F488531
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 466 | 2054 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100203105|Ga0070713_1002031052 |
| Length | 152 |
| Sequence | MAMSVGPGSGEEQTVMAAINTTPLVDVMLVLLIIFLITIPVINKNVPVVLPKAVNIPTQTKPENIVVSVNKDGKIFWKDQETKNRQQLLDLVKSVAVIKPQPEIHIRADKEAHYEAIGRVIFTIQRGGVQKVGFITEPDHGIGVSAAAAAAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 214 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 277 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 278 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 279 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 280 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 283 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 284 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 285 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 286 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 292 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 309 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 350 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 351 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 361 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 379 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 380 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 381 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 395 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 396 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 397 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 399 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 405 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 416 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 417 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 418 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.42 |
| Metatranscriptomes | 15.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.65 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 85.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100203105 | 3300005436 | Bacteria | 1791 |
| 2 | JGI24744J21845_10032899 | 3300002077 | Bacteria | 988 |
| 3 | JGI25156J39149_1025481 | 3300002705 | Bacteria | 950 |
| 4 | Ga0007410J51695_1047609 | 3300003574 | Bacteria | 1199 |
| 5 | Ga0032354_1074764 | 3300003693 | Bacteria | 1265 |
| 6 | Ga0055533_1000087 | 3300003756 | Bacteria | 122417 |
| 7 | Ga0055525_1000799 | 3300003759 | Bacteria | 9907 |
| 8 | Ga0055535_1000718 | 3300003761 | Bacteria | 25117 |
| 9 | Ga0055529_1000885 | 3300003763 | Bacteria | 16980 |
| 10 | Ga0058859_11575955 | 3300004798 | Bacteria | 596 |
| 11 | Ga0058859_11636537 | 3300004798 | Bacteria | 581 |
| 12 | Ga0058863_10034658 | 3300004799 | Bacteria | 3854 |
| 13 | Ga0058863_11886887 | 3300004799 | Bacteria | 1819 |
| 14 | Ga0058863_11955264 | 3300004799 | Bacteria | 3661 |
| 15 | Ga0058861_10033013 | 3300004800 | Bacteria | 4460 |
| 16 | Ga0058861_11829992 | 3300004800 | Bacteria | 3204 |
| 17 | Ga0058860_10027454 | 3300004801 | Bacteria | 4105 |
| 18 | Ga0058860_10098742 | 3300004801 | Bacteria | 891 |
| 19 | Ga0058860_10103368 | 3300004801 | Bacteria | 2017 |
| 20 | Ga0058862_10047899 | 3300004803 | Bacteria | 4748 |
| 21 | Ga0058862_10112105 | 3300004803 | Bacteria | 4614 |
| 22 | Ga0058862_12771566 | 3300004803 | Bacteria | 787 |
| 23 | Ga0065707_10115128 | 3300005295 | Bacteria | 2276 |
| 24 | Ga0070658_10092147 | 3300005327 | Bacteria | 2498 |
| 25 | Ga0070676_10101937 | 3300005328 | Bacteria | 1775 |
| 26 | Ga0070683_100027202 | 3300005329 | Bacteria | 5157 |
| 27 | Ga0070683_100246845 | 3300005329 | Bacteria | 1698 |
| 28 | Ga0070683_100480167 | 3300005329 | Bacteria | 1187 |
| 29 | Ga0070690_100014196 | 3300005330 | Bacteria | 4723 |
| 30 | Ga0070690_100017452 | 3300005330 | Bacteria | 4316 |
| 31 | Ga0070690_100554674 | 3300005330 | Bacteria | 867 |
| 32 | Ga0070670_100763436 | 3300005331 | Bacteria | 872 |
| 33 | Ga0068869_100041507 | 3300005334 | Bacteria | 3296 |
| 34 | Ga0068869_100322123 | 3300005334 | Bacteria | 1254 |
| 35 | Ga0068869_100427924 | 3300005334 | Bacteria | 1093 |
| 36 | Ga0068869_100650362 | 3300005334 | Bacteria | 895 |
| 37 | Ga0070666_10007154 | 3300005335 | Bacteria | 6876 |
| 38 | Ga0070666_10167532 | 3300005335 | Bacteria | 1537 |
| 39 | Ga0070666_11304180 | 3300005335 | Bacteria | 542 |
| 40 | Ga0070680_100067162 | 3300005336 | Bacteria | 2941 |
| 41 | Ga0070682_100404250 | 3300005337 | Bacteria | 1034 |
| 42 | Ga0070682_100481293 | 3300005337 | Bacteria | 958 |
| 43 | Ga0068868_100003950 | 3300005338 | Bacteria | 10353 |
| 44 | Ga0068868_100505187 | 3300005338 | Bacteria | 1059 |
| 45 | Ga0070660_100045223 | 3300005339 | Bacteria | 3369 |
| 46 | Ga0070689_100019912 | 3300005340 | Bacteria | 4969 |
| 47 | Ga0070689_100908061 | 3300005340 | Bacteria | 779 |
| 48 | Ga0070689_101130080 | 3300005340 | Bacteria | 701 |
| 49 | Ga0070691_10564235 | 3300005341 | Bacteria | 667 |
| 50 | Ga0070691_10780996 | 3300005341 | Bacteria | 580 |
| 51 | Ga0070661_100186482 | 3300005344 | Bacteria | 1580 |
| 52 | Ga0070661_100821862 | 3300005344 | Bacteria | 763 |
| 53 | Ga0070661_101168400 | 3300005344 | Bacteria | 643 |
| 54 | Ga0070692_10159278 | 3300005345 | Bacteria | 1292 |
| 55 | Ga0070668_100481474 | 3300005347 | Bacteria | 1072 |
| 56 | Ga0070669_100017622 | 3300005353 | Bacteria | 5095 |
| 57 | Ga0070669_101377913 | 3300005353 | Bacteria | 612 |
| 58 | Ga0070671_100000631 | 3300005355 | Bacteria | 25121 |
| 59 | Ga0070671_100111115 | 3300005355 | Bacteria | 2302 |
| 60 | Ga0070671_100838344 | 3300005355 | Bacteria | 801 |
| 61 | Ga0070674_100014580 | 3300005356 | Bacteria | 4889 |
| 62 | Ga0070673_100039827 | 3300005364 | Bacteria | 3600 |
| 63 | Ga0070673_100137012 | 3300005364 | Bacteria | 2061 |
| 64 | Ga0070673_100301816 | 3300005364 | Bacteria | 1410 |
| 65 | Ga0070673_100622344 | 3300005364 | Bacteria | 986 |
| 66 | Ga0070688_100108938 | 3300005365 | Bacteria | 1839 |
| 67 | Ga0070688_101190119 | 3300005365 | Bacteria | 612 |
| 68 | Ga0070659_100098220 | 3300005366 | Bacteria | 2354 |
| 69 | Ga0070659_100290954 | 3300005366 | Bacteria | 1360 |
| 70 | Ga0070667_100004025 | 3300005367 | Bacteria | 12440 |
| 71 | Ga0070667_100213813 | 3300005367 | Bacteria | 1714 |
| 72 | Ga0070667_100657725 | 3300005367 | Bacteria | 968 |
| 73 | Ga0070667_101284441 | 3300005367 | Bacteria | 686 |
| 74 | Ga0070667_101420506 | 3300005367 | Bacteria | 651 |
| 75 | Ga0070667_101553986 | 3300005367 | Bacteria | 622 |
| 76 | Ga0070703_10130968 | 3300005406 | Bacteria | 921 |
| 77 | Ga0070709_10049620 | 3300005434 | Bacteria | 2625 |
| 78 | Ga0070709_10335980 | 3300005434 | Bacteria | 1113 |
| 79 | Ga0070714_100022733 | 3300005435 | Bacteria | 5144 |
| 80 | Ga0070714_100053701 | 3300005435 | Bacteria | 3441 |
| 81 | Ga0070713_100040939 | 3300005436 | Bacteria | 3771 |
| 82 | Ga0070713_100141698 | 3300005436 | Bacteria | 2130 |
| 83 | Ga0070713_100577259 | 3300005436 | Bacteria | 1066 |
| 84 | Ga0070713_100764604 | 3300005436 | Bacteria | 925 |
| 85 | Ga0070710_10253618 | 3300005437 | Bacteria | 1132 |
| 86 | Ga0070710_10341404 | 3300005437 | Bacteria | 989 |
| 87 | Ga0070701_10011235 | 3300005438 | Bacteria | 3995 |
| 88 | Ga0070701_10101907 | 3300005438 | Bacteria | 1591 |
| 89 | Ga0070711_100077057 | 3300005439 | Bacteria | 2365 |
| 90 | Ga0070705_100867094 | 3300005440 | Bacteria | 724 |
| 91 | Ga0070705_100978758 | 3300005440 | Bacteria | 685 |
| 92 | Ga0070700_100582929 | 3300005441 | Bacteria | 874 |
| 93 | Ga0070694_100005435 | 3300005444 | Bacteria | 7712 |
| 94 | Ga0070708_100211817 | 3300005445 | Bacteria | 1816 |
| 95 | Ga0070663_100067195 | 3300005455 | Bacteria | 2599 |
| 96 | Ga0070663_100674065 | 3300005455 | Bacteria | 877 |
| 97 | Ga0070678_100222132 | 3300005456 | Bacteria | 1571 |
| 98 | Ga0070678_100432993 | 3300005456 | Bacteria | 1149 |
| 99 | Ga0070678_100499387 | 3300005456 | Bacteria | 1073 |
| 100 | Ga0070678_100955836 | 3300005456 | Bacteria | 786 |
| 101 | Ga0070662_100905926 | 3300005457 | Bacteria | 752 |
| 102 | Ga0070681_10001553 | 3300005458 | Bacteria | 20347 |
| 103 | Ga0070681_10034442 | 3300005458 | Bacteria | 5085 |
| 104 | Ga0070681_10048735 | 3300005458 | Bacteria | 4233 |
| 105 | Ga0070681_10083859 | 3300005458 | Bacteria | 3140 |
| 106 | Ga0070681_10582584 | 3300005458 | Bacteria | 1033 |
| 107 | Ga0068867_100084042 | 3300005459 | Bacteria | 2404 |
| 108 | Ga0068867_100127252 | 3300005459 | Bacteria | 1975 |
| 109 | Ga0068867_100183613 | 3300005459 | Bacteria | 1664 |
| 110 | Ga0068867_100249907 | 3300005459 | Bacteria | 1442 |
| 111 | Ga0068867_101196718 | 3300005459 | Bacteria | 698 |
| 112 | Ga0070685_10606144 | 3300005466 | Bacteria | 788 |
| 113 | Ga0070699_100264491 | 3300005518 | Bacteria | 1539 |
| 114 | Ga0070679_100013442 | 3300005530 | Bacteria | 7839 |
| 115 | Ga0070679_100067891 | 3300005530 | Bacteria | 3557 |
| 116 | Ga0070679_100219666 | 3300005530 | Bacteria | 1862 |
| 117 | Ga0070684_100207477 | 3300005535 | Bacteria | 1786 |
| 118 | Ga0070684_100554556 | 3300005535 | Bacteria | 1067 |
| 119 | Ga0070684_100592975 | 3300005535 | Bacteria | 1030 |
| 120 | Ga0070684_101451950 | 3300005535 | Bacteria | 646 |
| 121 | Ga0068853_100296853 | 3300005539 | Bacteria | 1493 |
| 122 | Ga0068853_100414252 | 3300005539 | Bacteria | 1263 |
| 123 | Ga0068853_101256972 | 3300005539 | Bacteria | 715 |
| 124 | Ga0070672_100002728 | 3300005543 | Bacteria | 11297 |
| 125 | Ga0070672_100014054 | 3300005543 | Bacteria | 5665 |
| 126 | Ga0070672_101101220 | 3300005543 | Bacteria | 706 |
| 127 | Ga0070686_100021404 | 3300005544 | Bacteria | 3844 |
| 128 | Ga0070686_100370920 | 3300005544 | Bacteria | 1081 |
| 129 | Ga0070686_100453369 | 3300005544 | Bacteria | 986 |
| 130 | Ga0070695_100032624 | 3300005545 | Bacteria | 3256 |
| 131 | Ga0070695_100046447 | 3300005545 | Bacteria | 2771 |
| 132 | Ga0070695_101597724 | 3300005545 | Bacteria | 544 |
| 133 | Ga0070696_100011332 | 3300005546 | Bacteria | 5969 |
| 134 | Ga0070696_100373824 | 3300005546 | Bacteria | 1109 |
| 135 | Ga0070693_100130788 | 3300005547 | Bacteria | 1569 |
| 136 | Ga0070693_100279700 | 3300005547 | Bacteria | 1117 |
| 137 | Ga0070665_100003303 | 3300005548 | Bacteria | 17280 |
| 138 | Ga0070665_100009341 | 3300005548 | Bacteria | 9926 |
| 139 | Ga0070665_100014326 | 3300005548 | Bacteria | 7963 |
| 140 | Ga0070665_100024057 | 3300005548 | Bacteria | 6133 |
| 141 | Ga0070665_100041275 | 3300005548 | Bacteria | 4637 |
| 142 | Ga0070665_100051461 | 3300005548 | Bacteria | 4131 |
| 143 | Ga0070665_100067747 | 3300005548 | Bacteria | 3579 |
| 144 | Ga0070665_100254610 | 3300005548 | Bacteria | 1756 |
| 145 | Ga0070665_100388767 | 3300005548 | Bacteria | 1403 |
| 146 | Ga0070704_102179687 | 3300005549 | Bacteria | 515 |
| 147 | Ga0068855_100001659 | 3300005563 | Bacteria | 27835 |
| 148 | Ga0070664_100422952 | 3300005564 | Bacteria | 1220 |
| 149 | Ga0070664_100635243 | 3300005564 | Bacteria | 992 |
| 150 | Ga0068857_100353114 | 3300005577 | Bacteria | 1362 |
| 151 | Ga0068857_101005918 | 3300005577 | Bacteria | 803 |
| 152 | Ga0068854_100226154 | 3300005578 | Bacteria | 1483 |
| 153 | Ga0068854_101657754 | 3300005578 | Bacteria | 584 |
| 154 | Ga0068856_100168958 | 3300005614 | Bacteria | 2199 |
| 155 | Ga0068856_101825358 | 3300005614 | Bacteria | 619 |
| 156 | Ga0068856_101832794 | 3300005614 | Bacteria | 618 |
| 157 | Ga0070702_100012685 | 3300005615 | Bacteria | 4233 |
| 158 | Ga0068852_100266957 | 3300005616 | Bacteria | 1645 |
| 159 | Ga0068852_100271259 | 3300005616 | Bacteria | 1633 |
| 160 | Ga0068852_100271861 | 3300005616 | Bacteria | 1631 |
| 161 | Ga0068852_100705092 | 3300005616 | Bacteria | 1019 |
| 162 | Ga0068852_101153412 | 3300005616 | Bacteria | 796 |
| 163 | Ga0068859_100000720 | 3300005617 | Bacteria | 33292 |
| 164 | Ga0068859_100024617 | 3300005617 | Bacteria | 6040 |
| 165 | Ga0068859_100115898 | 3300005617 | Bacteria | 2744 |
| 166 | Ga0068859_100183306 | 3300005617 | Bacteria | 2177 |
| 167 | Ga0068859_100453920 | 3300005617 | Bacteria | 1378 |
| 168 | Ga0068859_100487589 | 3300005617 | Bacteria | 1328 |
| 169 | Ga0068859_101849086 | 3300005617 | Bacteria | 667 |
| 170 | Ga0068864_100005158 | 3300005618 | Bacteria | 10702 |
| 171 | Ga0068864_100126297 | 3300005618 | Bacteria | 2293 |
| 172 | Ga0068864_101306805 | 3300005618 | Bacteria | 726 |
| 173 | Ga0068861_100001212 | 3300005719 | Bacteria | 16054 |
| 174 | Ga0068861_100005227 | 3300005719 | Bacteria | 8745 |
| 175 | Ga0068861_101313426 | 3300005719 | Bacteria | 704 |
| 176 | Ga0068851_10168944 | 3300005834 | Bacteria | 1206 |
| 177 | Ga0068851_11023415 | 3300005834 | Bacteria | 522 |
| 178 | Ga0068870_10306908 | 3300005840 | Bacteria | 1004 |
| 179 | Ga0068863_100014074 | 3300005841 | Bacteria | 7708 |
| 180 | Ga0068863_100022736 | 3300005841 | Bacteria | 5989 |
| 181 | Ga0068863_100038720 | 3300005841 | Bacteria | 4536 |
| 182 | Ga0068863_100175145 | 3300005841 | Bacteria | 2058 |
| 183 | Ga0068863_100426305 | 3300005841 | Bacteria | 1300 |
| 184 | Ga0068863_101109184 | 3300005841 | Bacteria | 796 |
| 185 | Ga0068858_100000571 | 3300005842 | Bacteria | 38529 |
| 186 | Ga0068858_100010826 | 3300005842 | Bacteria | 8622 |
| 187 | Ga0068858_100021381 | 3300005842 | Bacteria | 6044 |
| 188 | Ga0068858_100318992 | 3300005842 | Bacteria | 1485 |
| 189 | Ga0068858_100917597 | 3300005842 | Bacteria | 857 |
| 190 | Ga0068860_100011510 | 3300005843 | Bacteria | 8719 |
| 191 | Ga0068860_100023543 | 3300005843 | Bacteria | 5952 |
| 192 | Ga0068860_100025609 | 3300005843 | Bacteria | 5689 |
| 193 | Ga0068860_100059600 | 3300005843 | Bacteria | 3628 |
| 194 | Ga0068860_100183325 | 3300005843 | Bacteria | 2024 |
| 195 | Ga0068862_100016054 | 3300005844 | Bacteria | 6227 |
| 196 | Ga0068862_100017864 | 3300005844 | Bacteria | 5905 |
| 197 | Ga0068862_100566210 | 3300005844 | Bacteria | 1087 |
| 198 | Ga0068862_100885527 | 3300005844 | Bacteria | 877 |
| 199 | Ga0081455_10262011 | 3300005937 | Bacteria | 1258 |
| 200 | Ga0070717_10906533 | 3300006028 | Bacteria | 802 |
| 201 | Ga0070715_10000391 | 3300006163 | Bacteria | 11023 |
| 202 | Ga0070715_10158913 | 3300006163 | Bacteria | 1115 |
| 203 | Ga0070716_100056019 | 3300006173 | Bacteria | 2259 |
| 204 | Ga0070712_100005045 | 3300006175 | Bacteria | 8177 |
| 205 | Ga0070712_100413922 | 3300006175 | Bacteria | 1116 |
| 206 | Ga0075366_10012267 | 3300006195 | Bacteria | 4858 |
| 207 | Ga0075366_10012973 | 3300006195 | Bacteria | 4737 |
| 208 | Ga0075366_10027612 | 3300006195 | Bacteria | 3330 |
| 209 | Ga0075366_10154126 | 3300006195 | Bacteria | 1392 |
| 210 | Ga0097621_100193735 | 3300006237 | Bacteria | 1761 |
| 211 | Ga0097621_100297145 | 3300006237 | Bacteria | 1425 |
| 212 | Ga0097621_100423065 | 3300006237 | Bacteria | 1196 |
| 213 | Ga0097621_100575047 | 3300006237 | Bacteria | 1028 |
| 214 | Ga0097621_100636364 | 3300006237 | Bacteria | 978 |
| 215 | Ga0097621_100910085 | 3300006237 | Bacteria | 820 |
| 216 | Ga0097621_101083175 | 3300006237 | Bacteria | 752 |
| 217 | Ga0075370_10038229 | 3300006353 | Bacteria | 2700 |
| 218 | Ga0075370_10069945 | 3300006353 | Bacteria | 2007 |
| 219 | Ga0075370_10121983 | 3300006353 | Bacteria | 1518 |
| 220 | Ga0075370_10830392 | 3300006353 | Bacteria | 564 |
| 221 | Ga0068871_100055785 | 3300006358 | Bacteria | 3209 |
| 222 | Ga0068871_100120681 | 3300006358 | Bacteria | 2214 |
| 223 | Ga0068871_100171646 | 3300006358 | Bacteria | 1859 |
| 224 | Ga0068871_100370377 | 3300006358 | Bacteria | 1270 |
| 225 | Ga0068871_100392120 | 3300006358 | Bacteria | 1235 |
| 226 | Ga0068871_100697540 | 3300006358 | Bacteria | 930 |
| 227 | Ga0075430_100181058 | 3300006846 | Bacteria | 1753 |
| 228 | Ga0075434_100875106 | 3300006871 | Bacteria | 913 |
| 229 | Ga0068865_100002113 | 3300006881 | Bacteria | 11730 |
| 230 | Ga0068865_100118042 | 3300006881 | Bacteria | 1968 |
| 231 | Ga0068865_100894950 | 3300006881 | Bacteria | 772 |
| 232 | Ga0075436_100925096 | 3300006914 | Bacteria | 653 |
| 233 | Ga0097620_100000720 | 3300006931 | Bacteria | 33292 |
| 234 | Ga0097620_100024617 | 3300006931 | Bacteria | 6040 |
| 235 | Ga0097620_100115902 | 3300006931 | Bacteria | 2744 |
| 236 | Ga0097620_100183310 | 3300006931 | Bacteria | 2177 |
| 237 | Ga0097620_100453916 | 3300006931 | Bacteria | 1378 |
| 238 | Ga0097620_100487497 | 3300006931 | Bacteria | 1328 |
| 239 | Ga0097620_101848887 | 3300006931 | Bacteria | 667 |
| 240 | Ga0099795_10131997 | 3300007788 | Bacteria | 1009 |
| 241 | Ga0105250_10068890 | 3300009092 | Bacteria | 1429 |
| 242 | Ga0105250_10364386 | 3300009092 | Bacteria | 635 |
| 243 | Ga0105240_10000307 | 3300009093 | Bacteria | 94509 |
| 244 | Ga0105240_10142953 | 3300009093 | Bacteria | 2859 |
| 245 | Ga0105240_10344624 | 3300009093 | Bacteria | 1692 |
| 246 | Ga0105240_10366821 | 3300009093 | Bacteria | 1629 |
| 247 | Ga0105240_10484852 | 3300009093 | Bacteria | 1377 |
| 248 | Ga0105240_10633151 | 3300009093 | Bacteria | 1174 |
| 249 | Ga0105240_10899161 | 3300009093 | Bacteria | 953 |
| 250 | Ga0111539_10871523 | 3300009094 | Bacteria | 1047 |
| 251 | Ga0105245_10143056 | 3300009098 | Bacteria | 2254 |
| 252 | Ga0105245_10782570 | 3300009098 | Bacteria | 991 |
| 253 | Ga0105245_12641994 | 3300009098 | Bacteria | 555 |
| 254 | Ga0105247_10000598 | 3300009101 | Bacteria | 29258 |
| 255 | Ga0105247_10030816 | 3300009101 | Bacteria | 3253 |
| 256 | Ga0105247_10242956 | 3300009101 | Bacteria | 1227 |
| 257 | Ga0105247_10334138 | 3300009101 | Bacteria | 1061 |
| 258 | Ga0105247_10499597 | 3300009101 | Bacteria | 886 |
| 259 | Ga0105247_10743505 | 3300009101 | Bacteria | 743 |
| 260 | Ga0114129_10154179 | 3300009147 | Bacteria | 3143 |
| 261 | Ga0105243_10450504 | 3300009148 | Bacteria | 1207 |
| 262 | Ga0105241_10307786 | 3300009174 | Bacteria | 1362 |
| 263 | Ga0105241_10327860 | 3300009174 | Bacteria | 1322 |
| 264 | Ga0105241_10505448 | 3300009174 | Bacteria | 1078 |
| 265 | Ga0105242_10007597 | 3300009176 | Bacteria | 8343 |
| 266 | Ga0105242_10359564 | 3300009176 | Bacteria | 1347 |
| 267 | Ga0105242_10493350 | 3300009176 | Bacteria | 1163 |
| 268 | Ga0105242_10603919 | 3300009176 | Bacteria | 1060 |
| 269 | Ga0105242_10997189 | 3300009176 | Bacteria | 845 |
| 270 | Ga0105242_12147914 | 3300009176 | Bacteria | 603 |
| 271 | Ga0105248_10021845 | 3300009177 | Bacteria | 7091 |
| 272 | Ga0105248_10024493 | 3300009177 | Bacteria | 6710 |
| 273 | Ga0105248_10321348 | 3300009177 | Bacteria | 1743 |
| 274 | Ga0105248_10354465 | 3300009177 | Bacteria | 1652 |
| 275 | Ga0105248_10528173 | 3300009177 | Bacteria | 1331 |
| 276 | Ga0105248_11578734 | 3300009177 | Bacteria | 743 |
| 277 | Ga0105248_11879272 | 3300009177 | Bacteria | 679 |
| 278 | Ga0105237_10014635 | 3300009545 | Bacteria | 8194 |
| 279 | Ga0105237_10040905 | 3300009545 | Bacteria | 4675 |
| 280 | Ga0105237_10337999 | 3300009545 | Bacteria | 1510 |
| 281 | Ga0105237_10455096 | 3300009545 | Bacteria | 1286 |
| 282 | Ga0105237_10700425 | 3300009545 | Bacteria | 1019 |
| 283 | Ga0105237_10771522 | 3300009545 | Bacteria | 968 |
| 284 | Ga0105237_11551091 | 3300009545 | Bacteria | 669 |
| 285 | Ga0105237_11977938 | 3300009545 | Bacteria | 591 |
| 286 | Ga0105238_10057878 | 3300009551 | Bacteria | 3885 |
| 287 | Ga0105238_10105595 | 3300009551 | Bacteria | 2798 |
| 288 | Ga0105238_10124592 | 3300009551 | Bacteria | 2556 |
| 289 | Ga0105238_10219387 | 3300009551 | Bacteria | 1877 |
| 290 | Ga0105238_10433647 | 3300009551 | Bacteria | 1310 |
| 291 | Ga0105238_10595321 | 3300009551 | Bacteria | 1113 |
| 292 | Ga0105238_10929497 | 3300009551 | Bacteria | 889 |
| 293 | Ga0105238_11424727 | 3300009551 | Bacteria | 720 |
| 294 | Ga0105249_10027325 | 3300009553 | Bacteria | 5148 |
| 295 | Ga0105249_10049167 | 3300009553 | Bacteria | 3845 |
| 296 | Ga0105249_10298268 | 3300009553 | Bacteria | 1615 |
| 297 | Ga0105249_10384180 | 3300009553 | Bacteria | 1431 |
| 298 | Ga0105249_11034928 | 3300009553 | Bacteria | 890 |
| 299 | Ga0105239_10022131 | 3300010375 | Bacteria | 7006 |
| 300 | Ga0105239_10082627 | 3300010375 | Bacteria | 3538 |
| 301 | Ga0105239_10105579 | 3300010375 | Bacteria | 3120 |
| 302 | Ga0105239_10175265 | 3300010375 | Bacteria | 2398 |
| 303 | Ga0105239_10356885 | 3300010375 | Bacteria | 1650 |
| 304 | Ga0105239_10600920 | 3300010375 | Bacteria | 1255 |
| 305 | Ga0105239_10693387 | 3300010375 | Bacteria | 1164 |
| 306 | Ga0105239_13050598 | 3300010375 | Bacteria | 546 |
| 307 | Ga0105246_10243921 | 3300011119 | Bacteria | 1422 |
| 308 | Ga0105246_10321361 | 3300011119 | Bacteria | 1258 |
| 309 | Ga0105246_11827585 | 3300011119 | Bacteria | 581 |
| 310 | Ga0157371_10255227 | 3300013102 | Bacteria | 1263 |
| 311 | Ga0157371_10622041 | 3300013102 | Bacteria | 804 |
| 312 | Ga0157370_10394812 | 3300013104 | Bacteria | 1274 |
| 313 | Ga0157369_10087176 | 3300013105 | Bacteria | 3333 |
| 314 | Ga0157369_10214522 | 3300013105 | Bacteria | 2016 |
| 315 | Ga0157369_10273611 | 3300013105 | Bacteria | 1759 |
| 316 | Ga0157374_10113179 | 3300013296 | Bacteria | 2612 |
| 317 | Ga0157374_10304949 | 3300013296 | Bacteria | 1576 |
| 318 | Ga0157374_10609740 | 3300013296 | Bacteria | 1102 |
| 319 | Ga0157378_10048478 | 3300013297 | Bacteria | 3777 |
| 320 | Ga0157378_10081832 | 3300013297 | Bacteria | 2919 |
| 321 | Ga0163162_10003955 | 3300013306 | Bacteria | 14218 |
| 322 | Ga0163162_10056246 | 3300013306 | Bacteria | 3963 |
| 323 | Ga0163162_10112569 | 3300013306 | Bacteria | 2820 |
| 324 | Ga0163162_10132036 | 3300013306 | Bacteria | 2606 |
| 325 | Ga0163162_10332871 | 3300013306 | Bacteria | 1651 |
| 326 | Ga0157372_10271748 | 3300013307 | Bacteria | 1970 |
| 327 | Ga0157372_10327020 | 3300013307 | Bacteria | 1785 |
| 328 | Ga0157372_10865813 | 3300013307 | Bacteria | 1049 |
| 329 | Ga0157375_10037280 | 3300013308 | Bacteria | 4657 |
| 330 | Ga0157375_10173605 | 3300013308 | Bacteria | 2304 |
| 331 | Ga0157375_10349473 | 3300013308 | Bacteria | 1644 |
| 332 | Ga0157375_10569719 | 3300013308 | Bacteria | 1293 |
| 333 | Ga0157375_12593836 | 3300013308 | Bacteria | 606 |
| 334 | Ga0157375_13436579 | 3300013308 | Bacteria | 527 |
| 335 | Ga0163163_10019243 | 3300014325 | Bacteria | 6409 |
| 336 | Ga0163163_10106838 | 3300014325 | Bacteria | 2825 |
| 337 | Ga0163163_10445989 | 3300014325 | Bacteria | 1354 |
| 338 | Ga0163163_10804605 | 3300014325 | Bacteria | 1003 |
| 339 | Ga0163163_10915144 | 3300014325 | Bacteria | 940 |
| 340 | Ga0163163_11325315 | 3300014325 | Bacteria | 782 |
| 341 | Ga0163163_11707717 | 3300014325 | Bacteria | 690 |
| 342 | Ga0157380_10942454 | 3300014326 | Bacteria | 893 |
| 343 | Ga0157380_11224667 | 3300014326 | Bacteria | 795 |
| 344 | Ga0157380_11227449 | 3300014326 | Bacteria | 794 |
| 345 | Ga0157377_10448263 | 3300014745 | Bacteria | 890 |
| 346 | Ga0157379_10029723 | 3300014968 | Bacteria | 4859 |
| 347 | Ga0157379_10040550 | 3300014968 | Bacteria | 4156 |
| 348 | Ga0157379_10091983 | 3300014968 | Bacteria | 2721 |
| 349 | Ga0157379_10145753 | 3300014968 | Bacteria | 2135 |
| 350 | Ga0157376_10146723 | 3300014969 | Bacteria | 2123 |
| 351 | Ga0157376_10191770 | 3300014969 | Bacteria | 1874 |
| 352 | Ga0157376_10224046 | 3300014969 | Bacteria | 1743 |
| 353 | Ga0163161_10027982 | 3300017792 | Bacteria | 4000 |
| 354 | Ga0163161_10216042 | 3300017792 | Bacteria | 1483 |
| 355 | Ga0197907_11091587 | 3300020069 | Bacteria | 2415 |
| 356 | Ga0206356_10729450 | 3300020070 | Bacteria | 1940 |
| 357 | Ga0206349_1492484 | 3300020075 | Bacteria | 881 |
| 358 | Ga0206355_1673172 | 3300020076 | Bacteria | 1568 |
| 359 | Ga0206355_1694621 | 3300020076 | Bacteria | 1275 |
| 360 | Ga0206352_10323100 | 3300020078 | Bacteria | 573 |
| 361 | Ga0206352_10477912 | 3300020078 | Bacteria | 574 |
| 362 | Ga0206352_11342142 | 3300020078 | Bacteria | 1237 |
| 363 | Ga0206350_10166307 | 3300020080 | Bacteria | 1515 |
| 364 | Ga0206353_10940199 | 3300020082 | Bacteria | 804 |
| 365 | Ga0213872_10017280 | 3300021361 | Bacteria | 3336 |
| 366 | Ga0213876_10080580 | 3300021384 | Bacteria | 1721 |
| 367 | Ga0213871_10043169 | 3300021441 | Bacteria | 1216 |
| 368 | Ga0224712_10000712 | 3300022467 | Bacteria | 6882 |
| 369 | Ga0224712_10082901 | 3300022467 | Bacteria | 1327 |
| 370 | Ga0224712_10294634 | 3300022467 | Bacteria | 758 |
| 371 | Ga0209674_100088 | 3300025226 | Bacteria | 181554 |
| 372 | Ga0209672_106557 | 3300025228 | Bacteria | 1879 |
| 373 | Ga0209563_100179 | 3300025230 | Bacteria | 41234 |
| 374 | Ga0209258_100362 | 3300025242 | Bacteria | 61104 |
| 375 | Ga0209677_100962 | 3300025253 | Bacteria | 14011 |
| 376 | Ga0209148_1012256 | 3300025254 | Bacteria | 1573 |
| 377 | Ga0209759_1001320 | 3300025256 | Bacteria | 14578 |
| 378 | Ga0209759_1001825 | 3300025256 | Bacteria | 10688 |
| 379 | Ga0209759_1039357 | 3300025256 | Bacteria | 831 |
| 380 | Ga0209455_1000553 | 3300025272 | Bacteria | 25308 |
| 381 | Ga0209051_1004288 | 3300025303 | Bacteria | 8869 |
| 382 | Ga0207656_10690966 | 3300025321 | Bacteria | 522 |
| 383 | Ga0207692_10053272 | 3300025898 | Bacteria | 2060 |
| 384 | Ga0207692_10774734 | 3300025898 | Bacteria | 626 |
| 385 | Ga0207642_10299782 | 3300025899 | Bacteria | 931 |
| 386 | Ga0207710_10000550 | 3300025900 | Bacteria | 22540 |
| 387 | Ga0207710_10165809 | 3300025900 | Bacteria | 1078 |
| 388 | Ga0207710_10314593 | 3300025900 | Bacteria | 793 |
| 389 | Ga0207688_10202853 | 3300025901 | Bacteria | 1189 |
| 390 | Ga0207680_10089786 | 3300025903 | Bacteria | 1951 |
| 391 | Ga0207680_11316918 | 3300025903 | Bacteria | 513 |
| 392 | Ga0207647_10039674 | 3300025904 | Bacteria | 2969 |
| 393 | Ga0207685_10013616 | 3300025905 | Bacteria | 2521 |
| 394 | Ga0207699_10133716 | 3300025906 | Bacteria | 1621 |
| 395 | Ga0207699_10305964 | 3300025906 | Bacteria | 1111 |
| 396 | Ga0207645_10082538 | 3300025907 | Bacteria | 2060 |
| 397 | Ga0207645_10241709 | 3300025907 | Bacteria | 1193 |
| 398 | Ga0207643_10092863 | 3300025908 | Bacteria | 1761 |
| 399 | Ga0207643_10505438 | 3300025908 | Bacteria | 773 |
| 400 | Ga0207654_10315472 | 3300025911 | Bacteria | 1067 |
| 401 | Ga0207654_10485410 | 3300025911 | Bacteria | 871 |
| 402 | Ga0207707_10018928 | 3300025912 | Bacteria | 6003 |
| 403 | Ga0207707_10020224 | 3300025912 | Bacteria | 5812 |
| 404 | Ga0207707_10021766 | 3300025912 | Bacteria | 5603 |
| 405 | Ga0207707_10059982 | 3300025912 | Bacteria | 3310 |
| 406 | Ga0207707_10109633 | 3300025912 | Bacteria | 2413 |
| 407 | Ga0207707_10433640 | 3300025912 | Bacteria | 1125 |
| 408 | Ga0207695_10006233 | 3300025913 | Bacteria | 15534 |
| 409 | Ga0207695_10041002 | 3300025913 | Bacteria | 4957 |
| 410 | Ga0207695_10056184 | 3300025913 | Bacteria | 4097 |
| 411 | Ga0207695_10124052 | 3300025913 | Bacteria | 2547 |
| 412 | Ga0207695_10163544 | 3300025913 | Bacteria | 2155 |
| 413 | Ga0207695_10731297 | 3300025913 | Bacteria | 870 |
| 414 | Ga0207671_10026753 | 3300025914 | Bacteria | 4318 |
| 415 | Ga0207671_10039761 | 3300025914 | Bacteria | 3483 |
| 416 | Ga0207671_10299365 | 3300025914 | Bacteria | 1270 |
| 417 | Ga0207671_10317257 | 3300025914 | Bacteria | 1233 |
| 418 | Ga0207671_10517160 | 3300025914 | Bacteria | 952 |
| 419 | Ga0207671_10751317 | 3300025914 | Bacteria | 775 |
| 420 | Ga0207693_10000300 | 3300025915 | Bacteria | 46109 |
| 421 | Ga0207693_10015521 | 3300025915 | Bacteria | 6111 |
| 422 | Ga0207663_10281347 | 3300025916 | Bacteria | 1236 |
| 423 | Ga0207660_10058087 | 3300025917 | Bacteria | 2773 |
| 424 | Ga0207657_10026920 | 3300025919 | Bacteria | 5273 |
| 425 | Ga0207649_10894004 | 3300025920 | Bacteria | 696 |
| 426 | Ga0207652_10025490 | 3300025921 | Bacteria | 4918 |
| 427 | Ga0207652_10116449 | 3300025921 | Bacteria | 2374 |
| 428 | Ga0207652_10251207 | 3300025921 | Bacteria | 1595 |
| 429 | Ga0207681_10044059 | 3300025923 | Bacteria | 2989 |
| 430 | Ga0207694_10164152 | 3300025924 | Bacteria | 1795 |
| 431 | Ga0207694_10182501 | 3300025924 | Bacteria | 1702 |
| 432 | Ga0207694_10192873 | 3300025924 | Bacteria | 1656 |
| 433 | Ga0207694_10259426 | 3300025924 | Bacteria | 1423 |
| 434 | Ga0207694_10415621 | 3300025924 | Bacteria | 1120 |
| 435 | Ga0207694_10452521 | 3300025924 | Bacteria | 1072 |
| 436 | Ga0207694_10789444 | 3300025924 | Bacteria | 802 |
| 437 | Ga0207694_11817875 | 3300025924 | Bacteria | 512 |
| 438 | Ga0207650_10213836 | 3300025925 | Bacteria | 1549 |
| 439 | Ga0207687_10225772 | 3300025927 | Bacteria | 1477 |
| 440 | Ga0207687_11560415 | 3300025927 | Bacteria | 567 |
| 441 | Ga0207700_10060089 | 3300025928 | Bacteria | 2877 |
| 442 | Ga0207700_10066821 | 3300025928 | Bacteria | 2749 |
| 443 | Ga0207700_10112344 | 3300025928 | Bacteria | 2195 |
| 444 | Ga0207700_10170868 | 3300025928 | Bacteria | 1813 |
| 445 | Ga0207664_10017611 | 3300025929 | Bacteria | 5242 |
| 446 | Ga0207664_10054088 | 3300025929 | Bacteria | 3181 |
| 447 | Ga0207664_10365816 | 3300025929 | Bacteria | 1278 |
| 448 | Ga0207644_10001716 | 3300025931 | Bacteria | 14158 |
| 449 | Ga0207644_10070418 | 3300025931 | Bacteria | 2556 |
| 450 | Ga0207644_10076490 | 3300025931 | Bacteria | 2463 |
| 451 | Ga0207690_10089348 | 3300025932 | Bacteria | 2172 |
| 452 | Ga0207706_10659351 | 3300025933 | Bacteria | 896 |
| 453 | Ga0207706_10953457 | 3300025933 | Bacteria | 723 |
| 454 | Ga0207686_10018392 | 3300025934 | Bacteria | 3957 |
| 455 | Ga0207686_10098660 | 3300025934 | Bacteria | 1946 |
| 456 | Ga0207686_10628533 | 3300025934 | Bacteria | 848 |
| 457 | Ga0207670_10013314 | 3300025936 | Bacteria | 4845 |
| 458 | Ga0207670_10767906 | 3300025936 | Bacteria | 801 |
| 459 | Ga0207670_11155172 | 3300025936 | Bacteria | 655 |
| 460 | Ga0207704_10045766 | 3300025938 | Bacteria | 2602 |
| 461 | Ga0207704_10121017 | 3300025938 | Bacteria | 1791 |
| 462 | Ga0207704_10766144 | 3300025938 | Bacteria | 804 |
| 463 | Ga0207665_10004706 | 3300025939 | Bacteria | 9066 |
| 464 | Ga0207691_10007437 | 3300025940 | Bacteria | 10546 |
| 465 | Ga0207691_10020550 | 3300025940 | Bacteria | 6243 |
| 466 | Ga0207711_10059379 | 3300025941 | Bacteria | 3293 |
| 467 | Ga0207711_10249343 | 3300025941 | Bacteria | 1630 |
| 468 | Ga0207711_11500546 | 3300025941 | Bacteria | 617 |
| 469 | Ga0207711_11576796 | 3300025941 | Bacteria | 600 |
| 470 | Ga0207689_10052704 | 3300025942 | Bacteria | 3352 |
| 471 | Ga0207689_10164269 | 3300025942 | Bacteria | 1829 |
| 472 | Ga0207689_10200563 | 3300025942 | Bacteria | 1647 |
| 473 | Ga0207689_10321214 | 3300025942 | Bacteria | 1285 |
| 474 | Ga0207661_10040742 | 3300025944 | Bacteria | 3653 |
| 475 | Ga0207661_10153192 | 3300025944 | Bacteria | 1994 |
| 476 | Ga0207661_10614628 | 3300025944 | Bacteria | 998 |
| 477 | Ga0207679_10111763 | 3300025945 | Bacteria | 2158 |
| 478 | Ga0207679_10973797 | 3300025945 | Bacteria | 777 |
| 479 | Ga0207679_11352269 | 3300025945 | Bacteria | 654 |
| 480 | Ga0207679_11992207 | 3300025945 | Bacteria | 529 |
| 481 | Ga0207667_10012751 | 3300025949 | Bacteria | 9652 |
| 482 | Ga0207667_10609485 | 3300025949 | Bacteria | 1100 |
| 483 | Ga0207651_10001498 | 3300025960 | Bacteria | 10636 |
| 484 | Ga0207651_10545618 | 3300025960 | Bacteria | 1007 |
| 485 | Ga0207651_10579901 | 3300025960 | Bacteria | 978 |
| 486 | Ga0207651_11609941 | 3300025960 | Bacteria | 585 |
| 487 | Ga0207712_10055160 | 3300025961 | Bacteria | 2794 |
| 488 | Ga0207712_10410875 | 3300025961 | Bacteria | 1140 |
| 489 | Ga0207712_10946203 | 3300025961 | Bacteria | 763 |
| 490 | Ga0207640_10136646 | 3300025981 | Bacteria | 1781 |
| 491 | Ga0207658_10011588 | 3300025986 | Bacteria | 6001 |
| 492 | Ga0207658_10123535 | 3300025986 | Bacteria | 2068 |
| 493 | Ga0207658_10264046 | 3300025986 | Bacteria | 1468 |
| 494 | Ga0207658_10366423 | 3300025986 | Bacteria | 1258 |
| 495 | Ga0207658_10426781 | 3300025986 | Bacteria | 1170 |
| 496 | Ga0207677_10014815 | 3300026023 | Bacteria | 4566 |
| 497 | Ga0207677_11492553 | 3300026023 | Bacteria | 624 |
| 498 | Ga0207703_10001111 | 3300026035 | Bacteria | 25457 |
| 499 | Ga0207703_10001808 | 3300026035 | Bacteria | 19065 |
| 500 | Ga0207703_10207128 | 3300026035 | Bacteria | 1746 |
| 501 | Ga0207703_10287826 | 3300026035 | Bacteria | 1494 |
| 502 | Ga0207639_10593569 | 3300026041 | Bacteria | 1021 |
| 503 | Ga0207678_10026496 | 3300026067 | Bacteria | 5056 |
| 504 | Ga0207678_10251350 | 3300026067 | Bacteria | 1514 |
| 505 | Ga0207678_10255422 | 3300026067 | Bacteria | 1501 |
| 506 | Ga0207678_10807394 | 3300026067 | Bacteria | 828 |
| 507 | Ga0207678_10852052 | 3300026067 | Bacteria | 805 |
| 508 | Ga0207708_10048236 | 3300026075 | Bacteria | 3242 |
| 509 | Ga0207708_10244926 | 3300026075 | Bacteria | 1443 |
| 510 | Ga0207708_10391058 | 3300026075 | Bacteria | 1148 |
| 511 | Ga0207708_10645967 | 3300026075 | Bacteria | 900 |
| 512 | Ga0207702_10030266 | 3300026078 | Bacteria | 4511 |
| 513 | Ga0207702_10096816 | 3300026078 | Bacteria | 2596 |
| 514 | Ga0207702_10761052 | 3300026078 | Bacteria | 956 |
| 515 | Ga0207702_11657067 | 3300026078 | Bacteria | 633 |
| 516 | Ga0207641_10000083 | 3300026088 | Bacteria | 134703 |
| 517 | Ga0207641_10025326 | 3300026088 | Bacteria | 4892 |
| 518 | Ga0207641_10032612 | 3300026088 | Bacteria | 4325 |
| 519 | Ga0207641_10077516 | 3300026088 | Bacteria | 2876 |
| 520 | Ga0207641_10231767 | 3300026088 | Bacteria | 1716 |
| 521 | Ga0207641_10250977 | 3300026088 | Bacteria | 1652 |
| 522 | Ga0207641_10470313 | 3300026088 | Bacteria | 1217 |
| 523 | Ga0207641_11059118 | 3300026088 | Bacteria | 809 |
| 524 | Ga0207648_10028725 | 3300026089 | Bacteria | 4930 |
| 525 | Ga0207648_10039876 | 3300026089 | Bacteria | 4128 |
| 526 | Ga0207648_10107917 | 3300026089 | Bacteria | 2443 |
| 527 | Ga0207648_10178899 | 3300026089 | Bacteria | 1877 |
| 528 | Ga0207648_11648079 | 3300026089 | Bacteria | 603 |
| 529 | Ga0207676_10017296 | 3300026095 | Bacteria | 5227 |
| 530 | Ga0207676_10410941 | 3300026095 | Bacteria | 1267 |
| 531 | Ga0207676_10504006 | 3300026095 | Bacteria | 1150 |
| 532 | Ga0207676_11189795 | 3300026095 | Bacteria | 755 |
| 533 | Ga0207674_10156923 | 3300026116 | Bacteria | 2231 |
| 534 | Ga0207674_10678888 | 3300026116 | Bacteria | 994 |
| 535 | Ga0207675_100016698 | 3300026118 | Bacteria | 6855 |
| 536 | Ga0207675_100410569 | 3300026118 | Bacteria | 1336 |
| 537 | Ga0207683_10236500 | 3300026121 | Bacteria | 1666 |
| 538 | Ga0207683_10480604 | 3300026121 | Bacteria | 1146 |
| 539 | Ga0207698_10100442 | 3300026142 | Bacteria | 2396 |
| 540 | Ga0207698_10332850 | 3300026142 | Bacteria | 1427 |
| 541 | Ga0207698_10946753 | 3300026142 | Bacteria | 870 |
| 542 | Ga0209974_10049342 | 3300027876 | Bacteria | 1412 |
| 543 | Ga0268266_10001464 | 3300028379 | Bacteria | 28083 |
| 544 | Ga0268266_10002690 | 3300028379 | Bacteria | 18652 |
| 545 | Ga0268266_10009272 | 3300028379 | Bacteria | 8682 |
| 546 | Ga0268266_10022172 | 3300028379 | Bacteria | 5412 |
| 547 | Ga0268266_10052164 | 3300028379 | Bacteria | 3512 |
| 548 | Ga0268266_10062455 | 3300028379 | Bacteria | 3215 |
| 549 | Ga0268266_10123429 | 3300028379 | Bacteria | 2307 |
| 550 | Ga0268265_10004217 | 3300028380 | Bacteria | 10043 |
| 551 | Ga0268265_10013010 | 3300028380 | Bacteria | 5650 |
| 552 | Ga0268265_10045559 | 3300028380 | Bacteria | 3273 |
| 553 | Ga0268265_10074313 | 3300028380 | Bacteria | 2658 |
| 554 | Ga0268265_11768260 | 3300028380 | Bacteria | 624 |
| 555 | Ga0268264_10000179 | 3300028381 | Bacteria | 134401 |
| 556 | Ga0268264_10011064 | 3300028381 | Bacteria | 7452 |
| 557 | Ga0268264_10012783 | 3300028381 | Bacteria | 6909 |
| 558 | Ga0268264_10032760 | 3300028381 | Bacteria | 4264 |
| 559 | Ga0268264_10111722 | 3300028381 | Bacteria | 2394 |
| 560 | Ga0268264_10116657 | 3300028381 | Bacteria | 2347 |
| 561 | Ga0268264_10346545 | 3300028381 | Bacteria | 1412 |
| 562 | Ga0268264_10349707 | 3300028381 | Bacteria | 1406 |
| 563 | Ga0268264_10445284 | 3300028381 | Bacteria | 1254 |
| 564 | Ga0265319_1010575 | 3300028563 | Bacteria | 3842 |
| 565 | Ga0265334_10000242 | 3300028573 | Bacteria | 31502 |
| 566 | Ga0265334_10012101 | 3300028573 | Bacteria | 3627 |
| 567 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 568 | Ga0307515_10002191 | 3300028794 | Bacteria | 42879 |
| 569 | Ga0307515_10072294 | 3300028794 | Bacteria | 4658 |
| 570 | Ga0307515_10122972 | 3300028794 | Bacteria | 2922 |
| 571 | Ga0265338_10009779 | 3300028800 | Bacteria | 11378 |
| 572 | Ga0265338_10014084 | 3300028800 | Bacteria | 8951 |
| 573 | Ga0265324_10000908 | 3300029957 | Bacteria | 18733 |
| 574 | Ga0307511_10001031 | 3300030521 | Bacteria | 29591 |
| 575 | Ga0307511_10345474 | 3300030521 | Bacteria | 643 |
| 576 | Ga0265766_1002598 | 3300030863 | Bacteria | 1010 |
| 577 | Ga0265779_113045 | 3300031043 | Bacteria | 530 |
| 578 | Ga0265330_10007609 | 3300031235 | Bacteria | 5267 |
| 579 | Ga0265332_10013565 | 3300031238 | Bacteria | 3610 |
| 580 | Ga0265328_10009932 | 3300031239 | Bacteria | 3850 |
| 581 | Ga0265320_10003463 | 3300031240 | Bacteria | 10582 |
| 582 | Ga0265325_10003241 | 3300031241 | Bacteria | 10706 |
| 583 | Ga0265329_10000807 | 3300031242 | Bacteria | 15917 |
| 584 | Ga0265340_10059069 | 3300031247 | Bacteria | 1840 |
| 585 | Ga0265340_10143422 | 3300031247 | Bacteria | 1092 |
| 586 | Ga0265340_10166944 | 3300031247 | Bacteria | 998 |
| 587 | Ga0265339_10153772 | 3300031249 | Bacteria | 1161 |
| 588 | Ga0265331_10002138 | 3300031250 | Bacteria | 13584 |
| 589 | Ga0265331_10042357 | 3300031250 | Bacteria | 2208 |
| 590 | Ga0265316_10004634 | 3300031344 | Bacteria | 13630 |
| 591 | Ga0307513_10166143 | 3300031456 | Bacteria | 2091 |
| 592 | Ga0307513_10263412 | 3300031456 | Bacteria | 1512 |
| 593 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 594 | Ga0307408_100131702 | 3300031548 | Bacteria | 1952 |
| 595 | Ga0265313_10008827 | 3300031595 | Bacteria | 6639 |
| 596 | Ga0307508_10156586 | 3300031616 | Bacteria | 1882 |
| 597 | Ga0307508_10529487 | 3300031616 | Bacteria | 775 |
| 598 | Ga0307508_10534067 | 3300031616 | Bacteria | 770 |
| 599 | Ga0307514_10000854 | 3300031649 | Bacteria | 48916 |
| 600 | Ga0265314_10002873 | 3300031711 | Bacteria | 17111 |
| 601 | Ga0265342_10009386 | 3300031712 | Bacteria | 6903 |
| 602 | Ga0316576_10004217 | 3300031727 | Bacteria | 8584 |
| 603 | Ga0316578_10185360 | 3300031728 | Bacteria | 1254 |
| 604 | Ga0307516_10000432 | 3300031730 | Bacteria | 55006 |
| 605 | Ga0307516_10006666 | 3300031730 | Bacteria | 13499 |
| 606 | Ga0307516_10106242 | 3300031730 | Bacteria | 2618 |
| 607 | Ga0307405_10077160 | 3300031731 | Bacteria | 2164 |
| 608 | Ga0307413_10007993 | 3300031824 | Bacteria | 4958 |
| 609 | Ga0307410_10009459 | 3300031852 | Bacteria | 5464 |
| 610 | Ga0307406_10142861 | 3300031901 | Bacteria | 1697 |
| 611 | Ga0307406_11517084 | 3300031901 | Unclassified | 590 |
| 612 | Ga0307412_10193587 | 3300031911 | Bacteria | 1539 |
| 613 | Ga0307409_100000260 | 3300031995 | Bacteria | 21387 |
| 614 | Ga0307416_103097790 | 3300032002 | Bacteria | 556 |
| 615 | Ga0307411_10003073 | 3300032005 | Bacteria | 7629 |
| 616 | Ga0307415_100093549 | 3300032126 | Bacteria | 2183 |
| 617 | Ga0307507_10415666 | 3300033179 | Bacteria | 758 |
| 618 | Ga0307510_10000013 | 3300033180 | Bacteria | 274569 |
| 619 | Ga0307510_10014579 | 3300033180 | Bacteria | 9303 |
| 620 | Ga0373926_0319639 | 3300035083 | Bacteria | 607 |
| 621 | Ga0373923_0033379 | 3300035111 | Bacteria | 2084 |
| 622 | Ga0373932_0099214 | 3300035112 | Bacteria | 945 |
| 623 | Ga0373936_0016925 | 3300035113 | Bacteria | 2803 |
| 624 | Ga0373936_0022834 | 3300035113 | Bacteria | 2436 |
| 625 | Ga0373945_0507169 | 3300035116 | Bacteria | 538 |
| 626 | Ga0373953_0131906 | 3300035117 | Bacteria | 1066 |
| 627 | Ga0373954_0076448 | 3300035118 | Bacteria | 1596 |
| 628 | Ga0373956_0488854 | 3300035119 | Bacteria | 587 |
| 629 | Ga0373957_0113276 | 3300035120 | Bacteria | 1094 |
| 630 | Ga0373957_0392802 | 3300035120 | Bacteria | 596 |
| 631 | Ga0373957_0434159 | 3300035120 | Bacteria | 567 |
| 632 | Ga0373943_0113979 | 3300035170 | Bacteria | 1429 |
| 633 | Ga0316574_0010096 | 3300035398 | Bacteria | 5317 |
| 634 | Ga0373924_0318170 | 3300035410 | Bacteria | 692 |
| 635 | Ga0373931_0108038 | 3300035691 | Bacteria | 1574 |
| 636 | Ga0373935_0162570 | 3300035692 | Bacteria | 1523 |
| 637 | Ga0373935_1368904 | 3300035692 | Bacteria | 529 |
| 638 | Ga0373927_0035795 | 3300035695 | Bacteria | 3229 |
| 639 | Ga0373933_0085840 | 3300035724 | Bacteria | 1936 |
| 640 | Ga0373933_0351696 | 3300035724 | Bacteria | 957 |
| 641 | Ga0373947_0160362 | 3300035725 | Bacteria | 1454 |
| 642 | Ga0373947_0396828 | 3300035725 | Bacteria | 930 |
| 643 | Ga0373937_0028436 | 3300036401 | Bacteria | 5059 |
| 644 | Ga0373937_0085763 | 3300036401 | Bacteria | 2914 |
| 645 | Ga0373937_0346194 | 3300036401 | Bacteria | 1407 |
| 646 | Ga0316584_0052700 | 3300036712 | Bacteria | 3043 |
| 647 | Ga0373925_0006858 | 3300037068 | Bacteria | 8339 |
| 648 | Ga0373925_0703550 | 3300037068 | Bacteria | 833 |
| 649 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 650 | Ga0395898_0001112 | 3300037466 | Bacteria | 41418 |
| 651 | Ga0395905_0031321 | 3300037471 | Bacteria | 5007 |
| 652 | Ga0395905_0036617 | 3300037471 | Bacteria | 4608 |
| 653 | Ga0395905_0401396 | 3300037471 | Bacteria | 1266 |
| 654 | Ga0395905_0476590 | 3300037471 | Bacteria | 1147 |
| 655 | Ga0395905_0678399 | 3300037471 | Bacteria | 933 |
| 656 | Ga0395905_0865324 | 3300037471 | Bacteria | 807 |
| 657 | Ga0436364_0288620 | 3300037853 | Bacteria | 891 |
| 658 | Ga0436365_0935043 | 3300039437 | Bacteria | 1199 |
| 659 | Ga0436365_1116878 | 3300039437 | Bacteria | 10568 |
| 660 | Ga0436365_1123795 | 3300039437 | Bacteria | 3453 |
| 661 | Ga0436365_1273617 | 3300039437 | Bacteria | 1607 |
| 662 | Ga0436365_1369117 | 3300039437 | Bacteria | 561 |
| 663 | Ga0436365_1915437 | 3300039437 | Bacteria | 713 |
| 664 | Ga0436360_0109344 | 3300039438 | Bacteria | 853 |
| 665 | Ga0436360_0577739 | 3300039438 | Bacteria | 519 |
| 666 | Ga0436360_0770911 | 3300039438 | Bacteria | 659 |
| 667 | Ga0436360_0789934 | 3300039438 | Bacteria | 1591 |
| 668 | Ga0436360_1376956 | 3300039438 | Bacteria | 8587 |
| 669 | Ga0436361_0559178 | 3300039447 | Bacteria | 1320 |
| 670 | Ga0436361_0597012 | 3300039447 | Bacteria | 2510 |
| 671 | Ga0436361_0814403 | 3300039447 | Bacteria | 2875 |
| 672 | Ga0436361_0866882 | 3300039447 | Bacteria | 7359 |
| 673 | Ga0436363_0322376 | 3300039450 | Bacteria | 2942 |
| 674 | Ga0436363_0569581 | 3300039450 | Bacteria | 2211 |
| 675 | Ga0436363_0578683 | 3300039450 | Bacteria | 556 |
| 676 | Ga0436363_1295560 | 3300039450 | Bacteria | 2987 |
| 677 | Ga0436362_0136394 | 3300039453 | Bacteria | 591 |
| 678 | Ga0436362_0350607 | 3300039453 | Bacteria | 2153 |
| 679 | Ga0439436_0052150 | 3300041404 | Bacteria | 1154 |
| 680 | Ga0439439_0070597 | 3300041406 | Bacteria | 935 |
| 681 | Ga0439453_0049055 | 3300041408 | Bacteria | 849 |
| 682 | Ga0451798_0124787 | 3300041458 | Bacteria | 654 |
| 683 | Ga0451798_1134510 | 3300041458 | Bacteria | 635 |
| 684 | Ga0451800_0213464 | 3300041459 | Bacteria | 645 |
| 685 | Ga0451805_062905 | 3300041461 | Bacteria | 506 |
| 686 | Ga0439431_0011676 | 3300041997 | Bacteria | 2009 |
| 687 | Ga0439433_0033793 | 3300041999 | Bacteria | 1176 |
| 688 | Ga0439448_0041103 | 3300042005 | Bacteria | 1495 |
| 689 | Ga0439448_0135914 | 3300042005 | Bacteria | 849 |
| 690 | Ga0439449_0030723 | 3300042007 | Bacteria | 2002 |
| 691 | Ga0439449_0042891 | 3300042007 | Bacteria | 1680 |
| 692 | Ga0439457_034565 | 3300042014 | Bacteria | 1123 |
| 693 | Ga0439462_0013130 | 3300042015 | Bacteria | 2122 |
| 694 | Ga0450899_002960 | 3300042135 | Bacteria | 1831 |
| 695 | Ga0439446_0059901 | 3300042156 | Bacteria | 1149 |
| 696 | Ga0439464_0029358 | 3300042439 | Bacteria | 1536 |
| 697 | Ga0450893_0033394 | 3300042532 | Bacteria | 924 |
| 698 | Ga0450893_0056336 | 3300042532 | Bacteria | 744 |
| 699 | Ga0451577_0001132 | 3300042876 | Bacteria | 37818 |
| 700 | Ga0466969_0000075 | 3300044656 | Bacteria | 52007 |
| 701 | Ga0466969_0003117 | 3300044656 | Bacteria | 8835 |
| 702 | Ga0466969_0010879 | 3300044656 | Bacteria | 4820 |
| 703 | Ga0466969_0013190 | 3300044656 | Bacteria | 4353 |
| 704 | Ga0466969_0013216 | 3300044656 | Bacteria | 4348 |
| 705 | Ga0466969_0015530 | 3300044656 | Bacteria | 3991 |
| 706 | Ga0466969_0069294 | 3300044656 | Bacteria | 1699 |
| 707 | Ga0466972_0004215 | 3300044658 | Bacteria | 7184 |
| 708 | Ga0466972_0008052 | 3300044658 | Bacteria | 5283 |
| 709 | Ga0466972_0016103 | 3300044658 | Bacteria | 3738 |
| 710 | Ga0466972_0023590 | 3300044658 | Bacteria | 3058 |
| 711 | Ga0466965_0020677 | 3300044683 | Bacteria | 3166 |
| 712 | Ga0466965_0028559 | 3300044683 | Bacteria | 2710 |
| 713 | Ga0466965_0075348 | 3300044683 | Bacteria | 1701 |
| 714 | Ga0466965_0114003 | 3300044683 | Bacteria | 1391 |
| 715 | Ga0466965_0449530 | 3300044683 | Bacteria | 717 |
| 716 | Ga0466966_0004792 | 3300044684 | Bacteria | 8895 |
| 717 | Ga0466966_0011299 | 3300044684 | Bacteria | 5923 |
| 718 | Ga0466966_0023991 | 3300044684 | Bacteria | 3992 |
| 719 | Ga0466966_0047046 | 3300044684 | Bacteria | 2752 |
| 720 | Ga0466966_0057852 | 3300044684 | Bacteria | 2451 |
| 721 | Ga0466966_0440297 | 3300044684 | Bacteria | 783 |
| 722 | Ga0466961_0002234 | 3300044693 | Bacteria | 12061 |
| 723 | Ga0466961_0010322 | 3300044693 | Bacteria | 5953 |
| 724 | Ga0466961_0010421 | 3300044693 | Bacteria | 5931 |
| 725 | Ga0466961_0011978 | 3300044693 | Bacteria | 5542 |
| 726 | Ga0466961_0079707 | 3300044693 | Bacteria | 2073 |
| 727 | Ga0466963_0035056 | 3300044694 | Bacteria | 3267 |
| 728 | Ga0466964_0001005 | 3300044706 | Bacteria | 9360 |
| 729 | Ga0466964_0002737 | 3300044706 | Bacteria | 6329 |
| 730 | Ga0466964_0024262 | 3300044706 | Bacteria | 2362 |
| 731 | Ga0466971_0001125 | 3300044719 | Bacteria | 11124 |
| 732 | Ga0466971_0003912 | 3300044719 | Bacteria | 6388 |
| 733 | Ga0466971_0077730 | 3300044719 | Bacteria | 1511 |
| 734 | Ga0466971_0105875 | 3300044719 | Bacteria | 1295 |
| 735 | Ga0466968_0011359 | 3300044735 | Bacteria | 3467 |
| 736 | Ga0466968_0261351 | 3300044735 | Bacteria | 824 |
| 737 | Ga0466970_0004235 | 3300044765 | Bacteria | 7058 |
| 738 | Ga0466970_0008413 | 3300044765 | Bacteria | 5191 |
| 739 | Ga0466970_0012923 | 3300044765 | Bacteria | 4276 |
| 740 | Ga0466970_0183317 | 3300044765 | Bacteria | 1162 |
| 741 | Ga0466970_0466484 | 3300044765 | Bacteria | 725 |
| 742 | Ga0466957_0016451 | 3300044842 | Bacteria | 4327 |
| 743 | Ga0466957_0023740 | 3300044842 | Bacteria | 3627 |
| 744 | Ga0466960_0046107 | 3300044901 | Bacteria | 2085 |
| 745 | Ga0466960_0623140 | 3300044901 | Bacteria | 642 |
| 746 | Ga0466959_0000818 | 3300045049 | Bacteria | 18349 |
| 747 | Ga0466959_0006637 | 3300045049 | Bacteria | 8038 |
| 748 | Ga0466959_0009577 | 3300045049 | Bacteria | 6891 |
| 749 | Ga0466959_0013546 | 3300045049 | Bacteria | 5911 |
| 750 | Ga0466959_0015487 | 3300045049 | Bacteria | 5556 |
| 751 | Ga0466959_0016434 | 3300045049 | Bacteria | 5407 |
| 752 | Ga0466959_0041660 | 3300045049 | Bacteria | 3390 |
| 753 | Ga0466959_0081007 | 3300045049 | Bacteria | 2339 |
| 754 | Ga0451576_0317058 | 3300045051 | Bacteria | 1631 |
| 755 | Ga0451576_0930878 | 3300045051 | Bacteria | 911 |
| 756 | Ga0466958_0016466 | 3300045836 | Bacteria | 4257 |
| 757 | Ga0466958_0225294 | 3300045836 | Bacteria | 1196 |
| 758 | Ga0466967_0054356 | 3300045976 | Bacteria | 3523 |
| 759 | Ga0466967_0208802 | 3300045976 | Bacteria | 1851 |
| 760 | Ga0495651_0368445 | 3300046462 | Bacteria | 945 |
| 761 | Ga0495650_0032218 | 3300046471 | Bacteria | 2347 |
| 762 | Ga0495580_0009981 | 3300046472 | Bacteria | 7425 |
| 763 | Ga0495580_0170414 | 3300046472 | Bacteria | 1505 |
| 764 | Ga0495585_0010185 | 3300046492 | Bacteria | 5613 |
| 765 | Ga0495618_0213235 | 3300046514 | Bacteria | 1220 |
| 766 | Ga0495628_0344157 | 3300046516 | Bacteria | 1097 |
| 767 | Ga0495630_0035720 | 3300046517 | Bacteria | 3714 |
| 768 | Ga0495630_1264767 | 3300046517 | Bacteria | 557 |
| 769 | Ga0495648_0154202 | 3300046524 | Bacteria | 1195 |
| 770 | Ga0495652_0327323 | 3300046529 | Bacteria | 1105 |
| 771 | Ga0495640_0783704 | 3300046533 | Bacteria | 569 |
| 772 | Ga0495586_0061129 | 3300046535 | Bacteria | 2050 |
| 773 | Ga0495609_0155499 | 3300046538 | Bacteria | 971 |
| 774 | Ga0495645_0300550 | 3300046543 | Bacteria | 1049 |
| 775 | Ga0495645_0541353 | 3300046543 | Bacteria | 723 |
| 776 | Ga0495622_0443269 | 3300046557 | Bacteria | 557 |
| 777 | Ga0495668_0222231 | 3300046616 | Bacteria | 1034 |
| 778 | Ga0495625_0057959 | 3300046660 | Bacteria | 2753 |
| 779 | Ga0495625_0613197 | 3300046660 | Bacteria | 652 |
| 780 | Ga0495657_0141200 | 3300046675 | Bacteria | 1501 |
| 781 | Ga0495623_0466901 | 3300046679 | Bacteria | 670 |
| 782 | Ga0495649_0051908 | 3300046694 | Bacteria | 2223 |
| 783 | Ga0495680_0820564 | 3300047322 | Bacteria | 606 |
| 784 | Ga0495686_0019152 | 3300047472 | Bacteria | 4577 |
| 785 | Ga0495686_0238478 | 3300047472 | Bacteria | 1026 |
| 786 | Ga0496100_0060202 | 3300048903 | Bacteria | 2498 |
| 787 | Ga0496100_1046364 | 3300048903 | Bacteria | 643 |
| 788 | Ga0496101_0098798 | 3300048904 | Bacteria | 2181 |
| 789 | Ga0496101_0545467 | 3300048904 | Bacteria | 917 |
| 790 | Ga0496101_0906946 | 3300048904 | Bacteria | 694 |
| 791 | Ga0496102_0173096 | 3300048905 | Bacteria | 2032 |
| 792 | Ga0496102_0234846 | 3300048905 | Bacteria | 1729 |
| 793 | Ga0496103_0019355 | 3300048906 | Bacteria | 4088 |
| 794 | Ga0496104_0035306 | 3300048907 | Bacteria | 4668 |
| 795 | Ga0496104_0323321 | 3300048907 | Bacteria | 1456 |
| 796 | Ga0496105_0021395 | 3300048908 | Bacteria | 5234 |
| 797 | Ga0496105_0396128 | 3300048908 | Bacteria | 1097 |
| 798 | Ga0496106_0074733 | 3300048909 | Bacteria | 2595 |
| 799 | Ga0496106_0725878 | 3300048909 | Bacteria | 791 |
| 800 | Ga0496107_0020106 | 3300048910 | Bacteria | 4715 |
| 801 | Ga0496107_0331757 | 3300048910 | Bacteria | 1132 |
| 802 | Ga0496108_0235435 | 3300048911 | Bacteria | 1593 |
| 803 | Ga0496109_0004674 | 3300048912 | Bacteria | 11426 |
| 804 | Ga0496109_0197828 | 3300048912 | Bacteria | 1890 |
| 805 | Ga0496109_0285789 | 3300048912 | Bacteria | 1555 |
| 806 | Ga0496110_0110070 | 3300048913 | Bacteria | 2474 |
| 807 | Ga0496111_0032699 | 3300048914 | Bacteria | 3709 |
| 808 | Ga0496112_0353221 | 3300048915 | Bacteria | 1412 |
| 809 | Ga0496113_0157001 | 3300048916 | Bacteria | 1797 |
| 810 | Ga0496113_0257914 | 3300048916 | Bacteria | 1393 |
| 811 | Ga0496114_0000976 | 3300048917 | Bacteria | 21433 |
| 812 | Ga0496114_0561427 | 3300048917 | Bacteria | 1008 |
| 813 | Ga0496115_0003458 | 3300048918 | Bacteria | 11345 |
| 814 | Ga0496115_0141118 | 3300048918 | Bacteria | 1988 |
| 815 | Ga0496115_0426451 | 3300048918 | Bacteria | 1074 |
| 816 | Ga0496115_1265421 | 3300048918 | Bacteria | 551 |
| 817 | Ga0496116_0025905 | 3300048919 | Bacteria | 4301 |
| 818 | Ga0496117_0000057 | 3300048920 | Bacteria | 268246 |
| 819 | Ga0496118_0000028 | 3300048921 | Bacteria | 366490 |
| 820 | Ga0496119_0021299 | 3300048922 | Bacteria | 4690 |
| 821 | Ga0496119_0024683 | 3300048922 | Bacteria | 4221 |
| 822 | Ga0496119_0405115 | 3300048922 | Bacteria | 650 |
| 823 | Ga0496120_0021404 | 3300048923 | Bacteria | 4088 |
| 824 | Ga0496120_0209716 | 3300048923 | Bacteria | 937 |
| 825 | Ga0496121_0001748 | 3300048924 | Bacteria | 35482 |
| 826 | Ga0496121_0034849 | 3300048924 | Bacteria | 4521 |
| 827 | Ga0496121_0350704 | 3300048924 | Bacteria | 983 |
| 828 | Ga0496124_0018704 | 3300048927 | Bacteria | 6480 |
| 829 | Ga0496125_0000926 | 3300048928 | Bacteria | 46052 |
| 830 | Ga0496125_0071773 | 3300048928 | Bacteria | 2702 |
| 831 | Ga0496125_0290401 | 3300048928 | Bacteria | 1007 |
| 832 | Ga0496126_0008006 | 3300048929 | Bacteria | 11471 |
| 833 | Ga0496126_0029585 | 3300048929 | Bacteria | 5202 |
| 834 | Ga0496126_0108705 | 3300048929 | Bacteria | 2418 |
| 835 | Ga0496126_0681286 | 3300048929 | Bacteria | 801 |
| 836 | Ga0496126_0817917 | 3300048929 | Bacteria | 713 |
| 837 | Ga0501306_011807 | 3300049127 | Bacteria | 1119 |
| 838 | Ga0501308_000351 | 3300049128 | Bacteria | 2895 |
| 839 | Ga0501308_015256 | 3300049128 | Bacteria | 909 |
| 840 | Ga0501310_021793 | 3300049130 | Bacteria | 804 |
| 841 | Ga0501304_006097 | 3300049160 | Bacteria | 964 |
| 842 | Ga0501303_008953 | 3300049526 | Bacteria | 917 |
| 843 | Ga0501311_065750 | 3300049527 | Bacteria | 593 |
| 844 | Ga0501312_006801 | 3300049528 | Bacteria | 1441 |
| 845 | Ga0501312_109898 | 3300049528 | Bacteria | 525 |
| 846 | Ga0501313_019615 | 3300049529 | Bacteria | 828 |
| 847 | Ga0501314_001973 | 3300049530 | Bacteria | 1547 |
| 848 | Ga0501315_004684 | 3300049531 | Bacteria | 1444 |
| 849 | Ga0501315_025153 | 3300049531 | Bacteria | 827 |
| 850 | Ga0501317_002108 | 3300049533 | Bacteria | 1829 |
| 851 | Ga0501317_077225 | 3300049533 | Bacteria | 571 |
| 852 | Ga0501320_016223 | 3300049536 | Bacteria | 822 |
| 853 | Ga0501321_000564 | 3300049537 | Bacteria | 2459 |
| 854 | Ga0501323_049590 | 3300049539 | Bacteria | 634 |
| 855 | Ga0501325_002818 | 3300049541 | Bacteria | 1221 |
| 856 | Ga0501328_05474 | 3300049544 | Bacteria | 640 |
| 857 | Ga0501329_08434 | 3300049545 | Bacteria | 618 |
| 858 | Ga0501340_001985 | 3300049556 | Bacteria | 1153 |
| 859 | Ga0501340_013318 | 3300049556 | Bacteria | 632 |
| 860 | Ga0501036_0624912 | 3300049572 | Bacteria | 893 |
| 861 | Ga0501048_0238036 | 3300049582 | Bacteria | 1292 |
| 862 | Ga0501073_0604542 | 3300049589 | Bacteria | 757 |
| 863 | Ga0501199_006575 | 3300049650 | Bacteria | 1186 |
| 864 | Ga0501206_089418 | 3300049653 | Bacteria | 545 |
| 865 | Ga0501249_195455 | 3300049679 | Bacteria | 529 |
| 866 | Ga0501256_033520 | 3300049685 | Bacteria | 587 |
| 867 | Ga0501257_041467 | 3300049686 | Bacteria | 1131 |
| 868 | Ga0501079_0241535 | 3300049741 | Bacteria | 1411 |
| 869 | Ga0501079_1238847 | 3300049741 | Bacteria | 588 |
| 870 | nmdc:mga0k408_11566_c1 | 3300050493 | Bacteria | 4809 |
| 871 | nmdc:mga0k408_169358_c1 | 3300050493 | Bacteria | 1302 |
| 872 | nmdc:mga0k408_578236_c1 | 3300050493 | Bacteria | 663 |
| 873 | nmdc:mga0k408_69937_c1 | 3300050493 | Bacteria | 2049 |
| 874 | nmdc:mga0k408_89144_c1 | 3300050493 | Bacteria | 1811 |
| 875 | nmdc:mga07m45_1066_c1 | 3300050496 | Bacteria | 12209 |
| 876 | nmdc:mga07m45_41324_c1 | 3300050496 | Bacteria | 2582 |
| 877 | nmdc:mga05p37_105087_c1 | 3300050507 | Bacteria | 3474 |
| 878 | nmdc:mga05p37_1564738_c1 | 3300050507 | Bacteria | 652 |
| 879 | nmdc:mga0qj67_359680_c1 | 3300050509 | Bacteria | 1176 |
| 880 | nmdc:mga08y16_760236_c1 | 3300050511 | Bacteria | 965 |
| 881 | nmdc:mga0rr50_1214440_c1 | 3300050513 | Bacteria | 640 |
| 882 | nmdc:mga0a205_832390_c1 | 3300050515 | Bacteria | 770 |
| 883 | Ga0495612_0316719 | 3300053078 | Bacteria | 701 |
| 884 | Ga0500635_0000072 | 3300053080 | Bacteria | 66335 |
| 885 | Ga0500643_003570 | 3300053087 | Bacteria | 7399 |
| 886 | Ga0500644_0099591 | 3300053088 | Bacteria | 1102 |
| 887 | Ga0500646_0018273 | 3300053090 | Bacteria | 1845 |
| 888 | Ga0500583_0289367 | 3300053092 | Bacteria | 803 |
| 889 | Ga0500583_0319868 | 3300053092 | Bacteria | 756 |
| 890 | Ga0500651_0111819 | 3300053093 | Bacteria | 1666 |
| 891 | Ga0500641_0067946 | 3300053096 | Bacteria | 1495 |
| 892 | Ga0500650_0209796 | 3300053098 | Bacteria | 885 |
| 893 | Ga0500562_010211 | 3300053108 | Bacteria | 2379 |
| 894 | Ga0500572_016125 | 3300053111 | Bacteria | 1897 |
| 895 | Ga0500594_0009895 | 3300053118 | Bacteria | 2203 |
| 896 | Ga0500595_044003 | 3300053119 | Bacteria | 1418 |
| 897 | Ga0500608_206992 | 3300053122 | Bacteria | 805 |
| 898 | Ga0500652_025758 | 3300053131 | Bacteria | 2258 |
| 899 | Ga0500559_0459809 | 3300053136 | Bacteria | 588 |
| 900 | Ga0500564_169108 | 3300053138 | Bacteria | 920 |
| 901 | Ga0500568_0065017 | 3300053139 | Bacteria | 1405 |
| 902 | Ga0500577_0469173 | 3300053142 | Bacteria | 550 |
| 903 | Ga0500590_265471 | 3300053148 | Bacteria | 671 |
| 904 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 905 | Ga0500616_0045257 | 3300053153 | Bacteria | 2345 |
| 906 | Ga0500622_0006035 | 3300053156 | Bacteria | 7119 |
| 907 | Ga0500639_124948 | 3300053163 | Bacteria | 1229 |
| 908 | Ga0500639_341773 | 3300053163 | Bacteria | 535 |
| 909 | Ga0500636_0008914 | 3300053177 | Bacteria | 5823 |
| 910 | Ga0500637_0020797 | 3300053178 | Bacteria | 3559 |
| 911 | Ga0500637_0290957 | 3300053178 | Bacteria | 895 |
| 912 | Ga0500611_012209 | 3300053727 | Bacteria | 1443 |
| 913 | Ga0500596_004056 | 3300053735 | Bacteria | 2721 |
| 914 | Ga0500661_024804 | 3300055283 | Bacteria | 1060 |
| 915 | Ga0587084_000433 | 3300059477 | Bacteria | 3252 |
| 916 | Ga0587084_019002 | 3300059477 | Bacteria | 1008 |
| 917 | Ga0587093_001766 | 3300059478 | Bacteria | 1897 |
| 918 | Ga0587093_029952 | 3300059478 | Bacteria | 778 |
| 919 | Ga0587093_033969 | 3300059478 | Bacteria | 747 |
| 920 | Ga0587066_002318 | 3300059490 | Bacteria | 2082 |
| 921 | Ga0587066_003065 | 3300059490 | Bacteria | 1923 |
| 922 | Ga0587066_007195 | 3300059490 | Bacteria | 1499 |
| 923 | Ga0587066_019086 | 3300059490 | Bacteria | 1111 |
| 924 | Ga0587070_000937 | 3300059491 | Bacteria | 2774 |
| 925 | Ga0587070_066369 | 3300059491 | Bacteria | 759 |
| 926 | Ga0587070_155650 | 3300059491 | Unclassified | 577 |
| 927 | Ga0587073_0045814 | 3300059492 | Bacteria | 972 |
| 928 | Ga0587077_001010 | 3300059493 | Bacteria | 2822 |
| 929 | Ga0587077_003170 | 3300059493 | Bacteria | 2041 |
| 930 | Ga0587077_031732 | 3300059493 | Bacteria | 1010 |
| 931 | Ga0587080_004102 | 3300059503 | Bacteria | 1865 |
| 932 | Ga0587080_031744 | 3300059503 | Bacteria | 924 |
| 933 | Ga0587080_076724 | 3300059503 | Bacteria | 678 |
| 934 | Ga0587082_005534 | 3300059504 | Bacteria | 1647 |
| 935 | Ga0587082_010690 | 3300059504 | Bacteria | 1330 |
| 936 | Ga0587083_0005260 | 3300059505 | Bacteria | 1860 |
| 937 | Ga0587083_0025337 | 3300059505 | Bacteria | 1136 |
| 938 | Ga0587083_0031913 | 3300059505 | Bacteria | 1053 |
| 939 | Ga0587083_0061548 | 3300059505 | Bacteria | 847 |
| 940 | Ga0587083_0113233 | 3300059505 | Bacteria | 692 |
| 941 | Ga0587085_000405 | 3300059506 | Bacteria | 3120 |
| 942 | Ga0587085_003839 | 3300059506 | Bacteria | 1667 |
| 943 | Ga0587085_007270 | 3300059506 | Bacteria | 1376 |
| 944 | Ga0587086_000406 | 3300059507 | Bacteria | 3028 |
| 945 | Ga0587086_007979 | 3300059507 | Bacteria | 1226 |
| 946 | Ga0587088_001524 | 3300059508 | Bacteria | 2427 |
| 947 | Ga0587089_032450 | 3300059509 | Bacteria | 776 |
| 948 | Ga0587090_000400 | 3300059510 | Bacteria | 3515 |
| 949 | Ga0587090_000452 | 3300059510 | Bacteria | 3414 |
| 950 | Ga0587090_002039 | 3300059510 | Bacteria | 2162 |
| 951 | Ga0587091_000944 | 3300059511 | Bacteria | 2902 |
| 952 | Ga0587091_032435 | 3300059511 | Bacteria | 988 |
| 953 | Ga0587091_163997 | 3300059511 | Bacteria | 573 |
| 954 | Ga0587092_002029 | 3300059512 | Bacteria | 2105 |
| 955 | Ga0587092_048439 | 3300059512 | Bacteria | 762 |
| 956 | Ga0587094_000448 | 3300059513 | Bacteria | 3172 |
| 957 | Ga0587094_002938 | 3300059513 | Bacteria | 1806 |
| 958 | Ga0587098_009470 | 3300059604 | Bacteria | 1059 |
| 959 | Ga0587106_056876 | 3300059605 | Bacteria | 708 |
| 960 | Ga0587125_000549 | 3300059607 | Bacteria | 2272 |
| 961 | Ga0587125_006665 | 3300059607 | Bacteria | 1100 |
| 962 | Ga0587131_015709 | 3300059609 | Bacteria | 587 |
| 963 | Ga0587101_001373 | 3300059623 | Bacteria | 2082 |
| 964 | Ga0587101_026345 | 3300059623 | Bacteria | 877 |
| 965 | Ga0587109_005113 | 3300059624 | Bacteria | 1863 |
| 966 | Ga0587109_007367 | 3300059624 | Bacteria | 1659 |
| 967 | Ga0587109_033893 | 3300059624 | Bacteria | 983 |
| 968 | Ga0587109_076138 | 3300059624 | Bacteria | 734 |
| 969 | Ga0587115_000323 | 3300059626 | Bacteria | 3313 |
| 970 | Ga0587115_068987 | 3300059626 | Bacteria | 607 |
| 971 | Ga0587117_000345 | 3300059627 | Bacteria | 3024 |
| 972 | Ga0587128_008475 | 3300059630 | Bacteria | 1330 |
| 973 | Ga0587128_009243 | 3300059630 | Bacteria | 1295 |
| 974 | Ga0587128_029906 | 3300059630 | Bacteria | 896 |
| 975 | Ga0587128_100489 | 3300059630 | Bacteria | 606 |
| 976 | Ga0587130_010086 | 3300059631 | Bacteria | 917 |
| 977 | Ga0587062_000473 | 3300059639 | Bacteria | 2847 |
| 978 | Ga0587062_023336 | 3300059639 | Bacteria | 896 |
| 979 | Ga0587062_070581 | 3300059639 | Bacteria | 631 |
| 980 | Ga0587067_014060 | 3300059640 | Bacteria | 1277 |
| 981 | Ga0587067_056323 | 3300059640 | Bacteria | 811 |
| 982 | Ga0587067_238461 | 3300059640 | Bacteria | 500 |
| 983 | Ga0587068_002378 | 3300059641 | Bacteria | 2280 |
| 984 | Ga0587068_013300 | 3300059641 | Bacteria | 1268 |
| 985 | Ga0587068_015816 | 3300059641 | Bacteria | 1191 |
| 986 | Ga0587069_001653 | 3300059642 | Bacteria | 2104 |
| 987 | Ga0587069_025651 | 3300059642 | Bacteria | 918 |
| 988 | Ga0587069_088819 | 3300059642 | Bacteria | 615 |
| 989 | Ga0587072_005137 | 3300059643 | Bacteria | 1941 |
| 990 | Ga0587072_010373 | 3300059643 | Bacteria | 1504 |
| 991 | Ga0587072_172436 | 3300059643 | Bacteria | 535 |
| 992 | Ga0587075_011981 | 3300059644 | Bacteria | 1171 |
| 993 | Ga0587075_034614 | 3300059644 | Bacteria | 820 |
| 994 | Ga0587076_003254 | 3300059645 | Bacteria | 1916 |
| 995 | Ga0587076_005768 | 3300059645 | Bacteria | 1618 |
| 996 | Ga0587076_027891 | 3300059645 | Bacteria | 981 |
| 997 | Ga0587076_038149 | 3300059645 | Bacteria | 886 |
| 998 | Ga0587079_007398 | 3300059647 | Bacteria | 1642 |
| 999 | Ga0587079_065767 | 3300059647 | Bacteria | 797 |
| 1000 | Ga0587079_088196 | 3300059647 | Bacteria | 721 |
| 1001 | Ga0587079_099905 | 3300059647 | Bacteria | 691 |
| 1002 | Ga0587100_001147 | 3300059648 | Bacteria | 1479 |
| 1003 | Ga0587100_010643 | 3300059648 | Bacteria | 779 |
| 1004 | Ga0587102_022671 | 3300059649 | Bacteria | 720 |
| 1005 | Ga0587102_027836 | 3300059649 | Bacteria | 676 |
| 1006 | Ga0587105_012726 | 3300059651 | Bacteria | 663 |
| 1007 | Ga0587107_023462 | 3300059652 | Bacteria | 881 |
| 1008 | Ga0587107_039413 | 3300059652 | Bacteria | 757 |
| 1009 | Ga0587108_013740 | 3300059653 | Bacteria | 714 |
| 1010 | Ga0587110_002704 | 3300059654 | Bacteria | 1427 |
| 1011 | Ga0587114_010376 | 3300059655 | Bacteria | 1138 |
| 1012 | Ga0587118_12569 | 3300059657 | Bacteria | 660 |
| 1013 | Ga0587119_015585 | 3300059658 | Bacteria | 922 |
| 1014 | Ga0587124_002348 | 3300059660 | Bacteria | 1324 |
| 1015 | Ga0587124_051784 | 3300059660 | Bacteria | 502 |
| 1016 | Ga0587071_009437 | 3300060344 | Bacteria | 1604 |
| 1017 | Ga0587071_032189 | 3300060344 | Bacteria | 1015 |
| 1018 | Ga0587071_049276 | 3300060344 | Bacteria | 867 |
| 1019 | Ga0587071_061538 | 3300060344 | Bacteria | 799 |
| 1020 | Ga0587111_0000905 | 3300060346 | Bacteria | 3234 |
| 1021 | Ga0587111_0008978 | 3300060346 | Bacteria | 1673 |
| 1022 | Ga0501082_1108676 | 3300060353 | Bacteria | 692 |
| 1023 | Ga0501082_1290637 | 3300060353 | Bacteria | 638 |
| 1024 | Ga0466962_0008322 | 3300061719 | Bacteria | 4968 |
| 1025 | Ga0466962_0011878 | 3300061719 | Bacteria | 4192 |
| 1026 | Ga0466962_0031968 | 3300061719 | Bacteria | 2519 |
| 1027 | Ga0466962_0532071 | 3300061719 | Bacteria | 596 |
| 1028 | Ga0070713_100203105 | |||
| 1029 | JGI24744J21845_10032899 | |||
| 1030 | JGI25156J39149_1025481 | |||
| 1031 | Ga0007410J51695_1047609 | |||
| 1032 | Ga0032354_1074764 | |||
| 1033 | Ga0055533_1000087 | |||
| 1034 | Ga0055525_1000799 | |||
| 1035 | Ga0055535_1000718 | |||
| 1036 | Ga0055529_1000885 | |||
| 1037 | Ga0058859_11575955 | |||
| 1038 | Ga0058859_11636537 | |||
| 1039 | Ga0058863_10034658 | |||
| 1040 | Ga0058863_11886887 | |||
| 1041 | Ga0058863_11955264 | |||
| 1042 | Ga0058861_10033013 | |||
| 1043 | Ga0058861_11829992 | |||
| 1044 | Ga0058860_10027454 | |||
| 1045 | Ga0058860_10098742 | |||
| 1046 | Ga0058860_10103368 | |||
| 1047 | Ga0058862_10047899 | |||
| 1048 | Ga0058862_10112105 | |||
| 1049 | Ga0058862_12771566 | |||
| 1050 | Ga0065707_10115128 | |||
| 1051 | Ga0070658_10092147 | |||
| 1052 | Ga0070676_10101937 | |||
| 1053 | Ga0070683_100027202 | |||
| 1054 | Ga0070683_100246845 | |||
| 1055 | Ga0070683_100480167 | |||
| 1056 | Ga0070690_100014196 | |||
| 1057 | Ga0070690_100017452 | |||
| 1058 | Ga0070690_100554674 | |||
| 1059 | Ga0070670_100763436 | |||
| 1060 | Ga0068869_100041507 | |||
| 1061 | Ga0068869_100322123 | |||
| 1062 | Ga0068869_100427924 | |||
| 1063 | Ga0068869_100650362 | |||
| 1064 | Ga0070666_10007154 | |||
| 1065 | Ga0070666_10167532 | |||
| 1066 | Ga0070666_11304180 | |||
| 1067 | Ga0070680_100067162 | |||
| 1068 | Ga0070682_100404250 | |||
| 1069 | Ga0070682_100481293 | |||
| 1070 | Ga0068868_100003950 | |||
| 1071 | Ga0068868_100505187 | |||
| 1072 | Ga0070660_100045223 | |||
| 1073 | Ga0070689_100019912 | |||
| 1074 | Ga0070689_100908061 | |||
| 1075 | Ga0070689_101130080 | |||
| 1076 | Ga0070691_10564235 | |||
| 1077 | Ga0070691_10780996 | |||
| 1078 | Ga0070661_100186482 | |||
| 1079 | Ga0070661_100821862 | |||
| 1080 | Ga0070661_101168400 | |||
| 1081 | Ga0070692_10159278 | |||
| 1082 | Ga0070668_100481474 | |||
| 1083 | Ga0070669_100017622 | |||
| 1084 | Ga0070669_101377913 | |||
| 1085 | Ga0070671_100000631 | |||
| 1086 | Ga0070671_100111115 | |||
| 1087 | Ga0070671_100838344 | |||
| 1088 | Ga0070674_100014580 | |||
| 1089 | Ga0070673_100039827 | |||
| 1090 | Ga0070673_100137012 | |||
| 1091 | Ga0070673_100301816 | |||
| 1092 | Ga0070673_100622344 | |||
| 1093 | Ga0070688_100108938 | |||
| 1094 | Ga0070688_101190119 | |||
| 1095 | Ga0070659_100098220 | |||
| 1096 | Ga0070659_100290954 | |||
| 1097 | Ga0070667_100004025 | |||
| 1098 | Ga0070667_100213813 | |||
| 1099 | Ga0070667_100657725 | |||
| 1100 | Ga0070667_101284441 | |||
| 1101 | Ga0070667_101420506 | |||
| 1102 | Ga0070667_101553986 | |||
| 1103 | Ga0070703_10130968 | |||
| 1104 | Ga0070709_10049620 | |||
| 1105 | Ga0070709_10335980 | |||
| 1106 | Ga0070714_100022733 | |||
| 1107 | Ga0070714_100053701 | |||
| 1108 | Ga0070713_100040939 | |||
| 1109 | Ga0070713_100141698 | |||
| 1110 | Ga0070713_100577259 | |||
| 1111 | Ga0070713_100764604 | |||
| 1112 | Ga0070710_10253618 | |||
| 1113 | Ga0070710_10341404 | |||
| 1114 | Ga0070701_10011235 | |||
| 1115 | Ga0070701_10101907 | |||
| 1116 | Ga0070711_100077057 | |||
| 1117 | Ga0070705_100867094 | |||
| 1118 | Ga0070705_100978758 | |||
| 1119 | Ga0070700_100582929 | |||
| 1120 | Ga0070694_100005435 | |||
| 1121 | Ga0070708_100211817 | |||
| 1122 | Ga0070663_100067195 | |||
| 1123 | Ga0070663_100674065 | |||
| 1124 | Ga0070678_100222132 | |||
| 1125 | Ga0070678_100432993 | |||
| 1126 | Ga0070678_100499387 | |||
| 1127 | Ga0070678_100955836 | |||
| 1128 | Ga0070662_100905926 | |||
| 1129 | Ga0070681_10001553 | |||
| 1130 | Ga0070681_10034442 | |||
| 1131 | Ga0070681_10048735 | |||
| 1132 | Ga0070681_10083859 | |||
| 1133 | Ga0070681_10582584 | |||
| 1134 | Ga0068867_100084042 | |||
| 1135 | Ga0068867_100127252 | |||
| 1136 | Ga0068867_100183613 | |||
| 1137 | Ga0068867_100249907 | |||
| 1138 | Ga0068867_101196718 | |||
| 1139 | Ga0070685_10606144 | |||
| 1140 | Ga0070699_100264491 | |||
| 1141 | Ga0070679_100013442 | |||
| 1142 | Ga0070679_100067891 | |||
| 1143 | Ga0070679_100219666 | |||
| 1144 | Ga0070684_100207477 | |||
| 1145 | Ga0070684_100554556 | |||
| 1146 | Ga0070684_100592975 | |||
| 1147 | Ga0070684_101451950 | |||
| 1148 | Ga0068853_100296853 | |||
| 1149 | Ga0068853_100414252 | |||
| 1150 | Ga0068853_101256972 | |||
| 1151 | Ga0070672_100002728 | |||
| 1152 | Ga0070672_100014054 | |||
| 1153 | Ga0070672_101101220 | |||
| 1154 | Ga0070686_100021404 | |||
| 1155 | Ga0070686_100370920 | |||
| 1156 | Ga0070686_100453369 | |||
| 1157 | Ga0070695_100032624 | |||
| 1158 | Ga0070695_100046447 | |||
| 1159 | Ga0070695_101597724 | |||
| 1160 | Ga0070696_100011332 | |||
| 1161 | Ga0070696_100373824 | |||
| 1162 | Ga0070693_100130788 | |||
| 1163 | Ga0070693_100279700 | |||
| 1164 | Ga0070665_100003303 | |||
| 1165 | Ga0070665_100009341 | |||
| 1166 | Ga0070665_100014326 | |||
| 1167 | Ga0070665_100024057 | |||
| 1168 | Ga0070665_100041275 | |||
| 1169 | Ga0070665_100051461 | |||
| 1170 | Ga0070665_100067747 | |||
| 1171 | Ga0070665_100254610 | |||
| 1172 | Ga0070665_100388767 | |||
| 1173 | Ga0070704_102179687 | |||
| 1174 | Ga0068855_100001659 | |||
| 1175 | Ga0070664_100422952 | |||
| 1176 | Ga0070664_100635243 | |||
| 1177 | Ga0068857_100353114 | |||
| 1178 | Ga0068857_101005918 | |||
| 1179 | Ga0068854_100226154 | |||
| 1180 | Ga0068854_101657754 | |||
| 1181 | Ga0068856_100168958 | |||
| 1182 | Ga0068856_101825358 | |||
| 1183 | Ga0068856_101832794 | |||
| 1184 | Ga0070702_100012685 | |||
| 1185 | Ga0068852_100266957 | |||
| 1186 | Ga0068852_100271259 | |||
| 1187 | Ga0068852_100271861 | |||
| 1188 | Ga0068852_100705092 | |||
| 1189 | Ga0068852_101153412 | |||
| 1190 | Ga0068859_100000720 | |||
| 1191 | Ga0068859_100024617 | |||
| 1192 | Ga0068859_100115898 | |||
| 1193 | Ga0068859_100183306 | |||
| 1194 | Ga0068859_100453920 | |||
| 1195 | Ga0068859_100487589 | |||
| 1196 | Ga0068859_101849086 | |||
| 1197 | Ga0068864_100005158 | |||
| 1198 | Ga0068864_100126297 | |||
| 1199 | Ga0068864_101306805 | |||
| 1200 | Ga0068861_100001212 | |||
| 1201 | Ga0068861_100005227 | |||
| 1202 | Ga0068861_101313426 | |||
| 1203 | Ga0068851_10168944 | |||
| 1204 | Ga0068851_11023415 | |||
| 1205 | Ga0068870_10306908 | |||
| 1206 | Ga0068863_100014074 | |||
| 1207 | Ga0068863_100022736 | |||
| 1208 | Ga0068863_100038720 | |||
| 1209 | Ga0068863_100175145 | |||
| 1210 | Ga0068863_100426305 | |||
| 1211 | Ga0068863_101109184 | |||
| 1212 | Ga0068858_100000571 | |||
| 1213 | Ga0068858_100010826 | |||
| 1214 | Ga0068858_100021381 | |||
| 1215 | Ga0068858_100318992 | |||
| 1216 | Ga0068858_100917597 | |||
| 1217 | Ga0068860_100011510 | |||
| 1218 | Ga0068860_100023543 | |||
| 1219 | Ga0068860_100025609 | |||
| 1220 | Ga0068860_100059600 | |||
| 1221 | Ga0068860_100183325 | |||
| 1222 | Ga0068862_100016054 | |||
| 1223 | Ga0068862_100017864 | |||
| 1224 | Ga0068862_100566210 | |||
| 1225 | Ga0068862_100885527 | |||
| 1226 | Ga0081455_10262011 | |||
| 1227 | Ga0070717_10906533 | |||
| 1228 | Ga0070715_10000391 | |||
| 1229 | Ga0070715_10158913 | |||
| 1230 | Ga0070716_100056019 | |||
| 1231 | Ga0070712_100005045 | |||
| 1232 | Ga0070712_100413922 | |||
| 1233 | Ga0075366_10012267 | |||
| 1234 | Ga0075366_10012973 | |||
| 1235 | Ga0075366_10027612 | |||
| 1236 | Ga0075366_10154126 | |||
| 1237 | Ga0097621_100193735 | |||
| 1238 | Ga0097621_100297145 | |||
| 1239 | Ga0097621_100423065 | |||
| 1240 | Ga0097621_100575047 | |||
| 1241 | Ga0097621_100636364 | |||
| 1242 | Ga0097621_100910085 | |||
| 1243 | Ga0097621_101083175 | |||
| 1244 | Ga0075370_10038229 | |||
| 1245 | Ga0075370_10069945 | |||
| 1246 | Ga0075370_10121983 | |||
| 1247 | Ga0075370_10830392 | |||
| 1248 | Ga0068871_100055785 | |||
| 1249 | Ga0068871_100120681 | |||
| 1250 | Ga0068871_100171646 | |||
| 1251 | Ga0068871_100370377 | |||
| 1252 | Ga0068871_100392120 | |||
| 1253 | Ga0068871_100697540 | |||
| 1254 | Ga0075430_100181058 | |||
| 1255 | Ga0075434_100875106 | |||
| 1256 | Ga0068865_100002113 | |||
| 1257 | Ga0068865_100118042 | |||
| 1258 | Ga0068865_100894950 | |||
| 1259 | Ga0075436_100925096 | |||
| 1260 | Ga0097620_100000720 | |||
| 1261 | Ga0097620_100024617 | |||
| 1262 | Ga0097620_100115902 | |||
| 1263 | Ga0097620_100183310 | |||
| 1264 | Ga0097620_100453916 | |||
| 1265 | Ga0097620_100487497 | |||
| 1266 | Ga0097620_101848887 | |||
| 1267 | Ga0099795_10131997 | |||
| 1268 | Ga0105250_10068890 | |||
| 1269 | Ga0105250_10364386 | |||
| 1270 | Ga0105240_10000307 | |||
| 1271 | Ga0105240_10142953 | |||
| 1272 | Ga0105240_10344624 | |||
| 1273 | Ga0105240_10366821 | |||
| 1274 | Ga0105240_10484852 | |||
| 1275 | Ga0105240_10633151 | |||
| 1276 | Ga0105240_10899161 | |||
| 1277 | Ga0111539_10871523 | |||
| 1278 | Ga0105245_10143056 | |||
| 1279 | Ga0105245_10782570 | |||
| 1280 | Ga0105245_12641994 | |||
| 1281 | Ga0105247_10000598 | |||
| 1282 | Ga0105247_10030816 | |||
| 1283 | Ga0105247_10242956 | |||
| 1284 | Ga0105247_10334138 | |||
| 1285 | Ga0105247_10499597 | |||
| 1286 | Ga0105247_10743505 | |||
| 1287 | Ga0114129_10154179 | |||
| 1288 | Ga0105243_10450504 | |||
| 1289 | Ga0105241_10307786 | |||
| 1290 | Ga0105241_10327860 | |||
| 1291 | Ga0105241_10505448 | |||
| 1292 | Ga0105242_10007597 | |||
| 1293 | Ga0105242_10359564 | |||
| 1294 | Ga0105242_10493350 | |||
| 1295 | Ga0105242_10603919 | |||
| 1296 | Ga0105242_10997189 | |||
| 1297 | Ga0105242_12147914 | |||
| 1298 | Ga0105248_10021845 | |||
| 1299 | Ga0105248_10024493 | |||
| 1300 | Ga0105248_10321348 | |||
| 1301 | Ga0105248_10354465 | |||
| 1302 | Ga0105248_10528173 | |||
| 1303 | Ga0105248_11578734 | |||
| 1304 | Ga0105248_11879272 | |||
| 1305 | Ga0105237_10014635 | |||
| 1306 | Ga0105237_10040905 | |||
| 1307 | Ga0105237_10337999 | |||
| 1308 | Ga0105237_10455096 | |||
| 1309 | Ga0105237_10700425 | |||
| 1310 | Ga0105237_10771522 | |||
| 1311 | Ga0105237_11551091 | |||
| 1312 | Ga0105237_11977938 | |||
| 1313 | Ga0105238_10057878 | |||
| 1314 | Ga0105238_10105595 | |||
| 1315 | Ga0105238_10124592 | |||
| 1316 | Ga0105238_10219387 | |||
| 1317 | Ga0105238_10433647 | |||
| 1318 | Ga0105238_10595321 | |||
| 1319 | Ga0105238_10929497 | |||
| 1320 | Ga0105238_11424727 | |||
| 1321 | Ga0105249_10027325 | |||
| 1322 | Ga0105249_10049167 | |||
| 1323 | Ga0105249_10298268 | |||
| 1324 | Ga0105249_10384180 | |||
| 1325 | Ga0105249_11034928 | |||
| 1326 | Ga0105239_10022131 | |||
| 1327 | Ga0105239_10082627 | |||
| 1328 | Ga0105239_10105579 | |||
| 1329 | Ga0105239_10175265 | |||
| 1330 | Ga0105239_10356885 | |||
| 1331 | Ga0105239_10600920 | |||
| 1332 | Ga0105239_10693387 | |||
| 1333 | Ga0105239_13050598 | |||
| 1334 | Ga0105246_10243921 | |||
| 1335 | Ga0105246_10321361 | |||
| 1336 | Ga0105246_11827585 | |||
| 1337 | Ga0157371_10255227 | |||
| 1338 | Ga0157371_10622041 | |||
| 1339 | Ga0157370_10394812 | |||
| 1340 | Ga0157369_10087176 | |||
| 1341 | Ga0157369_10214522 | |||
| 1342 | Ga0157369_10273611 | |||
| 1343 | Ga0157374_10113179 | |||
| 1344 | Ga0157374_10304949 | |||
| 1345 | Ga0157374_10609740 | |||
| 1346 | Ga0157378_10048478 | |||
| 1347 | Ga0157378_10081832 | |||
| 1348 | Ga0163162_10003955 | |||
| 1349 | Ga0163162_10056246 | |||
| 1350 | Ga0163162_10112569 | |||
| 1351 | Ga0163162_10132036 | |||
| 1352 | Ga0163162_10332871 | |||
| 1353 | Ga0157372_10271748 | |||
| 1354 | Ga0157372_10327020 | |||
| 1355 | Ga0157372_10865813 | |||
| 1356 | Ga0157375_10037280 | |||
| 1357 | Ga0157375_10173605 | |||
| 1358 | Ga0157375_10349473 | |||
| 1359 | Ga0157375_10569719 | |||
| 1360 | Ga0157375_12593836 | |||
| 1361 | Ga0157375_13436579 | |||
| 1362 | Ga0163163_10019243 | |||
| 1363 | Ga0163163_10106838 | |||
| 1364 | Ga0163163_10445989 | |||
| 1365 | Ga0163163_10804605 | |||
| 1366 | Ga0163163_10915144 | |||
| 1367 | Ga0163163_11325315 | |||
| 1368 | Ga0163163_11707717 | |||
| 1369 | Ga0157380_10942454 | |||
| 1370 | Ga0157380_11224667 | |||
| 1371 | Ga0157380_11227449 | |||
| 1372 | Ga0157377_10448263 | |||
| 1373 | Ga0157379_10029723 | |||
| 1374 | Ga0157379_10040550 | |||
| 1375 | Ga0157379_10091983 | |||
| 1376 | Ga0157379_10145753 | |||
| 1377 | Ga0157376_10146723 | |||
| 1378 | Ga0157376_10191770 | |||
| 1379 | Ga0157376_10224046 | |||
| 1380 | Ga0163161_10027982 | |||
| 1381 | Ga0163161_10216042 | |||
| 1382 | Ga0197907_11091587 | |||
| 1383 | Ga0206356_10729450 | |||
| 1384 | Ga0206349_1492484 | |||
| 1385 | Ga0206355_1673172 | |||
| 1386 | Ga0206355_1694621 | |||
| 1387 | Ga0206352_10323100 | |||
| 1388 | Ga0206352_10477912 | |||
| 1389 | Ga0206352_11342142 | |||
| 1390 | Ga0206350_10166307 | |||
| 1391 | Ga0206353_10940199 | |||
| 1392 | Ga0213872_10017280 | |||
| 1393 | Ga0213876_10080580 | |||
| 1394 | Ga0213871_10043169 | |||
| 1395 | Ga0224712_10000712 | |||
| 1396 | Ga0224712_10082901 | |||
| 1397 | Ga0224712_10294634 | |||
| 1398 | Ga0209674_100088 | |||
| 1399 | Ga0209672_106557 | |||
| 1400 | Ga0209563_100179 | |||
| 1401 | Ga0209258_100362 | |||
| 1402 | Ga0209677_100962 | |||
| 1403 | Ga0209148_1012256 | |||
| 1404 | Ga0209759_1001320 | |||
| 1405 | Ga0209759_1001825 | |||
| 1406 | Ga0209759_1039357 | |||
| 1407 | Ga0209455_1000553 | |||
| 1408 | Ga0209051_1004288 | |||
| 1409 | Ga0207656_10690966 | |||
| 1410 | Ga0207692_10053272 | |||
| 1411 | Ga0207692_10774734 | |||
| 1412 | Ga0207642_10299782 | |||
| 1413 | Ga0207710_10000550 | |||
| 1414 | Ga0207710_10165809 | |||
| 1415 | Ga0207710_10314593 | |||
| 1416 | Ga0207688_10202853 | |||
| 1417 | Ga0207680_10089786 | |||
| 1418 | Ga0207680_11316918 | |||
| 1419 | Ga0207647_10039674 | |||
| 1420 | Ga0207685_10013616 | |||
| 1421 | Ga0207699_10133716 | |||
| 1422 | Ga0207699_10305964 | |||
| 1423 | Ga0207645_10082538 | |||
| 1424 | Ga0207645_10241709 | |||
| 1425 | Ga0207643_10092863 | |||
| 1426 | Ga0207643_10505438 | |||
| 1427 | Ga0207654_10315472 | |||
| 1428 | Ga0207654_10485410 | |||
| 1429 | Ga0207707_10018928 | |||
| 1430 | Ga0207707_10020224 | |||
| 1431 | Ga0207707_10021766 | |||
| 1432 | Ga0207707_10059982 | |||
| 1433 | Ga0207707_10109633 | |||
| 1434 | Ga0207707_10433640 | |||
| 1435 | Ga0207695_10006233 | |||
| 1436 | Ga0207695_10041002 | |||
| 1437 | Ga0207695_10056184 | |||
| 1438 | Ga0207695_10124052 | |||
| 1439 | Ga0207695_10163544 | |||
| 1440 | Ga0207695_10731297 | |||
| 1441 | Ga0207671_10026753 | |||
| 1442 | Ga0207671_10039761 | |||
| 1443 | Ga0207671_10299365 | |||
| 1444 | Ga0207671_10317257 | |||
| 1445 | Ga0207671_10517160 | |||
| 1446 | Ga0207671_10751317 | |||
| 1447 | Ga0207693_10000300 | |||
| 1448 | Ga0207693_10015521 | |||
| 1449 | Ga0207663_10281347 | |||
| 1450 | Ga0207660_10058087 | |||
| 1451 | Ga0207657_10026920 | |||
| 1452 | Ga0207649_10894004 | |||
| 1453 | Ga0207652_10025490 | |||
| 1454 | Ga0207652_10116449 | |||
| 1455 | Ga0207652_10251207 | |||
| 1456 | Ga0207681_10044059 | |||
| 1457 | Ga0207694_10164152 | |||
| 1458 | Ga0207694_10182501 | |||
| 1459 | Ga0207694_10192873 | |||
| 1460 | Ga0207694_10259426 | |||
| 1461 | Ga0207694_10415621 | |||
| 1462 | Ga0207694_10452521 | |||
| 1463 | Ga0207694_10789444 | |||
| 1464 | Ga0207694_11817875 | |||
| 1465 | Ga0207650_10213836 | |||
| 1466 | Ga0207687_10225772 | |||
| 1467 | Ga0207687_11560415 | |||
| 1468 | Ga0207700_10060089 | |||
| 1469 | Ga0207700_10066821 | |||
| 1470 | Ga0207700_10112344 | |||
| 1471 | Ga0207700_10170868 | |||
| 1472 | Ga0207664_10017611 | |||
| 1473 | Ga0207664_10054088 | |||
| 1474 | Ga0207664_10365816 | |||
| 1475 | Ga0207644_10001716 | |||
| 1476 | Ga0207644_10070418 | |||
| 1477 | Ga0207644_10076490 | |||
| 1478 | Ga0207690_10089348 | |||
| 1479 | Ga0207706_10659351 | |||
| 1480 | Ga0207706_10953457 | |||
| 1481 | Ga0207686_10018392 | |||
| 1482 | Ga0207686_10098660 | |||
| 1483 | Ga0207686_10628533 | |||
| 1484 | Ga0207670_10013314 | |||
| 1485 | Ga0207670_10767906 | |||
| 1486 | Ga0207670_11155172 | |||
| 1487 | Ga0207704_10045766 | |||
| 1488 | Ga0207704_10121017 | |||
| 1489 | Ga0207704_10766144 | |||
| 1490 | Ga0207665_10004706 | |||
| 1491 | Ga0207691_10007437 | |||
| 1492 | Ga0207691_10020550 | |||
| 1493 | Ga0207711_10059379 | |||
| 1494 | Ga0207711_10249343 | |||
| 1495 | Ga0207711_11500546 | |||
| 1496 | Ga0207711_11576796 | |||
| 1497 | Ga0207689_10052704 | |||
| 1498 | Ga0207689_10164269 | |||
| 1499 | Ga0207689_10200563 | |||
| 1500 | Ga0207689_10321214 | |||
| 1501 | Ga0207661_10040742 | |||
| 1502 | Ga0207661_10153192 | |||
| 1503 | Ga0207661_10614628 | |||
| 1504 | Ga0207679_10111763 | |||
| 1505 | Ga0207679_10973797 | |||
| 1506 | Ga0207679_11352269 | |||
| 1507 | Ga0207679_11992207 | |||
| 1508 | Ga0207667_10012751 | |||
| 1509 | Ga0207667_10609485 | |||
| 1510 | Ga0207651_10001498 | |||
| 1511 | Ga0207651_10545618 | |||
| 1512 | Ga0207651_10579901 | |||
| 1513 | Ga0207651_11609941 | |||
| 1514 | Ga0207712_10055160 | |||
| 1515 | Ga0207712_10410875 | |||
| 1516 | Ga0207712_10946203 | |||
| 1517 | Ga0207640_10136646 | |||
| 1518 | Ga0207658_10011588 | |||
| 1519 | Ga0207658_10123535 | |||
| 1520 | Ga0207658_10264046 | |||
| 1521 | Ga0207658_10366423 | |||
| 1522 | Ga0207658_10426781 | |||
| 1523 | Ga0207677_10014815 | |||
| 1524 | Ga0207677_11492553 | |||
| 1525 | Ga0207703_10001111 | |||
| 1526 | Ga0207703_10001808 | |||
| 1527 | Ga0207703_10207128 | |||
| 1528 | Ga0207703_10287826 | |||
| 1529 | Ga0207639_10593569 | |||
| 1530 | Ga0207678_10026496 | |||
| 1531 | Ga0207678_10251350 | |||
| 1532 | Ga0207678_10255422 | |||
| 1533 | Ga0207678_10807394 | |||
| 1534 | Ga0207678_10852052 | |||
| 1535 | Ga0207708_10048236 | |||
| 1536 | Ga0207708_10244926 | |||
| 1537 | Ga0207708_10391058 | |||
| 1538 | Ga0207708_10645967 | |||
| 1539 | Ga0207702_10030266 | |||
| 1540 | Ga0207702_10096816 | |||
| 1541 | Ga0207702_10761052 | |||
| 1542 | Ga0207702_11657067 | |||
| 1543 | Ga0207641_10000083 | |||
| 1544 | Ga0207641_10025326 | |||
| 1545 | Ga0207641_10032612 | |||
| 1546 | Ga0207641_10077516 | |||
| 1547 | Ga0207641_10231767 | |||
| 1548 | Ga0207641_10250977 | |||
| 1549 | Ga0207641_10470313 | |||
| 1550 | Ga0207641_11059118 | |||
| 1551 | Ga0207648_10028725 | |||
| 1552 | Ga0207648_10039876 | |||
| 1553 | Ga0207648_10107917 | |||
| 1554 | Ga0207648_10178899 | |||
| 1555 | Ga0207648_11648079 | |||
| 1556 | Ga0207676_10017296 | |||
| 1557 | Ga0207676_10410941 | |||
| 1558 | Ga0207676_10504006 | |||
| 1559 | Ga0207676_11189795 | |||
| 1560 | Ga0207674_10156923 | |||
| 1561 | Ga0207674_10678888 | |||
| 1562 | Ga0207675_100016698 | |||
| 1563 | Ga0207675_100410569 | |||
| 1564 | Ga0207683_10236500 | |||
| 1565 | Ga0207683_10480604 | |||
| 1566 | Ga0207698_10100442 | |||
| 1567 | Ga0207698_10332850 | |||
| 1568 | Ga0207698_10946753 | |||
| 1569 | Ga0209974_10049342 | |||
| 1570 | Ga0268266_10001464 | |||
| 1571 | Ga0268266_10002690 | |||
| 1572 | Ga0268266_10009272 | |||
| 1573 | Ga0268266_10022172 | |||
| 1574 | Ga0268266_10052164 | |||
| 1575 | Ga0268266_10062455 | |||
| 1576 | Ga0268266_10123429 | |||
| 1577 | Ga0268265_10004217 | |||
| 1578 | Ga0268265_10013010 | |||
| 1579 | Ga0268265_10045559 | |||
| 1580 | Ga0268265_10074313 | |||
| 1581 | Ga0268265_11768260 | |||
| 1582 | Ga0268264_10000179 | |||
| 1583 | Ga0268264_10011064 | |||
| 1584 | Ga0268264_10012783 | |||
| 1585 | Ga0268264_10032760 | |||
| 1586 | Ga0268264_10111722 | |||
| 1587 | Ga0268264_10116657 | |||
| 1588 | Ga0268264_10346545 | |||
| 1589 | Ga0268264_10349707 | |||
| 1590 | Ga0268264_10445284 | |||
| 1591 | Ga0265319_1010575 | |||
| 1592 | Ga0265334_10000242 | |||
| 1593 | Ga0265334_10012101 | |||
| 1594 | Ga0265318_10000024 | |||
| 1595 | Ga0307515_10002191 | |||
| 1596 | Ga0307515_10072294 | |||
| 1597 | Ga0307515_10122972 | |||
| 1598 | Ga0265338_10009779 | |||
| 1599 | Ga0265338_10014084 | |||
| 1600 | Ga0265324_10000908 | |||
| 1601 | Ga0307511_10001031 | |||
| 1602 | Ga0307511_10345474 | |||
| 1603 | Ga0265766_1002598 | |||
| 1604 | Ga0265779_113045 | |||
| 1605 | Ga0265330_10007609 | |||
| 1606 | Ga0265332_10013565 | |||
| 1607 | Ga0265328_10009932 | |||
| 1608 | Ga0265320_10003463 | |||
| 1609 | Ga0265325_10003241 | |||
| 1610 | Ga0265329_10000807 | |||
| 1611 | Ga0265340_10059069 | |||
| 1612 | Ga0265340_10143422 | |||
| 1613 | Ga0265340_10166944 | |||
| 1614 | Ga0265339_10153772 | |||
| 1615 | Ga0265331_10002138 | |||
| 1616 | Ga0265331_10042357 | |||
| 1617 | Ga0265316_10004634 | |||
| 1618 | Ga0307513_10166143 | |||
| 1619 | Ga0307513_10263412 | |||
| 1620 | Ga0307509_10000001 | |||
| 1621 | Ga0307408_100131702 | |||
| 1622 | Ga0265313_10008827 | |||
| 1623 | Ga0307508_10156586 | |||
| 1624 | Ga0307508_10529487 | |||
| 1625 | Ga0307508_10534067 | |||
| 1626 | Ga0307514_10000854 | |||
| 1627 | Ga0265314_10002873 | |||
| 1628 | Ga0265342_10009386 | |||
| 1629 | Ga0316576_10004217 | |||
| 1630 | Ga0316578_10185360 | |||
| 1631 | Ga0307516_10000432 | |||
| 1632 | Ga0307516_10006666 | |||
| 1633 | Ga0307516_10106242 | |||
| 1634 | Ga0307405_10077160 | |||
| 1635 | Ga0307413_10007993 | |||
| 1636 | Ga0307410_10009459 | |||
| 1637 | Ga0307406_10142861 | |||
| 1638 | Ga0307406_11517084 | |||
| 1639 | Ga0307412_10193587 | |||
| 1640 | Ga0307409_100000260 | |||
| 1641 | Ga0307416_103097790 | |||
| 1642 | Ga0307411_10003073 | |||
| 1643 | Ga0307415_100093549 | |||
| 1644 | Ga0307507_10415666 | |||
| 1645 | Ga0307510_10000013 | |||
| 1646 | Ga0307510_10014579 | |||
| 1647 | Ga0373926_0319639 | |||
| 1648 | Ga0373923_0033379 | |||
| 1649 | Ga0373932_0099214 | |||
| 1650 | Ga0373936_0016925 | |||
| 1651 | Ga0373936_0022834 | |||
| 1652 | Ga0373945_0507169 | |||
| 1653 | Ga0373953_0131906 | |||
| 1654 | Ga0373954_0076448 | |||
| 1655 | Ga0373956_0488854 | |||
| 1656 | Ga0373957_0113276 | |||
| 1657 | Ga0373957_0392802 | |||
| 1658 | Ga0373957_0434159 | |||
| 1659 | Ga0373943_0113979 | |||
| 1660 | Ga0316574_0010096 | |||
| 1661 | Ga0373924_0318170 | |||
| 1662 | Ga0373931_0108038 | |||
| 1663 | Ga0373935_0162570 | |||
| 1664 | Ga0373935_1368904 | |||
| 1665 | Ga0373927_0035795 | |||
| 1666 | Ga0373933_0085840 | |||
| 1667 | Ga0373933_0351696 | |||
| 1668 | Ga0373947_0160362 | |||
| 1669 | Ga0373947_0396828 | |||
| 1670 | Ga0373937_0028436 | |||
| 1671 | Ga0373937_0085763 | |||
| 1672 | Ga0373937_0346194 | |||
| 1673 | Ga0316584_0052700 | |||
| 1674 | Ga0373925_0006858 | |||
| 1675 | Ga0373925_0703550 | |||
| 1676 | Ga0395900_0000025 | |||
| 1677 | Ga0395898_0001112 | |||
| 1678 | Ga0395905_0031321 | |||
| 1679 | Ga0395905_0036617 | |||
| 1680 | Ga0395905_0401396 | |||
| 1681 | Ga0395905_0476590 | |||
| 1682 | Ga0395905_0678399 | |||
| 1683 | Ga0395905_0865324 | |||
| 1684 | Ga0436364_0288620 | |||
| 1685 | Ga0436365_0935043 | |||
| 1686 | Ga0436365_1116878 | |||
| 1687 | Ga0436365_1123795 | |||
| 1688 | Ga0436365_1273617 | |||
| 1689 | Ga0436365_1369117 | |||
| 1690 | Ga0436365_1915437 | |||
| 1691 | Ga0436360_0109344 | |||
| 1692 | Ga0436360_0577739 | |||
| 1693 | Ga0436360_0770911 | |||
| 1694 | Ga0436360_0789934 | |||
| 1695 | Ga0436360_1376956 | |||
| 1696 | Ga0436361_0559178 | |||
| 1697 | Ga0436361_0597012 | |||
| 1698 | Ga0436361_0814403 | |||
| 1699 | Ga0436361_0866882 | |||
| 1700 | Ga0436363_0322376 | |||
| 1701 | Ga0436363_0569581 | |||
| 1702 | Ga0436363_0578683 | |||
| 1703 | Ga0436363_1295560 | |||
| 1704 | Ga0436362_0136394 | |||
| 1705 | Ga0436362_0350607 | |||
| 1706 | Ga0439436_0052150 | |||
| 1707 | Ga0439439_0070597 | |||
| 1708 | Ga0439453_0049055 | |||
| 1709 | Ga0451798_0124787 | |||
| 1710 | Ga0451798_1134510 | |||
| 1711 | Ga0451800_0213464 | |||
| 1712 | Ga0451805_062905 | |||
| 1713 | Ga0439431_0011676 | |||
| 1714 | Ga0439433_0033793 | |||
| 1715 | Ga0439448_0041103 | |||
| 1716 | Ga0439448_0135914 | |||
| 1717 | Ga0439449_0030723 | |||
| 1718 | Ga0439449_0042891 | |||
| 1719 | Ga0439457_034565 | |||
| 1720 | Ga0439462_0013130 | |||
| 1721 | Ga0450899_002960 | |||
| 1722 | Ga0439446_0059901 | |||
| 1723 | Ga0439464_0029358 | |||
| 1724 | Ga0450893_0033394 | |||
| 1725 | Ga0450893_0056336 | |||
| 1726 | Ga0451577_0001132 | |||
| 1727 | Ga0466969_0000075 | |||
| 1728 | Ga0466969_0003117 | |||
| 1729 | Ga0466969_0010879 | |||
| 1730 | Ga0466969_0013190 | |||
| 1731 | Ga0466969_0013216 | |||
| 1732 | Ga0466969_0015530 | |||
| 1733 | Ga0466969_0069294 | |||
| 1734 | Ga0466972_0004215 | |||
| 1735 | Ga0466972_0008052 | |||
| 1736 | Ga0466972_0016103 | |||
| 1737 | Ga0466972_0023590 | |||
| 1738 | Ga0466965_0020677 | |||
| 1739 | Ga0466965_0028559 | |||
| 1740 | Ga0466965_0075348 | |||
| 1741 | Ga0466965_0114003 | |||
| 1742 | Ga0466965_0449530 | |||
| 1743 | Ga0466966_0004792 | |||
| 1744 | Ga0466966_0011299 | |||
| 1745 | Ga0466966_0023991 | |||
| 1746 | Ga0466966_0047046 | |||
| 1747 | Ga0466966_0057852 | |||
| 1748 | Ga0466966_0440297 | |||
| 1749 | Ga0466961_0002234 | |||
| 1750 | Ga0466961_0010322 | |||
| 1751 | Ga0466961_0010421 | |||
| 1752 | Ga0466961_0011978 | |||
| 1753 | Ga0466961_0079707 | |||
| 1754 | Ga0466963_0035056 | |||
| 1755 | Ga0466964_0001005 | |||
| 1756 | Ga0466964_0002737 | |||
| 1757 | Ga0466964_0024262 | |||
| 1758 | Ga0466971_0001125 | |||
| 1759 | Ga0466971_0003912 | |||
| 1760 | Ga0466971_0077730 | |||
| 1761 | Ga0466971_0105875 | |||
| 1762 | Ga0466968_0011359 | |||
| 1763 | Ga0466968_0261351 | |||
| 1764 | Ga0466970_0004235 | |||
| 1765 | Ga0466970_0008413 | |||
| 1766 | Ga0466970_0012923 | |||
| 1767 | Ga0466970_0183317 | |||
| 1768 | Ga0466970_0466484 | |||
| 1769 | Ga0466957_0016451 | |||
| 1770 | Ga0466957_0023740 | |||
| 1771 | Ga0466960_0046107 | |||
| 1772 | Ga0466960_0623140 | |||
| 1773 | Ga0466959_0000818 | |||
| 1774 | Ga0466959_0006637 | |||
| 1775 | Ga0466959_0009577 | |||
| 1776 | Ga0466959_0013546 | |||
| 1777 | Ga0466959_0015487 | |||
| 1778 | Ga0466959_0016434 | |||
| 1779 | Ga0466959_0041660 | |||
| 1780 | Ga0466959_0081007 | |||
| 1781 | Ga0451576_0317058 | |||
| 1782 | Ga0451576_0930878 | |||
| 1783 | Ga0466958_0016466 | |||
| 1784 | Ga0466958_0225294 | |||
| 1785 | Ga0466967_0054356 | |||
| 1786 | Ga0466967_0208802 | |||
| 1787 | Ga0495651_0368445 | |||
| 1788 | Ga0495650_0032218 | |||
| 1789 | Ga0495580_0009981 | |||
| 1790 | Ga0495580_0170414 | |||
| 1791 | Ga0495585_0010185 | |||
| 1792 | Ga0495618_0213235 | |||
| 1793 | Ga0495628_0344157 | |||
| 1794 | Ga0495630_0035720 | |||
| 1795 | Ga0495630_1264767 | |||
| 1796 | Ga0495648_0154202 | |||
| 1797 | Ga0495652_0327323 | |||
| 1798 | Ga0495640_0783704 | |||
| 1799 | Ga0495586_0061129 | |||
| 1800 | Ga0495609_0155499 | |||
| 1801 | Ga0495645_0300550 | |||
| 1802 | Ga0495645_0541353 | |||
| 1803 | Ga0495622_0443269 | |||
| 1804 | Ga0495668_0222231 | |||
| 1805 | Ga0495625_0057959 | |||
| 1806 | Ga0495625_0613197 | |||
| 1807 | Ga0495657_0141200 | |||
| 1808 | Ga0495623_0466901 | |||
| 1809 | Ga0495649_0051908 | |||
| 1810 | Ga0495680_0820564 | |||
| 1811 | Ga0495686_0019152 | |||
| 1812 | Ga0495686_0238478 | |||
| 1813 | Ga0496100_0060202 | |||
| 1814 | Ga0496100_1046364 | |||
| 1815 | Ga0496101_0098798 | |||
| 1816 | Ga0496101_0545467 | |||
| 1817 | Ga0496101_0906946 | |||
| 1818 | Ga0496102_0173096 | |||
| 1819 | Ga0496102_0234846 | |||
| 1820 | Ga0496103_0019355 | |||
| 1821 | Ga0496104_0035306 | |||
| 1822 | Ga0496104_0323321 | |||
| 1823 | Ga0496105_0021395 | |||
| 1824 | Ga0496105_0396128 | |||
| 1825 | Ga0496106_0074733 | |||
| 1826 | Ga0496106_0725878 | |||
| 1827 | Ga0496107_0020106 | |||
| 1828 | Ga0496107_0331757 | |||
| 1829 | Ga0496108_0235435 | |||
| 1830 | Ga0496109_0004674 | |||
| 1831 | Ga0496109_0197828 | |||
| 1832 | Ga0496109_0285789 | |||
| 1833 | Ga0496110_0110070 | |||
| 1834 | Ga0496111_0032699 | |||
| 1835 | Ga0496112_0353221 | |||
| 1836 | Ga0496113_0157001 | |||
| 1837 | Ga0496113_0257914 | |||
| 1838 | Ga0496114_0000976 | |||
| 1839 | Ga0496114_0561427 | |||
| 1840 | Ga0496115_0003458 | |||
| 1841 | Ga0496115_0141118 | |||
| 1842 | Ga0496115_0426451 | |||
| 1843 | Ga0496115_1265421 | |||
| 1844 | Ga0496116_0025905 | |||
| 1845 | Ga0496117_0000057 | |||
| 1846 | Ga0496118_0000028 | |||
| 1847 | Ga0496119_0021299 | |||
| 1848 | Ga0496119_0024683 | |||
| 1849 | Ga0496119_0405115 | |||
| 1850 | Ga0496120_0021404 | |||
| 1851 | Ga0496120_0209716 | |||
| 1852 | Ga0496121_0001748 | |||
| 1853 | Ga0496121_0034849 | |||
| 1854 | Ga0496121_0350704 | |||
| 1855 | Ga0496124_0018704 | |||
| 1856 | Ga0496125_0000926 | |||
| 1857 | Ga0496125_0071773 | |||
| 1858 | Ga0496125_0290401 | |||
| 1859 | Ga0496126_0008006 | |||
| 1860 | Ga0496126_0029585 | |||
| 1861 | Ga0496126_0108705 | |||
| 1862 | Ga0496126_0681286 | |||
| 1863 | Ga0496126_0817917 | |||
| 1864 | Ga0501306_011807 | |||
| 1865 | Ga0501308_000351 | |||
| 1866 | Ga0501308_015256 | |||
| 1867 | Ga0501310_021793 | |||
| 1868 | Ga0501304_006097 | |||
| 1869 | Ga0501303_008953 | |||
| 1870 | Ga0501311_065750 | |||
| 1871 | Ga0501312_006801 | |||
| 1872 | Ga0501312_109898 | |||
| 1873 | Ga0501313_019615 | |||
| 1874 | Ga0501314_001973 | |||
| 1875 | Ga0501315_004684 | |||
| 1876 | Ga0501315_025153 | |||
| 1877 | Ga0501317_002108 | |||
| 1878 | Ga0501317_077225 | |||
| 1879 | Ga0501320_016223 | |||
| 1880 | Ga0501321_000564 | |||
| 1881 | Ga0501323_049590 | |||
| 1882 | Ga0501325_002818 | |||
| 1883 | Ga0501328_05474 | |||
| 1884 | Ga0501329_08434 | |||
| 1885 | Ga0501340_001985 | |||
| 1886 | Ga0501340_013318 | |||
| 1887 | Ga0501036_0624912 | |||
| 1888 | Ga0501048_0238036 | |||
| 1889 | Ga0501073_0604542 | |||
| 1890 | Ga0501199_006575 | |||
| 1891 | Ga0501206_089418 | |||
| 1892 | Ga0501249_195455 | |||
| 1893 | Ga0501256_033520 | |||
| 1894 | Ga0501257_041467 | |||
| 1895 | Ga0501079_0241535 | |||
| 1896 | Ga0501079_1238847 | |||
| 1897 | nmdc:mga0k408_11566_c1 | |||
| 1898 | nmdc:mga0k408_169358_c1 | |||
| 1899 | nmdc:mga0k408_578236_c1 | |||
| 1900 | nmdc:mga0k408_69937_c1 | |||
| 1901 | nmdc:mga0k408_89144_c1 | |||
| 1902 | nmdc:mga07m45_1066_c1 | |||
| 1903 | nmdc:mga07m45_41324_c1 | |||
| 1904 | nmdc:mga05p37_105087_c1 | |||
| 1905 | nmdc:mga05p37_1564738_c1 | |||
| 1906 | nmdc:mga0qj67_359680_c1 | |||
| 1907 | nmdc:mga08y16_760236_c1 | |||
| 1908 | nmdc:mga0rr50_1214440_c1 | |||
| 1909 | nmdc:mga0a205_832390_c1 | |||
| 1910 | Ga0495612_0316719 | |||
| 1911 | Ga0500635_0000072 | |||
| 1912 | Ga0500643_003570 | |||
| 1913 | Ga0500644_0099591 | |||
| 1914 | Ga0500646_0018273 | |||
| 1915 | Ga0500583_0289367 | |||
| 1916 | Ga0500583_0319868 | |||
| 1917 | Ga0500651_0111819 | |||
| 1918 | Ga0500641_0067946 | |||
| 1919 | Ga0500650_0209796 | |||
| 1920 | Ga0500562_010211 | |||
| 1921 | Ga0500572_016125 | |||
| 1922 | Ga0500594_0009895 | |||
| 1923 | Ga0500595_044003 | |||
| 1924 | Ga0500608_206992 | |||
| 1925 | Ga0500652_025758 | |||
| 1926 | Ga0500559_0459809 | |||
| 1927 | Ga0500564_169108 | |||
| 1928 | Ga0500568_0065017 | |||
| 1929 | Ga0500577_0469173 | |||
| 1930 | Ga0500590_265471 | |||
| 1931 | Ga0500616_0000016 | |||
| 1932 | Ga0500616_0045257 | |||
| 1933 | Ga0500622_0006035 | |||
| 1934 | Ga0500639_124948 | |||
| 1935 | Ga0500639_341773 | |||
| 1936 | Ga0500636_0008914 | |||
| 1937 | Ga0500637_0020797 | |||
| 1938 | Ga0500637_0290957 | |||
| 1939 | Ga0500611_012209 | |||
| 1940 | Ga0500596_004056 | |||
| 1941 | Ga0500661_024804 | |||
| 1942 | Ga0587084_000433 | |||
| 1943 | Ga0587084_019002 | |||
| 1944 | Ga0587093_001766 | |||
| 1945 | Ga0587093_029952 | |||
| 1946 | Ga0587093_033969 | |||
| 1947 | Ga0587066_002318 | |||
| 1948 | Ga0587066_003065 | |||
| 1949 | Ga0587066_007195 | |||
| 1950 | Ga0587066_019086 | |||
| 1951 | Ga0587070_000937 | |||
| 1952 | Ga0587070_066369 | |||
| 1953 | Ga0587070_155650 | |||
| 1954 | Ga0587073_0045814 | |||
| 1955 | Ga0587077_001010 | |||
| 1956 | Ga0587077_003170 | |||
| 1957 | Ga0587077_031732 | |||
| 1958 | Ga0587080_004102 | |||
| 1959 | Ga0587080_031744 | |||
| 1960 | Ga0587080_076724 | |||
| 1961 | Ga0587082_005534 | |||
| 1962 | Ga0587082_010690 | |||
| 1963 | Ga0587083_0005260 | |||
| 1964 | Ga0587083_0025337 | |||
| 1965 | Ga0587083_0031913 | |||
| 1966 | Ga0587083_0061548 | |||
| 1967 | Ga0587083_0113233 | |||
| 1968 | Ga0587085_000405 | |||
| 1969 | Ga0587085_003839 | |||
| 1970 | Ga0587085_007270 | |||
| 1971 | Ga0587086_000406 | |||
| 1972 | Ga0587086_007979 | |||
| 1973 | Ga0587088_001524 | |||
| 1974 | Ga0587089_032450 | |||
| 1975 | Ga0587090_000400 | |||
| 1976 | Ga0587090_000452 | |||
| 1977 | Ga0587090_002039 | |||
| 1978 | Ga0587091_000944 | |||
| 1979 | Ga0587091_032435 | |||
| 1980 | Ga0587091_163997 | |||
| 1981 | Ga0587092_002029 | |||
| 1982 | Ga0587092_048439 | |||
| 1983 | Ga0587094_000448 | |||
| 1984 | Ga0587094_002938 | |||
| 1985 | Ga0587098_009470 | |||
| 1986 | Ga0587106_056876 | |||
| 1987 | Ga0587125_000549 | |||
| 1988 | Ga0587125_006665 | |||
| 1989 | Ga0587131_015709 | |||
| 1990 | Ga0587101_001373 | |||
| 1991 | Ga0587101_026345 | |||
| 1992 | Ga0587109_005113 | |||
| 1993 | Ga0587109_007367 | |||
| 1994 | Ga0587109_033893 | |||
| 1995 | Ga0587109_076138 | |||
| 1996 | Ga0587115_000323 | |||
| 1997 | Ga0587115_068987 | |||
| 1998 | Ga0587117_000345 | |||
| 1999 | Ga0587128_008475 | |||
| 2000 | Ga0587128_009243 | |||
| 2001 | Ga0587128_029906 | |||
| 2002 | Ga0587128_100489 | |||
| 2003 | Ga0587130_010086 | |||
| 2004 | Ga0587062_000473 | |||
| 2005 | Ga0587062_023336 | |||
| 2006 | Ga0587062_070581 | |||
| 2007 | Ga0587067_014060 | |||
| 2008 | Ga0587067_056323 | |||
| 2009 | Ga0587067_238461 | |||
| 2010 | Ga0587068_002378 | |||
| 2011 | Ga0587068_013300 | |||
| 2012 | Ga0587068_015816 | |||
| 2013 | Ga0587069_001653 | |||
| 2014 | Ga0587069_025651 | |||
| 2015 | Ga0587069_088819 | |||
| 2016 | Ga0587072_005137 | |||
| 2017 | Ga0587072_010373 | |||
| 2018 | Ga0587072_172436 | |||
| 2019 | Ga0587075_011981 | |||
| 2020 | Ga0587075_034614 | |||
| 2021 | Ga0587076_003254 | |||
| 2022 | Ga0587076_005768 | |||
| 2023 | Ga0587076_027891 | |||
| 2024 | Ga0587076_038149 | |||
| 2025 | Ga0587079_007398 | |||
| 2026 | Ga0587079_065767 | |||
| 2027 | Ga0587079_088196 | |||
| 2028 | Ga0587079_099905 | |||
| 2029 | Ga0587100_001147 | |||
| 2030 | Ga0587100_010643 | |||
| 2031 | Ga0587102_022671 | |||
| 2032 | Ga0587102_027836 | |||
| 2033 | Ga0587105_012726 | |||
| 2034 | Ga0587107_023462 | |||
| 2035 | Ga0587107_039413 | |||
| 2036 | Ga0587108_013740 | |||
| 2037 | Ga0587110_002704 | |||
| 2038 | Ga0587114_010376 | |||
| 2039 | Ga0587118_12569 | |||
| 2040 | Ga0587119_015585 | |||
| 2041 | Ga0587124_002348 | |||
| 2042 | Ga0587124_051784 | |||
| 2043 | Ga0587071_009437 | |||
| 2044 | Ga0587071_032189 | |||
| 2045 | Ga0587071_049276 | |||
| 2046 | Ga0587071_061538 | |||
| 2047 | Ga0587111_0000905 | |||
| 2048 | Ga0587111_0008978 | |||
| 2049 | Ga0501082_1108676 | |||
| 2050 | Ga0501082_1290637 | |||
| 2051 | Ga0466962_0008322 | |||
| 2052 | Ga0466962_0011878 | |||
| 2053 | Ga0466962_0031968 | |||
| 2054 | Ga0466962_0532071 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8572 | 56 | 128 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8363 | 56 | 128 |
| 2jwl-assembly1.cif.gz_B | solution structure of periplasmic domain of tolr from h. influenzae with saxs data | 0.8209 | 56 | 122 |
| 1vdm-assembly1.cif.gz_I | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.8094 | 95 | 126 |
| 3do6-assembly1.cif.gz_A | crystal structure of putative formyltetrahydrofolate synthetase (tm1766) from thermotoga maritima at 1.85 a resolution | 0.7515 | 83 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.8209 | 56 | 122 | 3.30.420.270 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7588 | 95 | 127 | 3.40.50.2020 |
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7475 | 56 | 122 | 3.30.420.270 |
| af_P9WIM5_63_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7114 | 79 | 127 | 3.40.50.150 |
| 3vthA04 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.6749 | 77 | 131 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9GU90-F1-model_v4 | Biopolymer transport protein ExbD/TolR | 0.9393 | 57 | 127 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A5E9Q4F2-F1-model_v4 | deleted | 0.9368 | 54 | 127 |
|
| AF-A0A2S9WYI7-F1-model_v4 | Biopolymer transporter ExbD | 0.9314 | 53 | 127 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A1I7IB77-F1-model_v4 | Biopolymer transport protein ExbD | 0.9277 | 51 | 127 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A4Q3LLI3-F1-model_v4 | Biopolymer transporter ExbD | 0.9198 | 53 | 133 |
GO:0005886
GO:0015031 GO:0022857 |