0496105_0001071 | 3300048908 | Bacteria | 18940 |
| 851 | Ga0496105_0010006 | 3300048908 | Bacteria | 7441 |
| 852 | Ga0496105_0094327 | 3300048908 | Bacteria | 2471 |
| 853 | Ga0496105_0137051 | 3300048908 | Bacteria | 2016 |
| 854 | Ga0496105_0254820 | 3300048908 | Bacteria | 1421 |
| 855 | Ga0496106_0013682 | 3300048909 | Bacteria | 5992 |
| 856 | Ga0496106_0016835 | 3300048909 | Bacteria | 5409 |
| 857 | Ga0496107_0001015 | 3300048910 | Bacteria | 16758 |
| 858 | Ga0496108_0033953 | 3300048911 | Bacteria | 4237 |
| 859 | Ga0496109_0006467 | 3300048912 | Bacteria | 9867 |
| 860 | Ga0496109_0011659 | 3300048912 | Bacteria | 7559 |
| 861 | Ga0496109_0011744 | 3300048912 | Bacteria | 7536 |
| 862 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 863 | Ga0496110_0016249 | 3300048913 | Bacteria | 6210 |
| 864 | Ga0496110_0039290 | 3300048913 | Bacteria | 4120 |
| 865 | Ga0496110_0233382 | 3300048913 | Bacteria | 1673 |
| 866 | Ga0496111_0005059 | 3300048914 | Bacteria | 8392 |
| 867 | Ga0496111_0030020 | 3300048914 | Bacteria | 3864 |
| 868 | Ga0496112_0011589 | 3300048915 | Bacteria | 8060 |
| 869 | Ga0496112_0011995 | 3300048915 | Bacteria | 7946 |
| 870 | Ga0496112_0068238 | 3300048915 | Bacteria | 3511 |
| 871 | Ga0496113_0016702 | 3300048916 | Bacteria | 5075 |
| 872 | Ga0496113_0043997 | 3300048916 | Bacteria | 3306 |
| 873 | Ga0496113_0291445 | 3300048916 | Bacteria | 1306 |
| 874 | Ga0496114_0004273 | 3300048917 | Bacteria | 11058 |
| 875 | Ga0496114_0004355 | 3300048917 | Bacteria | 10956 |
| 876 | Ga0496115_0013919 | 3300048918 | Bacteria | 6087 |
| 877 | Ga0496115_0016363 | 3300048918 | Bacteria | 5646 |
| 878 | Ga0496115_0038374 | 3300048918 | Bacteria | 3801 |
| 879 | Ga0496117_0015411 | 3300048920 | Bacteria | 6519 |
| 880 | Ga0496118_0003254 | 3300048921 | Bacteria | 20709 |
| 881 | Ga0496118_0026400 | 3300048921 | Bacteria | 4950 |
| 882 | Ga0496118_0041093 | 3300048921 | Bacteria | 3666 |
| 883 | Ga0496118_0072060 | 3300048921 | Bacteria | 2484 |
| 884 | Ga0496119_0002302 | 3300048922 | Bacteria | 21116 |
| 885 | Ga0496120_0002631 | 3300048923 | Bacteria | 17782 |
| 886 | Ga0496121_0043621 | 3300048924 | Bacteria | 3880 |
| 887 | Ga0496121_0052891 | 3300048924 | Bacteria | 3406 |
| 888 | Ga0496124_0024592 | 3300048927 | Bacteria | 5471 |
| 889 | Ga0496124_0081763 | 3300048927 | Bacteria | 2653 |
| 890 | Ga0496125_0035340 | 3300048928 | Bacteria | 4386 |
| 891 | Ga0496125_0061303 | 3300048928 | Bacteria | 3017 |
| 892 | Ga0495678_000542 | 3300049459 | Bacteria | 36459 |
| 893 | Ga0495678_004994 | 3300049459 | Bacteria | 7476 |
| 894 | Ga0495678_011420 | 3300049459 | Bacteria | 4255 |
| 895 | Ga0495678_016219 | 3300049459 | Bacteria | 3412 |
| 896 | Ga0495678_020921 | 3300049459 | Bacteria | 2887 |
| 897 | Ga0495678_061258 | 3300049459 | Bacteria | 1412 |
| 898 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 899 | Ga0495682_0000279 | 3300049460 | Bacteria | 40020 |
| 900 | Ga0495682_0011355 | 3300049460 | Bacteria | 3429 |
| 901 | Ga0495682_0042637 | 3300049460 | Bacteria | 1663 |
| 902 | Ga0501034_0078672 | 3300049571 | Bacteria | 3301 |
| 903 | Ga0501034_0114590 | 3300049571 | Bacteria | 2684 |
| 904 | Ga0501034_0124515 | 3300049571 | Bacteria | 2563 |
| 905 | Ga0501034_0143140 | 3300049571 | Bacteria | 2370 |
| 906 | Ga0501036_0016758 | 3300049572 | Bacteria | 6121 |
| 907 | Ga0501038_0003978 | 3300049574 | Bacteria | 13728 |
| 908 | Ga0501039_0007453 | 3300049575 | Bacteria | 8349 |
| 909 | Ga0501039_0028547 | 3300049575 | Bacteria | 4295 |
| 910 | Ga0501039_0130473 | 3300049575 | Bacteria | 1972 |
| 911 | Ga0501040_0002910 | 3300049576 | Bacteria | 11068 |
| 912 | Ga0501040_0027158 | 3300049576 | Bacteria | 3852 |
| 913 | Ga0501041_0020253 | 3300049577 | Bacteria | 3975 |
| 914 | Ga0501042_0004113 | 3300049578 | Bacteria | 9244 |
| 915 | Ga0501042_0024795 | 3300049578 | Bacteria | 4209 |
| 916 | Ga0501042_0230246 | 3300049578 | Bacteria | 1337 |
| 917 | Ga0501043_0113733 | 3300049579 | Bacteria | 2125 |
| 918 | Ga0501046_0006557 | 3300049580 | Bacteria | 10291 |
| 919 | Ga0501048_0000282 | 3300049582 | Bacteria | 34461 |
| 920 | Ga0501048_0001950 | 3300049582 | Bacteria | 15676 |
| 921 | Ga0501068_0001757 | 3300049584 | Bacteria | 11522 |
| 922 | Ga0501068_0021133 | 3300049584 | Bacteria | 3799 |
| 923 | Ga0501068_0026405 | 3300049584 | Bacteria | 3421 |
| 924 | Ga0501069_0165234 | 3300049585 | Bacteria | 1275 |
| 925 | Ga0501070_0085056 | 3300049586 | Bacteria | 2618 |
| 926 | Ga0501071_0099108 | 3300049587 | Bacteria | 2147 |
| 927 | Ga0501072_0001734 | 3300049588 | Bacteria | 16263 |
| 928 | Ga0501073_0008757 | 3300049589 | Bacteria | 7490 |
| 929 | Ga0501073_0070336 | 3300049589 | Bacteria | 2438 |
| 930 | Ga0501074_0004678 | 3300049590 | Bacteria | 9797 |
| 931 | Ga0501074_0005711 | 3300049590 | Bacteria | 8970 |
| 932 | Ga0501074_0047764 | 3300049590 | Bacteria | 3093 |
| 933 | Ga0501074_0086539 | 3300049590 | Bacteria | 2245 |
| 934 | Ga0501076_0000955 | 3300049592 | Bacteria | 18891 |
| 935 | Ga0501238_000771 | 3300049671 | Bacteria | 3617 |
| 936 | Ga0501079_0000142 | 3300049741 | Bacteria | 39341 |
| 937 | Ga0501079_0001187 | 3300049741 | Bacteria | 18244 |
| 938 | Ga0501079_0002370 | 3300049741 | Bacteria | 13690 |
| 939 | Ga0501080_0002846 | 3300049742 | Bacteria | 15209 |
| 940 | Ga0501080_0069979 | 3300049742 | Bacteria | 3263 |
| 941 | Ga0501080_0080217 | 3300049742 | Bacteria | 3033 |
| 942 | Ga0501080_0104938 | 3300049742 | Bacteria | 2621 |
| 943 | Ga0501081_0000147 | 3300049743 | Bacteria | 32041 |
| 944 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 945 | Ga0501083_0081976 | 3300049744 | Bacteria | 2138 |
| 946 | Ga0501035_0159671 | 3300049822 | Bacteria | 1952 |
| 947 | Ga0501035_0265255 | 3300049822 | Bacteria | 1455 |
| 948 | Ga0501044_0146499 | 3300049823 | Bacteria | 2346 |
| 949 | Ga0501045_0000401 | 3300049824 | Bacteria | 26284 |
| 950 | Ga0501045_0069893 | 3300049824 | Bacteria | 2582 |
| 951 | nmdc:mga03683_11227_c1 | 3300050489 | Bacteria | 3236 |
| 952 | nmdc:mga00v17_525_c1 | 3300050491 | Bacteria | 21487 |
| 953 | nmdc:mga00v17_84836_c1 | 3300050491 | Bacteria | 1983 |
| 954 | nmdc:mga05p37_234465_c1 | 3300050507 | Bacteria | 2210 |
| 955 | nmdc:mga05p37_277179_c1 | 3300050507 | Bacteria | 2001 |
| 956 | nmdc:mga09592_108376_c1 | 3300050508 | Bacteria | 2382 |
| 957 | nmdc:mga09592_218298_c1 | 3300050508 | Bacteria | 1652 |
| 958 | nmdc:mga09592_28022_c1 | 3300050508 | Bacteria | 4677 |
| 959 | nmdc:mga09592_53045_c1 | 3300050508 | Bacteria | 3423 |
| 960 | nmdc:mga09592_7612_c1 | 3300050508 | Bacteria | 8811 |
| 961 | nmdc:mga0qj67_148576_c1 | 3300050509 | Bacteria | 1900 |
| 962 | nmdc:mga0qj67_195516_c1 | 3300050509 | Bacteria | 1643 |
| 963 | nmdc:mga0qj67_4366_c1 | 3300050509 | Bacteria | 10243 |
| 964 | nmdc:mga0qj67_5391_c1 | 3300050509 | Bacteria | 9335 |
| 965 | nmdc:mga06r32_13988_c1 | 3300050510 | Bacteria | 7279 |
| 966 | nmdc:mga06r32_70979_c1 | 3300050510 | Bacteria | 3369 |
| 967 | nmdc:mga08y16_109806_c1 | 3300050511 | Bacteria | 2872 |
| 968 | nmdc:mga08y16_14457_c1 | 3300050511 | Bacteria | 8303 |
| 969 | nmdc:mga08y16_205111_c1 | 3300050511 | Bacteria | 2043 |
| 970 | nmdc:mga08y16_2161_c1 | 3300050511 | Bacteria | 20167 |
| 971 | nmdc:mga0n895_249507_c1 | 3300050512 | Bacteria | 1801 |
| 972 | nmdc:mga0rr50_36990_c1 | 3300050513 | Bacteria | 3520 |
| 973 | Ga0495619_0011851 | 3300053085 | Bacteria | 5491 |
| 974 | Ga0500586_036145 | 3300053145 | Bacteria | 1655 |
| 975 | Ga0500588_0061140 | 3300053146 | Bacteria | 1207 |
| 976 | Ga0500616_0006666 | 3300053153 | Bacteria | 7509 |
| 977 | Ga0500616_0010386 | 3300053153 | Bacteria | 5573 |
| 978 | Ga0500622_0023584 | 3300053156 | Bacteria | 3258 |
| 979 | Ga0500636_0116461 | 3300053177 | Bacteria | 1504 |
| 980 | Ga0500637_0014962 | 3300053178 | Bacteria | 4100 |
| 981 | Ga0500637_0064324 | 3300053178 | Bacteria | 2104 |
| 982 | Ga0501084_0008950 | 3300054114 | Bacteria | 8282 |
| 983 | Ga0501084_0012410 | 3300054114 | Bacteria | 7060 |
| 984 | Ga0501082_0005214 | 3300060353 | Bacteria | 11299 |
| 985 | Ga0501082_0013531 | 3300060353 | Bacteria | 7010 |
| 986 | Ga0501082_0083364 | 3300060353 | Bacteria | 2758 |
| 987 | Ga0466962_0024978 | 3300061719 | Bacteria | 2868 |
| 988 | Ga0530510_0009039 | 3300061734 | Bacteria | 6983 |
| 989 | Ga0530510_0040239 | 3300061734 | Bacteria | 3373 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0001950 | Ga0501048_0001950_1405_2442 | 311 |
| 2 | 3300005353 | Ga0070669_100056750 | Ga0070669_1000567501 | 317 |
| 3 | 3300009094 | Ga0111539_10564067 | Ga0111539_105640671 | 317 |
| 4 | 3300025925 | Ga0207650_10151323 | Ga0207650_101513232 | 321 |
| 5 | 3300049571 | Ga0501034_0124515 | Ga0501034_0124515_675_1742 | 323 |
| 6 | 3300005331 | Ga0070670_100156086 | Ga0070670_1001560862 | 324 |
| 7 | iso_pu_bacteria | 2954011201 | 2954014668 | 324 |
| 8 | 3300005434 | Ga0070709_10007519 | Ga0070709_100075194 | 327 |
| 9 | 3300014325 | Ga0163163_10259556 | Ga0163163_102595562 | 332 |
| 10 | 3300049575 | Ga0501039_0130473 | Ga0501039_0130473_385_1482 | 333 |
| 11 | 3300005354 | Ga0070675_100182374 | Ga0070675_1001823742 | 340 |
| 12 | 3300005548 | Ga0070665_100077491 | Ga0070665_1000774912 | 341 |
| 13 | 3300005563 | Ga0068855_100032489 | Ga0068855_1000324893 | 341 |
| 14 | 3300009093 | Ga0105240_10002127 | Ga0105240_100021279 | 341 |
| 15 | 3300009545 | Ga0105237_10008371 | Ga0105237_100083716 | 341 |
| 16 | 3300013296 | Ga0157374_10156555 | Ga0157374_101565552 | 341 |
| 17 | 3300025913 | Ga0207695_10009529 | Ga0207695_100095294 | 341 |
| 18 | 3300025949 | Ga0207667_10004634 | Ga0207667_100046346 | 341 |
| 19 | 3300028379 | Ga0268266_10078755 | Ga0268266_100787552 | 341 |
| 20 | 3300050510 | nmdc:mga06r32_13988_c1 | nmdc:mga06r32_13988_c1_5946_7085 | 341 |
| 21 | 3300053146 | Ga0500588_0061140 | Ga0500588_0061140_42_1190 | 341 |
| 22 | 3300005328 | Ga0070676_10080007 | Ga0070676_100800072 | 342 |
| 23 | 3300005340 | Ga0070689_100003911 | Ga0070689_10000391110 | 342 |
| 24 | 3300005353 | Ga0070669_100076753 | Ga0070669_1000767532 | 342 |
| 25 | 3300005457 | Ga0070662_100028108 | Ga0070662_1000281082 | 342 |
| 26 | 3300005546 | Ga0070696_100069992 | Ga0070696_1000699922 | 342 |
| 27 | 3300009093 | Ga0105240_10032775 | Ga0105240_100327753 | 342 |
| 28 | 3300009094 | Ga0111539_10077583 | Ga0111539_100775831 | 342 |
| 29 | 3300013308 | Ga0157375_10010708 | Ga0157375_100107081 | 342 |
| 30 | 3300021377 | Ga0213874_10025026 | Ga0213874_100250262 | 342 |
| 31 | 3300025907 | Ga0207645_10020611 | Ga0207645_100206114 | 342 |
| 32 | 3300025912 | Ga0207707_10051542 | Ga0207707_100515423 | 342 |
| 33 | 3300025933 | Ga0207706_10011127 | Ga0207706_100111272 | 342 |
| 34 | 3300025972 | Ga0207668_10018342 | Ga0207668_100183422 | 342 |
| 35 | 3300026116 | Ga0207674_10038183 | Ga0207674_100381832 | 342 |
| 36 | 3300026118 | Ga0207675_100025193 | Ga0207675_1000251932 | 342 |
| 37 | 3300035695 | Ga0373927_0006326 | Ga0373927_0006326_6841_7974 | 342 |
| 38 | 3300044656 | Ga0466969_0003345 | Ga0466969_0003345_2737_3765 | 342 |
| 39 | 3300044684 | Ga0466966_0087835 | Ga0466966_0087835_416_1444 | 342 |
| 40 | 3300045049 | Ga0466959_0035356 | Ga0466959_0035356_1196_2224 | 342 |
| 41 | 3300046519 | Ga0495632_0077697 | Ga0495632_0077697_55_1212 | 342 |
| 42 | 3300005290 | Ga0065712_10070719 | Ga0065712_100707193 | 343 |
| 43 | 3300005293 | Ga0065715_10179943 | Ga0065715_101799431 | 343 |
| 44 | 3300005329 | Ga0070683_100058980 | Ga0070683_1000589802 | 343 |
| 45 | 3300005330 | Ga0070690_100003222 | Ga0070690_1000032228 | 343 |
| 46 | 3300005334 | Ga0068869_100012109 | Ga0068869_1000121092 | 343 |
| 47 | 3300005335 | Ga0070666_10121936 | Ga0070666_101219362 | 343 |
| 48 | 3300005338 | Ga0068868_100049291 | Ga0068868_1000492913 | 343 |
| 49 | 3300005343 | Ga0070687_100009013 | Ga0070687_1000090132 | 343 |
| 50 | 3300005344 | Ga0070661_100006248 | Ga0070661_1000062487 | 343 |
| 51 | 3300005354 | Ga0070675_100001269 | Ga0070675_10000126910 | 343 |
| 52 | 3300005364 | Ga0070673_100170866 | Ga0070673_1001708662 | 343 |
| 53 | 3300005365 | Ga0070688_100032026 | Ga0070688_1000320263 | 343 |
| 54 | 3300005459 | Ga0068867_100027329 | Ga0068867_1000273293 | 343 |
| 55 | 3300005535 | Ga0070684_100000389 | Ga0070684_10000038927 | 343 |
| 56 | 3300005543 | Ga0070672_100011940 | Ga0070672_1000119402 | 343 |
| 57 | 3300005564 | Ga0070664_100002633 | Ga0070664_10000263311 | 343 |
| 58 | 3300005577 | Ga0068857_100013260 | Ga0068857_1000132602 | 343 |
| 59 | 3300005615 | Ga0070702_100034486 | Ga0070702_1000344862 | 343 |
| 60 | 3300005617 | Ga0068859_100008619 | Ga0068859_1000086196 | 343 |
| 61 | 3300005618 | Ga0068864_100004892 | Ga0068864_1000048923 | 343 |
| 62 | 3300005841 | Ga0068863_100005440 | Ga0068863_1000054407 | 343 |
| 63 | 3300005842 | Ga0068858_100326704 | Ga0068858_1003267042 | 343 |
| 64 | 3300005843 | Ga0068860_100021474 | Ga0068860_1000214744 | 343 |
| 65 | 3300005844 | Ga0068862_100004849 | Ga0068862_1000048491 | 343 |
| 66 | 3300006237 | Ga0097621_100031096 | Ga0097621_1000310964 | 343 |
| 67 | 3300006931 | Ga0097620_100008619 | Ga0097620_1000086196 | 343 |
| 68 | 3300009101 | Ga0105247_10012409 | Ga0105247_100124096 | 343 |
| 69 | 3300009101 | Ga0105247_10111901 | Ga0105247_101119012 | 343 |
| 70 | 3300009177 | Ga0105248_10001404 | Ga0105248_1000140410 | 343 |
| 71 | 3300010375 | Ga0105239_10216510 | Ga0105239_102165102 | 343 |
| 72 | 3300013296 | Ga0157374_10308818 | Ga0157374_103088182 | 343 |
| 73 | 3300014325 | Ga0163163_10000485 | Ga0163163_100004852 | 343 |
| 74 | 3300014745 | Ga0157377_10040514 | Ga0157377_100405143 | 343 |
| 75 | 3300014968 | Ga0157379_10160111 | Ga0157379_101601112 | 343 |
| 76 | 3300017792 | Ga0163161_10081043 | Ga0163161_100810432 | 343 |
| 77 | 3300025901 | Ga0207688_10003915 | Ga0207688_100039157 | 343 |
| 78 | 3300025903 | Ga0207680_10020513 | Ga0207680_100205132 | 343 |
| 79 | 3300025908 | Ga0207643_10054417 | Ga0207643_100544172 | 343 |
| 80 | 3300025918 | Ga0207662_10017279 | Ga0207662_100172792 | 343 |
| 81 | 3300025920 | Ga0207649_10015857 | Ga0207649_100158573 | 343 |
| 82 | 3300025936 | Ga0207670_10018344 | Ga0207670_100183443 | 343 |
| 83 | 3300025940 | Ga0207691_10025122 | Ga0207691_100251225 | 343 |
| 84 | 3300025942 | Ga0207689_10002923 | Ga0207689_100029233 | 343 |
| 85 | 3300025945 | Ga0207679_10004598 | Ga0207679_100045983 | 343 |
| 86 | 3300025961 | Ga0207712_10135138 | Ga0207712_101351381 | 343 |
| 87 | 3300026023 | Ga0207677_10011599 | Ga0207677_100115994 | 343 |
| 88 | 3300026035 | Ga0207703_10020264 | Ga0207703_100202644 | 343 |
| 89 | 3300026088 | Ga0207641_10013892 | Ga0207641_100138924 | 343 |
| 90 | 3300026089 | Ga0207648_10017129 | Ga0207648_100171296 | 343 |
| 91 | 3300026095 | Ga0207676_10000965 | Ga0207676_1000096514 | 343 |
| 92 | 3300026116 | Ga0207674_10019239 | Ga0207674_100192392 | 343 |
| 93 | 3300026121 | Ga0207683_10015951 | Ga0207683_100159513 | 343 |
| 94 | 3300028380 | Ga0268265_10027069 | Ga0268265_100270694 | 343 |
| 95 | 3300028381 | Ga0268264_10008436 | Ga0268264_100084364 | 343 |
| 96 | 3300039450 | Ga0436363_0826655 | Ga0436363_0826655_631_1851 | 343 |
| 97 | 3300045051 | Ga0451576_0023197 | Ga0451576_0023197_4434_5573 | 343 |
| 98 | 3300048909 | Ga0496106_0016835 | Ga0496106_0016835_624_1763 | 343 |
| 99 | 3300048915 | Ga0496112_0068238 | Ga0496112_0068238_664_1803 | 343 |
| 100 | 3300035171 | Ga0373946_0018068 | Ga0373946_0018068_80_1165 | 344 |
| 101 | 3300035695 | Ga0373927_0009759 | Ga0373927_0009759_3684_4769 | 344 |
| 102 | 3300035725 | Ga0373947_0088407 | Ga0373947_0088407_682_1767 | 344 |
| 103 | 3300037068 | Ga0373925_0005652 | Ga0373925_0005652_5921_7006 | 344 |
| 104 | 3300046455 | Ga0495603_0001283 | Ga0495603_0001283_4466_5551 | 344 |
| 105 | 3300046459 | Ga0495629_0000490 | Ga0495629_0000490_16267_17352 | 344 |
| 106 | 3300046461 | Ga0495641_0012212 | Ga0495641_0012212_14_1099 | 344 |
| 107 | 3300046473 | Ga0495582_0003939 | Ga0495582_0003939_2378_3463 | 344 |
| 108 | 3300046475 | Ga0495639_0005800 | Ga0495639_0005800_794_1879 | 344 |
| 109 | 3300046499 | Ga0495594_0001605 | Ga0495594_0001605_1011_2096 | 344 |
| 110 | 3300046557 | Ga0495622_0004166 | Ga0495622_0004166_3636_4721 | 344 |
| 111 | 3300046642 | Ga0495634_0006857 | Ga0495634_0006857_4578_5663 | 344 |
| 112 | 3300046663 | Ga0495635_0060343 | Ga0495635_0060343_881_1966 | 344 |
| 113 | 3300046674 | Ga0495588_0024007 | Ga0495588_0024007_1638_2723 | 344 |
| 114 | 3300046683 | Ga0495658_0012173 | Ga0495658_0012173_1382_2467 | 344 |
| 115 | 3300046689 | Ga0495613_0008530 | Ga0495613_0008530_5978_7063 | 344 |
| 116 | 3300047315 | Ga0495581_0000838 | Ga0495581_0000838_6155_7240 | 344 |
| 117 | 3300047321 | Ga0495676_0177801 | Ga0495676_0177801_319_1404 | 344 |
| 118 | 3300047322 | Ga0495680_0115936 | Ga0495680_0115936_106_1191 | 344 |
| 119 | 3300050512 | nmdc:mga0n895_249507_c1 | nmdc:mga0n895_249507_c1_265_1401 | 344 |
| 120 | 3300053085 | Ga0495619_0011851 | Ga0495619_0011851_3557_4642 | 344 |
| 121 | 3300007788 | Ga0099795_10000022 | Ga0099795_1000002215 | 345 |
| 122 | 3300009098 | Ga0105245_10023209 | Ga0105245_100232094 | 345 |
| 123 | 3300009551 | Ga0105238_10161450 | Ga0105238_101614502 | 345 |
| 124 | 3300010159 | Ga0099796_10000025 | Ga0099796_1000002519 | 345 |
| 125 | 3300013296 | Ga0157374_10014556 | Ga0157374_100145564 | 345 |
| 126 | 3300013306 | Ga0163162_10111624 | Ga0163162_101116244 | 345 |
| 127 | 3300014325 | Ga0163163_10025005 | Ga0163163_100250057 | 345 |
| 128 | 3300014968 | Ga0157379_10009851 | Ga0157379_100098512 | 345 |
| 129 | 3300014969 | Ga0157376_10014926 | Ga0157376_100149264 | 345 |
| 130 | 3300027512 | Ga0209179_1000130 | Ga0209179_10001307 | 345 |
| 131 | 3300048907 | Ga0496104_0007070 | Ga0496104_0007070_5926_7056 | 345 |
| 132 | 3300048908 | Ga0496105_0094327 | Ga0496105_0094327_1248_2378 | 345 |
| 133 | 3300048911 | Ga0496108_0033953 | Ga0496108_0033953_1446_2576 | 345 |
| 134 | 3300048912 | Ga0496109_0006467 | Ga0496109_0006467_3171_4301 | 345 |
| 135 | 3300048913 | Ga0496110_0016249 | Ga0496110_0016249_739_1869 | 345 |
| 136 | 3300048914 | Ga0496111_0030020 | Ga0496111_0030020_1479_2609 | 345 |
| 137 | 3300049571 | Ga0501034_0114590 | Ga0501034_0114590_402_1451 | 345 |
| 138 | 3300049586 | Ga0501070_0085056 | Ga0501070_0085056_583_1632 | 345 |
| 139 | 3300049590 | Ga0501074_0047764 | Ga0501074_0047764_1693_2742 | 345 |
| 140 | 3300049742 | Ga0501080_0069979 | Ga0501080_0069979_1345_2394 | 345 |
| 141 | 3300049822 | Ga0501035_0265255 | Ga0501035_0265255_85_1134 | 345 |
| 142 | 3300049823 | Ga0501044_0146499 | Ga0501044_0146499_677_1726 | 345 |
| 143 | 3300060353 | Ga0501082_0083364 | Ga0501082_0083364_139_1296 | 345 |
| 144 | 3300006051 | Ga0075364_10000792 | Ga0075364_100007927 | 346 |
| 145 | 3300046457 | Ga0495590_0010681 | Ga0495590_0010681_15_1175 | 346 |
| 146 | 3300046660 | Ga0495625_0081578 | Ga0495625_0081578_1059_2219 | 346 |
| 147 | 3300046694 | Ga0495649_0010623 | Ga0495649_0010623_3793_4881 | 346 |
| 148 | 3300049584 | Ga0501068_0001757 | Ga0501068_0001757_8198_9352 | 346 |
| 149 | 3300049589 | Ga0501073_0008757 | Ga0501073_0008757_2015_3169 | 346 |
| 150 | 3300049590 | Ga0501074_0004678 | Ga0501074_0004678_7466_8620 | 346 |
| 151 | 3300049741 | Ga0501079_0000142 | Ga0501079_0000142_29942_31096 | 346 |
| 152 | 3300049742 | Ga0501080_0002846 | Ga0501080_0002846_4003_5157 | 346 |
| 153 | 3300050491 | nmdc:mga00v17_525_c1 | nmdc:mga00v17_525_c1_7689_8819 | 346 |
| 154 | 3300005330 | Ga0070690_100004347 | Ga0070690_1000043473 | 347 |
| 155 | 3300005335 | Ga0070666_10000962 | Ga0070666_100009627 | 347 |
| 156 | 3300005338 | Ga0068868_100004028 | Ga0068868_1000040282 | 347 |
| 157 | 3300005355 | Ga0070671_100001534 | Ga0070671_1000015343 | 347 |
| 158 | 3300005366 | Ga0070659_100158956 | Ga0070659_1001589562 | 347 |
| 159 | 3300005434 | Ga0070709_10035426 | Ga0070709_100354262 | 347 |
| 160 | 3300005436 | Ga0070713_100012067 | Ga0070713_1000120675 | 347 |
| 161 | 3300005439 | Ga0070711_100002860 | Ga0070711_1000028603 | 347 |
| 162 | 3300005456 | Ga0070678_100001008 | Ga0070678_1000010082 | 347 |
| 163 | 3300005539 | Ga0068853_100235807 | Ga0068853_1002358072 | 347 |
| 164 | 3300005547 | Ga0070693_100066758 | Ga0070693_1000667582 | 347 |
| 165 | 3300005548 | Ga0070665_100027331 | Ga0070665_1000273313 | 347 |
| 166 | 3300005614 | Ga0068856_100008652 | Ga0068856_1000086524 | 347 |
| 167 | 3300005718 | Ga0068866_10008386 | Ga0068866_100083863 | 347 |
| 168 | 3300005842 | Ga0068858_100019147 | Ga0068858_1000191473 | 347 |
| 169 | 3300006163 | Ga0070715_10003057 | Ga0070715_100030574 | 347 |
| 170 | 3300006173 | Ga0070716_100000449 | Ga0070716_1000004496 | 347 |
| 171 | 3300006358 | Ga0068871_100058698 | Ga0068871_1000586982 | 347 |
| 172 | 3300006358 | Ga0068871_100321155 | Ga0068871_1003211551 | 347 |
| 173 | 3300006881 | Ga0068865_100000735 | Ga0068865_10000073514 | 347 |
| 174 | 3300009098 | Ga0105245_10007920 | Ga0105245_100079208 | 347 |
| 175 | 3300009174 | Ga0105241_10007997 | Ga0105241_100079976 | 347 |
| 176 | 3300009176 | Ga0105242_10005298 | Ga0105242_100052986 | 347 |
| 177 | 3300009177 | Ga0105248_10005489 | Ga0105248_1000548913 | 347 |
| 178 | 3300010375 | Ga0105239_10005723 | Ga0105239_100057236 | 347 |
| 179 | 3300013308 | Ga0157375_10039263 | Ga0157375_100392633 | 347 |
| 180 | 3300014325 | Ga0163163_10101260 | Ga0163163_101012602 | 347 |
| 181 | 3300025899 | Ga0207642_10012317 | Ga0207642_100123172 | 347 |
| 182 | 3300025906 | Ga0207699_10009239 | Ga0207699_100092392 | 347 |
| 183 | 3300025906 | Ga0207699_10019729 | Ga0207699_100197293 | 347 |
| 184 | 3300025914 | Ga0207671_10023246 | Ga0207671_100232463 | 347 |
| 185 | 3300025915 | Ga0207693_10000083 | Ga0207693_1000008322 | 347 |
| 186 | 3300025916 | Ga0207663_10014494 | Ga0207663_100144943 | 347 |
| 187 | 3300025928 | Ga0207700_10019447 | Ga0207700_100194474 | 347 |
| 188 | 3300025931 | Ga0207644_10054804 | Ga0207644_100548042 | 347 |
| 189 | 3300025934 | Ga0207686_10012915 | Ga0207686_100129153 | 347 |
| 190 | 3300025938 | Ga0207704_10004318 | Ga0207704_100043183 | 347 |
| 191 | 3300025939 | Ga0207665_10000587 | Ga0207665_1000058719 | 347 |
| 192 | 3300025941 | Ga0207711_10069829 | Ga0207711_100698292 | 347 |
| 193 | 3300025942 | Ga0207689_10119325 | Ga0207689_101193252 | 347 |
| 194 | 3300025960 | Ga0207651_10065531 | Ga0207651_100655312 | 347 |
| 195 | 3300025986 | Ga0207658_10033045 | Ga0207658_100330452 | 347 |
| 196 | 3300026035 | Ga0207703_10034034 | Ga0207703_100340342 | 347 |
| 197 | 3300026041 | Ga0207639_10187658 | Ga0207639_101876582 | 347 |
| 198 | 3300026078 | Ga0207702_10014159 | Ga0207702_100141594 | 347 |
| 199 | 3300026088 | Ga0207641_10107192 | Ga0207641_101071922 | 347 |
| 200 | 3300026121 | Ga0207683_10004897 | Ga0207683_1000489711 | 347 |
| 201 | 3300031548 | Ga0307408_100167094 | Ga0307408_1001670942 | 347 |
| 202 | 3300046460 | Ga0495638_0001991 | Ga0495638_0001991_11724_12812 | 347 |
| 203 | 3300046474 | Ga0495605_0002997 | Ga0495605_0002997_3967_5055 | 347 |
| 204 | 3300046492 | Ga0495585_0000871 | Ga0495585_0000871_10876_11964 | 347 |
| 205 | 3300046507 | Ga0495606_0083686 | Ga0495606_0083686_54_1142 | 347 |
| 206 | 3300046513 | Ga0495616_0006088 | Ga0495616_0006088_3771_4859 | 347 |
| 207 | 3300046518 | Ga0495631_0008277 | Ga0495631_0008277_1682_2770 | 347 |
| 208 | 3300046520 | Ga0495637_0003199 | Ga0495637_0003199_3508_4596 | 347 |
| 209 | 3300046524 | Ga0495648_0002585 | Ga0495648_0002585_7865_8953 | 347 |
| 210 | 3300046538 | Ga0495609_0008112 | Ga0495609_0008112_580_1668 | 347 |
| 211 | 3300046648 | Ga0495611_0002819 | Ga0495611_0002819_3591_4679 | 347 |
| 212 | 3300046660 | Ga0495625_0053431 | Ga0495625_0053431_1578_2666 | 347 |
| 213 | 3300046692 | Ga0495671_0004620 | Ga0495671_0004620_5528_6616 | 347 |
| 214 | 3300046694 | Ga0495649_0005118 | Ga0495649_0005118_542_1630 | 347 |
| 215 | 3300046794 | Ga0495589_0004860 | Ga0495589_0004860_3621_4709 | 347 |
| 216 | 3300046810 | Ga0495660_0038757 | Ga0495660_0038757_510_1598 | 347 |
| 217 | 3300047469 | Ga0495673_0023907 | Ga0495673_0023907_1328_2416 | 347 |
| 218 | 3300048091 | Ga0495626_0010989 | Ga0495626_0010989_1279_2367 | 347 |
| 219 | 3300048903 | Ga0496100_0003273 | Ga0496100_0003273_2711_3844 | 347 |
| 220 | 3300048905 | Ga0496102_0006064 | Ga0496102_0006064_6558_7691 | 347 |
| 221 | 3300048906 | Ga0496103_0085825 | Ga0496103_0085825_50_1183 | 347 |
| 222 | 3300048907 | Ga0496104_0250296 | Ga0496104_0250296_373_1506 | 347 |
| 223 | 3300048908 | Ga0496105_0010006 | Ga0496105_0010006_3155_4288 | 347 |
| 224 | 3300048909 | Ga0496106_0013682 | Ga0496106_0013682_2559_3692 | 347 |
| 225 | 3300048910 | Ga0496107_0001015 | Ga0496107_0001015_7374_8507 | 347 |
| 226 | 3300048913 | Ga0496110_0000749 | Ga0496110_0000749_13521_14654 | 347 |
| 227 | 3300048914 | Ga0496111_0005059 | Ga0496111_0005059_6193_7326 | 347 |
| 228 | 3300048916 | Ga0496113_0043997 | Ga0496113_0043997_1260_2393 | 347 |
| 229 | 3300048916 | Ga0496113_0291445 | Ga0496113_0291445_95_1201 | 347 |
| 230 | 3300048917 | Ga0496114_0004273 | Ga0496114_0004273_7558_8691 | 347 |
| 231 | 3300048918 | Ga0496115_0016363 | Ga0496115_0016363_3155_4288 | 347 |
| 232 | 3300049459 | Ga0495678_011420 | Ga0495678_011420_1792_2880 | 347 |
| 233 | 3300053145 | Ga0500586_036145 | Ga0500586_036145_222_1310 | 347 |
| 234 | 3300005295 | Ga0065707_10171212 | Ga0065707_101712122 | 348 |
| 235 | 3300005328 | Ga0070676_10016552 | Ga0070676_100165523 | 348 |
| 236 | 3300005353 | Ga0070669_100013419 | Ga0070669_1000134193 | 348 |
| 237 | 3300005543 | Ga0070672_100047307 | Ga0070672_1000473073 | 348 |
| 238 | 3300006173 | Ga0070716_100042537 | Ga0070716_1000425372 | 348 |
| 239 | 3300014326 | Ga0157380_10137624 | Ga0157380_101376242 | 348 |
| 240 | 3300025907 | Ga0207645_10031001 | Ga0207645_100310011 | 348 |
| 241 | 3300025913 | Ga0207695_10024867 | Ga0207695_100248673 | 348 |
| 242 | 3300025915 | Ga0207693_10067420 | Ga0207693_100674202 | 348 |
| 243 | 3300025923 | Ga0207681_10023771 | Ga0207681_100237714 | 348 |
| 244 | 3300025933 | Ga0207706_10049227 | Ga0207706_100492272 | 348 |
| 245 | 3300025940 | Ga0207691_10063046 | Ga0207691_100630462 | 348 |
| 246 | 3300026118 | Ga0207675_100044724 | Ga0207675_1000447242 | 348 |
| 247 | 3300028380 | Ga0268265_10010052 | Ga0268265_100100522 | 348 |
| 248 | 3300031507 | Ga0307509_10002372 | Ga0307509_100023729 | 348 |
| 249 | 3300031691 | Ga0316579_10006989 | Ga0316579_100069894 | 348 |
| 250 | 3300032002 | Ga0307416_100022288 | Ga0307416_1000222883 | 348 |
| 251 | 3300032133 | Ga0316583_10043007 | Ga0316583_100430071 | 348 |
| 252 | 3300032137 | Ga0316585_10026871 | Ga0316585_100268712 | 348 |
| 253 | 3300035398 | Ga0316574_0015922 | Ga0316574_0015922_1443_2540 | 348 |
| 254 | 3300036647 | Ga0316582_0053540 | Ga0316582_0053540_1351_2448 | 348 |
| 255 | 3300045051 | Ga0451576_0079861 | Ga0451576_0079861_1956_3119 | 348 |
| 256 | 3300046460 | Ga0495638_0020025 | Ga0495638_0020025_2115_3323 | 348 |
| 257 | 3300046660 | Ga0495625_0034474 | Ga0495625_0034474_1813_3021 | 348 |
| 258 | 3300049744 | Ga0501083_0081976 | Ga0501083_0081976_902_1984 | 348 |
| 259 | 2162886007 | SwRhRL2b_contig_953756 | SwRhRL2b_0708.00001080 | 349 |
| 260 | 3300005289 | Ga0065704_10000383 | Ga0065704_1000038316 | 349 |
| 261 | 3300005295 | Ga0065707_10086325 | Ga0065707_100863252 | 349 |
| 262 | 3300006846 | Ga0075430_100053905 | Ga0075430_1000539052 | 349 |
| 263 | 3300014969 | Ga0157376_10129844 | Ga0157376_101298442 | 349 |
| 264 | 3300025906 | Ga0207699_10047568 | Ga0207699_100475682 | 349 |
| 265 | 3300028558 | Ga0265326_10003138 | Ga0265326_100031382 | 349 |
| 266 | 3300028563 | Ga0265319_1034522 | Ga0265319_10345222 | 349 |
| 267 | 3300028573 | Ga0265334_10010215 | Ga0265334_100102152 | 349 |
| 268 | 3300028577 | Ga0265318_10001836 | Ga0265318_100018366 | 349 |
| 269 | 3300028800 | Ga0265338_10027362 | Ga0265338_100273623 | 349 |
| 270 | 3300031235 | Ga0265330_10004483 | Ga0265330_100044835 | 349 |
| 271 | 3300031238 | Ga0265332_10003174 | Ga0265332_100031747 | 349 |
| 272 | 3300031241 | Ga0265325_10014663 | Ga0265325_100146632 | 349 |
| 273 | 3300031242 | Ga0265329_10002693 | Ga0265329_100026934 | 349 |
| 274 | 3300031344 | Ga0265316_10087366 | Ga0265316_100873662 | 349 |
| 275 | 3300031711 | Ga0265314_10005988 | Ga0265314_100059881 | 349 |
| 276 | 3300031903 | Ga0307407_10026194 | Ga0307407_100261942 | 349 |
| 277 | 3300031995 | Ga0307409_100002517 | Ga0307409_1000025176 | 349 |
| 278 | 3300032126 | Ga0307415_100040526 | Ga0307415_1000405262 | 349 |
| 279 | 3300047320 | Ga0495672_0014421 | Ga0495672_0014421_925_2064 | 349 |
| 280 | 3300048921 | Ga0496118_0026400 | Ga0496118_0026400_3809_4897 | 349 |
| 281 | 3300048922 | Ga0496119_0002302 | Ga0496119_0002302_10150_11295 | 349 |
| 282 | 3300048923 | Ga0496120_0002631 | Ga0496120_0002631_14056_15201 | 349 |
| 283 | 3300005330 | Ga0070690_100057243 | Ga0070690_1000572434 | 350 |
| 284 | 3300005335 | Ga0070666_10011348 | Ga0070666_100113482 | 350 |
| 285 | 3300005343 | Ga0070687_100049552 | Ga0070687_1000495522 | 350 |
| 286 | 3300005367 | Ga0070667_100003021 | Ga0070667_1000030219 | 350 |
| 287 | 3300005548 | Ga0070665_100006304 | Ga0070665_1000063049 | 350 |
| 288 | 3300005549 | Ga0070704_100007227 | Ga0070704_1000072274 | 350 |
| 289 | 3300005577 | Ga0068857_100091965 | Ga0068857_1000919652 | 350 |
| 290 | 3300005617 | Ga0068859_100043274 | Ga0068859_1000432742 | 350 |
| 291 | 3300005719 | Ga0068861_100111892 | Ga0068861_1001118922 | 350 |
| 292 | 3300005841 | Ga0068863_100011401 | Ga0068863_1000114013 | 350 |
| 293 | 3300005842 | Ga0068858_100012168 | Ga0068858_1000121689 | 350 |
| 294 | 3300005843 | Ga0068860_100004196 | Ga0068860_1000041967 | 350 |
| 295 | 3300006237 | Ga0097621_100091567 | Ga0097621_1000915674 | 350 |
| 296 | 3300006847 | Ga0075431_100007866 | Ga0075431_1000078669 | 350 |
| 297 | 3300006931 | Ga0097620_100043275 | Ga0097620_1000432752 | 350 |
| 298 | 3300009094 | Ga0111539_10201499 | Ga0111539_102014992 | 350 |
| 299 | 3300013308 | Ga0157375_10087488 | Ga0157375_100874882 | 350 |
| 300 | 3300014326 | Ga0157380_10031338 | Ga0157380_100313383 | 350 |
| 301 | 3300025918 | Ga0207662_10049888 | Ga0207662_100498882 | 350 |
| 302 | 3300025941 | Ga0207711_10010034 | Ga0207711_100100342 | 350 |
| 303 | 3300025986 | Ga0207658_10015483 | Ga0207658_100154832 | 350 |
| 304 | 3300026035 | Ga0207703_10013397 | Ga0207703_100133972 | 350 |
| 305 | 3300026088 | Ga0207641_10010458 | Ga0207641_100104582 | 350 |
| 306 | 3300026095 | Ga0207676_10162691 | Ga0207676_101626912 | 350 |
| 307 | 3300026116 | Ga0207674_10106883 | Ga0207674_101068832 | 350 |
| 308 | 3300026116 | Ga0207674_10123226 | Ga0207674_101232262 | 350 |
| 309 | 3300031727 | Ga0316576_10016733 | Ga0316576_100167334 | 350 |
| 310 | 3300031728 | Ga0316578_10032798 | Ga0316578_100327982 | 350 |
| 311 | 3300031733 | Ga0316577_10012050 | Ga0316577_100120502 | 350 |
| 312 | 3300031901 | Ga0307406_10054867 | Ga0307406_100548672 | 350 |
| 313 | 3300032126 | Ga0307415_100125851 | Ga0307415_1001258512 | 350 |
| 314 | 3300032137 | Ga0316585_10009072 | Ga0316585_100090723 | 350 |
| 315 | 3300033528 | Ga0316588_1029669 | Ga0316588_10296692 | 350 |
| 316 | 3300039453 | Ga0436362_0359256 | Ga0436362_0359256_1747_2829 | 350 |
| 317 | 3300049571 | Ga0501034_0078672 | Ga0501034_0078672_1722_2816 | 350 |
| 318 | 3300050509 | nmdc:mga0qj67_4366_c1 | nmdc:mga0qj67_4366_c1_8054_9193 | 350 |
| 319 | iso_pu_bacteria | 2511231027 | 2511389348 | 350 |
| 320 | iso_pu_bacteria | 2765235802 | 2765464326 | 350 |
| 321 | iso_pu_bacteria | 2842871566 | 2842873045 | 350 |
| 322 | iso_pu_bacteria | 2928521798 | 2928521975 | 350 |
| 323 | 3300005347 | Ga0070668_100278649 | Ga0070668_1002786491 | 351 |
| 324 | 3300005457 | Ga0070662_100014075 | Ga0070662_1000140752 | 351 |
| 325 | 3300005546 | Ga0070696_100059238 | Ga0070696_1000592382 | 351 |
| 326 | 3300005719 | Ga0068861_100318503 | Ga0068861_1003185031 | 351 |
| 327 | 3300006175 | Ga0070712_100159298 | Ga0070712_1001592982 | 351 |
| 328 | 3300006846 | Ga0075430_100007468 | Ga0075430_1000074689 | 351 |
| 329 | 3300006880 | Ga0075429_100034978 | Ga0075429_1000349783 | 351 |
| 330 | 3300007076 | Ga0075435_100010333 | Ga0075435_1000103336 | 351 |
| 331 | 3300009094 | Ga0111539_10267558 | Ga0111539_102675583 | 351 |
| 332 | 3300009147 | Ga0114129_10000367 | Ga0114129_1000036751 | 351 |
| 333 | 3300009147 | Ga0114129_10447332 | Ga0114129_104473322 | 351 |
| 334 | 3300009176 | Ga0105242_10082584 | Ga0105242_100825842 | 351 |
| 335 | 3300013296 | Ga0157374_10376833 | Ga0157374_103768332 | 351 |
| 336 | 3300013297 | Ga0157378_10152685 | Ga0157378_101526852 | 351 |
| 337 | 3300013306 | Ga0163162_10126118 | Ga0163162_101261181 | 351 |
| 338 | 3300014325 | Ga0163163_10109176 | Ga0163163_101091762 | 351 |
| 339 | 3300014969 | Ga0157376_10296935 | Ga0157376_102969352 | 351 |
| 340 | 3300025915 | Ga0207693_10018817 | Ga0207693_100188173 | 351 |
| 341 | 3300025933 | Ga0207706_10123377 | Ga0207706_101233772 | 351 |
| 342 | 3300026118 | Ga0207675_100120239 | Ga0207675_1001202392 | 351 |
| 343 | 3300031456 | Ga0307513_10300521 | Ga0307513_103005211 | 351 |
| 344 | 3300035398 | Ga0316574_0082030 | Ga0316574_0082030_559_1704 | 351 |
| 345 | 3300042133 | Ga0450896_005081 | Ga0450896_005081_26_1147 | 351 |
| 346 | 3300042876 | Ga0451577_0013334 | Ga0451577_0013334_1058_2227 | 351 |
| 347 | 3300044712 | Ga0453684_0167831 | Ga0453684_0167831_591_1760 | 351 |
| 348 | 3300045051 | Ga0451576_0077150 | Ga0451576_0077150_1461_2630 | 351 |
| 349 | 3300046460 | Ga0495638_0003073 | Ga0495638_0003073_4103_5191 | 351 |
| 350 | 3300046501 | Ga0495607_0012999 | Ga0495607_0012999_4097_5185 | 351 |
| 351 | 3300046519 | Ga0495632_0004142 | Ga0495632_0004142_4103_5191 | 351 |
| 352 | 3300046542 | Ga0495597_0001251 | Ga0495597_0001251_13577_14665 | 351 |
| 353 | 3300047320 | Ga0495672_0006184 | Ga0495672_0006184_769_1857 | 351 |
| 354 | 3300048904 | Ga0496101_0014908 | Ga0496101_0014908_1916_3001 | 351 |
| 355 | 3300048905 | Ga0496102_0188412 | Ga0496102_0188412_493_1602 | 351 |
| 356 | 3300048906 | Ga0496103_0039847 | Ga0496103_0039847_388_1473 | 351 |
| 357 | 3300048907 | Ga0496104_0045553 | Ga0496104_0045553_1526_2611 | 351 |
| 358 | 3300048908 | Ga0496105_0137051 | Ga0496105_0137051_860_1945 | 351 |
| 359 | 3300048912 | Ga0496109_0011659 | Ga0496109_0011659_3618_4703 | 351 |
| 360 | 3300048913 | Ga0496110_0233382 | Ga0496110_0233382_21_1106 | 351 |
| 361 | 3300048915 | Ga0496112_0011589 | Ga0496112_0011589_3455_4540 | 351 |
| 362 | 3300048916 | Ga0496113_0016702 | Ga0496113_0016702_3120_4205 | 351 |
| 363 | 3300049585 | Ga0501069_0165234 | Ga0501069_0165234_135_1244 | 351 |
| 364 | 3300049589 | Ga0501073_0070336 | Ga0501073_0070336_95_1204 | 351 |
| 365 | 3300050507 | nmdc:mga05p37_277179_c1 | nmdc:mga05p37_277179_c1_542_1699 | 351 |
| 366 | 3300050508 | nmdc:mga09592_28022_c1 | nmdc:mga09592_28022_c1_1675_2832 | 351 |
| 367 | 3300050509 | nmdc:mga0qj67_5391_c1 | nmdc:mga0qj67_5391_c1_3633_4772 | 351 |
| 368 | 3300050511 | nmdc:mga08y16_205111_c1 | nmdc:mga08y16_205111_c1_702_1859 | 351 |
| 369 | 3300050513 | nmdc:mga0rr50_36990_c1 | nmdc:mga0rr50_36990_c1_253_1347 | 351 |
| 370 | 3300053178 | Ga0500637_0014962 | Ga0500637_0014962_1846_2985 | 351 |
| 371 | iso_pu_bacteria | 2534681786 | 2535485293 | 351 |
| 372 | iso_pu_bacteria | 2767802442 | 2770194653 | 351 |
| 373 | iso_pu_bacteria | 2837651117 | 2837651949 | 351 |
| 374 | iso_pu_bacteria | 2839993093 | 2839994241 | 351 |
| 375 | iso_pu_bacteria | 2904578770 | 2904579085 | 351 |
| 376 | iso_pu_bacteria | 2919119836 | 2919122087 | 351 |
| 377 | 3300005435 | Ga0070714_100006553 | Ga0070714_1000065533 | 352 |
| 378 | 3300005436 | Ga0070713_100056713 | Ga0070713_1000567131 | 352 |
| 379 | 3300005439 | Ga0070711_100079964 | Ga0070711_1000799642 | 352 |
| 380 | 3300005518 | Ga0070699_100245641 | Ga0070699_1002456412 | 352 |
| 381 | 3300006028 | Ga0070717_10296058 | Ga0070717_102960582 | 352 |
| 382 | 3300006847 | Ga0075431_100009924 | Ga0075431_1000099248 | 352 |
| 383 | 3300007265 | Ga0099794_10059459 | Ga0099794_100594592 | 352 |
| 384 | 3300021441 | Ga0213871_10024524 | Ga0213871_100245241 | 352 |
| 385 | 3300025898 | Ga0207692_10069265 | Ga0207692_100692652 | 352 |
| 386 | 3300025929 | Ga0207664_10002133 | Ga0207664_100021332 | 352 |
| 387 | 3300039438 | Ga0436360_0255389 | Ga0436360_0255389_219_1316 | 352 |
| 388 | 3300039450 | Ga0436363_0564042 | Ga0436363_0564042_207_1340 | 352 |
| 389 | 3300046535 | Ga0495586_0033140 | Ga0495586_0033140_1077_2174 | 352 |
| 390 | 3300046663 | Ga0495635_0196965 | Ga0495635_0196965_233_1330 | 352 |
| 391 | 3300046664 | Ga0495659_0035154 | Ga0495659_0035154_42_1193 | 352 |
| 392 | 3300048905 | Ga0496102_0293371 | Ga0496102_0293371_354_1451 | 352 |
| 393 | 3300048908 | Ga0496105_0254820 | Ga0496105_0254820_210_1307 | 352 |
| 394 | iso_pu_bacteria | 3000405567 | 3000407783 | 352 |
| 395 | 3300000546 | LJNas_1001711 | LJNas_10017112 | 353 |
| 396 | 3300005471 | Ga0070698_100092786 | Ga0070698_1000927862 | 353 |
| 397 | 3300005546 | Ga0070696_100000233 | Ga0070696_10000023312 | 353 |
| 398 | 3300005617 | Ga0068859_100109922 | Ga0068859_1001099223 | 353 |
| 399 | 3300006931 | Ga0097620_100109919 | Ga0097620_1001099192 | 353 |
| 400 | 3300009093 | Ga0105240_10024889 | Ga0105240_100248893 | 353 |
| 401 | 3300009093 | Ga0105240_10130983 | Ga0105240_101309832 | 353 |
| 402 | 3300009093 | Ga0105240_10328419 | Ga0105240_103284191 | 353 |
| 403 | 3300009551 | Ga0105238_10006381 | Ga0105238_1000638111 | 353 |
| 404 | 3300010375 | Ga0105239_10052494 | Ga0105239_100524944 | 353 |
| 405 | 3300025913 | Ga0207695_10224006 | Ga0207695_102240062 | 353 |
| 406 | 3300025913 | Ga0207695_10282383 | Ga0207695_102823831 | 353 |
| 407 | 3300028017 | Ga0265356_1002354 | Ga0265356_10023542 | 353 |
| 408 | 3300030878 | Ga0265770_1000007 | Ga0265770_10000077 | 353 |
| 409 | 3300031010 | Ga0265771_1000279 | Ga0265771_10002792 | 353 |
| 410 | 3300042876 | Ga0451577_0112387 | Ga0451577_0112387_426_1577 | 353 |
| 411 | 3300045049 | Ga0466959_0060878 | Ga0466959_0060878_1403_2575 | 353 |
| 412 | 3300049575 | Ga0501039_0028547 | Ga0501039_0028547_1972_3111 | 353 |
| 413 | 3300049576 | Ga0501040_0027158 | Ga0501040_0027158_840_1979 | 353 |
| 414 | 3300049577 | Ga0501041_0020253 | Ga0501041_0020253_2078_3217 | 353 |
| 415 | 3300049578 | Ga0501042_0024795 | Ga0501042_0024795_2191_3330 | 353 |
| 416 | 3300049584 | Ga0501068_0021133 | Ga0501068_0021133_1784_2923 | 353 |
| 417 | 3300049587 | Ga0501071_0099108 | Ga0501071_0099108_773_1912 | 353 |
| 418 | 3300049590 | Ga0501074_0086539 | Ga0501074_0086539_845_1984 | 353 |
| 419 | 3300049741 | Ga0501079_0001187 | Ga0501079_0001187_2464_3603 | 353 |
| 420 | 3300049742 | Ga0501080_0080217 | Ga0501080_0080217_50_1189 | 353 |
| 421 | 3300049743 | Ga0501081_0000552 | Ga0501081_0000552_11408_12547 | 353 |
| 422 | 3300049824 | Ga0501045_0069893 | Ga0501045_0069893_1190_2329 | 353 |
| 423 | 3300053153 | Ga0500616_0010386 | Ga0500616_0010386_3777_4898 | 353 |
| 424 | 3300054114 | Ga0501084_0012410 | Ga0501084_0012410_2811_3950 | 353 |
| 425 | 3300060353 | Ga0501082_0013531 | Ga0501082_0013531_2189_3328 | 353 |
| 426 | 3300061734 | Ga0530510_0009039 | Ga0530510_0009039_1644_2783 | 353 |
| 427 | 3300005336 | Ga0070680_100083582 | Ga0070680_1000835822 | 354 |
| 428 | 3300005439 | Ga0070711_100182802 | Ga0070711_1001828021 | 354 |
| 429 | 3300005458 | Ga0070681_10104148 | Ga0070681_101041482 | 354 |
| 430 | 3300005518 | Ga0070699_100023197 | Ga0070699_1000231973 | 354 |
| 431 | 3300005530 | Ga0070679_100133096 | Ga0070679_1001330962 | 354 |
| 432 | 3300005545 | Ga0070695_100001122 | Ga0070695_1000011227 | 354 |
| 433 | 3300005563 | Ga0068855_100020801 | Ga0068855_1000208011 | 354 |
| 434 | 3300009093 | Ga0105240_10002705 | Ga0105240_1000270516 | 354 |
| 435 | 3300015265 | Ga0182005_1001549 | Ga0182005_10015494 | 354 |
| 436 | 3300025912 | Ga0207707_10036563 | Ga0207707_100365632 | 354 |
| 437 | 3300025916 | Ga0207663_10103380 | Ga0207663_101033801 | 354 |
| 438 | 3300025940 | Ga0207691_10089162 | Ga0207691_100891622 | 354 |
| 439 | 3300025949 | Ga0207667_10045147 | Ga0207667_100451474 | 354 |
| 440 | 3300031247 | Ga0265340_10031574 | Ga0265340_100315742 | 354 |
| 441 | 3300046452 | Ga0495617_012387 | Ga0495617_012387_17_1081 | 354 |
| 442 | 3300046512 | Ga0495610_0014754 | Ga0495610_0014754_3268_4332 | 354 |
| 443 | 3300046539 | Ga0495621_0001365 | Ga0495621_0001365_5095_6264 | 354 |
| 444 | 3300046615 | Ga0495656_0004477 | Ga0495656_0004477_733_1902 | 354 |
| 445 | 3300046681 | Ga0495647_0006055 | Ga0495647_0006055_2436_3605 | 354 |
| 446 | 3300046683 | Ga0495658_0022014 | Ga0495658_0022014_2172_3341 | 354 |
| 447 | 3300046692 | Ga0495671_0001652 | Ga0495671_0001652_7464_8528 | 354 |
| 448 | 3300047470 | Ga0495681_0007287 | Ga0495681_0007287_2484_3548 | 354 |
| 449 | 3300047472 | Ga0495686_0045490 | Ga0495686_0045490_270_1430 | 354 |
| 450 | 3300048924 | Ga0496121_0052891 | Ga0496121_0052891_764_1828 | 354 |
| 451 | 3300049582 | Ga0501048_0000282 | Ga0501048_0000282_5065_6273 | 354 |
| 452 | 3300049671 | Ga0501238_000771 | Ga0501238_000771_110_1207 | 354 |
| 453 | 3300005328 | Ga0070676_10026332 | Ga0070676_100263321 | 355 |
| 454 | 3300005336 | Ga0070680_100035452 | Ga0070680_1000354522 | 355 |
| 455 | 3300005353 | Ga0070669_100005076 | Ga0070669_1000050767 | 355 |
| 456 | 3300005356 | Ga0070674_100009909 | Ga0070674_1000099092 | 355 |
| 457 | 3300005367 | Ga0070667_100114387 | Ga0070667_1001143872 | 355 |
| 458 | 3300005436 | Ga0070713_100194413 | Ga0070713_1001944132 | 355 |
| 459 | 3300005444 | Ga0070694_100226894 | Ga0070694_1002268941 | 355 |
| 460 | 3300005457 | Ga0070662_100003902 | Ga0070662_1000039022 | 355 |
| 461 | 3300005459 | Ga0068867_100022954 | Ga0068867_1000229542 | 355 |
| 462 | 3300005543 | Ga0070672_100004629 | Ga0070672_1000046292 | 355 |
| 463 | 3300005563 | Ga0068855_100001944 | Ga0068855_1000019445 | 355 |
| 464 | 3300005719 | Ga0068861_100014206 | Ga0068861_1000142064 | 355 |
| 465 | 3300005719 | Ga0068861_100023752 | Ga0068861_1000237523 | 355 |
| 466 | 3300005840 | Ga0068870_10088817 | Ga0068870_100888171 | 355 |
| 467 | 3300006844 | Ga0075428_100010582 | Ga0075428_10001058210 | 355 |
| 468 | 3300006844 | Ga0075428_100068346 | Ga0075428_1000683463 | 355 |
| 469 | 3300006847 | Ga0075431_100081783 | Ga0075431_1000817832 | 355 |
| 470 | 3300006948 | Ga0099826_10083695 | Ga0099826_100836952 | 355 |
| 471 | 3300009094 | Ga0111539_10033108 | Ga0111539_100331083 | 355 |
| 472 | 3300009094 | Ga0111539_10076554 | Ga0111539_100765542 | 355 |
| 473 | 3300009101 | Ga0105247_10121127 | Ga0105247_101211271 | 355 |
| 474 | 3300009147 | Ga0114129_10087255 | Ga0114129_100872553 | 355 |
| 475 | 3300009148 | Ga0105243_10027562 | Ga0105243_100275622 | 355 |
| 476 | 3300009545 | Ga0105237_10127911 | Ga0105237_101279112 | 355 |
| 477 | 3300009553 | Ga0105249_10184405 | Ga0105249_101844051 | 355 |
| 478 | 3300013105 | Ga0157369_10297375 | Ga0157369_102973752 | 355 |
| 479 | 3300013297 | Ga0157378_10122887 | Ga0157378_101228872 | 355 |
| 480 | 3300014326 | Ga0157380_10025900 | Ga0157380_100259002 | 355 |
| 481 | 3300014968 | Ga0157379_10060155 | Ga0157379_100601552 | 355 |
| 482 | 3300017792 | Ga0163161_10072485 | Ga0163161_100724852 | 355 |
| 483 | 3300025907 | Ga0207645_10001223 | Ga0207645_1000122314 | 355 |
| 484 | 3300025913 | Ga0207695_10076336 | Ga0207695_100763362 | 355 |
| 485 | 3300025914 | Ga0207671_10150432 | Ga0207671_101504322 | 355 |
| 486 | 3300025917 | Ga0207660_10125130 | Ga0207660_101251302 | 355 |
| 487 | 3300025923 | Ga0207681_10035475 | Ga0207681_100354752 | 355 |
| 488 | 3300025933 | Ga0207706_10004326 | Ga0207706_100043263 | 355 |
| 489 | 3300025938 | Ga0207704_10026508 | Ga0207704_100265082 | 355 |
| 490 | 3300025940 | Ga0207691_10001448 | Ga0207691_1000144814 | 355 |
| 491 | 3300025949 | Ga0207667_10010115 | Ga0207667_100101155 | 355 |
| 492 | 3300025986 | Ga0207658_10102880 | Ga0207658_101028802 | 355 |
| 493 | 3300026078 | Ga0207702_10050952 | Ga0207702_100509522 | 355 |
| 494 | 3300026089 | Ga0207648_10003080 | Ga0207648_100030807 | 355 |
| 495 | 3300026118 | Ga0207675_100011407 | Ga0207675_1000114079 | 355 |
| 496 | 3300026118 | Ga0207675_100021455 | Ga0207675_1000214553 | 355 |
| 497 | 3300027526 | Ga0209968_1002478 | Ga0209968_10024782 | 355 |
| 498 | 3300027617 | Ga0210002_1000931 | Ga0210002_10009313 | 355 |
| 499 | 3300027695 | Ga0209966_1008616 | Ga0209966_10086161 | 355 |
| 500 | 3300027876 | Ga0209974_10000908 | Ga0209974_100009084 | 355 |
| 501 | 3300027907 | Ga0207428_10031774 | Ga0207428_100317743 | 355 |
| 502 | 3300027907 | Ga0207428_10037263 | Ga0207428_100372632 | 355 |
| 503 | 3300028380 | Ga0268265_10004447 | Ga0268265_100044475 | 355 |
| 504 | 3300032002 | Ga0307416_100373857 | Ga0307416_1003738572 | 355 |
| 505 | 3300044656 | Ga0466969_0002997 | Ga0466969_0002997_3638_4804 | 355 |
| 506 | 3300044684 | Ga0466966_0004455 | Ga0466966_0004455_3963_5129 | 355 |
| 507 | 3300044693 | Ga0466961_0001050 | Ga0466961_0001050_12036_13202 | 355 |
| 508 | 3300044706 | Ga0466964_0022702 | Ga0466964_0022702_404_1570 | 355 |
| 509 | 3300044719 | Ga0466971_0009912 | Ga0466971_0009912_12_1178 | 355 |
| 510 | 3300044765 | Ga0466970_0007100 | Ga0466970_0007100_3869_5035 | 355 |
| 511 | 3300044842 | Ga0466957_0004657 | Ga0466957_0004657_5730_6896 | 355 |
| 512 | 3300045049 | Ga0466959_0144119 | Ga0466959_0144119_12_1178 | 355 |
| 513 | 3300049572 | Ga0501036_0016758 | Ga0501036_0016758_342_1511 | 355 |
| 514 | 3300049574 | Ga0501038_0003978 | Ga0501038_0003978_6641_7810 | 355 |
| 515 | 3300049575 | Ga0501039_0007453 | Ga0501039_0007453_1290_2459 | 355 |
| 516 | 3300049576 | Ga0501040_0002910 | Ga0501040_0002910_631_1800 | 355 |
| 517 | 3300049578 | Ga0501042_0004113 | Ga0501042_0004113_6372_7541 | 355 |
| 518 | 3300049578 | Ga0501042_0230246 | Ga0501042_0230246_117_1277 | 355 |
| 519 | 3300049579 | Ga0501043_0113733 | Ga0501043_0113733_129_1298 | 355 |
| 520 | 3300049580 | Ga0501046_0006557 | Ga0501046_0006557_8295_9464 | 355 |
| 521 | 3300049584 | Ga0501068_0026405 | Ga0501068_0026405_62_1231 | 355 |
| 522 | 3300049588 | Ga0501072_0001734 | Ga0501072_0001734_9655_10824 | 355 |
| 523 | 3300049590 | Ga0501074_0005711 | Ga0501074_0005711_613_1782 | 355 |
| 524 | 3300049592 | Ga0501076_0000955 | Ga0501076_0000955_10520_11689 | 355 |
| 525 | 3300049741 | Ga0501079_0002370 | Ga0501079_0002370_5736_6905 | 355 |
| 526 | 3300049742 | Ga0501080_0104938 | Ga0501080_0104938_237_1370 | 355 |
| 527 | 3300049743 | Ga0501081_0000147 | Ga0501081_0000147_29676_30845 | 355 |
| 528 | 3300049822 | Ga0501035_0159671 | Ga0501035_0159671_174_1343 | 355 |
| 529 | 3300049824 | Ga0501045_0000401 | Ga0501045_0000401_8502_9671 | 355 |
| 530 | 3300050507 | nmdc:mga05p37_234465_c1 | nmdc:mga05p37_234465_c1_242_1381 | 355 |
| 531 | 3300050508 | nmdc:mga09592_53045_c1 | nmdc:mga09592_53045_c1_683_1831 | 355 |
| 532 | 3300050508 | nmdc:mga09592_7612_c1 | nmdc:mga09592_7612_c1_7655_8794 | 355 |
| 533 | 3300050510 | nmdc:mga06r32_70979_c1 | nmdc:mga06r32_70979_c1_1484_2638 | 355 |
| 534 | 3300050511 | nmdc:mga08y16_109806_c1 | nmdc:mga08y16_109806_c1_1292_2440 | 355 |
| 535 | 3300050511 | nmdc:mga08y16_14457_c1 | nmdc:mga08y16_14457_c1_4980_6119 | 355 |
| 536 | 3300050511 | nmdc:mga08y16_2161_c1 | nmdc:mga08y16_2161_c1_10017_11156 | 355 |
| 537 | 3300053156 | Ga0500622_0023584 | Ga0500622_0023584_1408_2559 | 355 |
| 538 | 3300054114 | Ga0501084_0008950 | Ga0501084_0008950_1338_2507 | 355 |
| 539 | 3300060353 | Ga0501082_0005214 | Ga0501082_0005214_1575_2744 | 355 |
| 540 | 3300061719 | Ga0466962_0024978 | Ga0466962_0024978_866_2032 | 355 |
| 541 | 3300061734 | Ga0530510_0040239 | Ga0530510_0040239_2031_3200 | 355 |
| 542 | 3300005364 | Ga0070673_100082082 | Ga0070673_1000820822 | 356 |
| 543 | 3300005435 | Ga0070714_100098538 | Ga0070714_1000985382 | 356 |
| 544 | 3300005457 | Ga0070662_100017390 | Ga0070662_1000173902 | 356 |
| 545 | 3300005543 | Ga0070672_100291995 | Ga0070672_1002919951 | 356 |
| 546 | 3300005548 | Ga0070665_100002122 | Ga0070665_10000212218 | 356 |
| 547 | 3300005719 | Ga0068861_100084466 | Ga0068861_1000844662 | 356 |
| 548 | 3300005842 | Ga0068858_100391105 | Ga0068858_1003911051 | 356 |
| 549 | 3300005843 | Ga0068860_100007155 | Ga0068860_10000715510 | 356 |
| 550 | 3300005844 | Ga0068862_100042263 | Ga0068862_1000422632 | 356 |
| 551 | 3300006175 | Ga0070712_100007685 | Ga0070712_1000076852 | 356 |
| 552 | 3300006358 | Ga0068871_100203953 | Ga0068871_1002039532 | 356 |
| 553 | 3300006844 | Ga0075428_100151919 | Ga0075428_1001519191 | 356 |
| 554 | 3300006847 | Ga0075431_100335748 | Ga0075431_1003357482 | 356 |
| 555 | 3300013296 | Ga0157374_10007656 | Ga0157374_100076564 | 356 |
| 556 | 3300013297 | Ga0157378_10004873 | Ga0157378_100048735 | 356 |
| 557 | 3300013308 | Ga0157375_10018198 | Ga0157375_100181982 | 356 |
| 558 | 3300014968 | Ga0157379_10006630 | Ga0157379_100066307 | 356 |
| 559 | 3300025907 | Ga0207645_10008199 | Ga0207645_100081994 | 356 |
| 560 | 3300025908 | Ga0207643_10015755 | Ga0207643_100157552 | 356 |
| 561 | 3300025911 | Ga0207654_10059460 | Ga0207654_100594602 | 356 |
| 562 | 3300025923 | Ga0207681_10115901 | Ga0207681_101159012 | 356 |
| 563 | 3300025929 | Ga0207664_10092412 | Ga0207664_100924122 | 356 |
| 564 | 3300025933 | Ga0207706_10022865 | Ga0207706_100228654 | 356 |
| 565 | 3300025940 | Ga0207691_10003491 | Ga0207691_100034918 | 356 |
| 566 | 3300026089 | Ga0207648_10031254 | Ga0207648_100312543 | 356 |
| 567 | 3300026118 | Ga0207675_100021604 | Ga0207675_1000216045 | 356 |
| 568 | 3300027665 | Ga0209983_1003838 | Ga0209983_10038382 | 356 |
| 569 | 3300027682 | Ga0209971_1001319 | Ga0209971_10013195 | 356 |
| 570 | 3300027717 | Ga0209998_10003556 | Ga0209998_100035562 | 356 |
| 571 | 3300027876 | Ga0209974_10000854 | Ga0209974_1000085410 | 356 |
| 572 | 3300028379 | Ga0268266_10001602 | Ga0268266_1000160217 | 356 |
| 573 | 3300028380 | Ga0268265_10081988 | Ga0268265_100819882 | 356 |
| 574 | 3300031239 | Ga0265328_10001169 | Ga0265328_100011693 | 356 |
| 575 | 3300031239 | Ga0265328_10001255 | Ga0265328_100012557 | 356 |
| 576 | 3300031911 | Ga0307412_10083076 | Ga0307412_100830762 | 356 |
| 577 | 3300035398 | Ga0316574_0148528 | Ga0316574_0148528_148_1236 | 356 |
| 578 | 3300042876 | Ga0451577_0062323 | Ga0451577_0062323_1792_2961 | 356 |
| 579 | 3300046459 | Ga0495629_0111232 | Ga0495629_0111232_336_1469 | 356 |
| 580 | 3300046472 | Ga0495580_0002317 | Ga0495580_0002317_14324_15457 | 356 |
| 581 | 3300046472 | Ga0495580_0131295 | Ga0495580_0131295_176_1309 | 356 |
| 582 | 3300046683 | Ga0495658_0012040 | Ga0495658_0012040_971_2104 | 356 |
| 583 | 3300048912 | Ga0496109_0011744 | Ga0496109_0011744_4235_5368 | 356 |
| 584 | 3300048915 | Ga0496112_0011995 | Ga0496112_0011995_5666_6799 | 356 |
| 585 | 3300050509 | nmdc:mga0qj67_148576_c1 | nmdc:mga0qj67_148576_c1_715_1854 | 356 |
| 586 | 3300053177 | Ga0500636_0116461 | Ga0500636_0116461_85_1257 | 356 |
| 587 | 3300053178 | Ga0500637_0064324 | Ga0500637_0064324_143_1315 | 356 |
| 588 | 3300005436 | Ga0070713_100136448 | Ga0070713_1001364482 | 357 |
| 589 | 3300005458 | Ga0070681_10022982 | Ga0070681_100229825 | 357 |
| 590 | 3300006175 | Ga0070712_100216295 | Ga0070712_1002162951 | 357 |
| 591 | 3300006358 | Ga0068871_100186058 | Ga0068871_1001860581 | 357 |
| 592 | 3300006844 | Ga0075428_100116803 | Ga0075428_1001168032 | 357 |
| 593 | 3300006846 | Ga0075430_100031773 | Ga0075430_1000317733 | 357 |
| 594 | 3300006880 | Ga0075429_100044334 | Ga0075429_1000443342 | 357 |
| 595 | 3300027876 | Ga0209974_10015078 | Ga0209974_100150782 | 357 |
| 596 | 3300035086 | Ga0373934_0021534 | Ga0373934_0021534_1028_2161 | 357 |
| 597 | 3300039438 | Ga0436360_0257108 | Ga0436360_0257108_928_2070 | 357 |
| 598 | 3300044656 | Ga0466969_0053179 | Ga0466969_0053179_658_1836 | 357 |
| 599 | 3300046491 | Ga0495584_0000917 | Ga0495584_0000917_955_2028 | 357 |
| 600 | 3300046512 | Ga0495610_0010870 | Ga0495610_0010870_2108_3181 | 357 |
| 601 | 3300046520 | Ga0495637_0003357 | Ga0495637_0003357_3954_5027 | 357 |
| 602 | 3300046543 | Ga0495645_0133200 | Ga0495645_0133200_42_1175 | 357 |
| 603 | 3300046692 | Ga0495671_0010838 | Ga0495671_0010838_2285_3358 | 357 |
| 604 | 3300048088 | Ga0495602_0048266 | Ga0495602_0048266_924_2057 | 357 |
| 605 | 3300050508 | nmdc:mga09592_108376_c1 | nmdc:mga09592_108376_c1_180_1340 | 357 |
| 606 | 3300050508 | nmdc:mga09592_218298_c1 | nmdc:mga09592_218298_c1_166_1296 | 357 |
| 607 | 3300050509 | nmdc:mga0qj67_195516_c1 | nmdc:mga0qj67_195516_c1_159_1289 | 357 |
| 608 | iso_pu_bacteria | 2511231011 | 2511298825 | 357 |
| 609 | 3300005290 | Ga0065712_10097359 | Ga0065712_100973592 | 358 |
| 610 | 3300005336 | Ga0070680_100013082 | Ga0070680_1000130827 | 358 |
| 611 | 3300005458 | Ga0070681_10001577 | Ga0070681_1000157716 | 358 |
| 612 | 3300005458 | Ga0070681_10001582 | Ga0070681_1000158216 | 358 |
| 613 | 3300005458 | Ga0070681_10024376 | Ga0070681_100243763 | 358 |
| 614 | 3300005530 | Ga0070679_100000469 | Ga0070679_10000046915 | 358 |
| 615 | 3300005530 | Ga0070679_100025516 | Ga0070679_1000255162 | 358 |
| 616 | 3300005530 | Ga0070679_100034185 | Ga0070679_1000341854 | 358 |
| 617 | 3300005563 | Ga0068855_100001482 | Ga0068855_10000148216 | 358 |
| 618 | 3300005578 | Ga0068854_100276653 | Ga0068854_1002766532 | 358 |
| 619 | 3300009093 | Ga0105240_10003826 | Ga0105240_1000382620 | 358 |
| 620 | 3300009551 | Ga0105238_10005376 | Ga0105238_1000537610 | 358 |
| 621 | 3300013104 | Ga0157370_10001472 | Ga0157370_1000147213 | 358 |
| 622 | 3300013105 | Ga0157369_10065057 | Ga0157369_100650573 | 358 |
| 623 | 3300014745 | Ga0157377_10106531 | Ga0157377_101065312 | 358 |
| 624 | 3300025912 | Ga0207707_10000122 | Ga0207707_1000012220 | 358 |
| 625 | 3300025912 | Ga0207707_10010048 | Ga0207707_100100482 | 358 |
| 626 | 3300025912 | Ga0207707_10026203 | Ga0207707_100262032 | 358 |
| 627 | 3300025913 | Ga0207695_10003540 | Ga0207695_1000354010 | 358 |
| 628 | 3300025916 | Ga0207663_10068245 | Ga0207663_100682452 | 358 |
| 629 | 3300025917 | Ga0207660_10004896 | Ga0207660_100048966 | 358 |
| 630 | 3300025921 | Ga0207652_10000613 | Ga0207652_1000061329 | 358 |
| 631 | 3300025921 | Ga0207652_10054368 | Ga0207652_100543683 | 358 |
| 632 | 3300025924 | Ga0207694_10003403 | Ga0207694_1000340310 | 358 |
| 633 | 3300025949 | Ga0207667_10000798 | Ga0207667_1000079815 | 358 |
| 634 | 3300031730 | Ga0307516_10003963 | Ga0307516_100039637 | 358 |
| 635 | 3300048907 | Ga0496104_0032491 | Ga0496104_0032491_156_1304 | 358 |
| 636 | 3300048908 | Ga0496105_0001071 | Ga0496105_0001071_8770_9918 | 358 |
| 637 | 3300048917 | Ga0496114_0004355 | Ga0496114_0004355_5234_6382 | 358 |
| 638 | 3300048918 | Ga0496115_0013919 | Ga0496115_0013919_3881_5029 | 358 |
| 639 | 3300053153 | Ga0500616_0006666 | Ga0500616_0006666_5389_6582 | 358 |
| 640 | iso_pu_bacteria | 2511231004 | 2511258189 | 358 |
| 641 | iso_pu_bacteria | 2511231008 | 2511277120 | 358 |
| 642 | iso_pu_bacteria | 2511231010 | 2511292024 | 358 |
| 643 | iso_pu_bacteria | 2511231012 | 2511301453 | 358 |
| 644 | iso_pu_bacteria | 2511231014 | 2511314730 | 358 |
| 645 | iso_pu_bacteria | 2511231015 | 2511320526 | 358 |
| 646 | iso_pu_bacteria | 2511231017 | 2511333733 | 358 |
| 647 | iso_pu_bacteria | 2511231018 | 2511340091 | 358 |
| 648 | iso_pu_bacteria | 2511231019 | 2511346834 | 358 |
| 649 | iso_pu_bacteria | 2511231020 | 2511348314 | 358 |
| 650 | iso_pu_bacteria | 2511231021 | 2511357207 | 358 |
| 651 | iso_pu_bacteria | 2511231023 | 2511371719 | 358 |
| 652 | iso_pu_bacteria | 2643221589 | 2643953427 | 358 |
| 653 | iso_pu_bacteria | 2643221602 | 2644021169 | 358 |
| 654 | iso_pu_bacteria | 2643221633 | 2644188236 | 358 |
| 655 | iso_pu_bacteria | 2738543015 | 2739261859 | 358 |
| 656 | iso_pu_bacteria | 2808606445 | 2809214402 | 358 |
| 657 | iso_pu_bacteria | 2818991456 | 2819657787 | 358 |
| 658 | iso_pu_bacteria | 2904550169 | 2904551888 | 358 |
| 659 | iso_pu_bacteria | 2939636861 | 2939641542 | 358 |
| 660 | iso_pu_bacteria | 2939651529 | 2939654907 | 358 |
| 661 | iso_pu_bacteria | 3007511990 | 3007513702 | 358 |
| 662 | iso_pu_bacteria | 3007619802 | 3007625074 | 358 |
| 663 | iso_pu_bacteria | 8056125926 | 8056128234 | 358 |
| 664 | iso_pu_bacteria | 8056177738 | 8056178745 | 358 |
| 665 | 3300026116 | Ga0207674_10248924 | Ga0207674_102489242 | 359 |
| 666 | 3300046472 | Ga0495580_0097407 | Ga0495580_0097407_466_1671 | 359 |
| 667 | 3300048905 | Ga0496102_0172769 | Ga0496102_0172769_122_1315 | 359 |
| 668 | 3300014497 | Ga0182008_10000655 | Ga0182008_100006554 | 361 |
| 669 | 3300046454 | Ga0495592_0005399 | Ga0495592_0005399_5460_6545 | 361 |
| 670 | 3300046526 | Ga0495666_0002299 | Ga0495666_0002299_2914_3999 | 361 |
| 671 | 3300046543 | Ga0495645_0018444 | Ga0495645_0018444_310_1395 | 361 |
| 672 | 3300046642 | Ga0495634_0011150 | Ga0495634_0011150_5442_6527 | 361 |
| 673 | 3300046680 | Ga0495646_0003836 | Ga0495646_0003836_1526_2611 | 361 |
| 674 | 3300046689 | Ga0495613_0001100 | Ga0495613_0001100_6126_7211 | 361 |
| 675 | 3300046690 | Ga0495624_0000975 | Ga0495624_0000975_16147_17232 | 361 |
| 676 | 3300047320 | Ga0495672_0006235 | Ga0495672_0006235_2411_3496 | 361 |
| 677 | 3300047321 | Ga0495676_0007185 | Ga0495676_0007185_6102_7187 | 361 |
| 678 | 3300047471 | Ga0495684_0005960 | Ga0495684_0005960_5359_6444 | 361 |
| 679 | 3300048088 | Ga0495602_0001183 | Ga0495602_0001183_13135_14220 | 361 |
| 680 | 3300049571 | Ga0501034_0143140 | Ga0501034_0143140_497_1681 | 361 |
| 681 | 2124908027 | MRS2a_Contig_16 | MRS2a_00059140 | 362 |
| 682 | 3300003791 | Ga0055530_10012102 | Ga0055530_100121023 | 362 |
| 683 | 3300005288 | Ga0065714_10000072 | Ga0065714_100000724 | 362 |
| 684 | 3300005288 | Ga0065714_10005237 | Ga0065714_100052372 | 362 |
| 685 | 3300005288 | Ga0065714_10066226 | Ga0065714_100662262 | 362 |
| 686 | 3300005288 | Ga0065714_10067131 | Ga0065714_100671315 | 362 |
| 687 | 3300005288 | Ga0065714_10075957 | Ga0065714_100759571 | 362 |
| 688 | 3300005290 | Ga0065712_10008655 | Ga0065712_100086552 | 362 |
| 689 | 3300005293 | Ga0065715_10005206 | Ga0065715_100052063 | 362 |
| 690 | 3300006058 | Ga0075432_10002709 | Ga0075432_100027092 | 362 |
| 691 | 3300006058 | Ga0075432_10004298 | Ga0075432_100042981 | 362 |
| 692 | 3300006177 | Ga0075362_10007547 | Ga0075362_100075473 | 362 |
| 693 | 3300006946 | Ga0079104_1000068 | Ga0079104_1000068119 | 362 |
| 694 | 3300009011 | Ga0105251_10009643 | Ga0105251_100096435 | 362 |
| 695 | 3300009036 | Ga0105244_10006047 | Ga0105244_100060473 | 362 |
| 696 | 3300009036 | Ga0105244_10030412 | Ga0105244_100304124 | 362 |
| 697 | 3300009092 | Ga0105250_10006223 | Ga0105250_100062235 | 362 |
| 698 | 3300009092 | Ga0105250_10061266 | Ga0105250_100612661 | 362 |
| 699 | 3300009092 | Ga0105250_10061724 | Ga0105250_100617242 | 362 |
| 700 | 3300009148 | Ga0105243_10041735 | Ga0105243_100417354 | 362 |
| 701 | 3300009176 | Ga0105242_10321662 | Ga0105242_103216621 | 362 |
| 702 | 3300011119 | Ga0105246_10006341 | Ga0105246_100063416 | 362 |
| 703 | 3300013306 | Ga0163162_10020035 | Ga0163162_100200355 | 362 |
| 704 | 3300013306 | Ga0163162_10067923 | Ga0163162_100679234 | 362 |
| 705 | 3300015265 | Ga0182005_1001019 | Ga0182005_10010197 | 362 |
| 706 | 3300015265 | Ga0182005_1005470 | Ga0182005_10054703 | 362 |
| 707 | 3300015265 | Ga0182005_1006564 | Ga0182005_10065643 | 362 |
| 708 | 3300017792 | Ga0163161_10000986 | Ga0163161_100009865 | 362 |
| 709 | 3300017792 | Ga0163161_10012623 | Ga0163161_100126234 | 362 |
| 710 | 3300017792 | Ga0163161_10036963 | Ga0163161_100369633 | 362 |
| 711 | 3300025292 | Ga0209676_1003062 | Ga0209676_10030624 | 362 |
| 712 | 3300025298 | Ga0209050_1000229 | Ga0209050_100022996 | 362 |
| 713 | 3300025711 | Ga0207696_1001869 | Ga0207696_10018696 | 362 |
| 714 | 3300025711 | Ga0207696_1005521 | Ga0207696_10055212 | 362 |
| 715 | 3300025728 | Ga0207655_1002567 | Ga0207655_10025675 | 362 |
| 716 | 3300025728 | Ga0207655_1035489 | Ga0207655_10354891 | 362 |
| 717 | 3300025735 | Ga0207713_1007553 | Ga0207713_10075535 | 362 |
| 718 | 3300025735 | Ga0207713_1007696 | Ga0207713_10076966 | 362 |
| 719 | 3300025735 | Ga0207713_1007941 | Ga0207713_10079417 | 362 |
| 720 | 3300025935 | Ga0207709_10100092 | Ga0207709_101000922 | 362 |
| 721 | 3300027111 | Ga0209281_1000168 | Ga0209281_100016844 | 362 |
| 722 | 3300027907 | Ga0207428_10007665 | Ga0207428_100076658 | 362 |
| 723 | 3300027907 | Ga0207428_10054420 | Ga0207428_100544202 | 362 |
| 724 | 3300027907 | Ga0207428_10175028 | Ga0207428_101750281 | 362 |
| 725 | 3300038705 | Ga0237819_01035 | Ga0237819_01035_1855_2943 | 362 |
| 726 | 3300041405 | Ga0439438_000155 | Ga0439438_000155_24319_25407 | 362 |
| 727 | 3300041405 | Ga0439438_006304 | Ga0439438_006304_2050_3138 | 362 |
| 728 | 3300041407 | Ga0439447_000840 | Ga0439447_000840_9176_10264 | 362 |
| 729 | 3300041407 | Ga0439447_007663 | Ga0439447_007663_941_2029 | 362 |
| 730 | 3300041411 | Ga0439466_0001516 | Ga0439466_0001516_3218_4306 | 362 |
| 731 | 3300041411 | Ga0439466_0010091 | Ga0439466_0010091_211_1299 | 362 |
| 732 | 3300041411 | Ga0439466_0015719 | Ga0439466_0015719_760_1848 | 362 |
| 733 | 3300042006 | Ga0439432_014891 | Ga0439432_014891_118_1206 | 362 |
| 734 | 3300042009 | Ga0439451_001251 | Ga0439451_001251_3308_4396 | 362 |
| 735 | 3300042010 | Ga0439452_001295 | Ga0439452_001295_2660_3748 | 362 |
| 736 | 3300042013 | Ga0439456_000015 | Ga0439456_000015_37929_39023 | 362 |
| 737 | 3300042122 | Ga0450920_000277 | Ga0450920_000277_5164_6252 | 362 |
| 738 | 3300042124 | Ga0450922_000055 | Ga0450922_000055_3324_4412 | 362 |
| 739 | 3300042137 | Ga0450902_000197 | Ga0450902_000197_4523_5611 | 362 |
| 740 | 3300042137 | Ga0450902_000877 | Ga0450902_000877_415_1503 | 362 |
| 741 | 3300042138 | Ga0450903_001073 | Ga0450903_001073_98_1186 | 362 |
| 742 | 3300042139 | Ga0450904_000756 | Ga0450904_000756_1107_2195 | 362 |
| 743 | 3300042142 | Ga0450905_003315 | Ga0450905_003315_648_1736 | 362 |
| 744 | 3300042145 | Ga0450906_011247 | Ga0450906_011247_330_1418 | 362 |
| 745 | 3300042146 | Ga0450907_000997 | Ga0450907_000997_2682_3770 | 362 |
| 746 | 3300046452 | Ga0495617_000474 | Ga0495617_000474_14255_15343 | 362 |
| 747 | 3300046452 | Ga0495617_003460 | Ga0495617_003460_2978_4066 | 362 |
| 748 | 3300046452 | Ga0495617_003692 | Ga0495617_003692_4524_5612 | 362 |
| 749 | 3300046452 | Ga0495617_004104 | Ga0495617_004104_1577_2665 | 362 |
| 750 | 3300046452 | Ga0495617_006049 | Ga0495617_006049_2319_3407 | 362 |
| 751 | 3300046452 | Ga0495617_061351 | Ga0495617_061351_80_1168 | 362 |
| 752 | 3300046453 | Ga0495627_000534 | Ga0495627_000534_20441_21529 | 362 |
| 753 | 3300046453 | Ga0495627_000640 | Ga0495627_000640_5564_6652 | 362 |
| 754 | 3300046453 | Ga0495627_007012 | Ga0495627_007012_810_1898 | 362 |
| 755 | 3300046453 | Ga0495627_012974 | Ga0495627_012974_1319_2407 | 362 |
| 756 | 3300046453 | Ga0495627_052243 | Ga0495627_052243_81_1169 | 362 |
| 757 | 3300046455 | Ga0495603_0005913 | Ga0495603_0005913_710_1798 | 362 |
| 758 | 3300046457 | Ga0495590_0000130 | Ga0495590_0000130_35343_36431 | 362 |
| 759 | 3300046457 | Ga0495590_0003711 | Ga0495590_0003711_4357_5445 | 362 |
| 760 | 3300046457 | Ga0495590_0005128 | Ga0495590_0005128_234_1322 | 362 |
| 761 | 3300046458 | Ga0495591_000021 | Ga0495591_000021_87164_88252 | 362 |
| 762 | 3300046458 | Ga0495591_000150 | Ga0495591_000150_28380_29468 | 362 |
| 763 | 3300046458 | Ga0495591_000273 | Ga0495591_000273_22445_23533 | 362 |
| 764 | 3300046458 | Ga0495591_002178 | Ga0495591_002178_89_1177 | 362 |
| 765 | 3300046458 | Ga0495591_002505 | Ga0495591_002505_5130_6218 | 362 |
| 766 | 3300046458 | Ga0495591_007189 | Ga0495591_007189_2314_3402 | 362 |
| 767 | 3300046458 | Ga0495591_008436 | Ga0495591_008436_2766_3854 | 362 |
| 768 | 3300046458 | Ga0495591_009648 | Ga0495591_009648_76_1164 | 362 |
| 769 | 3300046459 | Ga0495629_0013707 | Ga0495629_0013707_1334_2422 | 362 |
| 770 | 3300046460 | Ga0495638_0000947 | Ga0495638_0000947_6576_7664 | 362 |
| 771 | 3300046460 | Ga0495638_0001168 | Ga0495638_0001168_15501_16589 | 362 |
| 772 | 3300046460 | Ga0495638_0002314 | Ga0495638_0002314_4767_5855 | 362 |
| 773 | 3300046460 | Ga0495638_0005036 | Ga0495638_0005036_4378_5466 | 362 |
| 774 | 3300046460 | Ga0495638_0007477 | Ga0495638_0007477_5010_6098 | 362 |
| 775 | 3300046460 | Ga0495638_0008564 | Ga0495638_0008564_1258_2346 | 362 |
| 776 | 3300046460 | Ga0495638_0009288 | Ga0495638_0009288_1065_2153 | 362 |
| 777 | 3300046460 | Ga0495638_0009651 | Ga0495638_0009651_3241_4329 | 362 |
| 778 | 3300046460 | Ga0495638_0018895 | Ga0495638_0018895_3461_4549 | 362 |
| 779 | 3300046460 | Ga0495638_0028419 | Ga0495638_0028419_2415_3503 | 362 |
| 780 | 3300046460 | Ga0495638_0115045 | Ga0495638_0115045_445_1533 | 362 |
| 781 | 3300046463 | Ga0495653_0070080 | Ga0495653_0070080_874_1962 | 362 |
| 782 | 3300046471 | Ga0495650_0003285 | Ga0495650_0003285_9607_10695 | 362 |
| 783 | 3300046471 | Ga0495650_0004517 | Ga0495650_0004517_4895_5983 | 362 |
| 784 | 3300046471 | Ga0495650_0005241 | Ga0495650_0005241_1321_2409 | 362 |
| 785 | 3300046471 | Ga0495650_0009160 | Ga0495650_0009160_2389_3477 | 362 |
| 786 | 3300046471 | Ga0495650_0022637 | Ga0495650_0022637_1679_2767 | 362 |
| 787 | 3300046473 | Ga0495582_0010605 | Ga0495582_0010605_2431_3519 | 362 |
| 788 | 3300046474 | Ga0495605_0000480 | Ga0495605_0000480_17821_18909 | 362 |
| 789 | 3300046474 | Ga0495605_0002173 | Ga0495605_0002173_6964_8052 | 362 |
| 790 | 3300046474 | Ga0495605_0006888 | Ga0495605_0006888_2460_3548 | 362 |
| 791 | 3300046475 | Ga0495639_0004319 | Ga0495639_0004319_2957_4045 | 362 |
| 792 | 3300046475 | Ga0495639_0022287 | Ga0495639_0022287_662_1750 | 362 |
| 793 | 3300046491 | Ga0495584_0000067 | Ga0495584_0000067_54777_55865 | 362 |
| 794 | 3300046491 | Ga0495584_0001601 | Ga0495584_0001601_5198_6286 | 362 |
| 795 | 3300046491 | Ga0495584_0020071 | Ga0495584_0020071_1969_3057 | 362 |
| 796 | 3300046491 | Ga0495584_0083289 | Ga0495584_0083289_33_1121 | 362 |
| 797 | 3300046492 | Ga0495585_0000030 | Ga0495585_0000030_21291_22379 | 362 |
| 798 | 3300046492 | Ga0495585_0000056 | Ga0495585_0000056_514_1602 | 362 |
| 799 | 3300046492 | Ga0495585_0000335 | Ga0495585_0000335_19044_20132 | 362 |
| 800 | 3300046492 | Ga0495585_0003232 | Ga0495585_0003232_9259_10347 | 362 |
| 801 | 3300046492 | Ga0495585_0003534 | Ga0495585_0003534_7048_8136 | 362 |
| 802 | 3300046492 | Ga0495585_0005465 | Ga0495585_0005465_3398_4486 | 362 |
| 803 | 3300046492 | Ga0495585_0006863 | Ga0495585_0006863_5919_7007 | 362 |
| 804 | 3300046492 | Ga0495585_0062042 | Ga0495585_0062042_906_1994 | 362 |
| 805 | 3300046499 | Ga0495594_0002194 | Ga0495594_0002194_3795_4883 | 362 |
| 806 | 3300046500 | Ga0495596_0000012 | Ga0495596_0000012_90917_92005 | 362 |
| 807 | 3300046500 | Ga0495596_0006906 | Ga0495596_0006906_1891_2979 | 362 |
| 808 | 3300046501 | Ga0495607_0001305 | Ga0495607_0001305_13514_14602 | 362 |
| 809 | 3300046501 | Ga0495607_0006997 | Ga0495607_0006997_2720_3808 | 362 |
| 810 | 3300046501 | Ga0495607_0014897 | Ga0495607_0014897_1164_2252 | 362 |
| 811 | 3300046501 | Ga0495607_0020256 | Ga0495607_0020256_471_1559 | 362 |
| 812 | 3300046506 | Ga0495583_0000112 | Ga0495583_0000112_104004_105092 | 362 |
| 813 | 3300046506 | Ga0495583_0003028 | Ga0495583_0003028_5261_6349 | 362 |
| 814 | 3300046506 | Ga0495583_0004042 | Ga0495583_0004042_2630_3718 | 362 |
| 815 | 3300046507 | Ga0495606_0002318 | Ga0495606_0002318_14029_15117 | 362 |
| 816 | 3300046507 | Ga0495606_0004165 | Ga0495606_0004165_12533_13621 | 362 |
| 817 | 3300046507 | Ga0495606_0007763 | Ga0495606_0007763_5201_6289 | 362 |
| 818 | 3300046507 | Ga0495606_0009647 | Ga0495606_0009647_2856_3944 | 362 |
| 819 | 3300046512 | Ga0495610_0003225 | Ga0495610_0003225_10319_11407 | 362 |
| 820 | 3300046512 | Ga0495610_0003495 | Ga0495610_0003495_8601_9689 | 362 |
| 821 | 3300046512 | Ga0495610_0004389 | Ga0495610_0004389_6548_7636 | 362 |
| 822 | 3300046512 | Ga0495610_0004415 | Ga0495610_0004415_1174_2262 | 362 |
| 823 | 3300046512 | Ga0495610_0017503 | Ga0495610_0017503_16_1104 | 362 |
| 824 | 3300046512 | Ga0495610_0030494 | Ga0495610_0030494_1066_2154 | 362 |
| 825 | 3300046513 | Ga0495616_0000251 | Ga0495616_0000251_20666_21754 | 362 |
| 826 | 3300046513 | Ga0495616_0001505 | Ga0495616_0001505_6638_7726 | 362 |
| 827 | 3300046513 | Ga0495616_0003694 | Ga0495616_0003694_2656_3744 | 362 |
| 828 | 3300046513 | Ga0495616_0011509 | Ga0495616_0011509_1010_2098 | 362 |
| 829 | 3300046513 | Ga0495616_0020835 | Ga0495616_0020835_380_1468 | 362 |
| 830 | 3300046513 | Ga0495616_0048391 | Ga0495616_0048391_1019_2107 | 362 |
| 831 | 3300046515 | Ga0495620_0000860 | Ga0495620_0000860_7231_8319 | 362 |
| 832 | 3300046515 | Ga0495620_0003461 | Ga0495620_0003461_4996_6084 | 362 |
| 833 | 3300046515 | Ga0495620_0004610 | Ga0495620_0004610_4194_5282 | 362 |
| 834 | 3300046515 | Ga0495620_0009266 | Ga0495620_0009266_3766_4854 | 362 |
| 835 | 3300046517 | Ga0495630_0003131 | Ga0495630_0003131_22_1110 | 362 |
| 836 | 3300046517 | Ga0495630_0022286 | Ga0495630_0022286_2527_3615 | 362 |
| 837 | 3300046518 | Ga0495631_0000002 | Ga0495631_0000002_128791_129879 | 362 |
| 838 | 3300046518 | Ga0495631_0005996 | Ga0495631_0005996_3471_4559 | 362 |
| 839 | 3300046519 | Ga0495632_0002079 | Ga0495632_0002079_4956_6044 | 362 |
| 840 | 3300046519 | Ga0495632_0003562 | Ga0495632_0003562_8077_9165 | 362 |
| 841 | 3300046519 | Ga0495632_0004772 | Ga0495632_0004772_4894_5982 | 362 |
| 842 | 3300046519 | Ga0495632_0005080 | Ga0495632_0005080_3282_4370 | 362 |
| 843 | 3300046519 | Ga0495632_0006324 | Ga0495632_0006324_5967_7055 | 362 |
| 844 | 3300046519 | Ga0495632_0007608 | Ga0495632_0007608_4515_5603 | 362 |
| 845 | 3300046519 | Ga0495632_0008901 | Ga0495632_0008901_4535_5623 | 362 |
| 846 | 3300046519 | Ga0495632_0009802 | Ga0495632_0009802_4618_5706 | 362 |
| 847 | 3300046519 | Ga0495632_0014646 | Ga0495632_0014646_2800_3888 | 362 |
| 848 | 3300046519 | Ga0495632_0096544 | Ga0495632_0096544_206_1294 | 362 |
| 849 | 3300046520 | Ga0495637_0000246 | Ga0495637_0000246_24730_25818 | 362 |
| 850 | 3300046520 | Ga0495637_0001056 | Ga0495637_0001056_14630_15718 | 362 |
| 851 | 3300046520 | Ga0495637_0002226 | Ga0495637_0002226_541_1629 | 362 |
| 852 | 3300046520 | Ga0495637_0004380 | Ga0495637_0004380_333_1421 | 362 |
| 853 | 3300046520 | Ga0495637_0013128 | Ga0495637_0013128_862_1950 | 362 |
| 854 | 3300046522 | Ga0495643_0004092 | Ga0495643_0004092_8057_9145 | 362 |
| 855 | 3300046522 | Ga0495643_0010664 | Ga0495643_0010664_2443_3531 | 362 |
| 856 | 3300046523 | Ga0495644_0000025 | Ga0495644_0000025_69339_70427 | 362 |
| 857 | 3300046523 | Ga0495644_0000545 | Ga0495644_0000545_4091_5179 | 362 |
| 858 | 3300046524 | Ga0495648_0000246 | Ga0495648_0000246_21166_22254 | 362 |
| 859 | 3300046524 | Ga0495648_0000981 | Ga0495648_0000981_13879_14967 | 362 |
| 860 | 3300046524 | Ga0495648_0001566 | Ga0495648_0001566_20698_21786 | 362 |
| 861 | 3300046524 | Ga0495648_0007688 | Ga0495648_0007688_3455_4543 | 362 |
| 862 | 3300046524 | Ga0495648_0015779 | Ga0495648_0015779_3025_4113 | 362 |
| 863 | 3300046524 | Ga0495648_0026386 | Ga0495648_0026386_1099_2187 | 362 |
| 864 | 3300046524 | Ga0495648_0034013 | Ga0495648_0034013_411_1499 | 362 |
| 865 | 3300046526 | Ga0495666_0006761 | Ga0495666_0006761_1447_2535 | 362 |
| 866 | 3300046526 | Ga0495666_0035650 | Ga0495666_0035650_777_1865 | 362 |
| 867 | 3300046528 | Ga0495642_0000003 | Ga0495642_0000003_133056_134144 | 362 |
| 868 | 3300046528 | Ga0495642_0000245 | Ga0495642_0000245_7674_8762 | 362 |
| 869 | 3300046530 | Ga0495654_0000225 | Ga0495654_0000225_29534_30622 | 362 |
| 870 | 3300046530 | Ga0495654_0003093 | Ga0495654_0003093_2239_3327 | 362 |
| 871 | 3300046530 | Ga0495654_0003282 | Ga0495654_0003282_8274_9362 | 362 |
| 872 | 3300046530 | Ga0495654_0004064 | Ga0495654_0004064_4835_5923 | 362 |
| 873 | 3300046530 | Ga0495654_0007273 | Ga0495654_0007273_2980_4068 | 362 |
| 874 | 3300046530 | Ga0495654_0011129 | Ga0495654_0011129_1283_2371 | 362 |
| 875 | 3300046530 | Ga0495654_0017099 | Ga0495654_0017099_2661_3749 | 362 |
| 876 | 3300046530 | Ga0495654_0033827 | Ga0495654_0033827_31_1119 | 362 |
| 877 | 3300046530 | Ga0495654_0042546 | Ga0495654_0042546_236_1324 | 362 |
| 878 | 3300046530 | Ga0495654_0043339 | Ga0495654_0043339_422_1510 | 362 |
| 879 | 3300046535 | Ga0495586_0026747 | Ga0495586_0026747_366_1454 | 362 |
| 880 | 3300046536 | Ga0495587_0000989 | Ga0495587_0000989_1243_2331 | 362 |
| 881 | 3300046536 | Ga0495587_0005793 | Ga0495587_0005793_5341_6429 | 362 |
| 882 | 3300046538 | Ga0495609_0004230 | Ga0495609_0004230_317_1405 | 362 |
| 883 | 3300046538 | Ga0495609_0006067 | Ga0495609_0006067_2610_3698 | 362 |
| 884 | 3300046542 | Ga0495597_0001245 | Ga0495597_0001245_3966_5054 | 362 |
| 885 | 3300046542 | Ga0495597_0005566 | Ga0495597_0005566_389_1477 | 362 |
| 886 | 3300046542 | Ga0495597_0008380 | Ga0495597_0008380_242_1330 | 362 |
| 887 | 3300046542 | Ga0495597_0015109 | Ga0495597_0015109_2487_3575 | 362 |
| 888 | 3300046542 | Ga0495597_0015948 | Ga0495597_0015948_2215_3303 | 362 |
| 889 | 3300046542 | Ga0495597_0021618 | Ga0495597_0021618_1435_2523 | 362 |
| 890 | 3300046557 | Ga0495622_0005166 | Ga0495622_0005166_4731_5819 | 362 |
| 891 | 3300046557 | Ga0495622_0007233 | Ga0495622_0007233_2665_3753 | 362 |
| 892 | 3300046557 | Ga0495622_0008458 | Ga0495622_0008458_226_1314 | 362 |
| 893 | 3300046558 | Ga0495633_0000612 | Ga0495633_0000612_2507_3595 | 362 |
| 894 | 3300046558 | Ga0495633_0005129 | Ga0495633_0005129_172_1260 | 362 |
| 895 | 3300046615 | Ga0495656_0014077 | Ga0495656_0014077_1786_2874 | 362 |
| 896 | 3300046616 | Ga0495668_0000728 | Ga0495668_0000728_14664_15752 | 362 |
| 897 | 3300046616 | Ga0495668_0001396 | Ga0495668_0001396_17871_18959 | 362 |
| 898 | 3300046616 | Ga0495668_0011121 | Ga0495668_0011121_1739_2827 | 362 |
| 899 | 3300046642 | Ga0495634_0000572 | Ga0495634_0000572_4274_5362 | 362 |
| 900 | 3300046660 | Ga0495625_0000838 | Ga0495625_0000838_20438_21526 | 362 |
| 901 | 3300046660 | Ga0495625_0001956 | Ga0495625_0001956_4349_5437 | 362 |
| 902 | 3300046660 | Ga0495625_0012219 | Ga0495625_0012219_4831_5919 | 362 |
| 903 | 3300046660 | Ga0495625_0018882 | Ga0495625_0018882_2966_4054 | 362 |
| 904 | 3300046660 | Ga0495625_0097604 | Ga0495625_0097604_583_1671 | 362 |
| 905 | 3300046663 | Ga0495635_0000115 | Ga0495635_0000115_31527_32615 | 362 |
| 906 | 3300046663 | Ga0495635_0000594 | Ga0495635_0000594_5325_6413 | 362 |
| 907 | 3300046664 | Ga0495659_0000208 | Ga0495659_0000208_3530_4618 | 362 |
| 908 | 3300046665 | Ga0495661_0000100 | Ga0495661_0000100_8756_9844 | 362 |
| 909 | 3300046665 | Ga0495661_0004882 | Ga0495661_0004882_4936_6024 | 362 |
| 910 | 3300046665 | Ga0495661_0030206 | Ga0495661_0030206_44_1132 | 362 |
| 911 | 3300046665 | Ga0495661_0034374 | Ga0495661_0034374_134_1222 | 362 |
| 912 | 3300046665 | Ga0495661_0071738 | Ga0495661_0071738_484_1572 | 362 |
| 913 | 3300046665 | Ga0495661_0076183 | Ga0495661_0076183_558_1646 | 362 |
| 914 | 3300046665 | Ga0495661_0148413 | Ga0495661_0148413_107_1195 | 362 |
| 915 | 3300046674 | Ga0495588_0005387 | Ga0495588_0005387_1706_2794 | 362 |
| 916 | 3300046674 | Ga0495588_0006858 | Ga0495588_0006858_1613_2701 | 362 |
| 917 | 3300046674 | Ga0495588_0089190 | Ga0495588_0089190_448_1536 | 362 |
| 918 | 3300046679 | Ga0495623_0004300 | Ga0495623_0004300_4617_5705 | 362 |
| 919 | 3300046680 | Ga0495646_0007178 | Ga0495646_0007178_3650_4738 | 362 |
| 920 | 3300046689 | Ga0495613_0007322 | Ga0495613_0007322_5593_6681 | 362 |
| 921 | 3300046689 | Ga0495613_0011859 | Ga0495613_0011859_1893_2981 | 362 |
| 922 | 3300046689 | Ga0495613_0014931 | Ga0495613_0014931_239_1327 | 362 |
| 923 | 3300046691 | Ga0495670_0000596 | Ga0495670_0000596_11994_13082 | 362 |
| 924 | 3300046691 | Ga0495670_0010570 | Ga0495670_0010570_424_1512 | 362 |
| 925 | 3300046692 | Ga0495671_0000066 | Ga0495671_0000066_58553_59641 | 362 |
| 926 | 3300046692 | Ga0495671_0000459 | Ga0495671_0000459_25870_26958 | 362 |
| 927 | 3300046692 | Ga0495671_0000814 | Ga0495671_0000814_11288_12376 | 362 |
| 928 | 3300046692 | Ga0495671_0004212 | Ga0495671_0004212_4994_6082 | 362 |
| 929 | 3300046692 | Ga0495671_0013033 | Ga0495671_0013033_2782_3870 | 362 |
| 930 | 3300046692 | Ga0495671_0014481 | Ga0495671_0014481_747_1835 | 362 |
| 931 | 3300046692 | Ga0495671_0100446 | Ga0495671_0100446_31_1119 | 362 |
| 932 | 3300046694 | Ga0495649_0000404 | Ga0495649_0000404_20539_21627 | 362 |
| 933 | 3300046694 | Ga0495649_0003432 | Ga0495649_0003432_9118_10206 | 362 |
| 934 | 3300046694 | Ga0495649_0004074 | Ga0495649_0004074_4552_5640 | 362 |
| 935 | 3300046694 | Ga0495649_0010434 | Ga0495649_0010434_2999_4087 | 362 |
| 936 | 3300046694 | Ga0495649_0010488 | Ga0495649_0010488_3743_4831 | 362 |
| 937 | 3300046694 | Ga0495649_0012992 | Ga0495649_0012992_2756_3844 | 362 |
| 938 | 3300046794 | Ga0495589_0002746 | Ga0495589_0002746_4268_5356 | 362 |
| 939 | 3300046794 | Ga0495589_0002978 | Ga0495589_0002978_4981_6069 | 362 |
| 940 | 3300046794 | Ga0495589_0003332 | Ga0495589_0003332_7568_8656 | 362 |
| 941 | 3300046794 | Ga0495589_0010325 | Ga0495589_0010325_2089_3177 | 362 |
| 942 | 3300046794 | Ga0495589_0011597 | Ga0495589_0011597_634_1722 | 362 |
| 943 | 3300046810 | Ga0495660_0003045 | Ga0495660_0003045_4881_5969 | 362 |
| 944 | 3300046810 | Ga0495660_0005353 | Ga0495660_0005353_2524_3612 | 362 |
| 945 | 3300046810 | Ga0495660_0006453 | Ga0495660_0006453_2940_4028 | 362 |
| 946 | 3300046810 | Ga0495660_0014849 | Ga0495660_0014849_1508_2596 | 362 |
| 947 | 3300046810 | Ga0495660_0015082 | Ga0495660_0015082_907_1995 | 362 |
| 948 | 3300046810 | Ga0495660_0018297 | Ga0495660_0018297_409_1497 | 362 |
| 949 | 3300046810 | Ga0495660_0018860 | Ga0495660_0018860_590_1678 | 362 |
| 950 | 3300046810 | Ga0495660_0046073 | Ga0495660_0046073_72_1160 | 362 |
| 951 | 3300047317 | Ga0495604_0001248 | Ga0495604_0001248_5285_6373 | 362 |
| 952 | 3300047317 | Ga0495604_0021351 | Ga0495604_0021351_3371_4459 | 362 |
| 953 | 3300047319 | Ga0495674_0005618 | Ga0495674_0005618_8533_9621 | 362 |
| 954 | 3300047320 | Ga0495672_0000185 | Ga0495672_0000185_24449_25537 | 362 |
| 955 | 3300047320 | Ga0495672_0000247 | Ga0495672_0000247_5348_6436 | 362 |
| 956 | 3300047320 | Ga0495672_0002156 | Ga0495672_0002156_6809_7897 | 362 |
| 957 | 3300047320 | Ga0495672_0002436 | Ga0495672_0002436_8929_10017 | 362 |
| 958 | 3300047320 | Ga0495672_0003437 | Ga0495672_0003437_5121_6209 | 362 |
| 959 | 3300047320 | Ga0495672_0008726 | Ga0495672_0008726_2478_3566 | 362 |
| 960 | 3300047320 | Ga0495672_0059405 | Ga0495672_0059405_148_1236 | 362 |
| 961 | 3300047320 | Ga0495672_0069994 | Ga0495672_0069994_666_1754 | 362 |
| 962 | 3300047322 | Ga0495680_0000029 | Ga0495680_0000029_108908_109996 | 362 |
| 963 | 3300047322 | Ga0495680_0019446 | Ga0495680_0019446_4009_5097 | 362 |
| 964 | 3300047322 | Ga0495680_0019504 | Ga0495680_0019504_2433_3521 | 362 |
| 965 | 3300047323 | Ga0495683_0000037 | Ga0495683_0000037_129170_130258 | 362 |
| 966 | 3300047323 | Ga0495683_0000674 | Ga0495683_0000674_23589_24677 | 362 |
| 967 | 3300047323 | Ga0495683_0006806 | Ga0495683_0006806_4747_5835 | 362 |
| 968 | 3300047323 | Ga0495683_0009191 | Ga0495683_0009191_3377_4465 | 362 |
| 969 | 3300047323 | Ga0495683_0014115 | Ga0495683_0014115_2056_3144 | 362 |
| 970 | 3300047323 | Ga0495683_0100629 | Ga0495683_0100629_247_1335 | 362 |
| 971 | 3300047323 | Ga0495683_0118524 | Ga0495683_0118524_48_1136 | 362 |
| 972 | 3300047444 | Ga0495675_0004640 | Ga0495675_0004640_1661_2749 | 362 |
| 973 | 3300047445 | Ga0495677_0001883 | Ga0495677_0001883_4884_5972 | 362 |
| 974 | 3300047446 | Ga0495679_000336 | Ga0495679_000336_15681_16769 | 362 |
| 975 | 3300047446 | Ga0495679_000402 | Ga0495679_000402_21013_22101 | 362 |
| 976 | 3300047446 | Ga0495679_001939 | Ga0495679_001939_2024_3112 | 362 |
| 977 | 3300047446 | Ga0495679_003604 | Ga0495679_003604_2825_3913 | 362 |
| 978 | 3300047446 | Ga0495679_004478 | Ga0495679_004478_1543_2631 | 362 |
| 979 | 3300047447 | Ga0495685_044248 | Ga0495685_044248_78_1166 | 362 |
| 980 | 3300047469 | Ga0495673_0000093 | Ga0495673_0000093_59865_60953 | 362 |
| 981 | 3300047469 | Ga0495673_0000184 | Ga0495673_0000184_39247_40335 | 362 |
| 982 | 3300047469 | Ga0495673_0000760 | Ga0495673_0000760_20445_21533 | 362 |
| 983 | 3300047469 | Ga0495673_0003126 | Ga0495673_0003126_6742_7839 | 362 |
| 984 | 3300047469 | Ga0495673_0008563 | Ga0495673_0008563_131_1219 | 362 |
| 985 | 3300047469 | Ga0495673_0014513 | Ga0495673_0014513_270_1358 | 362 |
| 986 | 3300047470 | Ga0495681_0000082 | Ga0495681_0000082_76403_77491 | 362 |
| 987 | 3300047470 | Ga0495681_0000156 | Ga0495681_0000156_54883_55971 | 362 |
| 988 | 3300047470 | Ga0495681_0001246 | Ga0495681_0001246_15619_16707 | 362 |
| 989 | 3300047470 | Ga0495681_0004206 | Ga0495681_0004206_1295_2383 | 362 |
| 990 | 3300047470 | Ga0495681_0006108 | Ga0495681_0006108_2748_3836 | 362 |
| 991 | 3300047470 | Ga0495681_0010952 | Ga0495681_0010952_31_1119 | 362 |
| 992 | 3300047470 | Ga0495681_0014931 | Ga0495681_0014931_587_1675 | 362 |
| 993 | 3300047472 | Ga0495686_0000789 | Ga0495686_0000789_26200_27288 | 362 |
| 994 | 3300047472 | Ga0495686_0009134 | Ga0495686_0009134_5056_6144 | 362 |
| 995 | 3300047472 | Ga0495686_0181060 | Ga0495686_0181060_83_1171 | 362 |
| 996 | 3300047673 | Ga0495593_0008525 | Ga0495593_0008525_3826_4914 | 362 |
| 997 | 3300047673 | Ga0495593_0086790 | Ga0495593_0086790_374_1462 | 362 |
| 998 | 3300048091 | Ga0495626_0000087 | Ga0495626_0000087_114416_115504 | 362 |
| 999 | 3300048091 | Ga0495626_0000331 | Ga0495626_0000331_28573_29661 | 362 |
| 1000 | 3300048091 | Ga0495626_0000525 | Ga0495626_0000525_22390_23478 | 362 |
| 1001 | 3300048091 | Ga0495626_0003549 | Ga0495626_0003549_2684_3772 | 362 |
| 1002 | 3300048091 | Ga0495626_0004136 | Ga0495626_0004136_7834_8922 | 362 |
| 1003 | 3300048091 | Ga0495626_0006636 | Ga0495626_0006636_1098_2186 | 362 |
| 1004 | 3300048905 | Ga0496102_0000073 | Ga0496102_0000073_37213_38301 | 362 |
| 1005 | 3300048906 | Ga0496103_0000755 | Ga0496103_0000755_6777_7865 | 362 |
| 1006 | 3300048913 | Ga0496110_0039290 | Ga0496110_0039290_2597_3685 | 362 |
| 1007 | 3300048918 | Ga0496115_0038374 | Ga0496115_0038374_1660_2748 | 362 |
| 1008 | 3300048920 | Ga0496117_0015411 | Ga0496117_0015411_3512_4600 | 362 |
| 1009 | 3300048921 | Ga0496118_0003254 | Ga0496118_0003254_12981_14069 | 362 |
| 1010 | 3300048921 | Ga0496118_0041093 | Ga0496118_0041093_1920_3008 | 362 |
| 1011 | 3300048921 | Ga0496118_0072060 | Ga0496118_0072060_108_1196 | 362 |
| 1012 | 3300048924 | Ga0496121_0043621 | Ga0496121_0043621_914_2002 | 362 |
| 1013 | 3300048927 | Ga0496124_0024592 | Ga0496124_0024592_2711_3799 | 362 |
| 1014 | 3300048927 | Ga0496124_0081763 | Ga0496124_0081763_395_1483 | 362 |
| 1015 | 3300048928 | Ga0496125_0035340 | Ga0496125_0035340_443_1531 | 362 |
| 1016 | 3300048928 | Ga0496125_0061303 | Ga0496125_0061303_430_1518 | 362 |
| 1017 | 3300049459 | Ga0495678_000542 | Ga0495678_000542_14759_15847 | 362 |
| 1018 | 3300049459 | Ga0495678_004994 | Ga0495678_004994_284_1372 | 362 |
| 1019 | 3300049459 | Ga0495678_016219 | Ga0495678_016219_1256_2344 | 362 |
| 1020 | 3300049459 | Ga0495678_020921 | Ga0495678_020921_702_1790 | 362 |
| 1021 | 3300049459 | Ga0495678_061258 | Ga0495678_061258_294_1382 | 362 |
| 1022 | 3300049460 | Ga0495682_0000020 | Ga0495682_0000020_187493_188581 | 362 |
| 1023 | 3300049460 | Ga0495682_0000279 | Ga0495682_0000279_31562_32650 | 362 |
| 1024 | 3300049460 | Ga0495682_0011355 | Ga0495682_0011355_590_1678 | 362 |
| 1025 | 3300049460 | Ga0495682_0042637 | Ga0495682_0042637_485_1573 | 362 |
| 1026 | 3300050489 | nmdc:mga03683_11227_c1 | nmdc:mga03683_11227_c1_148_1236 | 362 |
| 1027 | 3300050491 | nmdc:mga00v17_84836_c1 | nmdc:mga00v17_84836_c1_143_1231 | 362 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oyt-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine | 0.9707 | 23 | 360 |
| 7oyz-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d in complex with spermidine | 0.9704 | 23 | 360 |
| 7oyu-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine | 0.9695 | 23 | 360 |
| 7oyy-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine | 0.9676 | 22 | 360 |
| 7oys-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine | 0.9666 | 22 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9878 | 25 | 128 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9745 | 25 | 328 | 3.40.190.10 |
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9693 | 25 | 128 | 3.40.190.10 |
| af_Q2G2A8_37_140_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9688 | 25 | 130 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9685 | 25 | 328 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MU04-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.9923 | 156 | 251 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A530N1C4-F1-model_v4 | deleted | 0.99 | 20 | 342 |
|
| AF-A0A2N3AV69-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.988 | 39 | 362 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A2M7Y8B4-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.9839 | 94 | 362 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A3M4DHW7-F1-model_v4 | deleted | 0.983 | 68 | 362 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar