F488540

General Info

Members Datasets Scaffolds Average Seq Length
1027 445 989 364

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10248924|Ga0207674_102489242
Length 411
Sequence MSASNLPDSALLRGLTQRRLGRRDALRISGLSALGAALAACGVQGKATPGANLSAAPDVVSKFWTGKAKVGHVDFASWPLYMDPKHPQLKQFTKETGIKVNYDVFDSNEVLQTKLLAGNTGYDVVVPSASFLETQIKAGVFQKLDRSKLPNWKNLDPEILRRLALHDPGNEYAVNHMWGTTSLGYNVKKIKAIDPNAPVDSWNMIFDPKEISKFKSCGVSVLDAPDEVIGIALAYLGRDPNSEKDDDLKAAEDLLMKIRPSIRMIHSSQYIDSLANGDICLSLGWSGDVLQAKSRAEEAKQGVDIALSVPKEGTIIWFDMYAIPADAPHPDNAHAFINYMMRPDVAAANSDFVHYANGNAASLQLIDPAVRNDPGVYPPKETMDKLFPNLAHSPEYTRKMNRVWTRFTTGK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
17 2534681786 Brucella suis 92/29 Isolate Unclassified
18 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
19 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
20 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
21 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
22 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
23 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
24 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
25 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
26 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
27 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
28 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
29 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
30 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
31 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
32 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
33 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
34 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
35 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
36 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
37 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
38 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
39 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
209 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
253 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
262 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
265 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
270 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
271 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
272 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
273 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
274 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
275 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
276 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
277 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
278 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
279 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
280 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
297 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
303 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
304 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
323 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
365 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
366 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
378 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
379 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
395 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
396 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
397 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
416 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
435 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
440 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
443 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
444 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
445 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0.29
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 1.56
Rhizoplane 4.38
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_16 2124908027 Bacteria 42770
2 SwRhRL2b_contig_953756 2162886007 Bacteria 6740
3 LJNas_1001711 3300000546 Bacteria 2966
4 Ga0055530_10012102 3300003791 Bacteria 3036
5 Ga0065714_10000072 3300005288 Bacteria 12678
6 Ga0065714_10005237 3300005288 Bacteria 5203
7 Ga0065714_10066226 3300005288 Bacteria 7325
8 Ga0065714_10067131 3300005288 Bacteria 5852
9 Ga0065714_10075957 3300005288 Bacteria 2844
10 Ga0065704_10000383 3300005289 Bacteria 25333
11 Ga0065712_10008655 3300005290 Bacteria 3770
12 Ga0065712_10070719 3300005290 Bacteria 5763
13 Ga0065712_10097359 3300005290 Bacteria 2153
14 Ga0065715_10005206 3300005293 Bacteria 4027
15 Ga0065715_10179943 3300005293 Bacteria 1484
16 Ga0065707_10086325 3300005295 Bacteria 5532
17 Ga0065707_10171212 3300005295 Unclassified 1467
18 Ga0070676_10016552 3300005328 Bacteria 4078
19 Ga0070676_10026332 3300005328 Bacteria 3292
20 Ga0070676_10080007 3300005328 Bacteria 1980
21 Ga0070683_100058980 3300005329 Bacteria 3566
22 Ga0070690_100003222 3300005330 Bacteria 8903
23 Ga0070690_100004347 3300005330 Bacteria 7857
24 Ga0070690_100057243 3300005330 Bacteria 2501
25 Ga0070670_100156086 3300005331 Bacteria 1976
26 Ga0068869_100012109 3300005334 Bacteria 5686
27 Ga0070666_10000962 3300005335 Bacteria 17567
28 Ga0070666_10011348 3300005335 Bacteria 5590
29 Ga0070666_10121936 3300005335 Bacteria 1808
30 Ga0070680_100013082 3300005336 Bacteria 6459
31 Ga0070680_100035452 3300005336 Bacteria 4028
32 Ga0070680_100083582 3300005336 Bacteria 2636
33 Ga0068868_100004028 3300005338 Bacteria 10248
34 Ga0068868_100049291 3300005338 Bacteria 3305
35 Ga0070689_100003911 3300005340 Bacteria 9982
36 Ga0070687_100009013 3300005343 Bacteria 4255
37 Ga0070687_100049552 3300005343 Bacteria 2165
38 Ga0070661_100006248 3300005344 Bacteria 8219
39 Ga0070668_100278649 3300005347 Bacteria 1396
40 Ga0070669_100005076 3300005353 Bacteria 9515
41 Ga0070669_100013419 3300005353 Bacteria 5826
42 Ga0070669_100056750 3300005353 Bacteria 2871
43 Ga0070669_100076753 3300005353 Bacteria 2481
44 Ga0070675_100001269 3300005354 Bacteria 18440
45 Ga0070675_100182374 3300005354 Bacteria 1815
46 Ga0070671_100001534 3300005355 Bacteria 17343
47 Ga0070674_100009909 3300005356 Bacteria 5735
48 Ga0070673_100082082 3300005364 Bacteria 2616
49 Ga0070673_100170866 3300005364 Bacteria 1855
50 Ga0070688_100032026 3300005365 Bacteria 3167
51 Ga0070659_100158956 3300005366 Bacteria 1847
52 Ga0070667_100003021 3300005367 Bacteria 14456
53 Ga0070667_100114387 3300005367 Bacteria 2343
54 Ga0070709_10007519 3300005434 Bacteria 5977
55 Ga0070709_10035426 3300005434 Bacteria 3033
56 Ga0070714_100006553 3300005435 Bacteria 9004
57 Ga0070714_100098538 3300005435 Bacteria 2572
58 Ga0070713_100012067 3300005436 Bacteria 6326
59 Ga0070713_100056713 3300005436 Bacteria 3258
60 Ga0070713_100136448 3300005436 Bacteria 2168
61 Ga0070713_100194413 3300005436 Bacteria 1829
62 Ga0070711_100002860 3300005439 Bacteria 9931
63 Ga0070711_100079964 3300005439 Bacteria 2326
64 Ga0070711_100182802 3300005439 Bacteria 1606
65 Ga0070694_100226894 3300005444 Bacteria 1404
66 Ga0070678_100001008 3300005456 Bacteria 14634
67 Ga0070662_100003902 3300005457 Bacteria 9349
68 Ga0070662_100014075 3300005457 Bacteria 5335
69 Ga0070662_100017390 3300005457 Bacteria 4848
70 Ga0070662_100028108 3300005457 Bacteria 3911
71 Ga0070681_10001577 3300005458 Bacteria 20233
72 Ga0070681_10001582 3300005458 Bacteria 20207
73 Ga0070681_10022982 3300005458 Bacteria 6267
74 Ga0070681_10024376 3300005458 Bacteria 6090
75 Ga0070681_10104148 3300005458 Bacteria 2780
76 Ga0068867_100022954 3300005459 Bacteria 4464
77 Ga0068867_100027329 3300005459 Bacteria 4099
78 Ga0070698_100092786 3300005471 Bacteria 3000
79 Ga0070699_100023197 3300005518 Bacteria 5347
80 Ga0070699_100245641 3300005518 Bacteria 1599
81 Ga0070679_100000469 3300005530 Bacteria 34407
82 Ga0070679_100025516 3300005530 Bacteria 5801
83 Ga0070679_100034185 3300005530 Bacteria 5037
84 Ga0070679_100133096 3300005530 Bacteria 2467
85 Ga0070684_100000389 3300005535 Bacteria 30433
86 Ga0068853_100235807 3300005539 Bacteria 1675
87 Ga0070672_100004629 3300005543 Bacteria 9012
88 Ga0070672_100011940 3300005543 Bacteria 6072
89 Ga0070672_100047307 3300005543 Bacteria 3337
90 Ga0070672_100291995 3300005543 Bacteria 1380
91 Ga0070695_100001122 3300005545 Bacteria 14667
92 Ga0070696_100000233 3300005546 Bacteria 33711
93 Ga0070696_100059238 3300005546 Bacteria 2676
94 Ga0070696_100069992 3300005546 Bacteria 2467
95 Ga0070693_100066758 3300005547 Bacteria 2106
96 Ga0070665_100002122 3300005548 Bacteria 22146
97 Ga0070665_100006304 3300005548 Bacteria 12110
98 Ga0070665_100027331 3300005548 Bacteria 5747
99 Ga0070665_100077491 3300005548 Bacteria 3331
100 Ga0070704_100007227 3300005549 Bacteria 6604
101 Ga0068855_100001482 3300005563 Bacteria 29366
102 Ga0068855_100001944 3300005563 Bacteria 25660
103 Ga0068855_100020801 3300005563 Bacteria 7868
104 Ga0068855_100032489 3300005563 Bacteria 6231
105 Ga0070664_100002633 3300005564 Bacteria 14471
106 Ga0068857_100013260 3300005577 Bacteria 7179
107 Ga0068857_100091965 3300005577 Bacteria 2716
108 Ga0068854_100276653 3300005578 Bacteria 1350
109 Ga0068856_100008652 3300005614 Bacteria 9902
110 Ga0070702_100034486 3300005615 Bacteria 2790
111 Ga0068859_100008619 3300005617 Bacteria 10304
112 Ga0068859_100043274 3300005617 Bacteria 4526
113 Ga0068859_100109922 3300005617 Bacteria 2818
114 Ga0068864_100004892 3300005618 Bacteria 10973
115 Ga0068866_10008386 3300005718 Bacteria 4354
116 Ga0068861_100014206 3300005719 Bacteria 5586
117 Ga0068861_100023752 3300005719 Bacteria 4426
118 Ga0068861_100084466 3300005719 Bacteria 2492
119 Ga0068861_100111892 3300005719 Bacteria 2189
120 Ga0068861_100318503 3300005719 Bacteria 1354
121 Ga0068870_10088817 3300005840 Bacteria 1724
122 Ga0068863_100005440 3300005841 Bacteria 12546
123 Ga0068863_100011401 3300005841 Bacteria 8601
124 Ga0068858_100012168 3300005842 Bacteria 8112
125 Ga0068858_100019147 3300005842 Bacteria 6404
126 Ga0068858_100326704 3300005842 Bacteria 1467
127 Ga0068858_100391105 3300005842 Bacteria 1335
128 Ga0068860_100004196 3300005843 Bacteria 14770
129 Ga0068860_100007155 3300005843 Bacteria 11163
130 Ga0068860_100021474 3300005843 Bacteria 6251
131 Ga0068862_100004849 3300005844 Bacteria 11328
132 Ga0068862_100042263 3300005844 Bacteria 3882
133 Ga0070717_10296058 3300006028 Bacteria 1438
134 Ga0075364_10000792 3300006051 Bacteria 16666
135 Ga0075432_10002709 3300006058 Bacteria 5924
136 Ga0075432_10004298 3300006058 Bacteria 4850
137 Ga0070715_10003057 3300006163 Bacteria 5248
138 Ga0070716_100000449 3300006173 Bacteria 17023
139 Ga0070716_100042537 3300006173 Bacteria 2536
140 Ga0070712_100007685 3300006175 Bacteria 6742
141 Ga0070712_100159298 3300006175 Bacteria 1741
142 Ga0070712_100216295 3300006175 Bacteria 1514
143 Ga0075362_10007547 3300006177 Bacteria 4125
144 Ga0097621_100031096 3300006237 Bacteria 4233
145 Ga0097621_100091567 3300006237 Bacteria 2545
146 Ga0068871_100058698 3300006358 Bacteria 3133
147 Ga0068871_100186058 3300006358 Bacteria 1787
148 Ga0068871_100203953 3300006358 Bacteria 1708
149 Ga0068871_100321155 3300006358 Bacteria 1363
150 Ga0075428_100010582 3300006844 Bacteria 10252
151 Ga0075428_100068346 3300006844 Bacteria 3886
152 Ga0075428_100116803 3300006844 Bacteria 2906
153 Ga0075428_100151919 3300006844 Bacteria 2515
154 Ga0075430_100007468 3300006846 Bacteria 9227
155 Ga0075430_100031773 3300006846 Bacteria 4481
156 Ga0075430_100053905 3300006846 Bacteria 3385
157 Ga0075431_100007866 3300006847 Bacteria 10627
158 Ga0075431_100009924 3300006847 Bacteria 9565
159 Ga0075431_100081783 3300006847 Bacteria 3335
160 Ga0075431_100335748 3300006847 Bacteria 1521
161 Ga0075429_100034978 3300006880 Bacteria 4366
162 Ga0075429_100044334 3300006880 Bacteria 3870
163 Ga0068865_100000735 3300006881 Bacteria 18419
164 Ga0097620_100008619 3300006931 Bacteria 10304
165 Ga0097620_100043275 3300006931 Bacteria 4526
166 Ga0097620_100109919 3300006931 Bacteria 2818
167 Ga0079104_1000068 3300006946 Bacteria 154984
168 Ga0099826_10083695 3300006948 Bacteria 1977
169 Ga0075435_100010333 3300007076 Bacteria 6823
170 Ga0099794_10059459 3300007265 Bacteria 1854
171 Ga0099795_10000022 3300007788 Bacteria 52585
172 Ga0105251_10009643 3300009011 Bacteria 5682
173 Ga0105244_10006047 3300009036 Bacteria 7930
174 Ga0105244_10030412 3300009036 Bacteria 2874
175 Ga0105250_10006223 3300009092 Bacteria 5239
176 Ga0105250_10061266 3300009092 Bacteria 1513
177 Ga0105250_10061724 3300009092 Bacteria 1507
178 Ga0105240_10002127 3300009093 Bacteria 32338
179 Ga0105240_10002705 3300009093 Bacteria 28172
180 Ga0105240_10003826 3300009093 Bacteria 23268
181 Ga0105240_10024889 3300009093 Bacteria 7880
182 Ga0105240_10032775 3300009093 Bacteria 6721
183 Ga0105240_10130983 3300009093 Bacteria 3008
184 Ga0105240_10328419 3300009093 Bacteria 1741
185 Ga0111539_10033108 3300009094 Bacteria 6275
186 Ga0111539_10076554 3300009094 Bacteria 3939
187 Ga0111539_10077583 3300009094 Bacteria 3910
188 Ga0111539_10201499 3300009094 Bacteria 2321
189 Ga0111539_10267558 3300009094 Bacteria 1990
190 Ga0111539_10564067 3300009094 Bacteria 1326
191 Ga0105245_10007920 3300009098 Bacteria 9291
192 Ga0105245_10023209 3300009098 Bacteria 5445
193 Ga0105247_10012409 3300009101 Bacteria 5117
194 Ga0105247_10111901 3300009101 Bacteria 1758
195 Ga0105247_10121127 3300009101 Bacteria 1695
196 Ga0114129_10000367 3300009147 Bacteria 52338
197 Ga0114129_10087255 3300009147 Bacteria 4327
198 Ga0114129_10447332 3300009147 Bacteria 1695
199 Ga0105243_10027562 3300009148 Bacteria 4353
200 Ga0105243_10041735 3300009148 Bacteria 3588
201 Ga0105241_10007997 3300009174 Bacteria 7778
202 Ga0105242_10005298 3300009176 Bacteria 9957
203 Ga0105242_10082584 3300009176 Bacteria 2689
204 Ga0105242_10321662 3300009176 Bacteria 1419
205 Ga0105248_10001404 3300009177 Bacteria 26898
206 Ga0105248_10005489 3300009177 Bacteria 13923
207 Ga0105237_10008371 3300009545 Bacteria 11215
208 Ga0105237_10127911 3300009545 Bacteria 2534
209 Ga0105238_10005376 3300009551 Bacteria 12659
210 Ga0105238_10006381 3300009551 Bacteria 11732
211 Ga0105238_10161450 3300009551 Bacteria 2216
212 Ga0105249_10184405 3300009553 Bacteria 2033
213 Ga0099796_10000025 3300010159 Bacteria 37858
214 Ga0105239_10005723 3300010375 Bacteria 14518
215 Ga0105239_10052494 3300010375 Bacteria 4471
216 Ga0105239_10216510 3300010375 Bacteria 2147
217 Ga0105246_10006341 3300011119 Bacteria 7222
218 Ga0157370_10001472 3300013104 Bacteria 29117
219 Ga0157369_10065057 3300013105 Bacteria 3926
220 Ga0157369_10297375 3300013105 Bacteria 1680
221 Ga0157374_10007656 3300013296 Bacteria 9220
222 Ga0157374_10014556 3300013296 Bacteria 6885
223 Ga0157374_10156555 3300013296 Bacteria 2218
224 Ga0157374_10308818 3300013296 Bacteria 1565
225 Ga0157374_10376833 3300013296 Bacteria 1413
226 Ga0157378_10004873 3300013297 Bacteria 11772
227 Ga0157378_10122887 3300013297 Bacteria 2395
228 Ga0157378_10152685 3300013297 Bacteria 2153
229 Ga0163162_10020035 3300013306 Bacteria 6569
230 Ga0163162_10067923 3300013306 Bacteria 3616
231 Ga0163162_10111624 3300013306 Bacteria 2832
232 Ga0163162_10126118 3300013306 Bacteria 2666
233 Ga0157375_10010708 3300013308 Bacteria 8080
234 Ga0157375_10018198 3300013308 Bacteria 6367
235 Ga0157375_10039263 3300013308 Bacteria 4555
236 Ga0157375_10087488 3300013308 Bacteria 3168
237 Ga0163163_10000485 3300014325 Bacteria 35984
238 Ga0163163_10025005 3300014325 Bacteria 5688
239 Ga0163163_10101260 3300014325 Bacteria 2903
240 Ga0163163_10109176 3300014325 Bacteria 2794
241 Ga0163163_10259556 3300014325 Bacteria 1788
242 Ga0157380_10025900 3300014326 Bacteria 4450
243 Ga0157380_10031338 3300014326 Bacteria 4081
244 Ga0157380_10137624 3300014326 Unclassified 2093
245 Ga0182008_10000655 3300014497 Bacteria 25237
246 Ga0157377_10040514 3300014745 Bacteria 2580
247 Ga0157377_10106531 3300014745 Bacteria 1679
248 Ga0157379_10006630 3300014968 Bacteria 9989
249 Ga0157379_10009851 3300014968 Bacteria 8327
250 Ga0157379_10060155 3300014968 Bacteria 3396
251 Ga0157379_10160111 3300014968 Bacteria 2032
252 Ga0157376_10014926 3300014969 Bacteria 5852
253 Ga0157376_10129844 3300014969 Bacteria 2247
254 Ga0157376_10296935 3300014969 Bacteria 1528
255 Ga0182005_1001019 3300015265 Bacteria 11956
256 Ga0182005_1001549 3300015265 Bacteria 9106
257 Ga0182005_1005470 3300015265 Bacteria 3964
258 Ga0182005_1006564 3300015265 Bacteria 3540
259 Ga0163161_10000986 3300017792 Bacteria 21775
260 Ga0163161_10012623 3300017792 Bacteria 5869
261 Ga0163161_10036963 3300017792 Bacteria 3499
262 Ga0163161_10072485 3300017792 Bacteria 2522
263 Ga0163161_10081043 3300017792 Bacteria 2389
264 Ga0213874_10025026 3300021377 Bacteria 1680
265 Ga0213871_10024524 3300021441 Bacteria 1528
266 Ga0209676_1003062 3300025292 Bacteria 10785
267 Ga0209050_1000229 3300025298 Bacteria 123110
268 Ga0207696_1001869 3300025711 Bacteria 10797
269 Ga0207696_1005521 3300025711 Bacteria 5233
270 Ga0207655_1002567 3300025728 Bacteria 14523
271 Ga0207655_1035489 3300025728 Bacteria 2225
272 Ga0207713_1007553 3300025735 Bacteria 6388
273 Ga0207713_1007696 3300025735 Bacteria 6300
274 Ga0207713_1007941 3300025735 Bacteria 6182
275 Ga0207692_10069265 3300025898 Bacteria 1853
276 Ga0207642_10012317 3300025899 Bacteria 3084
277 Ga0207688_10003915 3300025901 Bacteria 8118
278 Ga0207680_10020513 3300025903 Bacteria 3559
279 Ga0207699_10009239 3300025906 Bacteria 4899
280 Ga0207699_10019729 3300025906 Bacteria 3601
281 Ga0207699_10047568 3300025906 Bacteria 2516
282 Ga0207645_10001223 3300025907 Bacteria 21174
283 Ga0207645_10008199 3300025907 Bacteria 7310
284 Ga0207645_10020611 3300025907 Bacteria 4312
285 Ga0207645_10031001 3300025907 Bacteria 3444
286 Ga0207643_10015755 3300025908 Bacteria 4117
287 Ga0207643_10054417 3300025908 Bacteria 2275
288 Ga0207654_10059460 3300025911 Bacteria 2229
289 Ga0207707_10000122 3300025912 Bacteria 80159
290 Ga0207707_10010048 3300025912 Bacteria 8208
291 Ga0207707_10026203 3300025912 Bacteria 5096
292 Ga0207707_10036563 3300025912 Bacteria 4292
293 Ga0207707_10051542 3300025912 Bacteria 3584
294 Ga0207695_10003540 3300025913 Bacteria 21874
295 Ga0207695_10009529 3300025913 Bacteria 12008
296 Ga0207695_10024867 3300025913 Bacteria 6721
297 Ga0207695_10076336 3300025913 Bacteria 3406
298 Ga0207695_10224006 3300025913 Bacteria 1787
299 Ga0207695_10282383 3300025913 Bacteria 1554
300 Ga0207671_10023246 3300025914 Bacteria 4676
301 Ga0207671_10150432 3300025914 Bacteria 1798
302 Ga0207693_10000083 3300025915 Bacteria 84611
303 Ga0207693_10018817 3300025915 Bacteria 5496
304 Ga0207693_10067420 3300025915 Bacteria 2802
305 Ga0207663_10014494 3300025916 Bacteria 4317
306 Ga0207663_10068245 3300025916 Bacteria 2283
307 Ga0207663_10103380 3300025916 Bacteria 1918
308 Ga0207660_10004896 3300025917 Bacteria 8723
309 Ga0207660_10125130 3300025917 Bacteria 1951
310 Ga0207662_10017279 3300025918 Bacteria 4079
311 Ga0207662_10049888 3300025918 Bacteria 2484
312 Ga0207649_10015857 3300025920 Bacteria 4237
313 Ga0207652_10000613 3300025921 Bacteria 35518
314 Ga0207652_10054368 3300025921 Bacteria 3442
315 Ga0207681_10023771 3300025923 Bacteria 3924
316 Ga0207681_10035475 3300025923 Bacteria 3286
317 Ga0207681_10115901 3300025923 Bacteria 1956
318 Ga0207694_10003403 3300025924 Bacteria 12669
319 Ga0207650_10151323 3300025925 Bacteria 1831
320 Ga0207700_10019447 3300025928 Bacteria 4588
321 Ga0207664_10002133 3300025929 Bacteria 13018
322 Ga0207664_10092412 3300025929 Bacteria 2483
323 Ga0207644_10054804 3300025931 Bacteria 2872
324 Ga0207706_10004326 3300025933 Bacteria 13333
325 Ga0207706_10011127 3300025933 Bacteria 8199
326 Ga0207706_10022865 3300025933 Bacteria 5610
327 Ga0207706_10049227 3300025933 Bacteria 3725
328 Ga0207706_10123377 3300025933 Bacteria 2279
329 Ga0207686_10012915 3300025934 Bacteria 4606
330 Ga0207709_10100092 3300025935 Bacteria 1914
331 Ga0207670_10018344 3300025936 Bacteria 4252
332 Ga0207704_10004318 3300025938 Bacteria 6496
333 Ga0207704_10026508 3300025938 Bacteria 3181
334 Ga0207665_10000587 3300025939 Bacteria 24539
335 Ga0207691_10001448 3300025940 Bacteria 23639
336 Ga0207691_10003491 3300025940 Bacteria 15299
337 Ga0207691_10025122 3300025940 Bacteria 5596
338 Ga0207691_10063046 3300025940 Bacteria 3362
339 Ga0207691_10089162 3300025940 Bacteria 2766
340 Ga0207711_10010034 3300025941 Bacteria 7872
341 Ga0207711_10069829 3300025941 Bacteria 3046
342 Ga0207689_10002923 3300025942 Bacteria 15774
343 Ga0207689_10119325 3300025942 Bacteria 2170
344 Ga0207679_10004598 3300025945 Bacteria 8586
345 Ga0207667_10000798 3300025949 Bacteria 40876
346 Ga0207667_10004634 3300025949 Bacteria 16866
347 Ga0207667_10010115 3300025949 Bacteria 11052
348 Ga0207667_10045147 3300025949 Bacteria 4668
349 Ga0207651_10065531 3300025960 Bacteria 2548
350 Ga0207712_10135138 3300025961 Bacteria 1885
351 Ga0207668_10018342 3300025972 Bacteria 4401
352 Ga0207658_10015483 3300025986 Bacteria 5231
353 Ga0207658_10033045 3300025986 Bacteria 3687
354 Ga0207658_10102880 3300025986 Bacteria 2241
355 Ga0207677_10011599 3300026023 Bacteria 5032
356 Ga0207703_10013397 3300026035 Bacteria 6391
357 Ga0207703_10020264 3300026035 Bacteria 5200
358 Ga0207703_10034034 3300026035 Bacteria 4041
359 Ga0207639_10187658 3300026041 Bacteria 1764
360 Ga0207702_10014159 3300026078 Bacteria 6624
361 Ga0207702_10050952 3300026078 Bacteria 3497
362 Ga0207641_10010458 3300026088 Bacteria 7625
363 Ga0207641_10013892 3300026088 Bacteria 6604
364 Ga0207641_10107192 3300026088 Bacteria 2471
365 Ga0207648_10003080 3300026089 Bacteria 17612
366 Ga0207648_10017129 3300026089 Bacteria 6604
367 Ga0207648_10031254 3300026089 Bacteria 4707
368 Ga0207676_10000965 3300026095 Bacteria 22224
369 Ga0207676_10162691 3300026095 Bacteria 1935
370 Ga0207674_10019239 3300026116 Bacteria 7402
371 Ga0207674_10038183 3300026116 Bacteria 4989
372 Ga0207674_10106883 3300026116 Bacteria 2775
373 Ga0207674_10123226 3300026116 Bacteria 2558
374 Ga0207674_10248924 3300026116 Bacteria 1724
375 Ga0207675_100011407 3300026118 Bacteria 8317
376 Ga0207675_100021455 3300026118 Bacteria 6016
377 Ga0207675_100021604 3300026118 Bacteria 5994
378 Ga0207675_100025193 3300026118 Bacteria 5536
379 Ga0207675_100044724 3300026118 Bacteria 4138
380 Ga0207675_100120239 3300026118 Bacteria 2485
381 Ga0207683_10004897 3300026121 Bacteria 11526
382 Ga0207683_10015951 3300026121 Bacteria 6394
383 Ga0209281_1000168 3300027111 Bacteria 155116
384 Ga0209179_1000130 3300027512 Bacteria 8124
385 Ga0209968_1002478 3300027526 Bacteria 2791
386 Ga0210002_1000931 3300027617 Bacteria 4034
387 Ga0209983_1003838 3300027665 Bacteria 3184
388 Ga0209971_1001319 3300027682 Bacteria 6164
389 Ga0209966_1008616 3300027695 Bacteria 1813
390 Ga0209998_10003556 3300027717 Bacteria 3396
391 Ga0209974_10000854 3300027876 Bacteria 10513
392 Ga0209974_10000908 3300027876 Bacteria 10305
393 Ga0209974_10015078 3300027876 Bacteria 2566
394 Ga0207428_10007665 3300027907 Bacteria 9826
395 Ga0207428_10031774 3300027907 Bacteria 4350
396 Ga0207428_10037263 3300027907 Bacteria 3958
397 Ga0207428_10054420 3300027907 Bacteria 3188
398 Ga0207428_10175028 3300027907 Bacteria 1624
399 Ga0265356_1002354 3300028017 Bacteria 2543
400 Ga0268266_10001602 3300028379 Bacteria 26388
401 Ga0268266_10078755 3300028379 Bacteria 2868
402 Ga0268265_10004447 3300028380 Bacteria 9730
403 Ga0268265_10010052 3300028380 Bacteria 6389
404 Ga0268265_10027069 3300028380 Bacteria 4087
405 Ga0268265_10081988 3300028380 Bacteria 2549
406 Ga0268264_10008436 3300028381 Bacteria 8568
407 Ga0265326_10003138 3300028558 Bacteria 5468
408 Ga0265319_1034522 3300028563 Bacteria 1739
409 Ga0265334_10010215 3300028573 Bacteria 3960
410 Ga0265318_10001836 3300028577 Bacteria 12018
411 Ga0265338_10027362 3300028800 Bacteria 5722
412 Ga0265770_1000007 3300030878 Bacteria 20558
413 Ga0265771_1000279 3300031010 Bacteria 1680
414 Ga0265330_10004483 3300031235 Bacteria 7083
415 Ga0265332_10003174 3300031238 Bacteria 8001
416 Ga0265328_10001169 3300031239 Bacteria 12122
417 Ga0265328_10001255 3300031239 Bacteria 11736
418 Ga0265325_10014663 3300031241 Bacteria 4422
419 Ga0265329_10002693 3300031242 Bacteria 7987
420 Ga0265340_10031574 3300031247 Bacteria 2648
421 Ga0265316_10087366 3300031344 Bacteria 2382
422 Ga0307513_10300521 3300031456 Bacteria 1372
423 Ga0307509_10002372 3300031507 Bacteria 30641
424 Ga0307408_100167094 3300031548 Bacteria 1753
425 Ga0316579_10006989 3300031691 Bacteria 4637
426 Ga0265314_10005988 3300031711 Bacteria 10844
427 Ga0316576_10016733 3300031727 Bacteria 4964
428 Ga0316578_10032798 3300031728 Bacteria 2970
429 Ga0307516_10003963 3300031730 Bacteria 18595
430 Ga0316577_10012050 3300031733 Bacteria 4700
431 Ga0307406_10054867 3300031901 Bacteria 2545
432 Ga0307407_10026194 3300031903 Bacteria 3085
433 Ga0307412_10083076 3300031911 Bacteria 2219
434 Ga0307409_100002517 3300031995 Bacteria 9603
435 Ga0307416_100022288 3300032002 Bacteria 4569
436 Ga0307416_100373857 3300032002 Bacteria 1452
437 Ga0307415_100040526 3300032126 Bacteria 3086
438 Ga0307415_100125851 3300032126 Bacteria 1931
439 Ga0316583_10043007 3300032133 Bacteria 1596
440 Ga0316585_10009072 3300032137 Bacteria 2894
441 Ga0316585_10026871 3300032137 Bacteria 1793
442 Ga0316588_1029669 3300033528 Bacteria 1280
443 Ga0373934_0021534 3300035086 Bacteria 2483
444 Ga0373946_0018068 3300035171 Bacteria 2703
445 Ga0316574_0015922 3300035398 Bacteria 4370
446 Ga0316574_0082030 3300035398 Bacteria 2048
447 Ga0316574_0148528 3300035398 Bacteria 1511
448 Ga0373927_0006326 3300035695 Bacteria 8071
449 Ga0373927_0009759 3300035695 Bacteria 6436
450 Ga0373947_0088407 3300035725 Bacteria 1928
451 Ga0316582_0053540 3300036647 Bacteria 2567
452 Ga0373925_0005652 3300037068 Bacteria 9305
453 Ga0237819_01035 3300038705 Bacteria 8308
454 Ga0436360_0255389 3300039438 Bacteria 5832
455 Ga0436360_0257108 3300039438 Bacteria 2602
456 Ga0436363_0564042 3300039450 Bacteria 1560
457 Ga0436363_0826655 3300039450 Bacteria 1865
458 Ga0436362_0359256 3300039453 Bacteria 3298
459 Ga0439438_000155 3300041405 Bacteria 31230
460 Ga0439438_006304 3300041405 Bacteria 4211
461 Ga0439447_000840 3300041407 Bacteria 11258
462 Ga0439447_007663 3300041407 Bacteria 3401
463 Ga0439466_0001516 3300041411 Bacteria 9079
464 Ga0439466_0010091 3300041411 Bacteria 3512
465 Ga0439466_0015719 3300041411 Bacteria 2748
466 Ga0439432_014891 3300042006 Bacteria 2629
467 Ga0439451_001251 3300042009 Bacteria 5025
468 Ga0439452_001295 3300042010 Bacteria 10559
469 Ga0439456_000015 3300042013 Bacteria 66691
470 Ga0450920_000277 3300042122 Bacteria 7716
471 Ga0450922_000055 3300042124 Bacteria 10075
472 Ga0450896_005081 3300042133 Bacteria 1792
473 Ga0450902_000197 3300042137 Bacteria 7063
474 Ga0450902_000877 3300042137 Bacteria 3916
475 Ga0450903_001073 3300042138 Bacteria 5210
476 Ga0450904_000756 3300042139 Bacteria 5594
477 Ga0450905_003315 3300042142 Bacteria 2113
478 Ga0450906_011247 3300042145 Bacteria 1677
479 Ga0450907_000997 3300042146 Bacteria 6667
480 Ga0451577_0013334 3300042876 Bacteria 7697
481 Ga0451577_0062323 3300042876 Bacteria 3326
482 Ga0451577_0112387 3300042876 Bacteria 2438
483 Ga0466969_0002997 3300044656 Bacteria 8993
484 Ga0466969_0003345 3300044656 Bacteria 8536
485 Ga0466969_0053179 3300044656 Bacteria 1988
486 Ga0466966_0004455 3300044684 Bacteria 9235
487 Ga0466966_0087835 3300044684 Bacteria 1932
488 Ga0466961_0001050 3300044693 Bacteria 17009
489 Ga0466964_0022702 3300044706 Bacteria 2436
490 Ga0453684_0167831 3300044712 Bacteria 2589
491 Ga0466971_0009912 3300044719 Bacteria 4161
492 Ga0466970_0007100 3300044765 Bacteria 5603
493 Ga0466957_0004657 3300044842 Bacteria 7664
494 Ga0466959_0035356 3300045049 Bacteria 3696
495 Ga0466959_0060878 3300045049 Bacteria 2746
496 Ga0466959_0144119 3300045049 Bacteria 1681
497 Ga0451576_0023197 3300045051 Bacteria 6722
498 Ga0451576_0077150 3300045051 Bacteria 3467
499 Ga0451576_0079861 3300045051 Bacteria 3404
500 Ga0495617_000474 3300046452 Bacteria 21327
501 Ga0495617_003460 3300046452 Bacteria 5939
502 Ga0495617_003692 3300046452 Bacteria 5708
503 Ga0495617_004104 3300046452 Bacteria 5348
504 Ga0495617_006049 3300046452 Bacteria 4262
505 Ga0495617_012387 3300046452 Bacteria 2905
506 Ga0495617_061351 3300046452 Bacteria 1243
507 Ga0495627_000534 3300046453 Bacteria 31440
508 Ga0495627_000640 3300046453 Bacteria 27419
509 Ga0495627_007012 3300046453 Bacteria 4369
510 Ga0495627_012974 3300046453 Bacteria 2941
511 Ga0495627_052243 3300046453 Bacteria 1226
512 Ga0495592_0005399 3300046454 Bacteria 9435
513 Ga0495603_0001283 3300046455 Bacteria 14634
514 Ga0495603_0005913 3300046455 Bacteria 7313
515 Ga0495590_0000130 3300046457 Bacteria 44477
516 Ga0495590_0003711 3300046457 Bacteria 6217
517 Ga0495590_0005128 3300046457 Bacteria 5212
518 Ga0495590_0010681 3300046457 Bacteria 3441
519 Ga0495591_000021 3300046458 Bacteria 203554
520 Ga0495591_000150 3300046458 Bacteria 73568
521 Ga0495591_000273 3300046458 Bacteria 48617
522 Ga0495591_002178 3300046458 Bacteria 11216
523 Ga0495591_002505 3300046458 Bacteria 10150
524 Ga0495591_007189 3300046458 Bacteria 4769
525 Ga0495591_008436 3300046458 Bacteria 4220
526 Ga0495591_009648 3300046458 Bacteria 3815
527 Ga0495629_0000490 3300046459 Bacteria 33122
528 Ga0495629_0013707 3300046459 Bacteria 5850
529 Ga0495629_0111232 3300046459 Bacteria 1910
530 Ga0495638_0000947 3300046460 Bacteria 29436
531 Ga0495638_0001168 3300046460 Bacteria 25231
532 Ga0495638_0001991 3300046460 Bacteria 17423
533 Ga0495638_0002314 3300046460 Bacteria 15692
534 Ga0495638_0003073 3300046460 Bacteria 13255
535 Ga0495638_0005036 3300046460 Bacteria 9915
536 Ga0495638_0007477 3300046460 Bacteria 7829
537 Ga0495638_0008564 3300046460 Bacteria 7239
538 Ga0495638_0009288 3300046460 Bacteria 6911
539 Ga0495638_0009651 3300046460 Bacteria 6751
540 Ga0495638_0018895 3300046460 Bacteria 4568
541 Ga0495638_0020025 3300046460 Bacteria 4422
542 Ga0495638_0028419 3300046460 Bacteria 3612
543 Ga0495638_0115045 3300046460 Bacteria 1594
544 Ga0495641_0012212 3300046461 Bacteria 4821
545 Ga0495653_0070080 3300046463 Bacteria 2624
546 Ga0495650_0003285 3300046471 Bacteria 11957
547 Ga0495650_0004517 3300046471 Bacteria 9500
548 Ga0495650_0005241 3300046471 Bacteria 8506
549 Ga0495650_0009160 3300046471 Bacteria 5669
550 Ga0495650_0022637 3300046471 Bacteria 3010
551 Ga0495580_0002317 3300046472 Bacteria 16600
552 Ga0495580_0097407 3300046472 Bacteria 2046
553 Ga0495580_0131295 3300046472 Bacteria 1737
554 Ga0495582_0003939 3300046473 Bacteria 8341
555 Ga0495582_0010605 3300046473 Bacteria 5069
556 Ga0495605_0000480 3300046474 Bacteria 35032
557 Ga0495605_0002173 3300046474 Bacteria 12250
558 Ga0495605_0002997 3300046474 Bacteria 10199
559 Ga0495605_0006888 3300046474 Bacteria 6491
560 Ga0495639_0004319 3300046475 Bacteria 6095
561 Ga0495639_0005800 3300046475 Bacteria 5314
562 Ga0495639_0022287 3300046475 Bacteria 2778
563 Ga0495584_0000067 3300046491 Bacteria 73689
564 Ga0495584_0000917 3300046491 Bacteria 18791
565 Ga0495584_0001601 3300046491 Bacteria 13348
566 Ga0495584_0020071 3300046491 Bacteria 3394
567 Ga0495584_0083289 3300046491 Bacteria 1610
568 Ga0495585_0000030 3300046492 Bacteria 145184
569 Ga0495585_0000056 3300046492 Bacteria 113739
570 Ga0495585_0000335 3300046492 Bacteria 45891
571 Ga0495585_0000871 3300046492 Bacteria 25767
572 Ga0495585_0003232 3300046492 Bacteria 11116
573 Ga0495585_0003534 3300046492 Bacteria 10511
574 Ga0495585_0005465 3300046492 Bacteria 8005
575 Ga0495585_0006863 3300046492 Bacteria 7022
576 Ga0495585_0062042 3300046492 Bacteria 2053
577 Ga0495594_0001605 3300046499 Bacteria 11772
578 Ga0495594_0002194 3300046499 Bacteria 10147
579 Ga0495596_0000012 3300046500 Bacteria 125996
580 Ga0495596_0006906 3300046500 Bacteria 5172
581 Ga0495607_0001305 3300046501 Bacteria 22209
582 Ga0495607_0006997 3300046501 Bacteria 7853
583 Ga0495607_0012999 3300046501 Bacteria 5473
584 Ga0495607_0014897 3300046501 Bacteria 5053
585 Ga0495607_0020256 3300046501 Bacteria 4209
586 Ga0495583_0000112 3300046506 Bacteria 138078
587 Ga0495583_0003028 3300046506 Bacteria 13394
588 Ga0495583_0004042 3300046506 Bacteria 10794
589 Ga0495606_0002318 3300046507 Bacteria 22431
590 Ga0495606_0004165 3300046507 Bacteria 14658
591 Ga0495606_0007763 3300046507 Bacteria 9494
592 Ga0495606_0009647 3300046507 Bacteria 8131
593 Ga0495606_0083686 3300046507 Bacteria 1977
594 Ga0495610_0003225 3300046512 Bacteria 12903
595 Ga0495610_0003495 3300046512 Bacteria 12221
596 Ga0495610_0004389 3300046512 Bacteria 10438
597 Ga0495610_0004415 3300046512 Bacteria 10403
598 Ga0495610_0010870 3300046512 Bacteria 5619
599 Ga0495610_0014754 3300046512 Bacteria 4574
600 Ga0495610_0017503 3300046512 Bacteria 4083
601 Ga0495610_0030494 3300046512 Bacteria 2825
602 Ga0495616_0000251 3300046513 Bacteria 43349
603 Ga0495616_0001505 3300046513 Bacteria 16092
604 Ga0495616_0003694 3300046513 Bacteria 9775
605 Ga0495616_0006088 3300046513 Bacteria 7354
606 Ga0495616_0011509 3300046513 Bacteria 5063
607 Ga0495616_0020835 3300046513 Bacteria 3561
608 Ga0495616_0048391 3300046513 Bacteria 2137
609 Ga0495620_0000860 3300046515 Bacteria 18785
610 Ga0495620_0003461 3300046515 Bacteria 9033
611 Ga0495620_0004610 3300046515 Bacteria 7747
612 Ga0495620_0009266 3300046515 Bacteria 5242
613 Ga0495630_0003131 3300046517 Bacteria 11476
614 Ga0495630_0022286 3300046517 Bacteria 4679
615 Ga0495631_0000002 3300046518 Bacteria 178694
616 Ga0495631_0005996 3300046518 Bacteria 6321
617 Ga0495631_0008277 3300046518 Bacteria 5243
618 Ga0495632_0002079 3300046519 Bacteria 15668
619 Ga0495632_0003562 3300046519 Bacteria 10990
620 Ga0495632_0004142 3300046519 Bacteria 9959
621 Ga0495632_0004772 3300046519 Bacteria 9129
622 Ga0495632_0005080 3300046519 Bacteria 8801
623 Ga0495632_0006324 3300046519 Bacteria 7641
624 Ga0495632_0007608 3300046519 Bacteria 6776
625 Ga0495632_0008901 3300046519 Bacteria 6099
626 Ga0495632_0009802 3300046519 Bacteria 5736
627 Ga0495632_0014646 3300046519 Bacteria 4428
628 Ga0495632_0077697 3300046519 Bacteria 1587
629 Ga0495632_0096544 3300046519 Bacteria 1396
630 Ga0495637_0000246 3300046520 Bacteria 42500
631 Ga0495637_0001056 3300046520 Bacteria 17210
632 Ga0495637_0002226 3300046520 Bacteria 10798
633 Ga0495637_0003199 3300046520 Bacteria 8740
634 Ga0495637_0003357 3300046520 Bacteria 8514
635 Ga0495637_0004380 3300046520 Bacteria 7321
636 Ga0495637_0013128 3300046520 Bacteria 3939
637 Ga0495643_0004092 3300046522 Bacteria 10388
638 Ga0495643_0010664 3300046522 Bacteria 5646
639 Ga0495644_0000025 3300046523 Bacteria 75756
640 Ga0495644_0000545 3300046523 Bacteria 15914
641 Ga0495648_0000246 3300046524 Bacteria 61159
642 Ga0495648_0000981 3300046524 Bacteria 29447
643 Ga0495648_0001566 3300046524 Bacteria 22326
644 Ga0495648_0002585 3300046524 Bacteria 16582
645 Ga0495648_0007688 3300046524 Bacteria 8592
646 Ga0495648_0015779 3300046524 Bacteria 5464
647 Ga0495648_0026386 3300046524 Bacteria 3912
648 Ga0495648_0034013 3300046524 Bacteria 3323
649 Ga0495666_0002299 3300046526 Bacteria 9524
650 Ga0495666_0006761 3300046526 Bacteria 5765
651 Ga0495666_0035650 3300046526 Bacteria 2424
652 Ga0495642_0000003 3300046528 Bacteria 185425
653 Ga0495642_0000245 3300046528 Bacteria 30611
654 Ga0495654_0000225 3300046530 Bacteria 52679
655 Ga0495654_0003093 3300046530 Bacteria 10351
656 Ga0495654_0003282 3300046530 Bacteria 9979
657 Ga0495654_0004064 3300046530 Bacteria 8786
658 Ga0495654_0007273 3300046530 Bacteria 6202
659 Ga0495654_0011129 3300046530 Bacteria 4884
660 Ga0495654_0017099 3300046530 Bacteria 3818
661 Ga0495654_0033827 3300046530 Bacteria 2584
662 Ga0495654_0042546 3300046530 Bacteria 2254
663 Ga0495654_0043339 3300046530 Bacteria 2230
664 Ga0495586_0026747 3300046535 Bacteria 3087
665 Ga0495586_0033140 3300046535 Bacteria 2772
666 Ga0495587_0000989 3300046536 Bacteria 18668
667 Ga0495587_0005793 3300046536 Bacteria 8045
668 Ga0495609_0004230 3300046538 Bacteria 7930
669 Ga0495609_0006067 3300046538 Bacteria 6222
670 Ga0495609_0008112 3300046538 Bacteria 5170
671 Ga0495621_0001365 3300046539 Bacteria 6314
672 Ga0495597_0001245 3300046542 Bacteria 18852
673 Ga0495597_0001251 3300046542 Bacteria 18767
674 Ga0495597_0005566 3300046542 Bacteria 6649
675 Ga0495597_0008380 3300046542 Bacteria 5182
676 Ga0495597_0015109 3300046542 Bacteria 3660
677 Ga0495597_0015948 3300046542 Bacteria 3552
678 Ga0495597_0021618 3300046542 Bacteria 2989
679 Ga0495645_0018444 3300046543 Bacteria 5011
680 Ga0495645_0133200 3300046543 Bacteria 1740
681 Ga0495622_0004166 3300046557 Bacteria 6746
682 Ga0495622_0005166 3300046557 Bacteria 6051
683 Ga0495622_0007233 3300046557 Bacteria 5153
684 Ga0495622_0008458 3300046557 Bacteria 4764
685 Ga0495633_0000612 3300046558 Bacteria 33866
686 Ga0495633_0005129 3300046558 Bacteria 8125
687 Ga0495656_0004477 3300046615 Bacteria 4790
688 Ga0495656_0014077 3300046615 Bacteria 2991
689 Ga0495668_0000728 3300046616 Bacteria 39499
690 Ga0495668_0001396 3300046616 Bacteria 23512
691 Ga0495668_0011121 3300046616 Bacteria 5407
692 Ga0495634_0000572 3300046642 Bacteria 35710
693 Ga0495634_0006857 3300046642 Bacteria 8617
694 Ga0495634_0011150 3300046642 Bacteria 6555
695 Ga0495611_0002819 3300046648 Bacteria 7775
696 Ga0495625_0000838 3300046660 Bacteria 42224
697 Ga0495625_0001956 3300046660 Bacteria 23279
698 Ga0495625_0012219 3300046660 Bacteria 6964
699 Ga0495625_0018882 3300046660 Bacteria 5368
700 Ga0495625_0034474 3300046660 Bacteria 3736
701 Ga0495625_0053431 3300046660 Bacteria 2889
702 Ga0495625_0081578 3300046660 Bacteria 2251
703 Ga0495625_0097604 3300046660 Bacteria 2022
704 Ga0495635_0000115 3300046663 Bacteria 47781
705 Ga0495635_0000594 3300046663 Bacteria 23281
706 Ga0495635_0060343 3300046663 Bacteria 2607
707 Ga0495635_0196965 3300046663 Bacteria 1367
708 Ga0495659_0000208 3300046664 Bacteria 25391
709 Ga0495659_0035154 3300046664 Bacteria 1765
710 Ga0495661_0000100 3300046665 Bacteria 104957
711 Ga0495661_0004882 3300046665 Bacteria 9600
712 Ga0495661_0030206 3300046665 Bacteria 3453
713 Ga0495661_0034374 3300046665 Bacteria 3190
714 Ga0495661_0071738 3300046665 Bacteria 2022
715 Ga0495661_0076183 3300046665 Bacteria 1947
716 Ga0495661_0148413 3300046665 Bacteria 1268
717 Ga0495588_0005387 3300046674 Bacteria 5689
718 Ga0495588_0006858 3300046674 Bacteria 5159
719 Ga0495588_0024007 3300046674 Bacteria 3025
720 Ga0495588_0089190 3300046674 Bacteria 1614
721 Ga0495623_0004300 3300046679 Bacteria 9372
722 Ga0495646_0003836 3300046680 Bacteria 9393
723 Ga0495646_0007178 3300046680 Bacteria 7075
724 Ga0495647_0006055 3300046681 Bacteria 3986
725 Ga0495658_0012040 3300046683 Bacteria 4369
726 Ga0495658_0012173 3300046683 Bacteria 4347
727 Ga0495658_0022014 3300046683 Bacteria 3367
728 Ga0495613_0001100 3300046689 Bacteria 20643
729 Ga0495613_0007322 3300046689 Bacteria 8217
730 Ga0495613_0008530 3300046689 Bacteria 7605
731 Ga0495613_0011859 3300046689 Bacteria 6476
732 Ga0495613_0014931 3300046689 Bacteria 5763
733 Ga0495624_0000975 3300046690 Bacteria 22598
734 Ga0495670_0000596 3300046691 Bacteria 17241
735 Ga0495670_0010570 3300046691 Bacteria 4536
736 Ga0495671_0000066 3300046692 Bacteria 105167
737 Ga0495671_0000459 3300046692 Bacteria 31939
738 Ga0495671_0000814 3300046692 Bacteria 22295
739 Ga0495671_0001652 3300046692 Bacteria 14603
740 Ga0495671_0004212 3300046692 Bacteria 8659
741 Ga0495671_0004620 3300046692 Bacteria 8178
742 Ga0495671_0010838 3300046692 Bacteria 5039
743 Ga0495671_0013033 3300046692 Bacteria 4521
744 Ga0495671_0014481 3300046692 Bacteria 4243
745 Ga0495671_0100446 3300046692 Bacteria 1414
746 Ga0495649_0000404 3300046694 Bacteria 37432
747 Ga0495649_0003432 3300046694 Bacteria 10695
748 Ga0495649_0004074 3300046694 Bacteria 9614
749 Ga0495649_0005118 3300046694 Bacteria 8414
750 Ga0495649_0010434 3300046694 Bacteria 5477
751 Ga0495649_0010488 3300046694 Bacteria 5464
752 Ga0495649_0010623 3300046694 Bacteria 5424
753 Ga0495649_0012992 3300046694 Bacteria 4820
754 Ga0495589_0002746 3300046794 Bacteria 9739
755 Ga0495589_0002978 3300046794 Bacteria 9333
756 Ga0495589_0003332 3300046794 Bacteria 8718
757 Ga0495589_0004860 3300046794 Bacteria 7129
758 Ga0495589_0010325 3300046794 Bacteria 4849
759 Ga0495589_0011597 3300046794 Bacteria 4575
760 Ga0495660_0003045 3300046810 Bacteria 10458
761 Ga0495660_0005353 3300046810 Bacteria 7684
762 Ga0495660_0006453 3300046810 Bacteria 6937
763 Ga0495660_0014849 3300046810 Bacteria 4503
764 Ga0495660_0015082 3300046810 Bacteria 4468
765 Ga0495660_0018297 3300046810 Bacteria 4027
766 Ga0495660_0018860 3300046810 Bacteria 3961
767 Ga0495660_0038757 3300046810 Bacteria 2648
768 Ga0495660_0046073 3300046810 Bacteria 2392
769 Ga0495581_0000838 3300047315 Bacteria 16367
770 Ga0495604_0001248 3300047317 Bacteria 20850
771 Ga0495604_0021351 3300047317 Bacteria 5168
772 Ga0495674_0005618 3300047319 Bacteria 12021
773 Ga0495672_0000185 3300047320 Bacteria 90160
774 Ga0495672_0000247 3300047320 Bacteria 75920
775 Ga0495672_0002156 3300047320 Bacteria 18395
776 Ga0495672_0002436 3300047320 Bacteria 17130
777 Ga0495672_0003437 3300047320 Bacteria 13558
778 Ga0495672_0006184 3300047320 Bacteria 9337
779 Ga0495672_0006235 3300047320 Bacteria 9300
780 Ga0495672_0008726 3300047320 Bacteria 7433
781 Ga0495672_0014421 3300047320 Bacteria 5412
782 Ga0495672_0059405 3300047320 Bacteria 2212
783 Ga0495672_0069994 3300047320 Bacteria 1989
784 Ga0495676_0007185 3300047321 Bacteria 10215
785 Ga0495676_0177801 3300047321 Bacteria 1493
786 Ga0495680_0000029 3300047322 Bacteria 112033
787 Ga0495680_0019446 3300047322 Bacteria 5732
788 Ga0495680_0019504 3300047322 Bacteria 5720
789 Ga0495680_0115936 3300047322 Bacteria 1981
790 Ga0495683_0000037 3300047323 Bacteria 140632
791 Ga0495683_0000674 3300047323 Bacteria 25217
792 Ga0495683_0006806 3300047323 Bacteria 6212
793 Ga0495683_0009191 3300047323 Bacteria 5267
794 Ga0495683_0014115 3300047323 Bacteria 4162
795 Ga0495683_0100629 3300047323 Bacteria 1390
796 Ga0495683_0118524 3300047323 Bacteria 1258
797 Ga0495675_0004640 3300047444 Bacteria 8349
798 Ga0495677_0001883 3300047445 Bacteria 8384
799 Ga0495679_000336 3300047446 Bacteria 37066
800 Ga0495679_000402 3300047446 Bacteria 32396
801 Ga0495679_001939 3300047446 Bacteria 11047
802 Ga0495679_003604 3300047446 Bacteria 7393
803 Ga0495679_004478 3300047446 Bacteria 6425
804 Ga0495685_044248 3300047447 Bacteria 1518
805 Ga0495673_0000093 3300047469 Bacteria 185841
806 Ga0495673_0000184 3300047469 Bacteria 101002
807 Ga0495673_0000760 3300047469 Bacteria 30610
808 Ga0495673_0003126 3300047469 Bacteria 11084
809 Ga0495673_0008563 3300047469 Bacteria 5734
810 Ga0495673_0014513 3300047469 Bacteria 4093
811 Ga0495673_0023907 3300047469 Bacteria 2962
812 Ga0495681_0000082 3300047470 Bacteria 83609
813 Ga0495681_0000156 3300047470 Bacteria 57235
814 Ga0495681_0001246 3300047470 Bacteria 19318
815 Ga0495681_0004206 3300047470 Bacteria 9870
816 Ga0495681_0006108 3300047470 Bacteria 7958
817 Ga0495681_0007287 3300047470 Bacteria 7097
818 Ga0495681_0010952 3300047470 Bacteria 5445
819 Ga0495681_0014931 3300047470 Bacteria 4425
820 Ga0495684_0005960 3300047471 Bacteria 9468
821 Ga0495686_0000789 3300047472 Bacteria 41293
822 Ga0495686_0009134 3300047472 Bacteria 7181
823 Ga0495686_0045490 3300047472 Bacteria 2777
824 Ga0495686_0181060 3300047472 Bacteria 1221
825 Ga0495593_0008525 3300047673 Bacteria 5959
826 Ga0495593_0086790 3300047673 Bacteria 1613
827 Ga0495602_0001183 3300048088 Bacteria 25616
828 Ga0495602_0048266 3300048088 Bacteria 3828
829 Ga0495626_0000087 3300048091 Bacteria 122878
830 Ga0495626_0000331 3300048091 Bacteria 50083
831 Ga0495626_0000525 3300048091 Bacteria 38289
832 Ga0495626_0003549 3300048091 Bacteria 9956
833 Ga0495626_0004136 3300048091 Bacteria 9007
834 Ga0495626_0006636 3300048091 Bacteria 6560
835 Ga0495626_0010989 3300048091 Bacteria 4804
836 Ga0496100_0003273 3300048903 Bacteria 8417
837 Ga0496101_0014908 3300048904 Bacteria 5230
838 Ga0496102_0000073 3300048905 Bacteria 149887
839 Ga0496102_0006064 3300048905 Bacteria 10305
840 Ga0496102_0172769 3300048905 Bacteria 2034
841 Ga0496102_0188412 3300048905 Bacteria 1944
842 Ga0496102_0293371 3300048905 Bacteria 1533
843 Ga0496103_0000755 3300048906 Bacteria 23849
844 Ga0496103_0039847 3300048906 Bacteria 2887
845 Ga0496103_0085825 3300048906 Bacteria 1984
846 Ga0496104_0007070 3300048907 Bacteria 9899
847 Ga0496104_0032491 3300048907 Bacteria 4857
848 Ga0496104_0045553 3300048907 Bacteria 4126
849 Ga0496104_0250296 3300048907 Bacteria 1684
850 Ga0496105_0001071 3300048908 Bacteria 18940
851 Ga0496105_0010006 3300048908 Bacteria 7441
852 Ga0496105_0094327 3300048908 Bacteria 2471
853 Ga0496105_0137051 3300048908 Bacteria 2016
854 Ga0496105_0254820 3300048908 Bacteria 1421
855 Ga0496106_0013682 3300048909 Bacteria 5992
856 Ga0496106_0016835 3300048909 Bacteria 5409
857 Ga0496107_0001015 3300048910 Bacteria 16758
858 Ga0496108_0033953 3300048911 Bacteria 4237
859 Ga0496109_0006467 3300048912 Bacteria 9867
860 Ga0496109_0011659 3300048912 Bacteria 7559
861 Ga0496109_0011744 3300048912 Bacteria 7536
862 Ga0496110_0000749 3300048913 Bacteria 22420
863 Ga0496110_0016249 3300048913 Bacteria 6210
864 Ga0496110_0039290 3300048913 Bacteria 4120
865 Ga0496110_0233382 3300048913 Bacteria 1673
866 Ga0496111_0005059 3300048914 Bacteria 8392
867 Ga0496111_0030020 3300048914 Bacteria 3864
868 Ga0496112_0011589 3300048915 Bacteria 8060
869 Ga0496112_0011995 3300048915 Bacteria 7946
870 Ga0496112_0068238 3300048915 Bacteria 3511
871 Ga0496113_0016702 3300048916 Bacteria 5075
872 Ga0496113_0043997 3300048916 Bacteria 3306
873 Ga0496113_0291445 3300048916 Bacteria 1306
874 Ga0496114_0004273 3300048917 Bacteria 11058
875 Ga0496114_0004355 3300048917 Bacteria 10956
876 Ga0496115_0013919 3300048918 Bacteria 6087
877 Ga0496115_0016363 3300048918 Bacteria 5646
878 Ga0496115_0038374 3300048918 Bacteria 3801
879 Ga0496117_0015411 3300048920 Bacteria 6519
880 Ga0496118_0003254 3300048921 Bacteria 20709
881 Ga0496118_0026400 3300048921 Bacteria 4950
882 Ga0496118_0041093 3300048921 Bacteria 3666
883 Ga0496118_0072060 3300048921 Bacteria 2484
884 Ga0496119_0002302 3300048922 Bacteria 21116
885 Ga0496120_0002631 3300048923 Bacteria 17782
886 Ga0496121_0043621 3300048924 Bacteria 3880
887 Ga0496121_0052891 3300048924 Bacteria 3406
888 Ga0496124_0024592 3300048927 Bacteria 5471
889 Ga0496124_0081763 3300048927 Bacteria 2653
890 Ga0496125_0035340 3300048928 Bacteria 4386
891 Ga0496125_0061303 3300048928 Bacteria 3017
892 Ga0495678_000542 3300049459 Bacteria 36459
893 Ga0495678_004994 3300049459 Bacteria 7476
894 Ga0495678_011420 3300049459 Bacteria 4255
895 Ga0495678_016219 3300049459 Bacteria 3412
896 Ga0495678_020921 3300049459 Bacteria 2887
897 Ga0495678_061258 3300049459 Bacteria 1412
898 Ga0495682_0000020 3300049460 Bacteria 210849
899 Ga0495682_0000279 3300049460 Bacteria 40020
900 Ga0495682_0011355 3300049460 Bacteria 3429
901 Ga0495682_0042637 3300049460 Bacteria 1663
902 Ga0501034_0078672 3300049571 Bacteria 3301
903 Ga0501034_0114590 3300049571 Bacteria 2684
904 Ga0501034_0124515 3300049571 Bacteria 2563
905 Ga0501034_0143140 3300049571 Bacteria 2370
906 Ga0501036_0016758 3300049572 Bacteria 6121
907 Ga0501038_0003978 3300049574 Bacteria 13728
908 Ga0501039_0007453 3300049575 Bacteria 8349
909 Ga0501039_0028547 3300049575 Bacteria 4295
910 Ga0501039_0130473 3300049575 Bacteria 1972
911 Ga0501040_0002910 3300049576 Bacteria 11068
912 Ga0501040_0027158 3300049576 Bacteria 3852
913 Ga0501041_0020253 3300049577 Bacteria 3975
914 Ga0501042_0004113 3300049578 Bacteria 9244
915 Ga0501042_0024795 3300049578 Bacteria 4209
916 Ga0501042_0230246 3300049578 Bacteria 1337
917 Ga0501043_0113733 3300049579 Bacteria 2125
918 Ga0501046_0006557 3300049580 Bacteria 10291
919 Ga0501048_0000282 3300049582 Bacteria 34461
920 Ga0501048_0001950 3300049582 Bacteria 15676
921 Ga0501068_0001757 3300049584 Bacteria 11522
922 Ga0501068_0021133 3300049584 Bacteria 3799
923 Ga0501068_0026405 3300049584 Bacteria 3421
924 Ga0501069_0165234 3300049585 Bacteria 1275
925 Ga0501070_0085056 3300049586 Bacteria 2618
926 Ga0501071_0099108 3300049587 Bacteria 2147
927 Ga0501072_0001734 3300049588 Bacteria 16263
928 Ga0501073_0008757 3300049589 Bacteria 7490
929 Ga0501073_0070336 3300049589 Bacteria 2438
930 Ga0501074_0004678 3300049590 Bacteria 9797
931 Ga0501074_0005711 3300049590 Bacteria 8970
932 Ga0501074_0047764 3300049590 Bacteria 3093
933 Ga0501074_0086539 3300049590 Bacteria 2245
934 Ga0501076_0000955 3300049592 Bacteria 18891
935 Ga0501238_000771 3300049671 Bacteria 3617
936 Ga0501079_0000142 3300049741 Bacteria 39341
937 Ga0501079_0001187 3300049741 Bacteria 18244
938 Ga0501079_0002370 3300049741 Bacteria 13690
939 Ga0501080_0002846 3300049742 Bacteria 15209
940 Ga0501080_0069979 3300049742 Bacteria 3263
941 Ga0501080_0080217 3300049742 Bacteria 3033
942 Ga0501080_0104938 3300049742 Bacteria 2621
943 Ga0501081_0000147 3300049743 Bacteria 32041
944 Ga0501081_0000552 3300049743 Bacteria 21253
945 Ga0501083_0081976 3300049744 Bacteria 2138
946 Ga0501035_0159671 3300049822 Bacteria 1952
947 Ga0501035_0265255 3300049822 Bacteria 1455
948 Ga0501044_0146499 3300049823 Bacteria 2346
949 Ga0501045_0000401 3300049824 Bacteria 26284
950 Ga0501045_0069893 3300049824 Bacteria 2582
951 nmdc:mga03683_11227_c1 3300050489 Bacteria 3236
952 nmdc:mga00v17_525_c1 3300050491 Bacteria 21487
953 nmdc:mga00v17_84836_c1 3300050491 Bacteria 1983
954 nmdc:mga05p37_234465_c1 3300050507 Bacteria 2210
955 nmdc:mga05p37_277179_c1 3300050507 Bacteria 2001
956 nmdc:mga09592_108376_c1 3300050508 Bacteria 2382
957 nmdc:mga09592_218298_c1 3300050508 Bacteria 1652
958 nmdc:mga09592_28022_c1 3300050508 Bacteria 4677
959 nmdc:mga09592_53045_c1 3300050508 Bacteria 3423
960 nmdc:mga09592_7612_c1 3300050508 Bacteria 8811
961 nmdc:mga0qj67_148576_c1 3300050509 Bacteria 1900
962 nmdc:mga0qj67_195516_c1 3300050509 Bacteria 1643
963 nmdc:mga0qj67_4366_c1 3300050509 Bacteria 10243
964 nmdc:mga0qj67_5391_c1 3300050509 Bacteria 9335
965 nmdc:mga06r32_13988_c1 3300050510 Bacteria 7279
966 nmdc:mga06r32_70979_c1 3300050510 Bacteria 3369
967 nmdc:mga08y16_109806_c1 3300050511 Bacteria 2872
968 nmdc:mga08y16_14457_c1 3300050511 Bacteria 8303
969 nmdc:mga08y16_205111_c1 3300050511 Bacteria 2043
970 nmdc:mga08y16_2161_c1 3300050511 Bacteria 20167
971 nmdc:mga0n895_249507_c1 3300050512 Bacteria 1801
972 nmdc:mga0rr50_36990_c1 3300050513 Bacteria 3520
973 Ga0495619_0011851 3300053085 Bacteria 5491
974 Ga0500586_036145 3300053145 Bacteria 1655
975 Ga0500588_0061140 3300053146 Bacteria 1207
976 Ga0500616_0006666 3300053153 Bacteria 7509
977 Ga0500616_0010386 3300053153 Bacteria 5573
978 Ga0500622_0023584 3300053156 Bacteria 3258
979 Ga0500636_0116461 3300053177 Bacteria 1504
980 Ga0500637_0014962 3300053178 Bacteria 4100
981 Ga0500637_0064324 3300053178 Bacteria 2104
982 Ga0501084_0008950 3300054114 Bacteria 8282
983 Ga0501084_0012410 3300054114 Bacteria 7060
984 Ga0501082_0005214 3300060353 Bacteria 11299
985 Ga0501082_0013531 3300060353 Bacteria 7010
986 Ga0501082_0083364 3300060353 Bacteria 2758
987 Ga0466962_0024978 3300061719 Bacteria 2868
988 Ga0530510_0009039 3300061734 Bacteria 6983
989 Ga0530510_0040239 3300061734 Bacteria 3373

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0001950 Ga0501048_0001950_1405_2442 311
2 3300005353 Ga0070669_100056750 Ga0070669_1000567501 317
3 3300009094 Ga0111539_10564067 Ga0111539_105640671 317
4 3300025925 Ga0207650_10151323 Ga0207650_101513232 321
5 3300049571 Ga0501034_0124515 Ga0501034_0124515_675_1742 323
6 3300005331 Ga0070670_100156086 Ga0070670_1001560862 324
7 iso_pu_bacteria 2954011201 2954014668 324
8 3300005434 Ga0070709_10007519 Ga0070709_100075194 327
9 3300014325 Ga0163163_10259556 Ga0163163_102595562 332
10 3300049575 Ga0501039_0130473 Ga0501039_0130473_385_1482 333
11 3300005354 Ga0070675_100182374 Ga0070675_1001823742 340
12 3300005548 Ga0070665_100077491 Ga0070665_1000774912 341
13 3300005563 Ga0068855_100032489 Ga0068855_1000324893 341
14 3300009093 Ga0105240_10002127 Ga0105240_100021279 341
15 3300009545 Ga0105237_10008371 Ga0105237_100083716 341
16 3300013296 Ga0157374_10156555 Ga0157374_101565552 341
17 3300025913 Ga0207695_10009529 Ga0207695_100095294 341
18 3300025949 Ga0207667_10004634 Ga0207667_100046346 341
19 3300028379 Ga0268266_10078755 Ga0268266_100787552 341
20 3300050510 nmdc:mga06r32_13988_c1 nmdc:mga06r32_13988_c1_5946_7085 341
21 3300053146 Ga0500588_0061140 Ga0500588_0061140_42_1190 341
22 3300005328 Ga0070676_10080007 Ga0070676_100800072 342
23 3300005340 Ga0070689_100003911 Ga0070689_10000391110 342
24 3300005353 Ga0070669_100076753 Ga0070669_1000767532 342
25 3300005457 Ga0070662_100028108 Ga0070662_1000281082 342
26 3300005546 Ga0070696_100069992 Ga0070696_1000699922 342
27 3300009093 Ga0105240_10032775 Ga0105240_100327753 342
28 3300009094 Ga0111539_10077583 Ga0111539_100775831 342
29 3300013308 Ga0157375_10010708 Ga0157375_100107081 342
30 3300021377 Ga0213874_10025026 Ga0213874_100250262 342
31 3300025907 Ga0207645_10020611 Ga0207645_100206114 342
32 3300025912 Ga0207707_10051542 Ga0207707_100515423 342
33 3300025933 Ga0207706_10011127 Ga0207706_100111272 342
34 3300025972 Ga0207668_10018342 Ga0207668_100183422 342
35 3300026116 Ga0207674_10038183 Ga0207674_100381832 342
36 3300026118 Ga0207675_100025193 Ga0207675_1000251932 342
37 3300035695 Ga0373927_0006326 Ga0373927_0006326_6841_7974 342
38 3300044656 Ga0466969_0003345 Ga0466969_0003345_2737_3765 342
39 3300044684 Ga0466966_0087835 Ga0466966_0087835_416_1444 342
40 3300045049 Ga0466959_0035356 Ga0466959_0035356_1196_2224 342
41 3300046519 Ga0495632_0077697 Ga0495632_0077697_55_1212 342
42 3300005290 Ga0065712_10070719 Ga0065712_100707193 343
43 3300005293 Ga0065715_10179943 Ga0065715_101799431 343
44 3300005329 Ga0070683_100058980 Ga0070683_1000589802 343
45 3300005330 Ga0070690_100003222 Ga0070690_1000032228 343
46 3300005334 Ga0068869_100012109 Ga0068869_1000121092 343
47 3300005335 Ga0070666_10121936 Ga0070666_101219362 343
48 3300005338 Ga0068868_100049291 Ga0068868_1000492913 343
49 3300005343 Ga0070687_100009013 Ga0070687_1000090132 343
50 3300005344 Ga0070661_100006248 Ga0070661_1000062487 343
51 3300005354 Ga0070675_100001269 Ga0070675_10000126910 343
52 3300005364 Ga0070673_100170866 Ga0070673_1001708662 343
53 3300005365 Ga0070688_100032026 Ga0070688_1000320263 343
54 3300005459 Ga0068867_100027329 Ga0068867_1000273293 343
55 3300005535 Ga0070684_100000389 Ga0070684_10000038927 343
56 3300005543 Ga0070672_100011940 Ga0070672_1000119402 343
57 3300005564 Ga0070664_100002633 Ga0070664_10000263311 343
58 3300005577 Ga0068857_100013260 Ga0068857_1000132602 343
59 3300005615 Ga0070702_100034486 Ga0070702_1000344862 343
60 3300005617 Ga0068859_100008619 Ga0068859_1000086196 343
61 3300005618 Ga0068864_100004892 Ga0068864_1000048923 343
62 3300005841 Ga0068863_100005440 Ga0068863_1000054407 343
63 3300005842 Ga0068858_100326704 Ga0068858_1003267042 343
64 3300005843 Ga0068860_100021474 Ga0068860_1000214744 343
65 3300005844 Ga0068862_100004849 Ga0068862_1000048491 343
66 3300006237 Ga0097621_100031096 Ga0097621_1000310964 343
67 3300006931 Ga0097620_100008619 Ga0097620_1000086196 343
68 3300009101 Ga0105247_10012409 Ga0105247_100124096 343
69 3300009101 Ga0105247_10111901 Ga0105247_101119012 343
70 3300009177 Ga0105248_10001404 Ga0105248_1000140410 343
71 3300010375 Ga0105239_10216510 Ga0105239_102165102 343
72 3300013296 Ga0157374_10308818 Ga0157374_103088182 343
73 3300014325 Ga0163163_10000485 Ga0163163_100004852 343
74 3300014745 Ga0157377_10040514 Ga0157377_100405143 343
75 3300014968 Ga0157379_10160111 Ga0157379_101601112 343
76 3300017792 Ga0163161_10081043 Ga0163161_100810432 343
77 3300025901 Ga0207688_10003915 Ga0207688_100039157 343
78 3300025903 Ga0207680_10020513 Ga0207680_100205132 343
79 3300025908 Ga0207643_10054417 Ga0207643_100544172 343
80 3300025918 Ga0207662_10017279 Ga0207662_100172792 343
81 3300025920 Ga0207649_10015857 Ga0207649_100158573 343
82 3300025936 Ga0207670_10018344 Ga0207670_100183443 343
83 3300025940 Ga0207691_10025122 Ga0207691_100251225 343
84 3300025942 Ga0207689_10002923 Ga0207689_100029233 343
85 3300025945 Ga0207679_10004598 Ga0207679_100045983 343
86 3300025961 Ga0207712_10135138 Ga0207712_101351381 343
87 3300026023 Ga0207677_10011599 Ga0207677_100115994 343
88 3300026035 Ga0207703_10020264 Ga0207703_100202644 343
89 3300026088 Ga0207641_10013892 Ga0207641_100138924 343
90 3300026089 Ga0207648_10017129 Ga0207648_100171296 343
91 3300026095 Ga0207676_10000965 Ga0207676_1000096514 343
92 3300026116 Ga0207674_10019239 Ga0207674_100192392 343
93 3300026121 Ga0207683_10015951 Ga0207683_100159513 343
94 3300028380 Ga0268265_10027069 Ga0268265_100270694 343
95 3300028381 Ga0268264_10008436 Ga0268264_100084364 343
96 3300039450 Ga0436363_0826655 Ga0436363_0826655_631_1851 343
97 3300045051 Ga0451576_0023197 Ga0451576_0023197_4434_5573 343
98 3300048909 Ga0496106_0016835 Ga0496106_0016835_624_1763 343
99 3300048915 Ga0496112_0068238 Ga0496112_0068238_664_1803 343
100 3300035171 Ga0373946_0018068 Ga0373946_0018068_80_1165 344
101 3300035695 Ga0373927_0009759 Ga0373927_0009759_3684_4769 344
102 3300035725 Ga0373947_0088407 Ga0373947_0088407_682_1767 344
103 3300037068 Ga0373925_0005652 Ga0373925_0005652_5921_7006 344
104 3300046455 Ga0495603_0001283 Ga0495603_0001283_4466_5551 344
105 3300046459 Ga0495629_0000490 Ga0495629_0000490_16267_17352 344
106 3300046461 Ga0495641_0012212 Ga0495641_0012212_14_1099 344
107 3300046473 Ga0495582_0003939 Ga0495582_0003939_2378_3463 344
108 3300046475 Ga0495639_0005800 Ga0495639_0005800_794_1879 344
109 3300046499 Ga0495594_0001605 Ga0495594_0001605_1011_2096 344
110 3300046557 Ga0495622_0004166 Ga0495622_0004166_3636_4721 344
111 3300046642 Ga0495634_0006857 Ga0495634_0006857_4578_5663 344
112 3300046663 Ga0495635_0060343 Ga0495635_0060343_881_1966 344
113 3300046674 Ga0495588_0024007 Ga0495588_0024007_1638_2723 344
114 3300046683 Ga0495658_0012173 Ga0495658_0012173_1382_2467 344
115 3300046689 Ga0495613_0008530 Ga0495613_0008530_5978_7063 344
116 3300047315 Ga0495581_0000838 Ga0495581_0000838_6155_7240 344
117 3300047321 Ga0495676_0177801 Ga0495676_0177801_319_1404 344
118 3300047322 Ga0495680_0115936 Ga0495680_0115936_106_1191 344
119 3300050512 nmdc:mga0n895_249507_c1 nmdc:mga0n895_249507_c1_265_1401 344
120 3300053085 Ga0495619_0011851 Ga0495619_0011851_3557_4642 344
121 3300007788 Ga0099795_10000022 Ga0099795_1000002215 345
122 3300009098 Ga0105245_10023209 Ga0105245_100232094 345
123 3300009551 Ga0105238_10161450 Ga0105238_101614502 345
124 3300010159 Ga0099796_10000025 Ga0099796_1000002519 345
125 3300013296 Ga0157374_10014556 Ga0157374_100145564 345
126 3300013306 Ga0163162_10111624 Ga0163162_101116244 345
127 3300014325 Ga0163163_10025005 Ga0163163_100250057 345
128 3300014968 Ga0157379_10009851 Ga0157379_100098512 345
129 3300014969 Ga0157376_10014926 Ga0157376_100149264 345
130 3300027512 Ga0209179_1000130 Ga0209179_10001307 345
131 3300048907 Ga0496104_0007070 Ga0496104_0007070_5926_7056 345
132 3300048908 Ga0496105_0094327 Ga0496105_0094327_1248_2378 345
133 3300048911 Ga0496108_0033953 Ga0496108_0033953_1446_2576 345
134 3300048912 Ga0496109_0006467 Ga0496109_0006467_3171_4301 345
135 3300048913 Ga0496110_0016249 Ga0496110_0016249_739_1869 345
136 3300048914 Ga0496111_0030020 Ga0496111_0030020_1479_2609 345
137 3300049571 Ga0501034_0114590 Ga0501034_0114590_402_1451 345
138 3300049586 Ga0501070_0085056 Ga0501070_0085056_583_1632 345
139 3300049590 Ga0501074_0047764 Ga0501074_0047764_1693_2742 345
140 3300049742 Ga0501080_0069979 Ga0501080_0069979_1345_2394 345
141 3300049822 Ga0501035_0265255 Ga0501035_0265255_85_1134 345
142 3300049823 Ga0501044_0146499 Ga0501044_0146499_677_1726 345
143 3300060353 Ga0501082_0083364 Ga0501082_0083364_139_1296 345
144 3300006051 Ga0075364_10000792 Ga0075364_100007927 346
145 3300046457 Ga0495590_0010681 Ga0495590_0010681_15_1175 346
146 3300046660 Ga0495625_0081578 Ga0495625_0081578_1059_2219 346
147 3300046694 Ga0495649_0010623 Ga0495649_0010623_3793_4881 346
148 3300049584 Ga0501068_0001757 Ga0501068_0001757_8198_9352 346
149 3300049589 Ga0501073_0008757 Ga0501073_0008757_2015_3169 346
150 3300049590 Ga0501074_0004678 Ga0501074_0004678_7466_8620 346
151 3300049741 Ga0501079_0000142 Ga0501079_0000142_29942_31096 346
152 3300049742 Ga0501080_0002846 Ga0501080_0002846_4003_5157 346
153 3300050491 nmdc:mga00v17_525_c1 nmdc:mga00v17_525_c1_7689_8819 346
154 3300005330 Ga0070690_100004347 Ga0070690_1000043473 347
155 3300005335 Ga0070666_10000962 Ga0070666_100009627 347
156 3300005338 Ga0068868_100004028 Ga0068868_1000040282 347
157 3300005355 Ga0070671_100001534 Ga0070671_1000015343 347
158 3300005366 Ga0070659_100158956 Ga0070659_1001589562 347
159 3300005434 Ga0070709_10035426 Ga0070709_100354262 347
160 3300005436 Ga0070713_100012067 Ga0070713_1000120675 347
161 3300005439 Ga0070711_100002860 Ga0070711_1000028603 347
162 3300005456 Ga0070678_100001008 Ga0070678_1000010082 347
163 3300005539 Ga0068853_100235807 Ga0068853_1002358072 347
164 3300005547 Ga0070693_100066758 Ga0070693_1000667582 347
165 3300005548 Ga0070665_100027331 Ga0070665_1000273313 347
166 3300005614 Ga0068856_100008652 Ga0068856_1000086524 347
167 3300005718 Ga0068866_10008386 Ga0068866_100083863 347
168 3300005842 Ga0068858_100019147 Ga0068858_1000191473 347
169 3300006163 Ga0070715_10003057 Ga0070715_100030574 347
170 3300006173 Ga0070716_100000449 Ga0070716_1000004496 347
171 3300006358 Ga0068871_100058698 Ga0068871_1000586982 347
172 3300006358 Ga0068871_100321155 Ga0068871_1003211551 347
173 3300006881 Ga0068865_100000735 Ga0068865_10000073514 347
174 3300009098 Ga0105245_10007920 Ga0105245_100079208 347
175 3300009174 Ga0105241_10007997 Ga0105241_100079976 347
176 3300009176 Ga0105242_10005298 Ga0105242_100052986 347
177 3300009177 Ga0105248_10005489 Ga0105248_1000548913 347
178 3300010375 Ga0105239_10005723 Ga0105239_100057236 347
179 3300013308 Ga0157375_10039263 Ga0157375_100392633 347
180 3300014325 Ga0163163_10101260 Ga0163163_101012602 347
181 3300025899 Ga0207642_10012317 Ga0207642_100123172 347
182 3300025906 Ga0207699_10009239 Ga0207699_100092392 347
183 3300025906 Ga0207699_10019729 Ga0207699_100197293 347
184 3300025914 Ga0207671_10023246 Ga0207671_100232463 347
185 3300025915 Ga0207693_10000083 Ga0207693_1000008322 347
186 3300025916 Ga0207663_10014494 Ga0207663_100144943 347
187 3300025928 Ga0207700_10019447 Ga0207700_100194474 347
188 3300025931 Ga0207644_10054804 Ga0207644_100548042 347
189 3300025934 Ga0207686_10012915 Ga0207686_100129153 347
190 3300025938 Ga0207704_10004318 Ga0207704_100043183 347
191 3300025939 Ga0207665_10000587 Ga0207665_1000058719 347
192 3300025941 Ga0207711_10069829 Ga0207711_100698292 347
193 3300025942 Ga0207689_10119325 Ga0207689_101193252 347
194 3300025960 Ga0207651_10065531 Ga0207651_100655312 347
195 3300025986 Ga0207658_10033045 Ga0207658_100330452 347
196 3300026035 Ga0207703_10034034 Ga0207703_100340342 347
197 3300026041 Ga0207639_10187658 Ga0207639_101876582 347
198 3300026078 Ga0207702_10014159 Ga0207702_100141594 347
199 3300026088 Ga0207641_10107192 Ga0207641_101071922 347
200 3300026121 Ga0207683_10004897 Ga0207683_1000489711 347
201 3300031548 Ga0307408_100167094 Ga0307408_1001670942 347
202 3300046460 Ga0495638_0001991 Ga0495638_0001991_11724_12812 347
203 3300046474 Ga0495605_0002997 Ga0495605_0002997_3967_5055 347
204 3300046492 Ga0495585_0000871 Ga0495585_0000871_10876_11964 347
205 3300046507 Ga0495606_0083686 Ga0495606_0083686_54_1142 347
206 3300046513 Ga0495616_0006088 Ga0495616_0006088_3771_4859 347
207 3300046518 Ga0495631_0008277 Ga0495631_0008277_1682_2770 347
208 3300046520 Ga0495637_0003199 Ga0495637_0003199_3508_4596 347
209 3300046524 Ga0495648_0002585 Ga0495648_0002585_7865_8953 347
210 3300046538 Ga0495609_0008112 Ga0495609_0008112_580_1668 347
211 3300046648 Ga0495611_0002819 Ga0495611_0002819_3591_4679 347
212 3300046660 Ga0495625_0053431 Ga0495625_0053431_1578_2666 347
213 3300046692 Ga0495671_0004620 Ga0495671_0004620_5528_6616 347
214 3300046694 Ga0495649_0005118 Ga0495649_0005118_542_1630 347
215 3300046794 Ga0495589_0004860 Ga0495589_0004860_3621_4709 347
216 3300046810 Ga0495660_0038757 Ga0495660_0038757_510_1598 347
217 3300047469 Ga0495673_0023907 Ga0495673_0023907_1328_2416 347
218 3300048091 Ga0495626_0010989 Ga0495626_0010989_1279_2367 347
219 3300048903 Ga0496100_0003273 Ga0496100_0003273_2711_3844 347
220 3300048905 Ga0496102_0006064 Ga0496102_0006064_6558_7691 347
221 3300048906 Ga0496103_0085825 Ga0496103_0085825_50_1183 347
222 3300048907 Ga0496104_0250296 Ga0496104_0250296_373_1506 347
223 3300048908 Ga0496105_0010006 Ga0496105_0010006_3155_4288 347
224 3300048909 Ga0496106_0013682 Ga0496106_0013682_2559_3692 347
225 3300048910 Ga0496107_0001015 Ga0496107_0001015_7374_8507 347
226 3300048913 Ga0496110_0000749 Ga0496110_0000749_13521_14654 347
227 3300048914 Ga0496111_0005059 Ga0496111_0005059_6193_7326 347
228 3300048916 Ga0496113_0043997 Ga0496113_0043997_1260_2393 347
229 3300048916 Ga0496113_0291445 Ga0496113_0291445_95_1201 347
230 3300048917 Ga0496114_0004273 Ga0496114_0004273_7558_8691 347
231 3300048918 Ga0496115_0016363 Ga0496115_0016363_3155_4288 347
232 3300049459 Ga0495678_011420 Ga0495678_011420_1792_2880 347
233 3300053145 Ga0500586_036145 Ga0500586_036145_222_1310 347
234 3300005295 Ga0065707_10171212 Ga0065707_101712122 348
235 3300005328 Ga0070676_10016552 Ga0070676_100165523 348
236 3300005353 Ga0070669_100013419 Ga0070669_1000134193 348
237 3300005543 Ga0070672_100047307 Ga0070672_1000473073 348
238 3300006173 Ga0070716_100042537 Ga0070716_1000425372 348
239 3300014326 Ga0157380_10137624 Ga0157380_101376242 348
240 3300025907 Ga0207645_10031001 Ga0207645_100310011 348
241 3300025913 Ga0207695_10024867 Ga0207695_100248673 348
242 3300025915 Ga0207693_10067420 Ga0207693_100674202 348
243 3300025923 Ga0207681_10023771 Ga0207681_100237714 348
244 3300025933 Ga0207706_10049227 Ga0207706_100492272 348
245 3300025940 Ga0207691_10063046 Ga0207691_100630462 348
246 3300026118 Ga0207675_100044724 Ga0207675_1000447242 348
247 3300028380 Ga0268265_10010052 Ga0268265_100100522 348
248 3300031507 Ga0307509_10002372 Ga0307509_100023729 348
249 3300031691 Ga0316579_10006989 Ga0316579_100069894 348
250 3300032002 Ga0307416_100022288 Ga0307416_1000222883 348
251 3300032133 Ga0316583_10043007 Ga0316583_100430071 348
252 3300032137 Ga0316585_10026871 Ga0316585_100268712 348
253 3300035398 Ga0316574_0015922 Ga0316574_0015922_1443_2540 348
254 3300036647 Ga0316582_0053540 Ga0316582_0053540_1351_2448 348
255 3300045051 Ga0451576_0079861 Ga0451576_0079861_1956_3119 348
256 3300046460 Ga0495638_0020025 Ga0495638_0020025_2115_3323 348
257 3300046660 Ga0495625_0034474 Ga0495625_0034474_1813_3021 348
258 3300049744 Ga0501083_0081976 Ga0501083_0081976_902_1984 348
259 2162886007 SwRhRL2b_contig_953756 SwRhRL2b_0708.00001080 349
260 3300005289 Ga0065704_10000383 Ga0065704_1000038316 349
261 3300005295 Ga0065707_10086325 Ga0065707_100863252 349
262 3300006846 Ga0075430_100053905 Ga0075430_1000539052 349
263 3300014969 Ga0157376_10129844 Ga0157376_101298442 349
264 3300025906 Ga0207699_10047568 Ga0207699_100475682 349
265 3300028558 Ga0265326_10003138 Ga0265326_100031382 349
266 3300028563 Ga0265319_1034522 Ga0265319_10345222 349
267 3300028573 Ga0265334_10010215 Ga0265334_100102152 349
268 3300028577 Ga0265318_10001836 Ga0265318_100018366 349
269 3300028800 Ga0265338_10027362 Ga0265338_100273623 349
270 3300031235 Ga0265330_10004483 Ga0265330_100044835 349
271 3300031238 Ga0265332_10003174 Ga0265332_100031747 349
272 3300031241 Ga0265325_10014663 Ga0265325_100146632 349
273 3300031242 Ga0265329_10002693 Ga0265329_100026934 349
274 3300031344 Ga0265316_10087366 Ga0265316_100873662 349
275 3300031711 Ga0265314_10005988 Ga0265314_100059881 349
276 3300031903 Ga0307407_10026194 Ga0307407_100261942 349
277 3300031995 Ga0307409_100002517 Ga0307409_1000025176 349
278 3300032126 Ga0307415_100040526 Ga0307415_1000405262 349
279 3300047320 Ga0495672_0014421 Ga0495672_0014421_925_2064 349
280 3300048921 Ga0496118_0026400 Ga0496118_0026400_3809_4897 349
281 3300048922 Ga0496119_0002302 Ga0496119_0002302_10150_11295 349
282 3300048923 Ga0496120_0002631 Ga0496120_0002631_14056_15201 349
283 3300005330 Ga0070690_100057243 Ga0070690_1000572434 350
284 3300005335 Ga0070666_10011348 Ga0070666_100113482 350
285 3300005343 Ga0070687_100049552 Ga0070687_1000495522 350
286 3300005367 Ga0070667_100003021 Ga0070667_1000030219 350
287 3300005548 Ga0070665_100006304 Ga0070665_1000063049 350
288 3300005549 Ga0070704_100007227 Ga0070704_1000072274 350
289 3300005577 Ga0068857_100091965 Ga0068857_1000919652 350
290 3300005617 Ga0068859_100043274 Ga0068859_1000432742 350
291 3300005719 Ga0068861_100111892 Ga0068861_1001118922 350
292 3300005841 Ga0068863_100011401 Ga0068863_1000114013 350
293 3300005842 Ga0068858_100012168 Ga0068858_1000121689 350
294 3300005843 Ga0068860_100004196 Ga0068860_1000041967 350
295 3300006237 Ga0097621_100091567 Ga0097621_1000915674 350
296 3300006847 Ga0075431_100007866 Ga0075431_1000078669 350
297 3300006931 Ga0097620_100043275 Ga0097620_1000432752 350
298 3300009094 Ga0111539_10201499 Ga0111539_102014992 350
299 3300013308 Ga0157375_10087488 Ga0157375_100874882 350
300 3300014326 Ga0157380_10031338 Ga0157380_100313383 350
301 3300025918 Ga0207662_10049888 Ga0207662_100498882 350
302 3300025941 Ga0207711_10010034 Ga0207711_100100342 350
303 3300025986 Ga0207658_10015483 Ga0207658_100154832 350
304 3300026035 Ga0207703_10013397 Ga0207703_100133972 350
305 3300026088 Ga0207641_10010458 Ga0207641_100104582 350
306 3300026095 Ga0207676_10162691 Ga0207676_101626912 350
307 3300026116 Ga0207674_10106883 Ga0207674_101068832 350
308 3300026116 Ga0207674_10123226 Ga0207674_101232262 350
309 3300031727 Ga0316576_10016733 Ga0316576_100167334 350
310 3300031728 Ga0316578_10032798 Ga0316578_100327982 350
311 3300031733 Ga0316577_10012050 Ga0316577_100120502 350
312 3300031901 Ga0307406_10054867 Ga0307406_100548672 350
313 3300032126 Ga0307415_100125851 Ga0307415_1001258512 350
314 3300032137 Ga0316585_10009072 Ga0316585_100090723 350
315 3300033528 Ga0316588_1029669 Ga0316588_10296692 350
316 3300039453 Ga0436362_0359256 Ga0436362_0359256_1747_2829 350
317 3300049571 Ga0501034_0078672 Ga0501034_0078672_1722_2816 350
318 3300050509 nmdc:mga0qj67_4366_c1 nmdc:mga0qj67_4366_c1_8054_9193 350
319 iso_pu_bacteria 2511231027 2511389348 350
320 iso_pu_bacteria 2765235802 2765464326 350
321 iso_pu_bacteria 2842871566 2842873045 350
322 iso_pu_bacteria 2928521798 2928521975 350
323 3300005347 Ga0070668_100278649 Ga0070668_1002786491 351
324 3300005457 Ga0070662_100014075 Ga0070662_1000140752 351
325 3300005546 Ga0070696_100059238 Ga0070696_1000592382 351
326 3300005719 Ga0068861_100318503 Ga0068861_1003185031 351
327 3300006175 Ga0070712_100159298 Ga0070712_1001592982 351
328 3300006846 Ga0075430_100007468 Ga0075430_1000074689 351
329 3300006880 Ga0075429_100034978 Ga0075429_1000349783 351
330 3300007076 Ga0075435_100010333 Ga0075435_1000103336 351
331 3300009094 Ga0111539_10267558 Ga0111539_102675583 351
332 3300009147 Ga0114129_10000367 Ga0114129_1000036751 351
333 3300009147 Ga0114129_10447332 Ga0114129_104473322 351
334 3300009176 Ga0105242_10082584 Ga0105242_100825842 351
335 3300013296 Ga0157374_10376833 Ga0157374_103768332 351
336 3300013297 Ga0157378_10152685 Ga0157378_101526852 351
337 3300013306 Ga0163162_10126118 Ga0163162_101261181 351
338 3300014325 Ga0163163_10109176 Ga0163163_101091762 351
339 3300014969 Ga0157376_10296935 Ga0157376_102969352 351
340 3300025915 Ga0207693_10018817 Ga0207693_100188173 351
341 3300025933 Ga0207706_10123377 Ga0207706_101233772 351
342 3300026118 Ga0207675_100120239 Ga0207675_1001202392 351
343 3300031456 Ga0307513_10300521 Ga0307513_103005211 351
344 3300035398 Ga0316574_0082030 Ga0316574_0082030_559_1704 351
345 3300042133 Ga0450896_005081 Ga0450896_005081_26_1147 351
346 3300042876 Ga0451577_0013334 Ga0451577_0013334_1058_2227 351
347 3300044712 Ga0453684_0167831 Ga0453684_0167831_591_1760 351
348 3300045051 Ga0451576_0077150 Ga0451576_0077150_1461_2630 351
349 3300046460 Ga0495638_0003073 Ga0495638_0003073_4103_5191 351
350 3300046501 Ga0495607_0012999 Ga0495607_0012999_4097_5185 351
351 3300046519 Ga0495632_0004142 Ga0495632_0004142_4103_5191 351
352 3300046542 Ga0495597_0001251 Ga0495597_0001251_13577_14665 351
353 3300047320 Ga0495672_0006184 Ga0495672_0006184_769_1857 351
354 3300048904 Ga0496101_0014908 Ga0496101_0014908_1916_3001 351
355 3300048905 Ga0496102_0188412 Ga0496102_0188412_493_1602 351
356 3300048906 Ga0496103_0039847 Ga0496103_0039847_388_1473 351
357 3300048907 Ga0496104_0045553 Ga0496104_0045553_1526_2611 351
358 3300048908 Ga0496105_0137051 Ga0496105_0137051_860_1945 351
359 3300048912 Ga0496109_0011659 Ga0496109_0011659_3618_4703 351
360 3300048913 Ga0496110_0233382 Ga0496110_0233382_21_1106 351
361 3300048915 Ga0496112_0011589 Ga0496112_0011589_3455_4540 351
362 3300048916 Ga0496113_0016702 Ga0496113_0016702_3120_4205 351
363 3300049585 Ga0501069_0165234 Ga0501069_0165234_135_1244 351
364 3300049589 Ga0501073_0070336 Ga0501073_0070336_95_1204 351
365 3300050507 nmdc:mga05p37_277179_c1 nmdc:mga05p37_277179_c1_542_1699 351
366 3300050508 nmdc:mga09592_28022_c1 nmdc:mga09592_28022_c1_1675_2832 351
367 3300050509 nmdc:mga0qj67_5391_c1 nmdc:mga0qj67_5391_c1_3633_4772 351
368 3300050511 nmdc:mga08y16_205111_c1 nmdc:mga08y16_205111_c1_702_1859 351
369 3300050513 nmdc:mga0rr50_36990_c1 nmdc:mga0rr50_36990_c1_253_1347 351
370 3300053178 Ga0500637_0014962 Ga0500637_0014962_1846_2985 351
371 iso_pu_bacteria 2534681786 2535485293 351
372 iso_pu_bacteria 2767802442 2770194653 351
373 iso_pu_bacteria 2837651117 2837651949 351
374 iso_pu_bacteria 2839993093 2839994241 351
375 iso_pu_bacteria 2904578770 2904579085 351
376 iso_pu_bacteria 2919119836 2919122087 351
377 3300005435 Ga0070714_100006553 Ga0070714_1000065533 352
378 3300005436 Ga0070713_100056713 Ga0070713_1000567131 352
379 3300005439 Ga0070711_100079964 Ga0070711_1000799642 352
380 3300005518 Ga0070699_100245641 Ga0070699_1002456412 352
381 3300006028 Ga0070717_10296058 Ga0070717_102960582 352
382 3300006847 Ga0075431_100009924 Ga0075431_1000099248 352
383 3300007265 Ga0099794_10059459 Ga0099794_100594592 352
384 3300021441 Ga0213871_10024524 Ga0213871_100245241 352
385 3300025898 Ga0207692_10069265 Ga0207692_100692652 352
386 3300025929 Ga0207664_10002133 Ga0207664_100021332 352
387 3300039438 Ga0436360_0255389 Ga0436360_0255389_219_1316 352
388 3300039450 Ga0436363_0564042 Ga0436363_0564042_207_1340 352
389 3300046535 Ga0495586_0033140 Ga0495586_0033140_1077_2174 352
390 3300046663 Ga0495635_0196965 Ga0495635_0196965_233_1330 352
391 3300046664 Ga0495659_0035154 Ga0495659_0035154_42_1193 352
392 3300048905 Ga0496102_0293371 Ga0496102_0293371_354_1451 352
393 3300048908 Ga0496105_0254820 Ga0496105_0254820_210_1307 352
394 iso_pu_bacteria 3000405567 3000407783 352
395 3300000546 LJNas_1001711 LJNas_10017112 353
396 3300005471 Ga0070698_100092786 Ga0070698_1000927862 353
397 3300005546 Ga0070696_100000233 Ga0070696_10000023312 353
398 3300005617 Ga0068859_100109922 Ga0068859_1001099223 353
399 3300006931 Ga0097620_100109919 Ga0097620_1001099192 353
400 3300009093 Ga0105240_10024889 Ga0105240_100248893 353
401 3300009093 Ga0105240_10130983 Ga0105240_101309832 353
402 3300009093 Ga0105240_10328419 Ga0105240_103284191 353
403 3300009551 Ga0105238_10006381 Ga0105238_1000638111 353
404 3300010375 Ga0105239_10052494 Ga0105239_100524944 353
405 3300025913 Ga0207695_10224006 Ga0207695_102240062 353
406 3300025913 Ga0207695_10282383 Ga0207695_102823831 353
407 3300028017 Ga0265356_1002354 Ga0265356_10023542 353
408 3300030878 Ga0265770_1000007 Ga0265770_10000077 353
409 3300031010 Ga0265771_1000279 Ga0265771_10002792 353
410 3300042876 Ga0451577_0112387 Ga0451577_0112387_426_1577 353
411 3300045049 Ga0466959_0060878 Ga0466959_0060878_1403_2575 353
412 3300049575 Ga0501039_0028547 Ga0501039_0028547_1972_3111 353
413 3300049576 Ga0501040_0027158 Ga0501040_0027158_840_1979 353
414 3300049577 Ga0501041_0020253 Ga0501041_0020253_2078_3217 353
415 3300049578 Ga0501042_0024795 Ga0501042_0024795_2191_3330 353
416 3300049584 Ga0501068_0021133 Ga0501068_0021133_1784_2923 353
417 3300049587 Ga0501071_0099108 Ga0501071_0099108_773_1912 353
418 3300049590 Ga0501074_0086539 Ga0501074_0086539_845_1984 353
419 3300049741 Ga0501079_0001187 Ga0501079_0001187_2464_3603 353
420 3300049742 Ga0501080_0080217 Ga0501080_0080217_50_1189 353
421 3300049743 Ga0501081_0000552 Ga0501081_0000552_11408_12547 353
422 3300049824 Ga0501045_0069893 Ga0501045_0069893_1190_2329 353
423 3300053153 Ga0500616_0010386 Ga0500616_0010386_3777_4898 353
424 3300054114 Ga0501084_0012410 Ga0501084_0012410_2811_3950 353
425 3300060353 Ga0501082_0013531 Ga0501082_0013531_2189_3328 353
426 3300061734 Ga0530510_0009039 Ga0530510_0009039_1644_2783 353
427 3300005336 Ga0070680_100083582 Ga0070680_1000835822 354
428 3300005439 Ga0070711_100182802 Ga0070711_1001828021 354
429 3300005458 Ga0070681_10104148 Ga0070681_101041482 354
430 3300005518 Ga0070699_100023197 Ga0070699_1000231973 354
431 3300005530 Ga0070679_100133096 Ga0070679_1001330962 354
432 3300005545 Ga0070695_100001122 Ga0070695_1000011227 354
433 3300005563 Ga0068855_100020801 Ga0068855_1000208011 354
434 3300009093 Ga0105240_10002705 Ga0105240_1000270516 354
435 3300015265 Ga0182005_1001549 Ga0182005_10015494 354
436 3300025912 Ga0207707_10036563 Ga0207707_100365632 354
437 3300025916 Ga0207663_10103380 Ga0207663_101033801 354
438 3300025940 Ga0207691_10089162 Ga0207691_100891622 354
439 3300025949 Ga0207667_10045147 Ga0207667_100451474 354
440 3300031247 Ga0265340_10031574 Ga0265340_100315742 354
441 3300046452 Ga0495617_012387 Ga0495617_012387_17_1081 354
442 3300046512 Ga0495610_0014754 Ga0495610_0014754_3268_4332 354
443 3300046539 Ga0495621_0001365 Ga0495621_0001365_5095_6264 354
444 3300046615 Ga0495656_0004477 Ga0495656_0004477_733_1902 354
445 3300046681 Ga0495647_0006055 Ga0495647_0006055_2436_3605 354
446 3300046683 Ga0495658_0022014 Ga0495658_0022014_2172_3341 354
447 3300046692 Ga0495671_0001652 Ga0495671_0001652_7464_8528 354
448 3300047470 Ga0495681_0007287 Ga0495681_0007287_2484_3548 354
449 3300047472 Ga0495686_0045490 Ga0495686_0045490_270_1430 354
450 3300048924 Ga0496121_0052891 Ga0496121_0052891_764_1828 354
451 3300049582 Ga0501048_0000282 Ga0501048_0000282_5065_6273 354
452 3300049671 Ga0501238_000771 Ga0501238_000771_110_1207 354
453 3300005328 Ga0070676_10026332 Ga0070676_100263321 355
454 3300005336 Ga0070680_100035452 Ga0070680_1000354522 355
455 3300005353 Ga0070669_100005076 Ga0070669_1000050767 355
456 3300005356 Ga0070674_100009909 Ga0070674_1000099092 355
457 3300005367 Ga0070667_100114387 Ga0070667_1001143872 355
458 3300005436 Ga0070713_100194413 Ga0070713_1001944132 355
459 3300005444 Ga0070694_100226894 Ga0070694_1002268941 355
460 3300005457 Ga0070662_100003902 Ga0070662_1000039022 355
461 3300005459 Ga0068867_100022954 Ga0068867_1000229542 355
462 3300005543 Ga0070672_100004629 Ga0070672_1000046292 355
463 3300005563 Ga0068855_100001944 Ga0068855_1000019445 355
464 3300005719 Ga0068861_100014206 Ga0068861_1000142064 355
465 3300005719 Ga0068861_100023752 Ga0068861_1000237523 355
466 3300005840 Ga0068870_10088817 Ga0068870_100888171 355
467 3300006844 Ga0075428_100010582 Ga0075428_10001058210 355
468 3300006844 Ga0075428_100068346 Ga0075428_1000683463 355
469 3300006847 Ga0075431_100081783 Ga0075431_1000817832 355
470 3300006948 Ga0099826_10083695 Ga0099826_100836952 355
471 3300009094 Ga0111539_10033108 Ga0111539_100331083 355
472 3300009094 Ga0111539_10076554 Ga0111539_100765542 355
473 3300009101 Ga0105247_10121127 Ga0105247_101211271 355
474 3300009147 Ga0114129_10087255 Ga0114129_100872553 355
475 3300009148 Ga0105243_10027562 Ga0105243_100275622 355
476 3300009545 Ga0105237_10127911 Ga0105237_101279112 355
477 3300009553 Ga0105249_10184405 Ga0105249_101844051 355
478 3300013105 Ga0157369_10297375 Ga0157369_102973752 355
479 3300013297 Ga0157378_10122887 Ga0157378_101228872 355
480 3300014326 Ga0157380_10025900 Ga0157380_100259002 355
481 3300014968 Ga0157379_10060155 Ga0157379_100601552 355
482 3300017792 Ga0163161_10072485 Ga0163161_100724852 355
483 3300025907 Ga0207645_10001223 Ga0207645_1000122314 355
484 3300025913 Ga0207695_10076336 Ga0207695_100763362 355
485 3300025914 Ga0207671_10150432 Ga0207671_101504322 355
486 3300025917 Ga0207660_10125130 Ga0207660_101251302 355
487 3300025923 Ga0207681_10035475 Ga0207681_100354752 355
488 3300025933 Ga0207706_10004326 Ga0207706_100043263 355
489 3300025938 Ga0207704_10026508 Ga0207704_100265082 355
490 3300025940 Ga0207691_10001448 Ga0207691_1000144814 355
491 3300025949 Ga0207667_10010115 Ga0207667_100101155 355
492 3300025986 Ga0207658_10102880 Ga0207658_101028802 355
493 3300026078 Ga0207702_10050952 Ga0207702_100509522 355
494 3300026089 Ga0207648_10003080 Ga0207648_100030807 355
495 3300026118 Ga0207675_100011407 Ga0207675_1000114079 355
496 3300026118 Ga0207675_100021455 Ga0207675_1000214553 355
497 3300027526 Ga0209968_1002478 Ga0209968_10024782 355
498 3300027617 Ga0210002_1000931 Ga0210002_10009313 355
499 3300027695 Ga0209966_1008616 Ga0209966_10086161 355
500 3300027876 Ga0209974_10000908 Ga0209974_100009084 355
501 3300027907 Ga0207428_10031774 Ga0207428_100317743 355
502 3300027907 Ga0207428_10037263 Ga0207428_100372632 355
503 3300028380 Ga0268265_10004447 Ga0268265_100044475 355
504 3300032002 Ga0307416_100373857 Ga0307416_1003738572 355
505 3300044656 Ga0466969_0002997 Ga0466969_0002997_3638_4804 355
506 3300044684 Ga0466966_0004455 Ga0466966_0004455_3963_5129 355
507 3300044693 Ga0466961_0001050 Ga0466961_0001050_12036_13202 355
508 3300044706 Ga0466964_0022702 Ga0466964_0022702_404_1570 355
509 3300044719 Ga0466971_0009912 Ga0466971_0009912_12_1178 355
510 3300044765 Ga0466970_0007100 Ga0466970_0007100_3869_5035 355
511 3300044842 Ga0466957_0004657 Ga0466957_0004657_5730_6896 355
512 3300045049 Ga0466959_0144119 Ga0466959_0144119_12_1178 355
513 3300049572 Ga0501036_0016758 Ga0501036_0016758_342_1511 355
514 3300049574 Ga0501038_0003978 Ga0501038_0003978_6641_7810 355
515 3300049575 Ga0501039_0007453 Ga0501039_0007453_1290_2459 355
516 3300049576 Ga0501040_0002910 Ga0501040_0002910_631_1800 355
517 3300049578 Ga0501042_0004113 Ga0501042_0004113_6372_7541 355
518 3300049578 Ga0501042_0230246 Ga0501042_0230246_117_1277 355
519 3300049579 Ga0501043_0113733 Ga0501043_0113733_129_1298 355
520 3300049580 Ga0501046_0006557 Ga0501046_0006557_8295_9464 355
521 3300049584 Ga0501068_0026405 Ga0501068_0026405_62_1231 355
522 3300049588 Ga0501072_0001734 Ga0501072_0001734_9655_10824 355
523 3300049590 Ga0501074_0005711 Ga0501074_0005711_613_1782 355
524 3300049592 Ga0501076_0000955 Ga0501076_0000955_10520_11689 355
525 3300049741 Ga0501079_0002370 Ga0501079_0002370_5736_6905 355
526 3300049742 Ga0501080_0104938 Ga0501080_0104938_237_1370 355
527 3300049743 Ga0501081_0000147 Ga0501081_0000147_29676_30845 355
528 3300049822 Ga0501035_0159671 Ga0501035_0159671_174_1343 355
529 3300049824 Ga0501045_0000401 Ga0501045_0000401_8502_9671 355
530 3300050507 nmdc:mga05p37_234465_c1 nmdc:mga05p37_234465_c1_242_1381 355
531 3300050508 nmdc:mga09592_53045_c1 nmdc:mga09592_53045_c1_683_1831 355
532 3300050508 nmdc:mga09592_7612_c1 nmdc:mga09592_7612_c1_7655_8794 355
533 3300050510 nmdc:mga06r32_70979_c1 nmdc:mga06r32_70979_c1_1484_2638 355
534 3300050511 nmdc:mga08y16_109806_c1 nmdc:mga08y16_109806_c1_1292_2440 355
535 3300050511 nmdc:mga08y16_14457_c1 nmdc:mga08y16_14457_c1_4980_6119 355
536 3300050511 nmdc:mga08y16_2161_c1 nmdc:mga08y16_2161_c1_10017_11156 355
537 3300053156 Ga0500622_0023584 Ga0500622_0023584_1408_2559 355
538 3300054114 Ga0501084_0008950 Ga0501084_0008950_1338_2507 355
539 3300060353 Ga0501082_0005214 Ga0501082_0005214_1575_2744 355
540 3300061719 Ga0466962_0024978 Ga0466962_0024978_866_2032 355
541 3300061734 Ga0530510_0040239 Ga0530510_0040239_2031_3200 355
542 3300005364 Ga0070673_100082082 Ga0070673_1000820822 356
543 3300005435 Ga0070714_100098538 Ga0070714_1000985382 356
544 3300005457 Ga0070662_100017390 Ga0070662_1000173902 356
545 3300005543 Ga0070672_100291995 Ga0070672_1002919951 356
546 3300005548 Ga0070665_100002122 Ga0070665_10000212218 356
547 3300005719 Ga0068861_100084466 Ga0068861_1000844662 356
548 3300005842 Ga0068858_100391105 Ga0068858_1003911051 356
549 3300005843 Ga0068860_100007155 Ga0068860_10000715510 356
550 3300005844 Ga0068862_100042263 Ga0068862_1000422632 356
551 3300006175 Ga0070712_100007685 Ga0070712_1000076852 356
552 3300006358 Ga0068871_100203953 Ga0068871_1002039532 356
553 3300006844 Ga0075428_100151919 Ga0075428_1001519191 356
554 3300006847 Ga0075431_100335748 Ga0075431_1003357482 356
555 3300013296 Ga0157374_10007656 Ga0157374_100076564 356
556 3300013297 Ga0157378_10004873 Ga0157378_100048735 356
557 3300013308 Ga0157375_10018198 Ga0157375_100181982 356
558 3300014968 Ga0157379_10006630 Ga0157379_100066307 356
559 3300025907 Ga0207645_10008199 Ga0207645_100081994 356
560 3300025908 Ga0207643_10015755 Ga0207643_100157552 356
561 3300025911 Ga0207654_10059460 Ga0207654_100594602 356
562 3300025923 Ga0207681_10115901 Ga0207681_101159012 356
563 3300025929 Ga0207664_10092412 Ga0207664_100924122 356
564 3300025933 Ga0207706_10022865 Ga0207706_100228654 356
565 3300025940 Ga0207691_10003491 Ga0207691_100034918 356
566 3300026089 Ga0207648_10031254 Ga0207648_100312543 356
567 3300026118 Ga0207675_100021604 Ga0207675_1000216045 356
568 3300027665 Ga0209983_1003838 Ga0209983_10038382 356
569 3300027682 Ga0209971_1001319 Ga0209971_10013195 356
570 3300027717 Ga0209998_10003556 Ga0209998_100035562 356
571 3300027876 Ga0209974_10000854 Ga0209974_1000085410 356
572 3300028379 Ga0268266_10001602 Ga0268266_1000160217 356
573 3300028380 Ga0268265_10081988 Ga0268265_100819882 356
574 3300031239 Ga0265328_10001169 Ga0265328_100011693 356
575 3300031239 Ga0265328_10001255 Ga0265328_100012557 356
576 3300031911 Ga0307412_10083076 Ga0307412_100830762 356
577 3300035398 Ga0316574_0148528 Ga0316574_0148528_148_1236 356
578 3300042876 Ga0451577_0062323 Ga0451577_0062323_1792_2961 356
579 3300046459 Ga0495629_0111232 Ga0495629_0111232_336_1469 356
580 3300046472 Ga0495580_0002317 Ga0495580_0002317_14324_15457 356
581 3300046472 Ga0495580_0131295 Ga0495580_0131295_176_1309 356
582 3300046683 Ga0495658_0012040 Ga0495658_0012040_971_2104 356
583 3300048912 Ga0496109_0011744 Ga0496109_0011744_4235_5368 356
584 3300048915 Ga0496112_0011995 Ga0496112_0011995_5666_6799 356
585 3300050509 nmdc:mga0qj67_148576_c1 nmdc:mga0qj67_148576_c1_715_1854 356
586 3300053177 Ga0500636_0116461 Ga0500636_0116461_85_1257 356
587 3300053178 Ga0500637_0064324 Ga0500637_0064324_143_1315 356
588 3300005436 Ga0070713_100136448 Ga0070713_1001364482 357
589 3300005458 Ga0070681_10022982 Ga0070681_100229825 357
590 3300006175 Ga0070712_100216295 Ga0070712_1002162951 357
591 3300006358 Ga0068871_100186058 Ga0068871_1001860581 357
592 3300006844 Ga0075428_100116803 Ga0075428_1001168032 357
593 3300006846 Ga0075430_100031773 Ga0075430_1000317733 357
594 3300006880 Ga0075429_100044334 Ga0075429_1000443342 357
595 3300027876 Ga0209974_10015078 Ga0209974_100150782 357
596 3300035086 Ga0373934_0021534 Ga0373934_0021534_1028_2161 357
597 3300039438 Ga0436360_0257108 Ga0436360_0257108_928_2070 357
598 3300044656 Ga0466969_0053179 Ga0466969_0053179_658_1836 357
599 3300046491 Ga0495584_0000917 Ga0495584_0000917_955_2028 357
600 3300046512 Ga0495610_0010870 Ga0495610_0010870_2108_3181 357
601 3300046520 Ga0495637_0003357 Ga0495637_0003357_3954_5027 357
602 3300046543 Ga0495645_0133200 Ga0495645_0133200_42_1175 357
603 3300046692 Ga0495671_0010838 Ga0495671_0010838_2285_3358 357
604 3300048088 Ga0495602_0048266 Ga0495602_0048266_924_2057 357
605 3300050508 nmdc:mga09592_108376_c1 nmdc:mga09592_108376_c1_180_1340 357
606 3300050508 nmdc:mga09592_218298_c1 nmdc:mga09592_218298_c1_166_1296 357
607 3300050509 nmdc:mga0qj67_195516_c1 nmdc:mga0qj67_195516_c1_159_1289 357
608 iso_pu_bacteria 2511231011 2511298825 357
609 3300005290 Ga0065712_10097359 Ga0065712_100973592 358
610 3300005336 Ga0070680_100013082 Ga0070680_1000130827 358
611 3300005458 Ga0070681_10001577 Ga0070681_1000157716 358
612 3300005458 Ga0070681_10001582 Ga0070681_1000158216 358
613 3300005458 Ga0070681_10024376 Ga0070681_100243763 358
614 3300005530 Ga0070679_100000469 Ga0070679_10000046915 358
615 3300005530 Ga0070679_100025516 Ga0070679_1000255162 358
616 3300005530 Ga0070679_100034185 Ga0070679_1000341854 358
617 3300005563 Ga0068855_100001482 Ga0068855_10000148216 358
618 3300005578 Ga0068854_100276653 Ga0068854_1002766532 358
619 3300009093 Ga0105240_10003826 Ga0105240_1000382620 358
620 3300009551 Ga0105238_10005376 Ga0105238_1000537610 358
621 3300013104 Ga0157370_10001472 Ga0157370_1000147213 358
622 3300013105 Ga0157369_10065057 Ga0157369_100650573 358
623 3300014745 Ga0157377_10106531 Ga0157377_101065312 358
624 3300025912 Ga0207707_10000122 Ga0207707_1000012220 358
625 3300025912 Ga0207707_10010048 Ga0207707_100100482 358
626 3300025912 Ga0207707_10026203 Ga0207707_100262032 358
627 3300025913 Ga0207695_10003540 Ga0207695_1000354010 358
628 3300025916 Ga0207663_10068245 Ga0207663_100682452 358
629 3300025917 Ga0207660_10004896 Ga0207660_100048966 358
630 3300025921 Ga0207652_10000613 Ga0207652_1000061329 358
631 3300025921 Ga0207652_10054368 Ga0207652_100543683 358
632 3300025924 Ga0207694_10003403 Ga0207694_1000340310 358
633 3300025949 Ga0207667_10000798 Ga0207667_1000079815 358
634 3300031730 Ga0307516_10003963 Ga0307516_100039637 358
635 3300048907 Ga0496104_0032491 Ga0496104_0032491_156_1304 358
636 3300048908 Ga0496105_0001071 Ga0496105_0001071_8770_9918 358
637 3300048917 Ga0496114_0004355 Ga0496114_0004355_5234_6382 358
638 3300048918 Ga0496115_0013919 Ga0496115_0013919_3881_5029 358
639 3300053153 Ga0500616_0006666 Ga0500616_0006666_5389_6582 358
640 iso_pu_bacteria 2511231004 2511258189 358
641 iso_pu_bacteria 2511231008 2511277120 358
642 iso_pu_bacteria 2511231010 2511292024 358
643 iso_pu_bacteria 2511231012 2511301453 358
644 iso_pu_bacteria 2511231014 2511314730 358
645 iso_pu_bacteria 2511231015 2511320526 358
646 iso_pu_bacteria 2511231017 2511333733 358
647 iso_pu_bacteria 2511231018 2511340091 358
648 iso_pu_bacteria 2511231019 2511346834 358
649 iso_pu_bacteria 2511231020 2511348314 358
650 iso_pu_bacteria 2511231021 2511357207 358
651 iso_pu_bacteria 2511231023 2511371719 358
652 iso_pu_bacteria 2643221589 2643953427 358
653 iso_pu_bacteria 2643221602 2644021169 358
654 iso_pu_bacteria 2643221633 2644188236 358
655 iso_pu_bacteria 2738543015 2739261859 358
656 iso_pu_bacteria 2808606445 2809214402 358
657 iso_pu_bacteria 2818991456 2819657787 358
658 iso_pu_bacteria 2904550169 2904551888 358
659 iso_pu_bacteria 2939636861 2939641542 358
660 iso_pu_bacteria 2939651529 2939654907 358
661 iso_pu_bacteria 3007511990 3007513702 358
662 iso_pu_bacteria 3007619802 3007625074 358
663 iso_pu_bacteria 8056125926 8056128234 358
664 iso_pu_bacteria 8056177738 8056178745 358
665 3300026116 Ga0207674_10248924 Ga0207674_102489242 359
666 3300046472 Ga0495580_0097407 Ga0495580_0097407_466_1671 359
667 3300048905 Ga0496102_0172769 Ga0496102_0172769_122_1315 359
668 3300014497 Ga0182008_10000655 Ga0182008_100006554 361
669 3300046454 Ga0495592_0005399 Ga0495592_0005399_5460_6545 361
670 3300046526 Ga0495666_0002299 Ga0495666_0002299_2914_3999 361
671 3300046543 Ga0495645_0018444 Ga0495645_0018444_310_1395 361
672 3300046642 Ga0495634_0011150 Ga0495634_0011150_5442_6527 361
673 3300046680 Ga0495646_0003836 Ga0495646_0003836_1526_2611 361
674 3300046689 Ga0495613_0001100 Ga0495613_0001100_6126_7211 361
675 3300046690 Ga0495624_0000975 Ga0495624_0000975_16147_17232 361
676 3300047320 Ga0495672_0006235 Ga0495672_0006235_2411_3496 361
677 3300047321 Ga0495676_0007185 Ga0495676_0007185_6102_7187 361
678 3300047471 Ga0495684_0005960 Ga0495684_0005960_5359_6444 361
679 3300048088 Ga0495602_0001183 Ga0495602_0001183_13135_14220 361
680 3300049571 Ga0501034_0143140 Ga0501034_0143140_497_1681 361
681 2124908027 MRS2a_Contig_16 MRS2a_00059140 362
682 3300003791 Ga0055530_10012102 Ga0055530_100121023 362
683 3300005288 Ga0065714_10000072 Ga0065714_100000724 362
684 3300005288 Ga0065714_10005237 Ga0065714_100052372 362
685 3300005288 Ga0065714_10066226 Ga0065714_100662262 362
686 3300005288 Ga0065714_10067131 Ga0065714_100671315 362
687 3300005288 Ga0065714_10075957 Ga0065714_100759571 362
688 3300005290 Ga0065712_10008655 Ga0065712_100086552 362
689 3300005293 Ga0065715_10005206 Ga0065715_100052063 362
690 3300006058 Ga0075432_10002709 Ga0075432_100027092 362
691 3300006058 Ga0075432_10004298 Ga0075432_100042981 362
692 3300006177 Ga0075362_10007547 Ga0075362_100075473 362
693 3300006946 Ga0079104_1000068 Ga0079104_1000068119 362
694 3300009011 Ga0105251_10009643 Ga0105251_100096435 362
695 3300009036 Ga0105244_10006047 Ga0105244_100060473 362
696 3300009036 Ga0105244_10030412 Ga0105244_100304124 362
697 3300009092 Ga0105250_10006223 Ga0105250_100062235 362
698 3300009092 Ga0105250_10061266 Ga0105250_100612661 362
699 3300009092 Ga0105250_10061724 Ga0105250_100617242 362
700 3300009148 Ga0105243_10041735 Ga0105243_100417354 362
701 3300009176 Ga0105242_10321662 Ga0105242_103216621 362
702 3300011119 Ga0105246_10006341 Ga0105246_100063416 362
703 3300013306 Ga0163162_10020035 Ga0163162_100200355 362
704 3300013306 Ga0163162_10067923 Ga0163162_100679234 362
705 3300015265 Ga0182005_1001019 Ga0182005_10010197 362
706 3300015265 Ga0182005_1005470 Ga0182005_10054703 362
707 3300015265 Ga0182005_1006564 Ga0182005_10065643 362
708 3300017792 Ga0163161_10000986 Ga0163161_100009865 362
709 3300017792 Ga0163161_10012623 Ga0163161_100126234 362
710 3300017792 Ga0163161_10036963 Ga0163161_100369633 362
711 3300025292 Ga0209676_1003062 Ga0209676_10030624 362
712 3300025298 Ga0209050_1000229 Ga0209050_100022996 362
713 3300025711 Ga0207696_1001869 Ga0207696_10018696 362
714 3300025711 Ga0207696_1005521 Ga0207696_10055212 362
715 3300025728 Ga0207655_1002567 Ga0207655_10025675 362
716 3300025728 Ga0207655_1035489 Ga0207655_10354891 362
717 3300025735 Ga0207713_1007553 Ga0207713_10075535 362
718 3300025735 Ga0207713_1007696 Ga0207713_10076966 362
719 3300025735 Ga0207713_1007941 Ga0207713_10079417 362
720 3300025935 Ga0207709_10100092 Ga0207709_101000922 362
721 3300027111 Ga0209281_1000168 Ga0209281_100016844 362
722 3300027907 Ga0207428_10007665 Ga0207428_100076658 362
723 3300027907 Ga0207428_10054420 Ga0207428_100544202 362
724 3300027907 Ga0207428_10175028 Ga0207428_101750281 362
725 3300038705 Ga0237819_01035 Ga0237819_01035_1855_2943 362
726 3300041405 Ga0439438_000155 Ga0439438_000155_24319_25407 362
727 3300041405 Ga0439438_006304 Ga0439438_006304_2050_3138 362
728 3300041407 Ga0439447_000840 Ga0439447_000840_9176_10264 362
729 3300041407 Ga0439447_007663 Ga0439447_007663_941_2029 362
730 3300041411 Ga0439466_0001516 Ga0439466_0001516_3218_4306 362
731 3300041411 Ga0439466_0010091 Ga0439466_0010091_211_1299 362
732 3300041411 Ga0439466_0015719 Ga0439466_0015719_760_1848 362
733 3300042006 Ga0439432_014891 Ga0439432_014891_118_1206 362
734 3300042009 Ga0439451_001251 Ga0439451_001251_3308_4396 362
735 3300042010 Ga0439452_001295 Ga0439452_001295_2660_3748 362
736 3300042013 Ga0439456_000015 Ga0439456_000015_37929_39023 362
737 3300042122 Ga0450920_000277 Ga0450920_000277_5164_6252 362
738 3300042124 Ga0450922_000055 Ga0450922_000055_3324_4412 362
739 3300042137 Ga0450902_000197 Ga0450902_000197_4523_5611 362
740 3300042137 Ga0450902_000877 Ga0450902_000877_415_1503 362
741 3300042138 Ga0450903_001073 Ga0450903_001073_98_1186 362
742 3300042139 Ga0450904_000756 Ga0450904_000756_1107_2195 362
743 3300042142 Ga0450905_003315 Ga0450905_003315_648_1736 362
744 3300042145 Ga0450906_011247 Ga0450906_011247_330_1418 362
745 3300042146 Ga0450907_000997 Ga0450907_000997_2682_3770 362
746 3300046452 Ga0495617_000474 Ga0495617_000474_14255_15343 362
747 3300046452 Ga0495617_003460 Ga0495617_003460_2978_4066 362
748 3300046452 Ga0495617_003692 Ga0495617_003692_4524_5612 362
749 3300046452 Ga0495617_004104 Ga0495617_004104_1577_2665 362
750 3300046452 Ga0495617_006049 Ga0495617_006049_2319_3407 362
751 3300046452 Ga0495617_061351 Ga0495617_061351_80_1168 362
752 3300046453 Ga0495627_000534 Ga0495627_000534_20441_21529 362
753 3300046453 Ga0495627_000640 Ga0495627_000640_5564_6652 362
754 3300046453 Ga0495627_007012 Ga0495627_007012_810_1898 362
755 3300046453 Ga0495627_012974 Ga0495627_012974_1319_2407 362
756 3300046453 Ga0495627_052243 Ga0495627_052243_81_1169 362
757 3300046455 Ga0495603_0005913 Ga0495603_0005913_710_1798 362
758 3300046457 Ga0495590_0000130 Ga0495590_0000130_35343_36431 362
759 3300046457 Ga0495590_0003711 Ga0495590_0003711_4357_5445 362
760 3300046457 Ga0495590_0005128 Ga0495590_0005128_234_1322 362
761 3300046458 Ga0495591_000021 Ga0495591_000021_87164_88252 362
762 3300046458 Ga0495591_000150 Ga0495591_000150_28380_29468 362
763 3300046458 Ga0495591_000273 Ga0495591_000273_22445_23533 362
764 3300046458 Ga0495591_002178 Ga0495591_002178_89_1177 362
765 3300046458 Ga0495591_002505 Ga0495591_002505_5130_6218 362
766 3300046458 Ga0495591_007189 Ga0495591_007189_2314_3402 362
767 3300046458 Ga0495591_008436 Ga0495591_008436_2766_3854 362
768 3300046458 Ga0495591_009648 Ga0495591_009648_76_1164 362
769 3300046459 Ga0495629_0013707 Ga0495629_0013707_1334_2422 362
770 3300046460 Ga0495638_0000947 Ga0495638_0000947_6576_7664 362
771 3300046460 Ga0495638_0001168 Ga0495638_0001168_15501_16589 362
772 3300046460 Ga0495638_0002314 Ga0495638_0002314_4767_5855 362
773 3300046460 Ga0495638_0005036 Ga0495638_0005036_4378_5466 362
774 3300046460 Ga0495638_0007477 Ga0495638_0007477_5010_6098 362
775 3300046460 Ga0495638_0008564 Ga0495638_0008564_1258_2346 362
776 3300046460 Ga0495638_0009288 Ga0495638_0009288_1065_2153 362
777 3300046460 Ga0495638_0009651 Ga0495638_0009651_3241_4329 362
778 3300046460 Ga0495638_0018895 Ga0495638_0018895_3461_4549 362
779 3300046460 Ga0495638_0028419 Ga0495638_0028419_2415_3503 362
780 3300046460 Ga0495638_0115045 Ga0495638_0115045_445_1533 362
781 3300046463 Ga0495653_0070080 Ga0495653_0070080_874_1962 362
782 3300046471 Ga0495650_0003285 Ga0495650_0003285_9607_10695 362
783 3300046471 Ga0495650_0004517 Ga0495650_0004517_4895_5983 362
784 3300046471 Ga0495650_0005241 Ga0495650_0005241_1321_2409 362
785 3300046471 Ga0495650_0009160 Ga0495650_0009160_2389_3477 362
786 3300046471 Ga0495650_0022637 Ga0495650_0022637_1679_2767 362
787 3300046473 Ga0495582_0010605 Ga0495582_0010605_2431_3519 362
788 3300046474 Ga0495605_0000480 Ga0495605_0000480_17821_18909 362
789 3300046474 Ga0495605_0002173 Ga0495605_0002173_6964_8052 362
790 3300046474 Ga0495605_0006888 Ga0495605_0006888_2460_3548 362
791 3300046475 Ga0495639_0004319 Ga0495639_0004319_2957_4045 362
792 3300046475 Ga0495639_0022287 Ga0495639_0022287_662_1750 362
793 3300046491 Ga0495584_0000067 Ga0495584_0000067_54777_55865 362
794 3300046491 Ga0495584_0001601 Ga0495584_0001601_5198_6286 362
795 3300046491 Ga0495584_0020071 Ga0495584_0020071_1969_3057 362
796 3300046491 Ga0495584_0083289 Ga0495584_0083289_33_1121 362
797 3300046492 Ga0495585_0000030 Ga0495585_0000030_21291_22379 362
798 3300046492 Ga0495585_0000056 Ga0495585_0000056_514_1602 362
799 3300046492 Ga0495585_0000335 Ga0495585_0000335_19044_20132 362
800 3300046492 Ga0495585_0003232 Ga0495585_0003232_9259_10347 362
801 3300046492 Ga0495585_0003534 Ga0495585_0003534_7048_8136 362
802 3300046492 Ga0495585_0005465 Ga0495585_0005465_3398_4486 362
803 3300046492 Ga0495585_0006863 Ga0495585_0006863_5919_7007 362
804 3300046492 Ga0495585_0062042 Ga0495585_0062042_906_1994 362
805 3300046499 Ga0495594_0002194 Ga0495594_0002194_3795_4883 362
806 3300046500 Ga0495596_0000012 Ga0495596_0000012_90917_92005 362
807 3300046500 Ga0495596_0006906 Ga0495596_0006906_1891_2979 362
808 3300046501 Ga0495607_0001305 Ga0495607_0001305_13514_14602 362
809 3300046501 Ga0495607_0006997 Ga0495607_0006997_2720_3808 362
810 3300046501 Ga0495607_0014897 Ga0495607_0014897_1164_2252 362
811 3300046501 Ga0495607_0020256 Ga0495607_0020256_471_1559 362
812 3300046506 Ga0495583_0000112 Ga0495583_0000112_104004_105092 362
813 3300046506 Ga0495583_0003028 Ga0495583_0003028_5261_6349 362
814 3300046506 Ga0495583_0004042 Ga0495583_0004042_2630_3718 362
815 3300046507 Ga0495606_0002318 Ga0495606_0002318_14029_15117 362
816 3300046507 Ga0495606_0004165 Ga0495606_0004165_12533_13621 362
817 3300046507 Ga0495606_0007763 Ga0495606_0007763_5201_6289 362
818 3300046507 Ga0495606_0009647 Ga0495606_0009647_2856_3944 362
819 3300046512 Ga0495610_0003225 Ga0495610_0003225_10319_11407 362
820 3300046512 Ga0495610_0003495 Ga0495610_0003495_8601_9689 362
821 3300046512 Ga0495610_0004389 Ga0495610_0004389_6548_7636 362
822 3300046512 Ga0495610_0004415 Ga0495610_0004415_1174_2262 362
823 3300046512 Ga0495610_0017503 Ga0495610_0017503_16_1104 362
824 3300046512 Ga0495610_0030494 Ga0495610_0030494_1066_2154 362
825 3300046513 Ga0495616_0000251 Ga0495616_0000251_20666_21754 362
826 3300046513 Ga0495616_0001505 Ga0495616_0001505_6638_7726 362
827 3300046513 Ga0495616_0003694 Ga0495616_0003694_2656_3744 362
828 3300046513 Ga0495616_0011509 Ga0495616_0011509_1010_2098 362
829 3300046513 Ga0495616_0020835 Ga0495616_0020835_380_1468 362
830 3300046513 Ga0495616_0048391 Ga0495616_0048391_1019_2107 362
831 3300046515 Ga0495620_0000860 Ga0495620_0000860_7231_8319 362
832 3300046515 Ga0495620_0003461 Ga0495620_0003461_4996_6084 362
833 3300046515 Ga0495620_0004610 Ga0495620_0004610_4194_5282 362
834 3300046515 Ga0495620_0009266 Ga0495620_0009266_3766_4854 362
835 3300046517 Ga0495630_0003131 Ga0495630_0003131_22_1110 362
836 3300046517 Ga0495630_0022286 Ga0495630_0022286_2527_3615 362
837 3300046518 Ga0495631_0000002 Ga0495631_0000002_128791_129879 362
838 3300046518 Ga0495631_0005996 Ga0495631_0005996_3471_4559 362
839 3300046519 Ga0495632_0002079 Ga0495632_0002079_4956_6044 362
840 3300046519 Ga0495632_0003562 Ga0495632_0003562_8077_9165 362
841 3300046519 Ga0495632_0004772 Ga0495632_0004772_4894_5982 362
842 3300046519 Ga0495632_0005080 Ga0495632_0005080_3282_4370 362
843 3300046519 Ga0495632_0006324 Ga0495632_0006324_5967_7055 362
844 3300046519 Ga0495632_0007608 Ga0495632_0007608_4515_5603 362
845 3300046519 Ga0495632_0008901 Ga0495632_0008901_4535_5623 362
846 3300046519 Ga0495632_0009802 Ga0495632_0009802_4618_5706 362
847 3300046519 Ga0495632_0014646 Ga0495632_0014646_2800_3888 362
848 3300046519 Ga0495632_0096544 Ga0495632_0096544_206_1294 362
849 3300046520 Ga0495637_0000246 Ga0495637_0000246_24730_25818 362
850 3300046520 Ga0495637_0001056 Ga0495637_0001056_14630_15718 362
851 3300046520 Ga0495637_0002226 Ga0495637_0002226_541_1629 362
852 3300046520 Ga0495637_0004380 Ga0495637_0004380_333_1421 362
853 3300046520 Ga0495637_0013128 Ga0495637_0013128_862_1950 362
854 3300046522 Ga0495643_0004092 Ga0495643_0004092_8057_9145 362
855 3300046522 Ga0495643_0010664 Ga0495643_0010664_2443_3531 362
856 3300046523 Ga0495644_0000025 Ga0495644_0000025_69339_70427 362
857 3300046523 Ga0495644_0000545 Ga0495644_0000545_4091_5179 362
858 3300046524 Ga0495648_0000246 Ga0495648_0000246_21166_22254 362
859 3300046524 Ga0495648_0000981 Ga0495648_0000981_13879_14967 362
860 3300046524 Ga0495648_0001566 Ga0495648_0001566_20698_21786 362
861 3300046524 Ga0495648_0007688 Ga0495648_0007688_3455_4543 362
862 3300046524 Ga0495648_0015779 Ga0495648_0015779_3025_4113 362
863 3300046524 Ga0495648_0026386 Ga0495648_0026386_1099_2187 362
864 3300046524 Ga0495648_0034013 Ga0495648_0034013_411_1499 362
865 3300046526 Ga0495666_0006761 Ga0495666_0006761_1447_2535 362
866 3300046526 Ga0495666_0035650 Ga0495666_0035650_777_1865 362
867 3300046528 Ga0495642_0000003 Ga0495642_0000003_133056_134144 362
868 3300046528 Ga0495642_0000245 Ga0495642_0000245_7674_8762 362
869 3300046530 Ga0495654_0000225 Ga0495654_0000225_29534_30622 362
870 3300046530 Ga0495654_0003093 Ga0495654_0003093_2239_3327 362
871 3300046530 Ga0495654_0003282 Ga0495654_0003282_8274_9362 362
872 3300046530 Ga0495654_0004064 Ga0495654_0004064_4835_5923 362
873 3300046530 Ga0495654_0007273 Ga0495654_0007273_2980_4068 362
874 3300046530 Ga0495654_0011129 Ga0495654_0011129_1283_2371 362
875 3300046530 Ga0495654_0017099 Ga0495654_0017099_2661_3749 362
876 3300046530 Ga0495654_0033827 Ga0495654_0033827_31_1119 362
877 3300046530 Ga0495654_0042546 Ga0495654_0042546_236_1324 362
878 3300046530 Ga0495654_0043339 Ga0495654_0043339_422_1510 362
879 3300046535 Ga0495586_0026747 Ga0495586_0026747_366_1454 362
880 3300046536 Ga0495587_0000989 Ga0495587_0000989_1243_2331 362
881 3300046536 Ga0495587_0005793 Ga0495587_0005793_5341_6429 362
882 3300046538 Ga0495609_0004230 Ga0495609_0004230_317_1405 362
883 3300046538 Ga0495609_0006067 Ga0495609_0006067_2610_3698 362
884 3300046542 Ga0495597_0001245 Ga0495597_0001245_3966_5054 362
885 3300046542 Ga0495597_0005566 Ga0495597_0005566_389_1477 362
886 3300046542 Ga0495597_0008380 Ga0495597_0008380_242_1330 362
887 3300046542 Ga0495597_0015109 Ga0495597_0015109_2487_3575 362
888 3300046542 Ga0495597_0015948 Ga0495597_0015948_2215_3303 362
889 3300046542 Ga0495597_0021618 Ga0495597_0021618_1435_2523 362
890 3300046557 Ga0495622_0005166 Ga0495622_0005166_4731_5819 362
891 3300046557 Ga0495622_0007233 Ga0495622_0007233_2665_3753 362
892 3300046557 Ga0495622_0008458 Ga0495622_0008458_226_1314 362
893 3300046558 Ga0495633_0000612 Ga0495633_0000612_2507_3595 362
894 3300046558 Ga0495633_0005129 Ga0495633_0005129_172_1260 362
895 3300046615 Ga0495656_0014077 Ga0495656_0014077_1786_2874 362
896 3300046616 Ga0495668_0000728 Ga0495668_0000728_14664_15752 362
897 3300046616 Ga0495668_0001396 Ga0495668_0001396_17871_18959 362
898 3300046616 Ga0495668_0011121 Ga0495668_0011121_1739_2827 362
899 3300046642 Ga0495634_0000572 Ga0495634_0000572_4274_5362 362
900 3300046660 Ga0495625_0000838 Ga0495625_0000838_20438_21526 362
901 3300046660 Ga0495625_0001956 Ga0495625_0001956_4349_5437 362
902 3300046660 Ga0495625_0012219 Ga0495625_0012219_4831_5919 362
903 3300046660 Ga0495625_0018882 Ga0495625_0018882_2966_4054 362
904 3300046660 Ga0495625_0097604 Ga0495625_0097604_583_1671 362
905 3300046663 Ga0495635_0000115 Ga0495635_0000115_31527_32615 362
906 3300046663 Ga0495635_0000594 Ga0495635_0000594_5325_6413 362
907 3300046664 Ga0495659_0000208 Ga0495659_0000208_3530_4618 362
908 3300046665 Ga0495661_0000100 Ga0495661_0000100_8756_9844 362
909 3300046665 Ga0495661_0004882 Ga0495661_0004882_4936_6024 362
910 3300046665 Ga0495661_0030206 Ga0495661_0030206_44_1132 362
911 3300046665 Ga0495661_0034374 Ga0495661_0034374_134_1222 362
912 3300046665 Ga0495661_0071738 Ga0495661_0071738_484_1572 362
913 3300046665 Ga0495661_0076183 Ga0495661_0076183_558_1646 362
914 3300046665 Ga0495661_0148413 Ga0495661_0148413_107_1195 362
915 3300046674 Ga0495588_0005387 Ga0495588_0005387_1706_2794 362
916 3300046674 Ga0495588_0006858 Ga0495588_0006858_1613_2701 362
917 3300046674 Ga0495588_0089190 Ga0495588_0089190_448_1536 362
918 3300046679 Ga0495623_0004300 Ga0495623_0004300_4617_5705 362
919 3300046680 Ga0495646_0007178 Ga0495646_0007178_3650_4738 362
920 3300046689 Ga0495613_0007322 Ga0495613_0007322_5593_6681 362
921 3300046689 Ga0495613_0011859 Ga0495613_0011859_1893_2981 362
922 3300046689 Ga0495613_0014931 Ga0495613_0014931_239_1327 362
923 3300046691 Ga0495670_0000596 Ga0495670_0000596_11994_13082 362
924 3300046691 Ga0495670_0010570 Ga0495670_0010570_424_1512 362
925 3300046692 Ga0495671_0000066 Ga0495671_0000066_58553_59641 362
926 3300046692 Ga0495671_0000459 Ga0495671_0000459_25870_26958 362
927 3300046692 Ga0495671_0000814 Ga0495671_0000814_11288_12376 362
928 3300046692 Ga0495671_0004212 Ga0495671_0004212_4994_6082 362
929 3300046692 Ga0495671_0013033 Ga0495671_0013033_2782_3870 362
930 3300046692 Ga0495671_0014481 Ga0495671_0014481_747_1835 362
931 3300046692 Ga0495671_0100446 Ga0495671_0100446_31_1119 362
932 3300046694 Ga0495649_0000404 Ga0495649_0000404_20539_21627 362
933 3300046694 Ga0495649_0003432 Ga0495649_0003432_9118_10206 362
934 3300046694 Ga0495649_0004074 Ga0495649_0004074_4552_5640 362
935 3300046694 Ga0495649_0010434 Ga0495649_0010434_2999_4087 362
936 3300046694 Ga0495649_0010488 Ga0495649_0010488_3743_4831 362
937 3300046694 Ga0495649_0012992 Ga0495649_0012992_2756_3844 362
938 3300046794 Ga0495589_0002746 Ga0495589_0002746_4268_5356 362
939 3300046794 Ga0495589_0002978 Ga0495589_0002978_4981_6069 362
940 3300046794 Ga0495589_0003332 Ga0495589_0003332_7568_8656 362
941 3300046794 Ga0495589_0010325 Ga0495589_0010325_2089_3177 362
942 3300046794 Ga0495589_0011597 Ga0495589_0011597_634_1722 362
943 3300046810 Ga0495660_0003045 Ga0495660_0003045_4881_5969 362
944 3300046810 Ga0495660_0005353 Ga0495660_0005353_2524_3612 362
945 3300046810 Ga0495660_0006453 Ga0495660_0006453_2940_4028 362
946 3300046810 Ga0495660_0014849 Ga0495660_0014849_1508_2596 362
947 3300046810 Ga0495660_0015082 Ga0495660_0015082_907_1995 362
948 3300046810 Ga0495660_0018297 Ga0495660_0018297_409_1497 362
949 3300046810 Ga0495660_0018860 Ga0495660_0018860_590_1678 362
950 3300046810 Ga0495660_0046073 Ga0495660_0046073_72_1160 362
951 3300047317 Ga0495604_0001248 Ga0495604_0001248_5285_6373 362
952 3300047317 Ga0495604_0021351 Ga0495604_0021351_3371_4459 362
953 3300047319 Ga0495674_0005618 Ga0495674_0005618_8533_9621 362
954 3300047320 Ga0495672_0000185 Ga0495672_0000185_24449_25537 362
955 3300047320 Ga0495672_0000247 Ga0495672_0000247_5348_6436 362
956 3300047320 Ga0495672_0002156 Ga0495672_0002156_6809_7897 362
957 3300047320 Ga0495672_0002436 Ga0495672_0002436_8929_10017 362
958 3300047320 Ga0495672_0003437 Ga0495672_0003437_5121_6209 362
959 3300047320 Ga0495672_0008726 Ga0495672_0008726_2478_3566 362
960 3300047320 Ga0495672_0059405 Ga0495672_0059405_148_1236 362
961 3300047320 Ga0495672_0069994 Ga0495672_0069994_666_1754 362
962 3300047322 Ga0495680_0000029 Ga0495680_0000029_108908_109996 362
963 3300047322 Ga0495680_0019446 Ga0495680_0019446_4009_5097 362
964 3300047322 Ga0495680_0019504 Ga0495680_0019504_2433_3521 362
965 3300047323 Ga0495683_0000037 Ga0495683_0000037_129170_130258 362
966 3300047323 Ga0495683_0000674 Ga0495683_0000674_23589_24677 362
967 3300047323 Ga0495683_0006806 Ga0495683_0006806_4747_5835 362
968 3300047323 Ga0495683_0009191 Ga0495683_0009191_3377_4465 362
969 3300047323 Ga0495683_0014115 Ga0495683_0014115_2056_3144 362
970 3300047323 Ga0495683_0100629 Ga0495683_0100629_247_1335 362
971 3300047323 Ga0495683_0118524 Ga0495683_0118524_48_1136 362
972 3300047444 Ga0495675_0004640 Ga0495675_0004640_1661_2749 362
973 3300047445 Ga0495677_0001883 Ga0495677_0001883_4884_5972 362
974 3300047446 Ga0495679_000336 Ga0495679_000336_15681_16769 362
975 3300047446 Ga0495679_000402 Ga0495679_000402_21013_22101 362
976 3300047446 Ga0495679_001939 Ga0495679_001939_2024_3112 362
977 3300047446 Ga0495679_003604 Ga0495679_003604_2825_3913 362
978 3300047446 Ga0495679_004478 Ga0495679_004478_1543_2631 362
979 3300047447 Ga0495685_044248 Ga0495685_044248_78_1166 362
980 3300047469 Ga0495673_0000093 Ga0495673_0000093_59865_60953 362
981 3300047469 Ga0495673_0000184 Ga0495673_0000184_39247_40335 362
982 3300047469 Ga0495673_0000760 Ga0495673_0000760_20445_21533 362
983 3300047469 Ga0495673_0003126 Ga0495673_0003126_6742_7839 362
984 3300047469 Ga0495673_0008563 Ga0495673_0008563_131_1219 362
985 3300047469 Ga0495673_0014513 Ga0495673_0014513_270_1358 362
986 3300047470 Ga0495681_0000082 Ga0495681_0000082_76403_77491 362
987 3300047470 Ga0495681_0000156 Ga0495681_0000156_54883_55971 362
988 3300047470 Ga0495681_0001246 Ga0495681_0001246_15619_16707 362
989 3300047470 Ga0495681_0004206 Ga0495681_0004206_1295_2383 362
990 3300047470 Ga0495681_0006108 Ga0495681_0006108_2748_3836 362
991 3300047470 Ga0495681_0010952 Ga0495681_0010952_31_1119 362
992 3300047470 Ga0495681_0014931 Ga0495681_0014931_587_1675 362
993 3300047472 Ga0495686_0000789 Ga0495686_0000789_26200_27288 362
994 3300047472 Ga0495686_0009134 Ga0495686_0009134_5056_6144 362
995 3300047472 Ga0495686_0181060 Ga0495686_0181060_83_1171 362
996 3300047673 Ga0495593_0008525 Ga0495593_0008525_3826_4914 362
997 3300047673 Ga0495593_0086790 Ga0495593_0086790_374_1462 362
998 3300048091 Ga0495626_0000087 Ga0495626_0000087_114416_115504 362
999 3300048091 Ga0495626_0000331 Ga0495626_0000331_28573_29661 362
1000 3300048091 Ga0495626_0000525 Ga0495626_0000525_22390_23478 362
1001 3300048091 Ga0495626_0003549 Ga0495626_0003549_2684_3772 362
1002 3300048091 Ga0495626_0004136 Ga0495626_0004136_7834_8922 362
1003 3300048091 Ga0495626_0006636 Ga0495626_0006636_1098_2186 362
1004 3300048905 Ga0496102_0000073 Ga0496102_0000073_37213_38301 362
1005 3300048906 Ga0496103_0000755 Ga0496103_0000755_6777_7865 362
1006 3300048913 Ga0496110_0039290 Ga0496110_0039290_2597_3685 362
1007 3300048918 Ga0496115_0038374 Ga0496115_0038374_1660_2748 362
1008 3300048920 Ga0496117_0015411 Ga0496117_0015411_3512_4600 362
1009 3300048921 Ga0496118_0003254 Ga0496118_0003254_12981_14069 362
1010 3300048921 Ga0496118_0041093 Ga0496118_0041093_1920_3008 362
1011 3300048921 Ga0496118_0072060 Ga0496118_0072060_108_1196 362
1012 3300048924 Ga0496121_0043621 Ga0496121_0043621_914_2002 362
1013 3300048927 Ga0496124_0024592 Ga0496124_0024592_2711_3799 362
1014 3300048927 Ga0496124_0081763 Ga0496124_0081763_395_1483 362
1015 3300048928 Ga0496125_0035340 Ga0496125_0035340_443_1531 362
1016 3300048928 Ga0496125_0061303 Ga0496125_0061303_430_1518 362
1017 3300049459 Ga0495678_000542 Ga0495678_000542_14759_15847 362
1018 3300049459 Ga0495678_004994 Ga0495678_004994_284_1372 362
1019 3300049459 Ga0495678_016219 Ga0495678_016219_1256_2344 362
1020 3300049459 Ga0495678_020921 Ga0495678_020921_702_1790 362
1021 3300049459 Ga0495678_061258 Ga0495678_061258_294_1382 362
1022 3300049460 Ga0495682_0000020 Ga0495682_0000020_187493_188581 362
1023 3300049460 Ga0495682_0000279 Ga0495682_0000279_31562_32650 362
1024 3300049460 Ga0495682_0011355 Ga0495682_0011355_590_1678 362
1025 3300049460 Ga0495682_0042637 Ga0495682_0042637_485_1573 362
1026 3300050489 nmdc:mga03683_11227_c1 nmdc:mga03683_11227_c1_148_1236 362
1027 3300050491 nmdc:mga00v17_84836_c1 nmdc:mga00v17_84836_c1_143_1231 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

119

368

0.88

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

48

347

0.86

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

88

378

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9707 23 360
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9704 23 360
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9695 23 360
7oyy-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine 0.9676 22 360
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9666 22 360
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9878 25 128 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9745 25 328 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9693 25 128 3.40.190.10
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9688 25 130 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9685 25 328 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MU04-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9923 156 251 GO:0015846
GO:0019808
GO:0042597
AF-A0A530N1C4-F1-model_v4 deleted 0.99 20 342
AF-A0A2N3AV69-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.988 39 362 GO:0015846
GO:0019808
GO:0042597
AF-A0A2M7Y8B4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9839 94 362 GO:0015846
GO:0019808
GO:0042597
AF-A0A3M4DHW7-F1-model_v4 deleted 0.983 68 362

Feature Viewer

pLDDT pTM Quality
92.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map