F488531

General Info

Members Datasets Scaffolds Average Seq Length
1027 466 2054 139

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100203105|Ga0070713_1002031052
Length 152
Sequence MAMSVGPGSGEEQTVMAAINTTPLVDVMLVLLIIFLITIPVINKNVPVVLPKAVNIPTQTKPENIVVSVNKDGKIFWKDQETKNRQQLLDLVKSVAVIKPQPEIHIRADKEAHYEAIGRVIFTIQRGGVQKVGFITEPDHGIGVSAAAAAAQ

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
214 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
277 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
278 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
279 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
280 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
283 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
284 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
285 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
286 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
292 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
361 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
378 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
381 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
395 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
396 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
397 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
398 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
399 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
400 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
401 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
404 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
416 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
417 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
418 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.42
Metatranscriptomes 15.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0
Rhizoplane 3.41
Rhizosphere 85.2
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100203105 3300005436 Bacteria 1791
2 JGI24744J21845_10032899 3300002077 Bacteria 988
3 JGI25156J39149_1025481 3300002705 Bacteria 950
4 Ga0007410J51695_1047609 3300003574 Bacteria 1199
5 Ga0032354_1074764 3300003693 Bacteria 1265
6 Ga0055533_1000087 3300003756 Bacteria 122417
7 Ga0055525_1000799 3300003759 Bacteria 9907
8 Ga0055535_1000718 3300003761 Bacteria 25117
9 Ga0055529_1000885 3300003763 Bacteria 16980
10 Ga0058859_11575955 3300004798 Bacteria 596
11 Ga0058859_11636537 3300004798 Bacteria 581
12 Ga0058863_10034658 3300004799 Bacteria 3854
13 Ga0058863_11886887 3300004799 Bacteria 1819
14 Ga0058863_11955264 3300004799 Bacteria 3661
15 Ga0058861_10033013 3300004800 Bacteria 4460
16 Ga0058861_11829992 3300004800 Bacteria 3204
17 Ga0058860_10027454 3300004801 Bacteria 4105
18 Ga0058860_10098742 3300004801 Bacteria 891
19 Ga0058860_10103368 3300004801 Bacteria 2017
20 Ga0058862_10047899 3300004803 Bacteria 4748
21 Ga0058862_10112105 3300004803 Bacteria 4614
22 Ga0058862_12771566 3300004803 Bacteria 787
23 Ga0065707_10115128 3300005295 Bacteria 2276
24 Ga0070658_10092147 3300005327 Bacteria 2498
25 Ga0070676_10101937 3300005328 Bacteria 1775
26 Ga0070683_100027202 3300005329 Bacteria 5157
27 Ga0070683_100246845 3300005329 Bacteria 1698
28 Ga0070683_100480167 3300005329 Bacteria 1187
29 Ga0070690_100014196 3300005330 Bacteria 4723
30 Ga0070690_100017452 3300005330 Bacteria 4316
31 Ga0070690_100554674 3300005330 Bacteria 867
32 Ga0070670_100763436 3300005331 Bacteria 872
33 Ga0068869_100041507 3300005334 Bacteria 3296
34 Ga0068869_100322123 3300005334 Bacteria 1254
35 Ga0068869_100427924 3300005334 Bacteria 1093
36 Ga0068869_100650362 3300005334 Bacteria 895
37 Ga0070666_10007154 3300005335 Bacteria 6876
38 Ga0070666_10167532 3300005335 Bacteria 1537
39 Ga0070666_11304180 3300005335 Bacteria 542
40 Ga0070680_100067162 3300005336 Bacteria 2941
41 Ga0070682_100404250 3300005337 Bacteria 1034
42 Ga0070682_100481293 3300005337 Bacteria 958
43 Ga0068868_100003950 3300005338 Bacteria 10353
44 Ga0068868_100505187 3300005338 Bacteria 1059
45 Ga0070660_100045223 3300005339 Bacteria 3369
46 Ga0070689_100019912 3300005340 Bacteria 4969
47 Ga0070689_100908061 3300005340 Bacteria 779
48 Ga0070689_101130080 3300005340 Bacteria 701
49 Ga0070691_10564235 3300005341 Bacteria 667
50 Ga0070691_10780996 3300005341 Bacteria 580
51 Ga0070661_100186482 3300005344 Bacteria 1580
52 Ga0070661_100821862 3300005344 Bacteria 763
53 Ga0070661_101168400 3300005344 Bacteria 643
54 Ga0070692_10159278 3300005345 Bacteria 1292
55 Ga0070668_100481474 3300005347 Bacteria 1072
56 Ga0070669_100017622 3300005353 Bacteria 5095
57 Ga0070669_101377913 3300005353 Bacteria 612
58 Ga0070671_100000631 3300005355 Bacteria 25121
59 Ga0070671_100111115 3300005355 Bacteria 2302
60 Ga0070671_100838344 3300005355 Bacteria 801
61 Ga0070674_100014580 3300005356 Bacteria 4889
62 Ga0070673_100039827 3300005364 Bacteria 3600
63 Ga0070673_100137012 3300005364 Bacteria 2061
64 Ga0070673_100301816 3300005364 Bacteria 1410
65 Ga0070673_100622344 3300005364 Bacteria 986
66 Ga0070688_100108938 3300005365 Bacteria 1839
67 Ga0070688_101190119 3300005365 Bacteria 612
68 Ga0070659_100098220 3300005366 Bacteria 2354
69 Ga0070659_100290954 3300005366 Bacteria 1360
70 Ga0070667_100004025 3300005367 Bacteria 12440
71 Ga0070667_100213813 3300005367 Bacteria 1714
72 Ga0070667_100657725 3300005367 Bacteria 968
73 Ga0070667_101284441 3300005367 Bacteria 686
74 Ga0070667_101420506 3300005367 Bacteria 651
75 Ga0070667_101553986 3300005367 Bacteria 622
76 Ga0070703_10130968 3300005406 Bacteria 921
77 Ga0070709_10049620 3300005434 Bacteria 2625
78 Ga0070709_10335980 3300005434 Bacteria 1113
79 Ga0070714_100022733 3300005435 Bacteria 5144
80 Ga0070714_100053701 3300005435 Bacteria 3441
81 Ga0070713_100040939 3300005436 Bacteria 3771
82 Ga0070713_100141698 3300005436 Bacteria 2130
83 Ga0070713_100577259 3300005436 Bacteria 1066
84 Ga0070713_100764604 3300005436 Bacteria 925
85 Ga0070710_10253618 3300005437 Bacteria 1132
86 Ga0070710_10341404 3300005437 Bacteria 989
87 Ga0070701_10011235 3300005438 Bacteria 3995
88 Ga0070701_10101907 3300005438 Bacteria 1591
89 Ga0070711_100077057 3300005439 Bacteria 2365
90 Ga0070705_100867094 3300005440 Bacteria 724
91 Ga0070705_100978758 3300005440 Bacteria 685
92 Ga0070700_100582929 3300005441 Bacteria 874
93 Ga0070694_100005435 3300005444 Bacteria 7712
94 Ga0070708_100211817 3300005445 Bacteria 1816
95 Ga0070663_100067195 3300005455 Bacteria 2599
96 Ga0070663_100674065 3300005455 Bacteria 877
97 Ga0070678_100222132 3300005456 Bacteria 1571
98 Ga0070678_100432993 3300005456 Bacteria 1149
99 Ga0070678_100499387 3300005456 Bacteria 1073
100 Ga0070678_100955836 3300005456 Bacteria 786
101 Ga0070662_100905926 3300005457 Bacteria 752
102 Ga0070681_10001553 3300005458 Bacteria 20347
103 Ga0070681_10034442 3300005458 Bacteria 5085
104 Ga0070681_10048735 3300005458 Bacteria 4233
105 Ga0070681_10083859 3300005458 Bacteria 3140
106 Ga0070681_10582584 3300005458 Bacteria 1033
107 Ga0068867_100084042 3300005459 Bacteria 2404
108 Ga0068867_100127252 3300005459 Bacteria 1975
109 Ga0068867_100183613 3300005459 Bacteria 1664
110 Ga0068867_100249907 3300005459 Bacteria 1442
111 Ga0068867_101196718 3300005459 Bacteria 698
112 Ga0070685_10606144 3300005466 Bacteria 788
113 Ga0070699_100264491 3300005518 Bacteria 1539
114 Ga0070679_100013442 3300005530 Bacteria 7839
115 Ga0070679_100067891 3300005530 Bacteria 3557
116 Ga0070679_100219666 3300005530 Bacteria 1862
117 Ga0070684_100207477 3300005535 Bacteria 1786
118 Ga0070684_100554556 3300005535 Bacteria 1067
119 Ga0070684_100592975 3300005535 Bacteria 1030
120 Ga0070684_101451950 3300005535 Bacteria 646
121 Ga0068853_100296853 3300005539 Bacteria 1493
122 Ga0068853_100414252 3300005539 Bacteria 1263
123 Ga0068853_101256972 3300005539 Bacteria 715
124 Ga0070672_100002728 3300005543 Bacteria 11297
125 Ga0070672_100014054 3300005543 Bacteria 5665
126 Ga0070672_101101220 3300005543 Bacteria 706
127 Ga0070686_100021404 3300005544 Bacteria 3844
128 Ga0070686_100370920 3300005544 Bacteria 1081
129 Ga0070686_100453369 3300005544 Bacteria 986
130 Ga0070695_100032624 3300005545 Bacteria 3256
131 Ga0070695_100046447 3300005545 Bacteria 2771
132 Ga0070695_101597724 3300005545 Bacteria 544
133 Ga0070696_100011332 3300005546 Bacteria 5969
134 Ga0070696_100373824 3300005546 Bacteria 1109
135 Ga0070693_100130788 3300005547 Bacteria 1569
136 Ga0070693_100279700 3300005547 Bacteria 1117
137 Ga0070665_100003303 3300005548 Bacteria 17280
138 Ga0070665_100009341 3300005548 Bacteria 9926
139 Ga0070665_100014326 3300005548 Bacteria 7963
140 Ga0070665_100024057 3300005548 Bacteria 6133
141 Ga0070665_100041275 3300005548 Bacteria 4637
142 Ga0070665_100051461 3300005548 Bacteria 4131
143 Ga0070665_100067747 3300005548 Bacteria 3579
144 Ga0070665_100254610 3300005548 Bacteria 1756
145 Ga0070665_100388767 3300005548 Bacteria 1403
146 Ga0070704_102179687 3300005549 Bacteria 515
147 Ga0068855_100001659 3300005563 Bacteria 27835
148 Ga0070664_100422952 3300005564 Bacteria 1220
149 Ga0070664_100635243 3300005564 Bacteria 992
150 Ga0068857_100353114 3300005577 Bacteria 1362
151 Ga0068857_101005918 3300005577 Bacteria 803
152 Ga0068854_100226154 3300005578 Bacteria 1483
153 Ga0068854_101657754 3300005578 Bacteria 584
154 Ga0068856_100168958 3300005614 Bacteria 2199
155 Ga0068856_101825358 3300005614 Bacteria 619
156 Ga0068856_101832794 3300005614 Bacteria 618
157 Ga0070702_100012685 3300005615 Bacteria 4233
158 Ga0068852_100266957 3300005616 Bacteria 1645
159 Ga0068852_100271259 3300005616 Bacteria 1633
160 Ga0068852_100271861 3300005616 Bacteria 1631
161 Ga0068852_100705092 3300005616 Bacteria 1019
162 Ga0068852_101153412 3300005616 Bacteria 796
163 Ga0068859_100000720 3300005617 Bacteria 33292
164 Ga0068859_100024617 3300005617 Bacteria 6040
165 Ga0068859_100115898 3300005617 Bacteria 2744
166 Ga0068859_100183306 3300005617 Bacteria 2177
167 Ga0068859_100453920 3300005617 Bacteria 1378
168 Ga0068859_100487589 3300005617 Bacteria 1328
169 Ga0068859_101849086 3300005617 Bacteria 667
170 Ga0068864_100005158 3300005618 Bacteria 10702
171 Ga0068864_100126297 3300005618 Bacteria 2293
172 Ga0068864_101306805 3300005618 Bacteria 726
173 Ga0068861_100001212 3300005719 Bacteria 16054
174 Ga0068861_100005227 3300005719 Bacteria 8745
175 Ga0068861_101313426 3300005719 Bacteria 704
176 Ga0068851_10168944 3300005834 Bacteria 1206
177 Ga0068851_11023415 3300005834 Bacteria 522
178 Ga0068870_10306908 3300005840 Bacteria 1004
179 Ga0068863_100014074 3300005841 Bacteria 7708
180 Ga0068863_100022736 3300005841 Bacteria 5989
181 Ga0068863_100038720 3300005841 Bacteria 4536
182 Ga0068863_100175145 3300005841 Bacteria 2058
183 Ga0068863_100426305 3300005841 Bacteria 1300
184 Ga0068863_101109184 3300005841 Bacteria 796
185 Ga0068858_100000571 3300005842 Bacteria 38529
186 Ga0068858_100010826 3300005842 Bacteria 8622
187 Ga0068858_100021381 3300005842 Bacteria 6044
188 Ga0068858_100318992 3300005842 Bacteria 1485
189 Ga0068858_100917597 3300005842 Bacteria 857
190 Ga0068860_100011510 3300005843 Bacteria 8719
191 Ga0068860_100023543 3300005843 Bacteria 5952
192 Ga0068860_100025609 3300005843 Bacteria 5689
193 Ga0068860_100059600 3300005843 Bacteria 3628
194 Ga0068860_100183325 3300005843 Bacteria 2024
195 Ga0068862_100016054 3300005844 Bacteria 6227
196 Ga0068862_100017864 3300005844 Bacteria 5905
197 Ga0068862_100566210 3300005844 Bacteria 1087
198 Ga0068862_100885527 3300005844 Bacteria 877
199 Ga0081455_10262011 3300005937 Bacteria 1258
200 Ga0070717_10906533 3300006028 Bacteria 802
201 Ga0070715_10000391 3300006163 Bacteria 11023
202 Ga0070715_10158913 3300006163 Bacteria 1115
203 Ga0070716_100056019 3300006173 Bacteria 2259
204 Ga0070712_100005045 3300006175 Bacteria 8177
205 Ga0070712_100413922 3300006175 Bacteria 1116
206 Ga0075366_10012267 3300006195 Bacteria 4858
207 Ga0075366_10012973 3300006195 Bacteria 4737
208 Ga0075366_10027612 3300006195 Bacteria 3330
209 Ga0075366_10154126 3300006195 Bacteria 1392
210 Ga0097621_100193735 3300006237 Bacteria 1761
211 Ga0097621_100297145 3300006237 Bacteria 1425
212 Ga0097621_100423065 3300006237 Bacteria 1196
213 Ga0097621_100575047 3300006237 Bacteria 1028
214 Ga0097621_100636364 3300006237 Bacteria 978
215 Ga0097621_100910085 3300006237 Bacteria 820
216 Ga0097621_101083175 3300006237 Bacteria 752
217 Ga0075370_10038229 3300006353 Bacteria 2700
218 Ga0075370_10069945 3300006353 Bacteria 2007
219 Ga0075370_10121983 3300006353 Bacteria 1518
220 Ga0075370_10830392 3300006353 Bacteria 564
221 Ga0068871_100055785 3300006358 Bacteria 3209
222 Ga0068871_100120681 3300006358 Bacteria 2214
223 Ga0068871_100171646 3300006358 Bacteria 1859
224 Ga0068871_100370377 3300006358 Bacteria 1270
225 Ga0068871_100392120 3300006358 Bacteria 1235
226 Ga0068871_100697540 3300006358 Bacteria 930
227 Ga0075430_100181058 3300006846 Bacteria 1753
228 Ga0075434_100875106 3300006871 Bacteria 913
229 Ga0068865_100002113 3300006881 Bacteria 11730
230 Ga0068865_100118042 3300006881 Bacteria 1968
231 Ga0068865_100894950 3300006881 Bacteria 772
232 Ga0075436_100925096 3300006914 Bacteria 653
233 Ga0097620_100000720 3300006931 Bacteria 33292
234 Ga0097620_100024617 3300006931 Bacteria 6040
235 Ga0097620_100115902 3300006931 Bacteria 2744
236 Ga0097620_100183310 3300006931 Bacteria 2177
237 Ga0097620_100453916 3300006931 Bacteria 1378
238 Ga0097620_100487497 3300006931 Bacteria 1328
239 Ga0097620_101848887 3300006931 Bacteria 667
240 Ga0099795_10131997 3300007788 Bacteria 1009
241 Ga0105250_10068890 3300009092 Bacteria 1429
242 Ga0105250_10364386 3300009092 Bacteria 635
243 Ga0105240_10000307 3300009093 Bacteria 94509
244 Ga0105240_10142953 3300009093 Bacteria 2859
245 Ga0105240_10344624 3300009093 Bacteria 1692
246 Ga0105240_10366821 3300009093 Bacteria 1629
247 Ga0105240_10484852 3300009093 Bacteria 1377
248 Ga0105240_10633151 3300009093 Bacteria 1174
249 Ga0105240_10899161 3300009093 Bacteria 953
250 Ga0111539_10871523 3300009094 Bacteria 1047
251 Ga0105245_10143056 3300009098 Bacteria 2254
252 Ga0105245_10782570 3300009098 Bacteria 991
253 Ga0105245_12641994 3300009098 Bacteria 555
254 Ga0105247_10000598 3300009101 Bacteria 29258
255 Ga0105247_10030816 3300009101 Bacteria 3253
256 Ga0105247_10242956 3300009101 Bacteria 1227
257 Ga0105247_10334138 3300009101 Bacteria 1061
258 Ga0105247_10499597 3300009101 Bacteria 886
259 Ga0105247_10743505 3300009101 Bacteria 743
260 Ga0114129_10154179 3300009147 Bacteria 3143
261 Ga0105243_10450504 3300009148 Bacteria 1207
262 Ga0105241_10307786 3300009174 Bacteria 1362
263 Ga0105241_10327860 3300009174 Bacteria 1322
264 Ga0105241_10505448 3300009174 Bacteria 1078
265 Ga0105242_10007597 3300009176 Bacteria 8343
266 Ga0105242_10359564 3300009176 Bacteria 1347
267 Ga0105242_10493350 3300009176 Bacteria 1163
268 Ga0105242_10603919 3300009176 Bacteria 1060
269 Ga0105242_10997189 3300009176 Bacteria 845
270 Ga0105242_12147914 3300009176 Bacteria 603
271 Ga0105248_10021845 3300009177 Bacteria 7091
272 Ga0105248_10024493 3300009177 Bacteria 6710
273 Ga0105248_10321348 3300009177 Bacteria 1743
274 Ga0105248_10354465 3300009177 Bacteria 1652
275 Ga0105248_10528173 3300009177 Bacteria 1331
276 Ga0105248_11578734 3300009177 Bacteria 743
277 Ga0105248_11879272 3300009177 Bacteria 679
278 Ga0105237_10014635 3300009545 Bacteria 8194
279 Ga0105237_10040905 3300009545 Bacteria 4675
280 Ga0105237_10337999 3300009545 Bacteria 1510
281 Ga0105237_10455096 3300009545 Bacteria 1286
282 Ga0105237_10700425 3300009545 Bacteria 1019
283 Ga0105237_10771522 3300009545 Bacteria 968
284 Ga0105237_11551091 3300009545 Bacteria 669
285 Ga0105237_11977938 3300009545 Bacteria 591
286 Ga0105238_10057878 3300009551 Bacteria 3885
287 Ga0105238_10105595 3300009551 Bacteria 2798
288 Ga0105238_10124592 3300009551 Bacteria 2556
289 Ga0105238_10219387 3300009551 Bacteria 1877
290 Ga0105238_10433647 3300009551 Bacteria 1310
291 Ga0105238_10595321 3300009551 Bacteria 1113
292 Ga0105238_10929497 3300009551 Bacteria 889
293 Ga0105238_11424727 3300009551 Bacteria 720
294 Ga0105249_10027325 3300009553 Bacteria 5148
295 Ga0105249_10049167 3300009553 Bacteria 3845
296 Ga0105249_10298268 3300009553 Bacteria 1615
297 Ga0105249_10384180 3300009553 Bacteria 1431
298 Ga0105249_11034928 3300009553 Bacteria 890
299 Ga0105239_10022131 3300010375 Bacteria 7006
300 Ga0105239_10082627 3300010375 Bacteria 3538
301 Ga0105239_10105579 3300010375 Bacteria 3120
302 Ga0105239_10175265 3300010375 Bacteria 2398
303 Ga0105239_10356885 3300010375 Bacteria 1650
304 Ga0105239_10600920 3300010375 Bacteria 1255
305 Ga0105239_10693387 3300010375 Bacteria 1164
306 Ga0105239_13050598 3300010375 Bacteria 546
307 Ga0105246_10243921 3300011119 Bacteria 1422
308 Ga0105246_10321361 3300011119 Bacteria 1258
309 Ga0105246_11827585 3300011119 Bacteria 581
310 Ga0157371_10255227 3300013102 Bacteria 1263
311 Ga0157371_10622041 3300013102 Bacteria 804
312 Ga0157370_10394812 3300013104 Bacteria 1274
313 Ga0157369_10087176 3300013105 Bacteria 3333
314 Ga0157369_10214522 3300013105 Bacteria 2016
315 Ga0157369_10273611 3300013105 Bacteria 1759
316 Ga0157374_10113179 3300013296 Bacteria 2612
317 Ga0157374_10304949 3300013296 Bacteria 1576
318 Ga0157374_10609740 3300013296 Bacteria 1102
319 Ga0157378_10048478 3300013297 Bacteria 3777
320 Ga0157378_10081832 3300013297 Bacteria 2919
321 Ga0163162_10003955 3300013306 Bacteria 14218
322 Ga0163162_10056246 3300013306 Bacteria 3963
323 Ga0163162_10112569 3300013306 Bacteria 2820
324 Ga0163162_10132036 3300013306 Bacteria 2606
325 Ga0163162_10332871 3300013306 Bacteria 1651
326 Ga0157372_10271748 3300013307 Bacteria 1970
327 Ga0157372_10327020 3300013307 Bacteria 1785
328 Ga0157372_10865813 3300013307 Bacteria 1049
329 Ga0157375_10037280 3300013308 Bacteria 4657
330 Ga0157375_10173605 3300013308 Bacteria 2304
331 Ga0157375_10349473 3300013308 Bacteria 1644
332 Ga0157375_10569719 3300013308 Bacteria 1293
333 Ga0157375_12593836 3300013308 Bacteria 606
334 Ga0157375_13436579 3300013308 Bacteria 527
335 Ga0163163_10019243 3300014325 Bacteria 6409
336 Ga0163163_10106838 3300014325 Bacteria 2825
337 Ga0163163_10445989 3300014325 Bacteria 1354
338 Ga0163163_10804605 3300014325 Bacteria 1003
339 Ga0163163_10915144 3300014325 Bacteria 940
340 Ga0163163_11325315 3300014325 Bacteria 782
341 Ga0163163_11707717 3300014325 Bacteria 690
342 Ga0157380_10942454 3300014326 Bacteria 893
343 Ga0157380_11224667 3300014326 Bacteria 795
344 Ga0157380_11227449 3300014326 Bacteria 794
345 Ga0157377_10448263 3300014745 Bacteria 890
346 Ga0157379_10029723 3300014968 Bacteria 4859
347 Ga0157379_10040550 3300014968 Bacteria 4156
348 Ga0157379_10091983 3300014968 Bacteria 2721
349 Ga0157379_10145753 3300014968 Bacteria 2135
350 Ga0157376_10146723 3300014969 Bacteria 2123
351 Ga0157376_10191770 3300014969 Bacteria 1874
352 Ga0157376_10224046 3300014969 Bacteria 1743
353 Ga0163161_10027982 3300017792 Bacteria 4000
354 Ga0163161_10216042 3300017792 Bacteria 1483
355 Ga0197907_11091587 3300020069 Bacteria 2415
356 Ga0206356_10729450 3300020070 Bacteria 1940
357 Ga0206349_1492484 3300020075 Bacteria 881
358 Ga0206355_1673172 3300020076 Bacteria 1568
359 Ga0206355_1694621 3300020076 Bacteria 1275
360 Ga0206352_10323100 3300020078 Bacteria 573
361 Ga0206352_10477912 3300020078 Bacteria 574
362 Ga0206352_11342142 3300020078 Bacteria 1237
363 Ga0206350_10166307 3300020080 Bacteria 1515
364 Ga0206353_10940199 3300020082 Bacteria 804
365 Ga0213872_10017280 3300021361 Bacteria 3336
366 Ga0213876_10080580 3300021384 Bacteria 1721
367 Ga0213871_10043169 3300021441 Bacteria 1216
368 Ga0224712_10000712 3300022467 Bacteria 6882
369 Ga0224712_10082901 3300022467 Bacteria 1327
370 Ga0224712_10294634 3300022467 Bacteria 758
371 Ga0209674_100088 3300025226 Bacteria 181554
372 Ga0209672_106557 3300025228 Bacteria 1879
373 Ga0209563_100179 3300025230 Bacteria 41234
374 Ga0209258_100362 3300025242 Bacteria 61104
375 Ga0209677_100962 3300025253 Bacteria 14011
376 Ga0209148_1012256 3300025254 Bacteria 1573
377 Ga0209759_1001320 3300025256 Bacteria 14578
378 Ga0209759_1001825 3300025256 Bacteria 10688
379 Ga0209759_1039357 3300025256 Bacteria 831
380 Ga0209455_1000553 3300025272 Bacteria 25308
381 Ga0209051_1004288 3300025303 Bacteria 8869
382 Ga0207656_10690966 3300025321 Bacteria 522
383 Ga0207692_10053272 3300025898 Bacteria 2060
384 Ga0207692_10774734 3300025898 Bacteria 626
385 Ga0207642_10299782 3300025899 Bacteria 931
386 Ga0207710_10000550 3300025900 Bacteria 22540
387 Ga0207710_10165809 3300025900 Bacteria 1078
388 Ga0207710_10314593 3300025900 Bacteria 793
389 Ga0207688_10202853 3300025901 Bacteria 1189
390 Ga0207680_10089786 3300025903 Bacteria 1951
391 Ga0207680_11316918 3300025903 Bacteria 513
392 Ga0207647_10039674 3300025904 Bacteria 2969
393 Ga0207685_10013616 3300025905 Bacteria 2521
394 Ga0207699_10133716 3300025906 Bacteria 1621
395 Ga0207699_10305964 3300025906 Bacteria 1111
396 Ga0207645_10082538 3300025907 Bacteria 2060
397 Ga0207645_10241709 3300025907 Bacteria 1193
398 Ga0207643_10092863 3300025908 Bacteria 1761
399 Ga0207643_10505438 3300025908 Bacteria 773
400 Ga0207654_10315472 3300025911 Bacteria 1067
401 Ga0207654_10485410 3300025911 Bacteria 871
402 Ga0207707_10018928 3300025912 Bacteria 6003
403 Ga0207707_10020224 3300025912 Bacteria 5812
404 Ga0207707_10021766 3300025912 Bacteria 5603
405 Ga0207707_10059982 3300025912 Bacteria 3310
406 Ga0207707_10109633 3300025912 Bacteria 2413
407 Ga0207707_10433640 3300025912 Bacteria 1125
408 Ga0207695_10006233 3300025913 Bacteria 15534
409 Ga0207695_10041002 3300025913 Bacteria 4957
410 Ga0207695_10056184 3300025913 Bacteria 4097
411 Ga0207695_10124052 3300025913 Bacteria 2547
412 Ga0207695_10163544 3300025913 Bacteria 2155
413 Ga0207695_10731297 3300025913 Bacteria 870
414 Ga0207671_10026753 3300025914 Bacteria 4318
415 Ga0207671_10039761 3300025914 Bacteria 3483
416 Ga0207671_10299365 3300025914 Bacteria 1270
417 Ga0207671_10317257 3300025914 Bacteria 1233
418 Ga0207671_10517160 3300025914 Bacteria 952
419 Ga0207671_10751317 3300025914 Bacteria 775
420 Ga0207693_10000300 3300025915 Bacteria 46109
421 Ga0207693_10015521 3300025915 Bacteria 6111
422 Ga0207663_10281347 3300025916 Bacteria 1236
423 Ga0207660_10058087 3300025917 Bacteria 2773
424 Ga0207657_10026920 3300025919 Bacteria 5273
425 Ga0207649_10894004 3300025920 Bacteria 696
426 Ga0207652_10025490 3300025921 Bacteria 4918
427 Ga0207652_10116449 3300025921 Bacteria 2374
428 Ga0207652_10251207 3300025921 Bacteria 1595
429 Ga0207681_10044059 3300025923 Bacteria 2989
430 Ga0207694_10164152 3300025924 Bacteria 1795
431 Ga0207694_10182501 3300025924 Bacteria 1702
432 Ga0207694_10192873 3300025924 Bacteria 1656
433 Ga0207694_10259426 3300025924 Bacteria 1423
434 Ga0207694_10415621 3300025924 Bacteria 1120
435 Ga0207694_10452521 3300025924 Bacteria 1072
436 Ga0207694_10789444 3300025924 Bacteria 802
437 Ga0207694_11817875 3300025924 Bacteria 512
438 Ga0207650_10213836 3300025925 Bacteria 1549
439 Ga0207687_10225772 3300025927 Bacteria 1477
440 Ga0207687_11560415 3300025927 Bacteria 567
441 Ga0207700_10060089 3300025928 Bacteria 2877
442 Ga0207700_10066821 3300025928 Bacteria 2749
443 Ga0207700_10112344 3300025928 Bacteria 2195
444 Ga0207700_10170868 3300025928 Bacteria 1813
445 Ga0207664_10017611 3300025929 Bacteria 5242
446 Ga0207664_10054088 3300025929 Bacteria 3181
447 Ga0207664_10365816 3300025929 Bacteria 1278
448 Ga0207644_10001716 3300025931 Bacteria 14158
449 Ga0207644_10070418 3300025931 Bacteria 2556
450 Ga0207644_10076490 3300025931 Bacteria 2463
451 Ga0207690_10089348 3300025932 Bacteria 2172
452 Ga0207706_10659351 3300025933 Bacteria 896
453 Ga0207706_10953457 3300025933 Bacteria 723
454 Ga0207686_10018392 3300025934 Bacteria 3957
455 Ga0207686_10098660 3300025934 Bacteria 1946
456 Ga0207686_10628533 3300025934 Bacteria 848
457 Ga0207670_10013314 3300025936 Bacteria 4845
458 Ga0207670_10767906 3300025936 Bacteria 801
459 Ga0207670_11155172 3300025936 Bacteria 655
460 Ga0207704_10045766 3300025938 Bacteria 2602
461 Ga0207704_10121017 3300025938 Bacteria 1791
462 Ga0207704_10766144 3300025938 Bacteria 804
463 Ga0207665_10004706 3300025939 Bacteria 9066
464 Ga0207691_10007437 3300025940 Bacteria 10546
465 Ga0207691_10020550 3300025940 Bacteria 6243
466 Ga0207711_10059379 3300025941 Bacteria 3293
467 Ga0207711_10249343 3300025941 Bacteria 1630
468 Ga0207711_11500546 3300025941 Bacteria 617
469 Ga0207711_11576796 3300025941 Bacteria 600
470 Ga0207689_10052704 3300025942 Bacteria 3352
471 Ga0207689_10164269 3300025942 Bacteria 1829
472 Ga0207689_10200563 3300025942 Bacteria 1647
473 Ga0207689_10321214 3300025942 Bacteria 1285
474 Ga0207661_10040742 3300025944 Bacteria 3653
475 Ga0207661_10153192 3300025944 Bacteria 1994
476 Ga0207661_10614628 3300025944 Bacteria 998
477 Ga0207679_10111763 3300025945 Bacteria 2158
478 Ga0207679_10973797 3300025945 Bacteria 777
479 Ga0207679_11352269 3300025945 Bacteria 654
480 Ga0207679_11992207 3300025945 Bacteria 529
481 Ga0207667_10012751 3300025949 Bacteria 9652
482 Ga0207667_10609485 3300025949 Bacteria 1100
483 Ga0207651_10001498 3300025960 Bacteria 10636
484 Ga0207651_10545618 3300025960 Bacteria 1007
485 Ga0207651_10579901 3300025960 Bacteria 978
486 Ga0207651_11609941 3300025960 Bacteria 585
487 Ga0207712_10055160 3300025961 Bacteria 2794
488 Ga0207712_10410875 3300025961 Bacteria 1140
489 Ga0207712_10946203 3300025961 Bacteria 763
490 Ga0207640_10136646 3300025981 Bacteria 1781
491 Ga0207658_10011588 3300025986 Bacteria 6001
492 Ga0207658_10123535 3300025986 Bacteria 2068
493 Ga0207658_10264046 3300025986 Bacteria 1468
494 Ga0207658_10366423 3300025986 Bacteria 1258
495 Ga0207658_10426781 3300025986 Bacteria 1170
496 Ga0207677_10014815 3300026023 Bacteria 4566
497 Ga0207677_11492553 3300026023 Bacteria 624
498 Ga0207703_10001111 3300026035 Bacteria 25457
499 Ga0207703_10001808 3300026035 Bacteria 19065
500 Ga0207703_10207128 3300026035 Bacteria 1746
501 Ga0207703_10287826 3300026035 Bacteria 1494
502 Ga0207639_10593569 3300026041 Bacteria 1021
503 Ga0207678_10026496 3300026067 Bacteria 5056
504 Ga0207678_10251350 3300026067 Bacteria 1514
505 Ga0207678_10255422 3300026067 Bacteria 1501
506 Ga0207678_10807394 3300026067 Bacteria 828
507 Ga0207678_10852052 3300026067 Bacteria 805
508 Ga0207708_10048236 3300026075 Bacteria 3242
509 Ga0207708_10244926 3300026075 Bacteria 1443
510 Ga0207708_10391058 3300026075 Bacteria 1148
511 Ga0207708_10645967 3300026075 Bacteria 900
512 Ga0207702_10030266 3300026078 Bacteria 4511
513 Ga0207702_10096816 3300026078 Bacteria 2596
514 Ga0207702_10761052 3300026078 Bacteria 956
515 Ga0207702_11657067 3300026078 Bacteria 633
516 Ga0207641_10000083 3300026088 Bacteria 134703
517 Ga0207641_10025326 3300026088 Bacteria 4892
518 Ga0207641_10032612 3300026088 Bacteria 4325
519 Ga0207641_10077516 3300026088 Bacteria 2876
520 Ga0207641_10231767 3300026088 Bacteria 1716
521 Ga0207641_10250977 3300026088 Bacteria 1652
522 Ga0207641_10470313 3300026088 Bacteria 1217
523 Ga0207641_11059118 3300026088 Bacteria 809
524 Ga0207648_10028725 3300026089 Bacteria 4930
525 Ga0207648_10039876 3300026089 Bacteria 4128
526 Ga0207648_10107917 3300026089 Bacteria 2443
527 Ga0207648_10178899 3300026089 Bacteria 1877
528 Ga0207648_11648079 3300026089 Bacteria 603
529 Ga0207676_10017296 3300026095 Bacteria 5227
530 Ga0207676_10410941 3300026095 Bacteria 1267
531 Ga0207676_10504006 3300026095 Bacteria 1150
532 Ga0207676_11189795 3300026095 Bacteria 755
533 Ga0207674_10156923 3300026116 Bacteria 2231
534 Ga0207674_10678888 3300026116 Bacteria 994
535 Ga0207675_100016698 3300026118 Bacteria 6855
536 Ga0207675_100410569 3300026118 Bacteria 1336
537 Ga0207683_10236500 3300026121 Bacteria 1666
538 Ga0207683_10480604 3300026121 Bacteria 1146
539 Ga0207698_10100442 3300026142 Bacteria 2396
540 Ga0207698_10332850 3300026142 Bacteria 1427
541 Ga0207698_10946753 3300026142 Bacteria 870
542 Ga0209974_10049342 3300027876 Bacteria 1412
543 Ga0268266_10001464 3300028379 Bacteria 28083
544 Ga0268266_10002690 3300028379 Bacteria 18652
545 Ga0268266_10009272 3300028379 Bacteria 8682
546 Ga0268266_10022172 3300028379 Bacteria 5412
547 Ga0268266_10052164 3300028379 Bacteria 3512
548 Ga0268266_10062455 3300028379 Bacteria 3215
549 Ga0268266_10123429 3300028379 Bacteria 2307
550 Ga0268265_10004217 3300028380 Bacteria 10043
551 Ga0268265_10013010 3300028380 Bacteria 5650
552 Ga0268265_10045559 3300028380 Bacteria 3273
553 Ga0268265_10074313 3300028380 Bacteria 2658
554 Ga0268265_11768260 3300028380 Bacteria 624
555 Ga0268264_10000179 3300028381 Bacteria 134401
556 Ga0268264_10011064 3300028381 Bacteria 7452
557 Ga0268264_10012783 3300028381 Bacteria 6909
558 Ga0268264_10032760 3300028381 Bacteria 4264
559 Ga0268264_10111722 3300028381 Bacteria 2394
560 Ga0268264_10116657 3300028381 Bacteria 2347
561 Ga0268264_10346545 3300028381 Bacteria 1412
562 Ga0268264_10349707 3300028381 Bacteria 1406
563 Ga0268264_10445284 3300028381 Bacteria 1254
564 Ga0265319_1010575 3300028563 Bacteria 3842
565 Ga0265334_10000242 3300028573 Bacteria 31502
566 Ga0265334_10012101 3300028573 Bacteria 3627
567 Ga0265318_10000024 3300028577 Bacteria 159801
568 Ga0307515_10002191 3300028794 Bacteria 42879
569 Ga0307515_10072294 3300028794 Bacteria 4658
570 Ga0307515_10122972 3300028794 Bacteria 2922
571 Ga0265338_10009779 3300028800 Bacteria 11378
572 Ga0265338_10014084 3300028800 Bacteria 8951
573 Ga0265324_10000908 3300029957 Bacteria 18733
574 Ga0307511_10001031 3300030521 Bacteria 29591
575 Ga0307511_10345474 3300030521 Bacteria 643
576 Ga0265766_1002598 3300030863 Bacteria 1010
577 Ga0265779_113045 3300031043 Bacteria 530
578 Ga0265330_10007609 3300031235 Bacteria 5267
579 Ga0265332_10013565 3300031238 Bacteria 3610
580 Ga0265328_10009932 3300031239 Bacteria 3850
581 Ga0265320_10003463 3300031240 Bacteria 10582
582 Ga0265325_10003241 3300031241 Bacteria 10706
583 Ga0265329_10000807 3300031242 Bacteria 15917
584 Ga0265340_10059069 3300031247 Bacteria 1840
585 Ga0265340_10143422 3300031247 Bacteria 1092
586 Ga0265340_10166944 3300031247 Bacteria 998
587 Ga0265339_10153772 3300031249 Bacteria 1161
588 Ga0265331_10002138 3300031250 Bacteria 13584
589 Ga0265331_10042357 3300031250 Bacteria 2208
590 Ga0265316_10004634 3300031344 Bacteria 13630
591 Ga0307513_10166143 3300031456 Bacteria 2091
592 Ga0307513_10263412 3300031456 Bacteria 1512
593 Ga0307509_10000001 3300031507 Bacteria 629324
594 Ga0307408_100131702 3300031548 Bacteria 1952
595 Ga0265313_10008827 3300031595 Bacteria 6639
596 Ga0307508_10156586 3300031616 Bacteria 1882
597 Ga0307508_10529487 3300031616 Bacteria 775
598 Ga0307508_10534067 3300031616 Bacteria 770
599 Ga0307514_10000854 3300031649 Bacteria 48916
600 Ga0265314_10002873 3300031711 Bacteria 17111
601 Ga0265342_10009386 3300031712 Bacteria 6903
602 Ga0316576_10004217 3300031727 Bacteria 8584
603 Ga0316578_10185360 3300031728 Bacteria 1254
604 Ga0307516_10000432 3300031730 Bacteria 55006
605 Ga0307516_10006666 3300031730 Bacteria 13499
606 Ga0307516_10106242 3300031730 Bacteria 2618
607 Ga0307405_10077160 3300031731 Bacteria 2164
608 Ga0307413_10007993 3300031824 Bacteria 4958
609 Ga0307410_10009459 3300031852 Bacteria 5464
610 Ga0307406_10142861 3300031901 Bacteria 1697
611 Ga0307406_11517084 3300031901 Unclassified 590
612 Ga0307412_10193587 3300031911 Bacteria 1539
613 Ga0307409_100000260 3300031995 Bacteria 21387
614 Ga0307416_103097790 3300032002 Bacteria 556
615 Ga0307411_10003073 3300032005 Bacteria 7629
616 Ga0307415_100093549 3300032126 Bacteria 2183
617 Ga0307507_10415666 3300033179 Bacteria 758
618 Ga0307510_10000013 3300033180 Bacteria 274569
619 Ga0307510_10014579 3300033180 Bacteria 9303
620 Ga0373926_0319639 3300035083 Bacteria 607
621 Ga0373923_0033379 3300035111 Bacteria 2084
622 Ga0373932_0099214 3300035112 Bacteria 945
623 Ga0373936_0016925 3300035113 Bacteria 2803
624 Ga0373936_0022834 3300035113 Bacteria 2436
625 Ga0373945_0507169 3300035116 Bacteria 538
626 Ga0373953_0131906 3300035117 Bacteria 1066
627 Ga0373954_0076448 3300035118 Bacteria 1596
628 Ga0373956_0488854 3300035119 Bacteria 587
629 Ga0373957_0113276 3300035120 Bacteria 1094
630 Ga0373957_0392802 3300035120 Bacteria 596
631 Ga0373957_0434159 3300035120 Bacteria 567
632 Ga0373943_0113979 3300035170 Bacteria 1429
633 Ga0316574_0010096 3300035398 Bacteria 5317
634 Ga0373924_0318170 3300035410 Bacteria 692
635 Ga0373931_0108038 3300035691 Bacteria 1574
636 Ga0373935_0162570 3300035692 Bacteria 1523
637 Ga0373935_1368904 3300035692 Bacteria 529
638 Ga0373927_0035795 3300035695 Bacteria 3229
639 Ga0373933_0085840 3300035724 Bacteria 1936
640 Ga0373933_0351696 3300035724 Bacteria 957
641 Ga0373947_0160362 3300035725 Bacteria 1454
642 Ga0373947_0396828 3300035725 Bacteria 930
643 Ga0373937_0028436 3300036401 Bacteria 5059
644 Ga0373937_0085763 3300036401 Bacteria 2914
645 Ga0373937_0346194 3300036401 Bacteria 1407
646 Ga0316584_0052700 3300036712 Bacteria 3043
647 Ga0373925_0006858 3300037068 Bacteria 8339
648 Ga0373925_0703550 3300037068 Bacteria 833
649 Ga0395900_0000025 3300037418 Bacteria 321217
650 Ga0395898_0001112 3300037466 Bacteria 41418
651 Ga0395905_0031321 3300037471 Bacteria 5007
652 Ga0395905_0036617 3300037471 Bacteria 4608
653 Ga0395905_0401396 3300037471 Bacteria 1266
654 Ga0395905_0476590 3300037471 Bacteria 1147
655 Ga0395905_0678399 3300037471 Bacteria 933
656 Ga0395905_0865324 3300037471 Bacteria 807
657 Ga0436364_0288620 3300037853 Bacteria 891
658 Ga0436365_0935043 3300039437 Bacteria 1199
659 Ga0436365_1116878 3300039437 Bacteria 10568
660 Ga0436365_1123795 3300039437 Bacteria 3453
661 Ga0436365_1273617 3300039437 Bacteria 1607
662 Ga0436365_1369117 3300039437 Bacteria 561
663 Ga0436365_1915437 3300039437 Bacteria 713
664 Ga0436360_0109344 3300039438 Bacteria 853
665 Ga0436360_0577739 3300039438 Bacteria 519
666 Ga0436360_0770911 3300039438 Bacteria 659
667 Ga0436360_0789934 3300039438 Bacteria 1591
668 Ga0436360_1376956 3300039438 Bacteria 8587
669 Ga0436361_0559178 3300039447 Bacteria 1320
670 Ga0436361_0597012 3300039447 Bacteria 2510
671 Ga0436361_0814403 3300039447 Bacteria 2875
672 Ga0436361_0866882 3300039447 Bacteria 7359
673 Ga0436363_0322376 3300039450 Bacteria 2942
674 Ga0436363_0569581 3300039450 Bacteria 2211
675 Ga0436363_0578683 3300039450 Bacteria 556
676 Ga0436363_1295560 3300039450 Bacteria 2987
677 Ga0436362_0136394 3300039453 Bacteria 591
678 Ga0436362_0350607 3300039453 Bacteria 2153
679 Ga0439436_0052150 3300041404 Bacteria 1154
680 Ga0439439_0070597 3300041406 Bacteria 935
681 Ga0439453_0049055 3300041408 Bacteria 849
682 Ga0451798_0124787 3300041458 Bacteria 654
683 Ga0451798_1134510 3300041458 Bacteria 635
684 Ga0451800_0213464 3300041459 Bacteria 645
685 Ga0451805_062905 3300041461 Bacteria 506
686 Ga0439431_0011676 3300041997 Bacteria 2009
687 Ga0439433_0033793 3300041999 Bacteria 1176
688 Ga0439448_0041103 3300042005 Bacteria 1495
689 Ga0439448_0135914 3300042005 Bacteria 849
690 Ga0439449_0030723 3300042007 Bacteria 2002
691 Ga0439449_0042891 3300042007 Bacteria 1680
692 Ga0439457_034565 3300042014 Bacteria 1123
693 Ga0439462_0013130 3300042015 Bacteria 2122
694 Ga0450899_002960 3300042135 Bacteria 1831
695 Ga0439446_0059901 3300042156 Bacteria 1149
696 Ga0439464_0029358 3300042439 Bacteria 1536
697 Ga0450893_0033394 3300042532 Bacteria 924
698 Ga0450893_0056336 3300042532 Bacteria 744
699 Ga0451577_0001132 3300042876 Bacteria 37818
700 Ga0466969_0000075 3300044656 Bacteria 52007
701 Ga0466969_0003117 3300044656 Bacteria 8835
702 Ga0466969_0010879 3300044656 Bacteria 4820
703 Ga0466969_0013190 3300044656 Bacteria 4353
704 Ga0466969_0013216 3300044656 Bacteria 4348
705 Ga0466969_0015530 3300044656 Bacteria 3991
706 Ga0466969_0069294 3300044656 Bacteria 1699
707 Ga0466972_0004215 3300044658 Bacteria 7184
708 Ga0466972_0008052 3300044658 Bacteria 5283
709 Ga0466972_0016103 3300044658 Bacteria 3738
710 Ga0466972_0023590 3300044658 Bacteria 3058
711 Ga0466965_0020677 3300044683 Bacteria 3166
712 Ga0466965_0028559 3300044683 Bacteria 2710
713 Ga0466965_0075348 3300044683 Bacteria 1701
714 Ga0466965_0114003 3300044683 Bacteria 1391
715 Ga0466965_0449530 3300044683 Bacteria 717
716 Ga0466966_0004792 3300044684 Bacteria 8895
717 Ga0466966_0011299 3300044684 Bacteria 5923
718 Ga0466966_0023991 3300044684 Bacteria 3992
719 Ga0466966_0047046 3300044684 Bacteria 2752
720 Ga0466966_0057852 3300044684 Bacteria 2451
721 Ga0466966_0440297 3300044684 Bacteria 783
722 Ga0466961_0002234 3300044693 Bacteria 12061
723 Ga0466961_0010322 3300044693 Bacteria 5953
724 Ga0466961_0010421 3300044693 Bacteria 5931
725 Ga0466961_0011978 3300044693 Bacteria 5542
726 Ga0466961_0079707 3300044693 Bacteria 2073
727 Ga0466963_0035056 3300044694 Bacteria 3267
728 Ga0466964_0001005 3300044706 Bacteria 9360
729 Ga0466964_0002737 3300044706 Bacteria 6329
730 Ga0466964_0024262 3300044706 Bacteria 2362
731 Ga0466971_0001125 3300044719 Bacteria 11124
732 Ga0466971_0003912 3300044719 Bacteria 6388
733 Ga0466971_0077730 3300044719 Bacteria 1511
734 Ga0466971_0105875 3300044719 Bacteria 1295
735 Ga0466968_0011359 3300044735 Bacteria 3467
736 Ga0466968_0261351 3300044735 Bacteria 824
737 Ga0466970_0004235 3300044765 Bacteria 7058
738 Ga0466970_0008413 3300044765 Bacteria 5191
739 Ga0466970_0012923 3300044765 Bacteria 4276
740 Ga0466970_0183317 3300044765 Bacteria 1162
741 Ga0466970_0466484 3300044765 Bacteria 725
742 Ga0466957_0016451 3300044842 Bacteria 4327
743 Ga0466957_0023740 3300044842 Bacteria 3627
744 Ga0466960_0046107 3300044901 Bacteria 2085
745 Ga0466960_0623140 3300044901 Bacteria 642
746 Ga0466959_0000818 3300045049 Bacteria 18349
747 Ga0466959_0006637 3300045049 Bacteria 8038
748 Ga0466959_0009577 3300045049 Bacteria 6891
749 Ga0466959_0013546 3300045049 Bacteria 5911
750 Ga0466959_0015487 3300045049 Bacteria 5556
751 Ga0466959_0016434 3300045049 Bacteria 5407
752 Ga0466959_0041660 3300045049 Bacteria 3390
753 Ga0466959_0081007 3300045049 Bacteria 2339
754 Ga0451576_0317058 3300045051 Bacteria 1631
755 Ga0451576_0930878 3300045051 Bacteria 911
756 Ga0466958_0016466 3300045836 Bacteria 4257
757 Ga0466958_0225294 3300045836 Bacteria 1196
758 Ga0466967_0054356 3300045976 Bacteria 3523
759 Ga0466967_0208802 3300045976 Bacteria 1851
760 Ga0495651_0368445 3300046462 Bacteria 945
761 Ga0495650_0032218 3300046471 Bacteria 2347
762 Ga0495580_0009981 3300046472 Bacteria 7425
763 Ga0495580_0170414 3300046472 Bacteria 1505
764 Ga0495585_0010185 3300046492 Bacteria 5613
765 Ga0495618_0213235 3300046514 Bacteria 1220
766 Ga0495628_0344157 3300046516 Bacteria 1097
767 Ga0495630_0035720 3300046517 Bacteria 3714
768 Ga0495630_1264767 3300046517 Bacteria 557
769 Ga0495648_0154202 3300046524 Bacteria 1195
770 Ga0495652_0327323 3300046529 Bacteria 1105
771 Ga0495640_0783704 3300046533 Bacteria 569
772 Ga0495586_0061129 3300046535 Bacteria 2050
773 Ga0495609_0155499 3300046538 Bacteria 971
774 Ga0495645_0300550 3300046543 Bacteria 1049
775 Ga0495645_0541353 3300046543 Bacteria 723
776 Ga0495622_0443269 3300046557 Bacteria 557
777 Ga0495668_0222231 3300046616 Bacteria 1034
778 Ga0495625_0057959 3300046660 Bacteria 2753
779 Ga0495625_0613197 3300046660 Bacteria 652
780 Ga0495657_0141200 3300046675 Bacteria 1501
781 Ga0495623_0466901 3300046679 Bacteria 670
782 Ga0495649_0051908 3300046694 Bacteria 2223
783 Ga0495680_0820564 3300047322 Bacteria 606
784 Ga0495686_0019152 3300047472 Bacteria 4577
785 Ga0495686_0238478 3300047472 Bacteria 1026
786 Ga0496100_0060202 3300048903 Bacteria 2498
787 Ga0496100_1046364 3300048903 Bacteria 643
788 Ga0496101_0098798 3300048904 Bacteria 2181
789 Ga0496101_0545467 3300048904 Bacteria 917
790 Ga0496101_0906946 3300048904 Bacteria 694
791 Ga0496102_0173096 3300048905 Bacteria 2032
792 Ga0496102_0234846 3300048905 Bacteria 1729
793 Ga0496103_0019355 3300048906 Bacteria 4088
794 Ga0496104_0035306 3300048907 Bacteria 4668
795 Ga0496104_0323321 3300048907 Bacteria 1456
796 Ga0496105_0021395 3300048908 Bacteria 5234
797 Ga0496105_0396128 3300048908 Bacteria 1097
798 Ga0496106_0074733 3300048909 Bacteria 2595
799 Ga0496106_0725878 3300048909 Bacteria 791
800 Ga0496107_0020106 3300048910 Bacteria 4715
801 Ga0496107_0331757 3300048910 Bacteria 1132
802 Ga0496108_0235435 3300048911 Bacteria 1593
803 Ga0496109_0004674 3300048912 Bacteria 11426
804 Ga0496109_0197828 3300048912 Bacteria 1890
805 Ga0496109_0285789 3300048912 Bacteria 1555
806 Ga0496110_0110070 3300048913 Bacteria 2474
807 Ga0496111_0032699 3300048914 Bacteria 3709
808 Ga0496112_0353221 3300048915 Bacteria 1412
809 Ga0496113_0157001 3300048916 Bacteria 1797
810 Ga0496113_0257914 3300048916 Bacteria 1393
811 Ga0496114_0000976 3300048917 Bacteria 21433
812 Ga0496114_0561427 3300048917 Bacteria 1008
813 Ga0496115_0003458 3300048918 Bacteria 11345
814 Ga0496115_0141118 3300048918 Bacteria 1988
815 Ga0496115_0426451 3300048918 Bacteria 1074
816 Ga0496115_1265421 3300048918 Bacteria 551
817 Ga0496116_0025905 3300048919 Bacteria 4301
818 Ga0496117_0000057 3300048920 Bacteria 268246
819 Ga0496118_0000028 3300048921 Bacteria 366490
820 Ga0496119_0021299 3300048922 Bacteria 4690
821 Ga0496119_0024683 3300048922 Bacteria 4221
822 Ga0496119_0405115 3300048922 Bacteria 650
823 Ga0496120_0021404 3300048923 Bacteria 4088
824 Ga0496120_0209716 3300048923 Bacteria 937
825 Ga0496121_0001748 3300048924 Bacteria 35482
826 Ga0496121_0034849 3300048924 Bacteria 4521
827 Ga0496121_0350704 3300048924 Bacteria 983
828 Ga0496124_0018704 3300048927 Bacteria 6480
829 Ga0496125_0000926 3300048928 Bacteria 46052
830 Ga0496125_0071773 3300048928 Bacteria 2702
831 Ga0496125_0290401 3300048928 Bacteria 1007
832 Ga0496126_0008006 3300048929 Bacteria 11471
833 Ga0496126_0029585 3300048929 Bacteria 5202
834 Ga0496126_0108705 3300048929 Bacteria 2418
835 Ga0496126_0681286 3300048929 Bacteria 801
836 Ga0496126_0817917 3300048929 Bacteria 713
837 Ga0501306_011807 3300049127 Bacteria 1119
838 Ga0501308_000351 3300049128 Bacteria 2895
839 Ga0501308_015256 3300049128 Bacteria 909
840 Ga0501310_021793 3300049130 Bacteria 804
841 Ga0501304_006097 3300049160 Bacteria 964
842 Ga0501303_008953 3300049526 Bacteria 917
843 Ga0501311_065750 3300049527 Bacteria 593
844 Ga0501312_006801 3300049528 Bacteria 1441
845 Ga0501312_109898 3300049528 Bacteria 525
846 Ga0501313_019615 3300049529 Bacteria 828
847 Ga0501314_001973 3300049530 Bacteria 1547
848 Ga0501315_004684 3300049531 Bacteria 1444
849 Ga0501315_025153 3300049531 Bacteria 827
850 Ga0501317_002108 3300049533 Bacteria 1829
851 Ga0501317_077225 3300049533 Bacteria 571
852 Ga0501320_016223 3300049536 Bacteria 822
853 Ga0501321_000564 3300049537 Bacteria 2459
854 Ga0501323_049590 3300049539 Bacteria 634
855 Ga0501325_002818 3300049541 Bacteria 1221
856 Ga0501328_05474 3300049544 Bacteria 640
857 Ga0501329_08434 3300049545 Bacteria 618
858 Ga0501340_001985 3300049556 Bacteria 1153
859 Ga0501340_013318 3300049556 Bacteria 632
860 Ga0501036_0624912 3300049572 Bacteria 893
861 Ga0501048_0238036 3300049582 Bacteria 1292
862 Ga0501073_0604542 3300049589 Bacteria 757
863 Ga0501199_006575 3300049650 Bacteria 1186
864 Ga0501206_089418 3300049653 Bacteria 545
865 Ga0501249_195455 3300049679 Bacteria 529
866 Ga0501256_033520 3300049685 Bacteria 587
867 Ga0501257_041467 3300049686 Bacteria 1131
868 Ga0501079_0241535 3300049741 Bacteria 1411
869 Ga0501079_1238847 3300049741 Bacteria 588
870 nmdc:mga0k408_11566_c1 3300050493 Bacteria 4809
871 nmdc:mga0k408_169358_c1 3300050493 Bacteria 1302
872 nmdc:mga0k408_578236_c1 3300050493 Bacteria 663
873 nmdc:mga0k408_69937_c1 3300050493 Bacteria 2049
874 nmdc:mga0k408_89144_c1 3300050493 Bacteria 1811
875 nmdc:mga07m45_1066_c1 3300050496 Bacteria 12209
876 nmdc:mga07m45_41324_c1 3300050496 Bacteria 2582
877 nmdc:mga05p37_105087_c1 3300050507 Bacteria 3474
878 nmdc:mga05p37_1564738_c1 3300050507 Bacteria 652
879 nmdc:mga0qj67_359680_c1 3300050509 Bacteria 1176
880 nmdc:mga08y16_760236_c1 3300050511 Bacteria 965
881 nmdc:mga0rr50_1214440_c1 3300050513 Bacteria 640
882 nmdc:mga0a205_832390_c1 3300050515 Bacteria 770
883 Ga0495612_0316719 3300053078 Bacteria 701
884 Ga0500635_0000072 3300053080 Bacteria 66335
885 Ga0500643_003570 3300053087 Bacteria 7399
886 Ga0500644_0099591 3300053088 Bacteria 1102
887 Ga0500646_0018273 3300053090 Bacteria 1845
888 Ga0500583_0289367 3300053092 Bacteria 803
889 Ga0500583_0319868 3300053092 Bacteria 756
890 Ga0500651_0111819 3300053093 Bacteria 1666
891 Ga0500641_0067946 3300053096 Bacteria 1495
892 Ga0500650_0209796 3300053098 Bacteria 885
893 Ga0500562_010211 3300053108 Bacteria 2379
894 Ga0500572_016125 3300053111 Bacteria 1897
895 Ga0500594_0009895 3300053118 Bacteria 2203
896 Ga0500595_044003 3300053119 Bacteria 1418
897 Ga0500608_206992 3300053122 Bacteria 805
898 Ga0500652_025758 3300053131 Bacteria 2258
899 Ga0500559_0459809 3300053136 Bacteria 588
900 Ga0500564_169108 3300053138 Bacteria 920
901 Ga0500568_0065017 3300053139 Bacteria 1405
902 Ga0500577_0469173 3300053142 Bacteria 550
903 Ga0500590_265471 3300053148 Bacteria 671
904 Ga0500616_0000016 3300053153 Bacteria 627087
905 Ga0500616_0045257 3300053153 Bacteria 2345
906 Ga0500622_0006035 3300053156 Bacteria 7119
907 Ga0500639_124948 3300053163 Bacteria 1229
908 Ga0500639_341773 3300053163 Bacteria 535
909 Ga0500636_0008914 3300053177 Bacteria 5823
910 Ga0500637_0020797 3300053178 Bacteria 3559
911 Ga0500637_0290957 3300053178 Bacteria 895
912 Ga0500611_012209 3300053727 Bacteria 1443
913 Ga0500596_004056 3300053735 Bacteria 2721
914 Ga0500661_024804 3300055283 Bacteria 1060
915 Ga0587084_000433 3300059477 Bacteria 3252
916 Ga0587084_019002 3300059477 Bacteria 1008
917 Ga0587093_001766 3300059478 Bacteria 1897
918 Ga0587093_029952 3300059478 Bacteria 778
919 Ga0587093_033969 3300059478 Bacteria 747
920 Ga0587066_002318 3300059490 Bacteria 2082
921 Ga0587066_003065 3300059490 Bacteria 1923
922 Ga0587066_007195 3300059490 Bacteria 1499
923 Ga0587066_019086 3300059490 Bacteria 1111
924 Ga0587070_000937 3300059491 Bacteria 2774
925 Ga0587070_066369 3300059491 Bacteria 759
926 Ga0587070_155650 3300059491 Unclassified 577
927 Ga0587073_0045814 3300059492 Bacteria 972
928 Ga0587077_001010 3300059493 Bacteria 2822
929 Ga0587077_003170 3300059493 Bacteria 2041
930 Ga0587077_031732 3300059493 Bacteria 1010
931 Ga0587080_004102 3300059503 Bacteria 1865
932 Ga0587080_031744 3300059503 Bacteria 924
933 Ga0587080_076724 3300059503 Bacteria 678
934 Ga0587082_005534 3300059504 Bacteria 1647
935 Ga0587082_010690 3300059504 Bacteria 1330
936 Ga0587083_0005260 3300059505 Bacteria 1860
937 Ga0587083_0025337 3300059505 Bacteria 1136
938 Ga0587083_0031913 3300059505 Bacteria 1053
939 Ga0587083_0061548 3300059505 Bacteria 847
940 Ga0587083_0113233 3300059505 Bacteria 692
941 Ga0587085_000405 3300059506 Bacteria 3120
942 Ga0587085_003839 3300059506 Bacteria 1667
943 Ga0587085_007270 3300059506 Bacteria 1376
944 Ga0587086_000406 3300059507 Bacteria 3028
945 Ga0587086_007979 3300059507 Bacteria 1226
946 Ga0587088_001524 3300059508 Bacteria 2427
947 Ga0587089_032450 3300059509 Bacteria 776
948 Ga0587090_000400 3300059510 Bacteria 3515
949 Ga0587090_000452 3300059510 Bacteria 3414
950 Ga0587090_002039 3300059510 Bacteria 2162
951 Ga0587091_000944 3300059511 Bacteria 2902
952 Ga0587091_032435 3300059511 Bacteria 988
953 Ga0587091_163997 3300059511 Bacteria 573
954 Ga0587092_002029 3300059512 Bacteria 2105
955 Ga0587092_048439 3300059512 Bacteria 762
956 Ga0587094_000448 3300059513 Bacteria 3172
957 Ga0587094_002938 3300059513 Bacteria 1806
958 Ga0587098_009470 3300059604 Bacteria 1059
959 Ga0587106_056876 3300059605 Bacteria 708
960 Ga0587125_000549 3300059607 Bacteria 2272
961 Ga0587125_006665 3300059607 Bacteria 1100
962 Ga0587131_015709 3300059609 Bacteria 587
963 Ga0587101_001373 3300059623 Bacteria 2082
964 Ga0587101_026345 3300059623 Bacteria 877
965 Ga0587109_005113 3300059624 Bacteria 1863
966 Ga0587109_007367 3300059624 Bacteria 1659
967 Ga0587109_033893 3300059624 Bacteria 983
968 Ga0587109_076138 3300059624 Bacteria 734
969 Ga0587115_000323 3300059626 Bacteria 3313
970 Ga0587115_068987 3300059626 Bacteria 607
971 Ga0587117_000345 3300059627 Bacteria 3024
972 Ga0587128_008475 3300059630 Bacteria 1330
973 Ga0587128_009243 3300059630 Bacteria 1295
974 Ga0587128_029906 3300059630 Bacteria 896
975 Ga0587128_100489 3300059630 Bacteria 606
976 Ga0587130_010086 3300059631 Bacteria 917
977 Ga0587062_000473 3300059639 Bacteria 2847
978 Ga0587062_023336 3300059639 Bacteria 896
979 Ga0587062_070581 3300059639 Bacteria 631
980 Ga0587067_014060 3300059640 Bacteria 1277
981 Ga0587067_056323 3300059640 Bacteria 811
982 Ga0587067_238461 3300059640 Bacteria 500
983 Ga0587068_002378 3300059641 Bacteria 2280
984 Ga0587068_013300 3300059641 Bacteria 1268
985 Ga0587068_015816 3300059641 Bacteria 1191
986 Ga0587069_001653 3300059642 Bacteria 2104
987 Ga0587069_025651 3300059642 Bacteria 918
988 Ga0587069_088819 3300059642 Bacteria 615
989 Ga0587072_005137 3300059643 Bacteria 1941
990 Ga0587072_010373 3300059643 Bacteria 1504
991 Ga0587072_172436 3300059643 Bacteria 535
992 Ga0587075_011981 3300059644 Bacteria 1171
993 Ga0587075_034614 3300059644 Bacteria 820
994 Ga0587076_003254 3300059645 Bacteria 1916
995 Ga0587076_005768 3300059645 Bacteria 1618
996 Ga0587076_027891 3300059645 Bacteria 981
997 Ga0587076_038149 3300059645 Bacteria 886
998 Ga0587079_007398 3300059647 Bacteria 1642
999 Ga0587079_065767 3300059647 Bacteria 797
1000 Ga0587079_088196 3300059647 Bacteria 721
1001 Ga0587079_099905 3300059647 Bacteria 691
1002 Ga0587100_001147 3300059648 Bacteria 1479
1003 Ga0587100_010643 3300059648 Bacteria 779
1004 Ga0587102_022671 3300059649 Bacteria 720
1005 Ga0587102_027836 3300059649 Bacteria 676
1006 Ga0587105_012726 3300059651 Bacteria 663
1007 Ga0587107_023462 3300059652 Bacteria 881
1008 Ga0587107_039413 3300059652 Bacteria 757
1009 Ga0587108_013740 3300059653 Bacteria 714
1010 Ga0587110_002704 3300059654 Bacteria 1427
1011 Ga0587114_010376 3300059655 Bacteria 1138
1012 Ga0587118_12569 3300059657 Bacteria 660
1013 Ga0587119_015585 3300059658 Bacteria 922
1014 Ga0587124_002348 3300059660 Bacteria 1324
1015 Ga0587124_051784 3300059660 Bacteria 502
1016 Ga0587071_009437 3300060344 Bacteria 1604
1017 Ga0587071_032189 3300060344 Bacteria 1015
1018 Ga0587071_049276 3300060344 Bacteria 867
1019 Ga0587071_061538 3300060344 Bacteria 799
1020 Ga0587111_0000905 3300060346 Bacteria 3234
1021 Ga0587111_0008978 3300060346 Bacteria 1673
1022 Ga0501082_1108676 3300060353 Bacteria 692
1023 Ga0501082_1290637 3300060353 Bacteria 638
1024 Ga0466962_0008322 3300061719 Bacteria 4968
1025 Ga0466962_0011878 3300061719 Bacteria 4192
1026 Ga0466962_0031968 3300061719 Bacteria 2519
1027 Ga0466962_0532071 3300061719 Bacteria 596
1028 Ga0070713_100203105
1029 JGI24744J21845_10032899
1030 JGI25156J39149_1025481
1031 Ga0007410J51695_1047609
1032 Ga0032354_1074764
1033 Ga0055533_1000087
1034 Ga0055525_1000799
1035 Ga0055535_1000718
1036 Ga0055529_1000885
1037 Ga0058859_11575955
1038 Ga0058859_11636537
1039 Ga0058863_10034658
1040 Ga0058863_11886887
1041 Ga0058863_11955264
1042 Ga0058861_10033013
1043 Ga0058861_11829992
1044 Ga0058860_10027454
1045 Ga0058860_10098742
1046 Ga0058860_10103368
1047 Ga0058862_10047899
1048 Ga0058862_10112105
1049 Ga0058862_12771566
1050 Ga0065707_10115128
1051 Ga0070658_10092147
1052 Ga0070676_10101937
1053 Ga0070683_100027202
1054 Ga0070683_100246845
1055 Ga0070683_100480167
1056 Ga0070690_100014196
1057 Ga0070690_100017452
1058 Ga0070690_100554674
1059 Ga0070670_100763436
1060 Ga0068869_100041507
1061 Ga0068869_100322123
1062 Ga0068869_100427924
1063 Ga0068869_100650362
1064 Ga0070666_10007154
1065 Ga0070666_10167532
1066 Ga0070666_11304180
1067 Ga0070680_100067162
1068 Ga0070682_100404250
1069 Ga0070682_100481293
1070 Ga0068868_100003950
1071 Ga0068868_100505187
1072 Ga0070660_100045223
1073 Ga0070689_100019912
1074 Ga0070689_100908061
1075 Ga0070689_101130080
1076 Ga0070691_10564235
1077 Ga0070691_10780996
1078 Ga0070661_100186482
1079 Ga0070661_100821862
1080 Ga0070661_101168400
1081 Ga0070692_10159278
1082 Ga0070668_100481474
1083 Ga0070669_100017622
1084 Ga0070669_101377913
1085 Ga0070671_100000631
1086 Ga0070671_100111115
1087 Ga0070671_100838344
1088 Ga0070674_100014580
1089 Ga0070673_100039827
1090 Ga0070673_100137012
1091 Ga0070673_100301816
1092 Ga0070673_100622344
1093 Ga0070688_100108938
1094 Ga0070688_101190119
1095 Ga0070659_100098220
1096 Ga0070659_100290954
1097 Ga0070667_100004025
1098 Ga0070667_100213813
1099 Ga0070667_100657725
1100 Ga0070667_101284441
1101 Ga0070667_101420506
1102 Ga0070667_101553986
1103 Ga0070703_10130968
1104 Ga0070709_10049620
1105 Ga0070709_10335980
1106 Ga0070714_100022733
1107 Ga0070714_100053701
1108 Ga0070713_100040939
1109 Ga0070713_100141698
1110 Ga0070713_100577259
1111 Ga0070713_100764604
1112 Ga0070710_10253618
1113 Ga0070710_10341404
1114 Ga0070701_10011235
1115 Ga0070701_10101907
1116 Ga0070711_100077057
1117 Ga0070705_100867094
1118 Ga0070705_100978758
1119 Ga0070700_100582929
1120 Ga0070694_100005435
1121 Ga0070708_100211817
1122 Ga0070663_100067195
1123 Ga0070663_100674065
1124 Ga0070678_100222132
1125 Ga0070678_100432993
1126 Ga0070678_100499387
1127 Ga0070678_100955836
1128 Ga0070662_100905926
1129 Ga0070681_10001553
1130 Ga0070681_10034442
1131 Ga0070681_10048735
1132 Ga0070681_10083859
1133 Ga0070681_10582584
1134 Ga0068867_100084042
1135 Ga0068867_100127252
1136 Ga0068867_100183613
1137 Ga0068867_100249907
1138 Ga0068867_101196718
1139 Ga0070685_10606144
1140 Ga0070699_100264491
1141 Ga0070679_100013442
1142 Ga0070679_100067891
1143 Ga0070679_100219666
1144 Ga0070684_100207477
1145 Ga0070684_100554556
1146 Ga0070684_100592975
1147 Ga0070684_101451950
1148 Ga0068853_100296853
1149 Ga0068853_100414252
1150 Ga0068853_101256972
1151 Ga0070672_100002728
1152 Ga0070672_100014054
1153 Ga0070672_101101220
1154 Ga0070686_100021404
1155 Ga0070686_100370920
1156 Ga0070686_100453369
1157 Ga0070695_100032624
1158 Ga0070695_100046447
1159 Ga0070695_101597724
1160 Ga0070696_100011332
1161 Ga0070696_100373824
1162 Ga0070693_100130788
1163 Ga0070693_100279700
1164 Ga0070665_100003303
1165 Ga0070665_100009341
1166 Ga0070665_100014326
1167 Ga0070665_100024057
1168 Ga0070665_100041275
1169 Ga0070665_100051461
1170 Ga0070665_100067747
1171 Ga0070665_100254610
1172 Ga0070665_100388767
1173 Ga0070704_102179687
1174 Ga0068855_100001659
1175 Ga0070664_100422952
1176 Ga0070664_100635243
1177 Ga0068857_100353114
1178 Ga0068857_101005918
1179 Ga0068854_100226154
1180 Ga0068854_101657754
1181 Ga0068856_100168958
1182 Ga0068856_101825358
1183 Ga0068856_101832794
1184 Ga0070702_100012685
1185 Ga0068852_100266957
1186 Ga0068852_100271259
1187 Ga0068852_100271861
1188 Ga0068852_100705092
1189 Ga0068852_101153412
1190 Ga0068859_100000720
1191 Ga0068859_100024617
1192 Ga0068859_100115898
1193 Ga0068859_100183306
1194 Ga0068859_100453920
1195 Ga0068859_100487589
1196 Ga0068859_101849086
1197 Ga0068864_100005158
1198 Ga0068864_100126297
1199 Ga0068864_101306805
1200 Ga0068861_100001212
1201 Ga0068861_100005227
1202 Ga0068861_101313426
1203 Ga0068851_10168944
1204 Ga0068851_11023415
1205 Ga0068870_10306908
1206 Ga0068863_100014074
1207 Ga0068863_100022736
1208 Ga0068863_100038720
1209 Ga0068863_100175145
1210 Ga0068863_100426305
1211 Ga0068863_101109184
1212 Ga0068858_100000571
1213 Ga0068858_100010826
1214 Ga0068858_100021381
1215 Ga0068858_100318992
1216 Ga0068858_100917597
1217 Ga0068860_100011510
1218 Ga0068860_100023543
1219 Ga0068860_100025609
1220 Ga0068860_100059600
1221 Ga0068860_100183325
1222 Ga0068862_100016054
1223 Ga0068862_100017864
1224 Ga0068862_100566210
1225 Ga0068862_100885527
1226 Ga0081455_10262011
1227 Ga0070717_10906533
1228 Ga0070715_10000391
1229 Ga0070715_10158913
1230 Ga0070716_100056019
1231 Ga0070712_100005045
1232 Ga0070712_100413922
1233 Ga0075366_10012267
1234 Ga0075366_10012973
1235 Ga0075366_10027612
1236 Ga0075366_10154126
1237 Ga0097621_100193735
1238 Ga0097621_100297145
1239 Ga0097621_100423065
1240 Ga0097621_100575047
1241 Ga0097621_100636364
1242 Ga0097621_100910085
1243 Ga0097621_101083175
1244 Ga0075370_10038229
1245 Ga0075370_10069945
1246 Ga0075370_10121983
1247 Ga0075370_10830392
1248 Ga0068871_100055785
1249 Ga0068871_100120681
1250 Ga0068871_100171646
1251 Ga0068871_100370377
1252 Ga0068871_100392120
1253 Ga0068871_100697540
1254 Ga0075430_100181058
1255 Ga0075434_100875106
1256 Ga0068865_100002113
1257 Ga0068865_100118042
1258 Ga0068865_100894950
1259 Ga0075436_100925096
1260 Ga0097620_100000720
1261 Ga0097620_100024617
1262 Ga0097620_100115902
1263 Ga0097620_100183310
1264 Ga0097620_100453916
1265 Ga0097620_100487497
1266 Ga0097620_101848887
1267 Ga0099795_10131997
1268 Ga0105250_10068890
1269 Ga0105250_10364386
1270 Ga0105240_10000307
1271 Ga0105240_10142953
1272 Ga0105240_10344624
1273 Ga0105240_10366821
1274 Ga0105240_10484852
1275 Ga0105240_10633151
1276 Ga0105240_10899161
1277 Ga0111539_10871523
1278 Ga0105245_10143056
1279 Ga0105245_10782570
1280 Ga0105245_12641994
1281 Ga0105247_10000598
1282 Ga0105247_10030816
1283 Ga0105247_10242956
1284 Ga0105247_10334138
1285 Ga0105247_10499597
1286 Ga0105247_10743505
1287 Ga0114129_10154179
1288 Ga0105243_10450504
1289 Ga0105241_10307786
1290 Ga0105241_10327860
1291 Ga0105241_10505448
1292 Ga0105242_10007597
1293 Ga0105242_10359564
1294 Ga0105242_10493350
1295 Ga0105242_10603919
1296 Ga0105242_10997189
1297 Ga0105242_12147914
1298 Ga0105248_10021845
1299 Ga0105248_10024493
1300 Ga0105248_10321348
1301 Ga0105248_10354465
1302 Ga0105248_10528173
1303 Ga0105248_11578734
1304 Ga0105248_11879272
1305 Ga0105237_10014635
1306 Ga0105237_10040905
1307 Ga0105237_10337999
1308 Ga0105237_10455096
1309 Ga0105237_10700425
1310 Ga0105237_10771522
1311 Ga0105237_11551091
1312 Ga0105237_11977938
1313 Ga0105238_10057878
1314 Ga0105238_10105595
1315 Ga0105238_10124592
1316 Ga0105238_10219387
1317 Ga0105238_10433647
1318 Ga0105238_10595321
1319 Ga0105238_10929497
1320 Ga0105238_11424727
1321 Ga0105249_10027325
1322 Ga0105249_10049167
1323 Ga0105249_10298268
1324 Ga0105249_10384180
1325 Ga0105249_11034928
1326 Ga0105239_10022131
1327 Ga0105239_10082627
1328 Ga0105239_10105579
1329 Ga0105239_10175265
1330 Ga0105239_10356885
1331 Ga0105239_10600920
1332 Ga0105239_10693387
1333 Ga0105239_13050598
1334 Ga0105246_10243921
1335 Ga0105246_10321361
1336 Ga0105246_11827585
1337 Ga0157371_10255227
1338 Ga0157371_10622041
1339 Ga0157370_10394812
1340 Ga0157369_10087176
1341 Ga0157369_10214522
1342 Ga0157369_10273611
1343 Ga0157374_10113179
1344 Ga0157374_10304949
1345 Ga0157374_10609740
1346 Ga0157378_10048478
1347 Ga0157378_10081832
1348 Ga0163162_10003955
1349 Ga0163162_10056246
1350 Ga0163162_10112569
1351 Ga0163162_10132036
1352 Ga0163162_10332871
1353 Ga0157372_10271748
1354 Ga0157372_10327020
1355 Ga0157372_10865813
1356 Ga0157375_10037280
1357 Ga0157375_10173605
1358 Ga0157375_10349473
1359 Ga0157375_10569719
1360 Ga0157375_12593836
1361 Ga0157375_13436579
1362 Ga0163163_10019243
1363 Ga0163163_10106838
1364 Ga0163163_10445989
1365 Ga0163163_10804605
1366 Ga0163163_10915144
1367 Ga0163163_11325315
1368 Ga0163163_11707717
1369 Ga0157380_10942454
1370 Ga0157380_11224667
1371 Ga0157380_11227449
1372 Ga0157377_10448263
1373 Ga0157379_10029723
1374 Ga0157379_10040550
1375 Ga0157379_10091983
1376 Ga0157379_10145753
1377 Ga0157376_10146723
1378 Ga0157376_10191770
1379 Ga0157376_10224046
1380 Ga0163161_10027982
1381 Ga0163161_10216042
1382 Ga0197907_11091587
1383 Ga0206356_10729450
1384 Ga0206349_1492484
1385 Ga0206355_1673172
1386 Ga0206355_1694621
1387 Ga0206352_10323100
1388 Ga0206352_10477912
1389 Ga0206352_11342142
1390 Ga0206350_10166307
1391 Ga0206353_10940199
1392 Ga0213872_10017280
1393 Ga0213876_10080580
1394 Ga0213871_10043169
1395 Ga0224712_10000712
1396 Ga0224712_10082901
1397 Ga0224712_10294634
1398 Ga0209674_100088
1399 Ga0209672_106557
1400 Ga0209563_100179
1401 Ga0209258_100362
1402 Ga0209677_100962
1403 Ga0209148_1012256
1404 Ga0209759_1001320
1405 Ga0209759_1001825
1406 Ga0209759_1039357
1407 Ga0209455_1000553
1408 Ga0209051_1004288
1409 Ga0207656_10690966
1410 Ga0207692_10053272
1411 Ga0207692_10774734
1412 Ga0207642_10299782
1413 Ga0207710_10000550
1414 Ga0207710_10165809
1415 Ga0207710_10314593
1416 Ga0207688_10202853
1417 Ga0207680_10089786
1418 Ga0207680_11316918
1419 Ga0207647_10039674
1420 Ga0207685_10013616
1421 Ga0207699_10133716
1422 Ga0207699_10305964
1423 Ga0207645_10082538
1424 Ga0207645_10241709
1425 Ga0207643_10092863
1426 Ga0207643_10505438
1427 Ga0207654_10315472
1428 Ga0207654_10485410
1429 Ga0207707_10018928
1430 Ga0207707_10020224
1431 Ga0207707_10021766
1432 Ga0207707_10059982
1433 Ga0207707_10109633
1434 Ga0207707_10433640
1435 Ga0207695_10006233
1436 Ga0207695_10041002
1437 Ga0207695_10056184
1438 Ga0207695_10124052
1439 Ga0207695_10163544
1440 Ga0207695_10731297
1441 Ga0207671_10026753
1442 Ga0207671_10039761
1443 Ga0207671_10299365
1444 Ga0207671_10317257
1445 Ga0207671_10517160
1446 Ga0207671_10751317
1447 Ga0207693_10000300
1448 Ga0207693_10015521
1449 Ga0207663_10281347
1450 Ga0207660_10058087
1451 Ga0207657_10026920
1452 Ga0207649_10894004
1453 Ga0207652_10025490
1454 Ga0207652_10116449
1455 Ga0207652_10251207
1456 Ga0207681_10044059
1457 Ga0207694_10164152
1458 Ga0207694_10182501
1459 Ga0207694_10192873
1460 Ga0207694_10259426
1461 Ga0207694_10415621
1462 Ga0207694_10452521
1463 Ga0207694_10789444
1464 Ga0207694_11817875
1465 Ga0207650_10213836
1466 Ga0207687_10225772
1467 Ga0207687_11560415
1468 Ga0207700_10060089
1469 Ga0207700_10066821
1470 Ga0207700_10112344
1471 Ga0207700_10170868
1472 Ga0207664_10017611
1473 Ga0207664_10054088
1474 Ga0207664_10365816
1475 Ga0207644_10001716
1476 Ga0207644_10070418
1477 Ga0207644_10076490
1478 Ga0207690_10089348
1479 Ga0207706_10659351
1480 Ga0207706_10953457
1481 Ga0207686_10018392
1482 Ga0207686_10098660
1483 Ga0207686_10628533
1484 Ga0207670_10013314
1485 Ga0207670_10767906
1486 Ga0207670_11155172
1487 Ga0207704_10045766
1488 Ga0207704_10121017
1489 Ga0207704_10766144
1490 Ga0207665_10004706
1491 Ga0207691_10007437
1492 Ga0207691_10020550
1493 Ga0207711_10059379
1494 Ga0207711_10249343
1495 Ga0207711_11500546
1496 Ga0207711_11576796
1497 Ga0207689_10052704
1498 Ga0207689_10164269
1499 Ga0207689_10200563
1500 Ga0207689_10321214
1501 Ga0207661_10040742
1502 Ga0207661_10153192
1503 Ga0207661_10614628
1504 Ga0207679_10111763
1505 Ga0207679_10973797
1506 Ga0207679_11352269
1507 Ga0207679_11992207
1508 Ga0207667_10012751
1509 Ga0207667_10609485
1510 Ga0207651_10001498
1511 Ga0207651_10545618
1512 Ga0207651_10579901
1513 Ga0207651_11609941
1514 Ga0207712_10055160
1515 Ga0207712_10410875
1516 Ga0207712_10946203
1517 Ga0207640_10136646
1518 Ga0207658_10011588
1519 Ga0207658_10123535
1520 Ga0207658_10264046
1521 Ga0207658_10366423
1522 Ga0207658_10426781
1523 Ga0207677_10014815
1524 Ga0207677_11492553
1525 Ga0207703_10001111
1526 Ga0207703_10001808
1527 Ga0207703_10207128
1528 Ga0207703_10287826
1529 Ga0207639_10593569
1530 Ga0207678_10026496
1531 Ga0207678_10251350
1532 Ga0207678_10255422
1533 Ga0207678_10807394
1534 Ga0207678_10852052
1535 Ga0207708_10048236
1536 Ga0207708_10244926
1537 Ga0207708_10391058
1538 Ga0207708_10645967
1539 Ga0207702_10030266
1540 Ga0207702_10096816
1541 Ga0207702_10761052
1542 Ga0207702_11657067
1543 Ga0207641_10000083
1544 Ga0207641_10025326
1545 Ga0207641_10032612
1546 Ga0207641_10077516
1547 Ga0207641_10231767
1548 Ga0207641_10250977
1549 Ga0207641_10470313
1550 Ga0207641_11059118
1551 Ga0207648_10028725
1552 Ga0207648_10039876
1553 Ga0207648_10107917
1554 Ga0207648_10178899
1555 Ga0207648_11648079
1556 Ga0207676_10017296
1557 Ga0207676_10410941
1558 Ga0207676_10504006
1559 Ga0207676_11189795
1560 Ga0207674_10156923
1561 Ga0207674_10678888
1562 Ga0207675_100016698
1563 Ga0207675_100410569
1564 Ga0207683_10236500
1565 Ga0207683_10480604
1566 Ga0207698_10100442
1567 Ga0207698_10332850
1568 Ga0207698_10946753
1569 Ga0209974_10049342
1570 Ga0268266_10001464
1571 Ga0268266_10002690
1572 Ga0268266_10009272
1573 Ga0268266_10022172
1574 Ga0268266_10052164
1575 Ga0268266_10062455
1576 Ga0268266_10123429
1577 Ga0268265_10004217
1578 Ga0268265_10013010
1579 Ga0268265_10045559
1580 Ga0268265_10074313
1581 Ga0268265_11768260
1582 Ga0268264_10000179
1583 Ga0268264_10011064
1584 Ga0268264_10012783
1585 Ga0268264_10032760
1586 Ga0268264_10111722
1587 Ga0268264_10116657
1588 Ga0268264_10346545
1589 Ga0268264_10349707
1590 Ga0268264_10445284
1591 Ga0265319_1010575
1592 Ga0265334_10000242
1593 Ga0265334_10012101
1594 Ga0265318_10000024
1595 Ga0307515_10002191
1596 Ga0307515_10072294
1597 Ga0307515_10122972
1598 Ga0265338_10009779
1599 Ga0265338_10014084
1600 Ga0265324_10000908
1601 Ga0307511_10001031
1602 Ga0307511_10345474
1603 Ga0265766_1002598
1604 Ga0265779_113045
1605 Ga0265330_10007609
1606 Ga0265332_10013565
1607 Ga0265328_10009932
1608 Ga0265320_10003463
1609 Ga0265325_10003241
1610 Ga0265329_10000807
1611 Ga0265340_10059069
1612 Ga0265340_10143422
1613 Ga0265340_10166944
1614 Ga0265339_10153772
1615 Ga0265331_10002138
1616 Ga0265331_10042357
1617 Ga0265316_10004634
1618 Ga0307513_10166143
1619 Ga0307513_10263412
1620 Ga0307509_10000001
1621 Ga0307408_100131702
1622 Ga0265313_10008827
1623 Ga0307508_10156586
1624 Ga0307508_10529487
1625 Ga0307508_10534067
1626 Ga0307514_10000854
1627 Ga0265314_10002873
1628 Ga0265342_10009386
1629 Ga0316576_10004217
1630 Ga0316578_10185360
1631 Ga0307516_10000432
1632 Ga0307516_10006666
1633 Ga0307516_10106242
1634 Ga0307405_10077160
1635 Ga0307413_10007993
1636 Ga0307410_10009459
1637 Ga0307406_10142861
1638 Ga0307406_11517084
1639 Ga0307412_10193587
1640 Ga0307409_100000260
1641 Ga0307416_103097790
1642 Ga0307411_10003073
1643 Ga0307415_100093549
1644 Ga0307507_10415666
1645 Ga0307510_10000013
1646 Ga0307510_10014579
1647 Ga0373926_0319639
1648 Ga0373923_0033379
1649 Ga0373932_0099214
1650 Ga0373936_0016925
1651 Ga0373936_0022834
1652 Ga0373945_0507169
1653 Ga0373953_0131906
1654 Ga0373954_0076448
1655 Ga0373956_0488854
1656 Ga0373957_0113276
1657 Ga0373957_0392802
1658 Ga0373957_0434159
1659 Ga0373943_0113979
1660 Ga0316574_0010096
1661 Ga0373924_0318170
1662 Ga0373931_0108038
1663 Ga0373935_0162570
1664 Ga0373935_1368904
1665 Ga0373927_0035795
1666 Ga0373933_0085840
1667 Ga0373933_0351696
1668 Ga0373947_0160362
1669 Ga0373947_0396828
1670 Ga0373937_0028436
1671 Ga0373937_0085763
1672 Ga0373937_0346194
1673 Ga0316584_0052700
1674 Ga0373925_0006858
1675 Ga0373925_0703550
1676 Ga0395900_0000025
1677 Ga0395898_0001112
1678 Ga0395905_0031321
1679 Ga0395905_0036617
1680 Ga0395905_0401396
1681 Ga0395905_0476590
1682 Ga0395905_0678399
1683 Ga0395905_0865324
1684 Ga0436364_0288620
1685 Ga0436365_0935043
1686 Ga0436365_1116878
1687 Ga0436365_1123795
1688 Ga0436365_1273617
1689 Ga0436365_1369117
1690 Ga0436365_1915437
1691 Ga0436360_0109344
1692 Ga0436360_0577739
1693 Ga0436360_0770911
1694 Ga0436360_0789934
1695 Ga0436360_1376956
1696 Ga0436361_0559178
1697 Ga0436361_0597012
1698 Ga0436361_0814403
1699 Ga0436361_0866882
1700 Ga0436363_0322376
1701 Ga0436363_0569581
1702 Ga0436363_0578683
1703 Ga0436363_1295560
1704 Ga0436362_0136394
1705 Ga0436362_0350607
1706 Ga0439436_0052150
1707 Ga0439439_0070597
1708 Ga0439453_0049055
1709 Ga0451798_0124787
1710 Ga0451798_1134510
1711 Ga0451800_0213464
1712 Ga0451805_062905
1713 Ga0439431_0011676
1714 Ga0439433_0033793
1715 Ga0439448_0041103
1716 Ga0439448_0135914
1717 Ga0439449_0030723
1718 Ga0439449_0042891
1719 Ga0439457_034565
1720 Ga0439462_0013130
1721 Ga0450899_002960
1722 Ga0439446_0059901
1723 Ga0439464_0029358
1724 Ga0450893_0033394
1725 Ga0450893_0056336
1726 Ga0451577_0001132
1727 Ga0466969_0000075
1728 Ga0466969_0003117
1729 Ga0466969_0010879
1730 Ga0466969_0013190
1731 Ga0466969_0013216
1732 Ga0466969_0015530
1733 Ga0466969_0069294
1734 Ga0466972_0004215
1735 Ga0466972_0008052
1736 Ga0466972_0016103
1737 Ga0466972_0023590
1738 Ga0466965_0020677
1739 Ga0466965_0028559
1740 Ga0466965_0075348
1741 Ga0466965_0114003
1742 Ga0466965_0449530
1743 Ga0466966_0004792
1744 Ga0466966_0011299
1745 Ga0466966_0023991
1746 Ga0466966_0047046
1747 Ga0466966_0057852
1748 Ga0466966_0440297
1749 Ga0466961_0002234
1750 Ga0466961_0010322
1751 Ga0466961_0010421
1752 Ga0466961_0011978
1753 Ga0466961_0079707
1754 Ga0466963_0035056
1755 Ga0466964_0001005
1756 Ga0466964_0002737
1757 Ga0466964_0024262
1758 Ga0466971_0001125
1759 Ga0466971_0003912
1760 Ga0466971_0077730
1761 Ga0466971_0105875
1762 Ga0466968_0011359
1763 Ga0466968_0261351
1764 Ga0466970_0004235
1765 Ga0466970_0008413
1766 Ga0466970_0012923
1767 Ga0466970_0183317
1768 Ga0466970_0466484
1769 Ga0466957_0016451
1770 Ga0466957_0023740
1771 Ga0466960_0046107
1772 Ga0466960_0623140
1773 Ga0466959_0000818
1774 Ga0466959_0006637
1775 Ga0466959_0009577
1776 Ga0466959_0013546
1777 Ga0466959_0015487
1778 Ga0466959_0016434
1779 Ga0466959_0041660
1780 Ga0466959_0081007
1781 Ga0451576_0317058
1782 Ga0451576_0930878
1783 Ga0466958_0016466
1784 Ga0466958_0225294
1785 Ga0466967_0054356
1786 Ga0466967_0208802
1787 Ga0495651_0368445
1788 Ga0495650_0032218
1789 Ga0495580_0009981
1790 Ga0495580_0170414
1791 Ga0495585_0010185
1792 Ga0495618_0213235
1793 Ga0495628_0344157
1794 Ga0495630_0035720
1795 Ga0495630_1264767
1796 Ga0495648_0154202
1797 Ga0495652_0327323
1798 Ga0495640_0783704
1799 Ga0495586_0061129
1800 Ga0495609_0155499
1801 Ga0495645_0300550
1802 Ga0495645_0541353
1803 Ga0495622_0443269
1804 Ga0495668_0222231
1805 Ga0495625_0057959
1806 Ga0495625_0613197
1807 Ga0495657_0141200
1808 Ga0495623_0466901
1809 Ga0495649_0051908
1810 Ga0495680_0820564
1811 Ga0495686_0019152
1812 Ga0495686_0238478
1813 Ga0496100_0060202
1814 Ga0496100_1046364
1815 Ga0496101_0098798
1816 Ga0496101_0545467
1817 Ga0496101_0906946
1818 Ga0496102_0173096
1819 Ga0496102_0234846
1820 Ga0496103_0019355
1821 Ga0496104_0035306
1822 Ga0496104_0323321
1823 Ga0496105_0021395
1824 Ga0496105_0396128
1825 Ga0496106_0074733
1826 Ga0496106_0725878
1827 Ga0496107_0020106
1828 Ga0496107_0331757
1829 Ga0496108_0235435
1830 Ga0496109_0004674
1831 Ga0496109_0197828
1832 Ga0496109_0285789
1833 Ga0496110_0110070
1834 Ga0496111_0032699
1835 Ga0496112_0353221
1836 Ga0496113_0157001
1837 Ga0496113_0257914
1838 Ga0496114_0000976
1839 Ga0496114_0561427
1840 Ga0496115_0003458
1841 Ga0496115_0141118
1842 Ga0496115_0426451
1843 Ga0496115_1265421
1844 Ga0496116_0025905
1845 Ga0496117_0000057
1846 Ga0496118_0000028
1847 Ga0496119_0021299
1848 Ga0496119_0024683
1849 Ga0496119_0405115
1850 Ga0496120_0021404
1851 Ga0496120_0209716
1852 Ga0496121_0001748
1853 Ga0496121_0034849
1854 Ga0496121_0350704
1855 Ga0496124_0018704
1856 Ga0496125_0000926
1857 Ga0496125_0071773
1858 Ga0496125_0290401
1859 Ga0496126_0008006
1860 Ga0496126_0029585
1861 Ga0496126_0108705
1862 Ga0496126_0681286
1863 Ga0496126_0817917
1864 Ga0501306_011807
1865 Ga0501308_000351
1866 Ga0501308_015256
1867 Ga0501310_021793
1868 Ga0501304_006097
1869 Ga0501303_008953
1870 Ga0501311_065750
1871 Ga0501312_006801
1872 Ga0501312_109898
1873 Ga0501313_019615
1874 Ga0501314_001973
1875 Ga0501315_004684
1876 Ga0501315_025153
1877 Ga0501317_002108
1878 Ga0501317_077225
1879 Ga0501320_016223
1880 Ga0501321_000564
1881 Ga0501323_049590
1882 Ga0501325_002818
1883 Ga0501328_05474
1884 Ga0501329_08434
1885 Ga0501340_001985
1886 Ga0501340_013318
1887 Ga0501036_0624912
1888 Ga0501048_0238036
1889 Ga0501073_0604542
1890 Ga0501199_006575
1891 Ga0501206_089418
1892 Ga0501249_195455
1893 Ga0501256_033520
1894 Ga0501257_041467
1895 Ga0501079_0241535
1896 Ga0501079_1238847
1897 nmdc:mga0k408_11566_c1
1898 nmdc:mga0k408_169358_c1
1899 nmdc:mga0k408_578236_c1
1900 nmdc:mga0k408_69937_c1
1901 nmdc:mga0k408_89144_c1
1902 nmdc:mga07m45_1066_c1
1903 nmdc:mga07m45_41324_c1
1904 nmdc:mga05p37_105087_c1
1905 nmdc:mga05p37_1564738_c1
1906 nmdc:mga0qj67_359680_c1
1907 nmdc:mga08y16_760236_c1
1908 nmdc:mga0rr50_1214440_c1
1909 nmdc:mga0a205_832390_c1
1910 Ga0495612_0316719
1911 Ga0500635_0000072
1912 Ga0500643_003570
1913 Ga0500644_0099591
1914 Ga0500646_0018273
1915 Ga0500583_0289367
1916 Ga0500583_0319868
1917 Ga0500651_0111819
1918 Ga0500641_0067946
1919 Ga0500650_0209796
1920 Ga0500562_010211
1921 Ga0500572_016125
1922 Ga0500594_0009895
1923 Ga0500595_044003
1924 Ga0500608_206992
1925 Ga0500652_025758
1926 Ga0500559_0459809
1927 Ga0500564_169108
1928 Ga0500568_0065017
1929 Ga0500577_0469173
1930 Ga0500590_265471
1931 Ga0500616_0000016
1932 Ga0500616_0045257
1933 Ga0500622_0006035
1934 Ga0500639_124948
1935 Ga0500639_341773
1936 Ga0500636_0008914
1937 Ga0500637_0020797
1938 Ga0500637_0290957
1939 Ga0500611_012209
1940 Ga0500596_004056
1941 Ga0500661_024804
1942 Ga0587084_000433
1943 Ga0587084_019002
1944 Ga0587093_001766
1945 Ga0587093_029952
1946 Ga0587093_033969
1947 Ga0587066_002318
1948 Ga0587066_003065
1949 Ga0587066_007195
1950 Ga0587066_019086
1951 Ga0587070_000937
1952 Ga0587070_066369
1953 Ga0587070_155650
1954 Ga0587073_0045814
1955 Ga0587077_001010
1956 Ga0587077_003170
1957 Ga0587077_031732
1958 Ga0587080_004102
1959 Ga0587080_031744
1960 Ga0587080_076724
1961 Ga0587082_005534
1962 Ga0587082_010690
1963 Ga0587083_0005260
1964 Ga0587083_0025337
1965 Ga0587083_0031913
1966 Ga0587083_0061548
1967 Ga0587083_0113233
1968 Ga0587085_000405
1969 Ga0587085_003839
1970 Ga0587085_007270
1971 Ga0587086_000406
1972 Ga0587086_007979
1973 Ga0587088_001524
1974 Ga0587089_032450
1975 Ga0587090_000400
1976 Ga0587090_000452
1977 Ga0587090_002039
1978 Ga0587091_000944
1979 Ga0587091_032435
1980 Ga0587091_163997
1981 Ga0587092_002029
1982 Ga0587092_048439
1983 Ga0587094_000448
1984 Ga0587094_002938
1985 Ga0587098_009470
1986 Ga0587106_056876
1987 Ga0587125_000549
1988 Ga0587125_006665
1989 Ga0587131_015709
1990 Ga0587101_001373
1991 Ga0587101_026345
1992 Ga0587109_005113
1993 Ga0587109_007367
1994 Ga0587109_033893
1995 Ga0587109_076138
1996 Ga0587115_000323
1997 Ga0587115_068987
1998 Ga0587117_000345
1999 Ga0587128_008475
2000 Ga0587128_009243
2001 Ga0587128_029906
2002 Ga0587128_100489
2003 Ga0587130_010086
2004 Ga0587062_000473
2005 Ga0587062_023336
2006 Ga0587062_070581
2007 Ga0587067_014060
2008 Ga0587067_056323
2009 Ga0587067_238461
2010 Ga0587068_002378
2011 Ga0587068_013300
2012 Ga0587068_015816
2013 Ga0587069_001653
2014 Ga0587069_025651
2015 Ga0587069_088819
2016 Ga0587072_005137
2017 Ga0587072_010373
2018 Ga0587072_172436
2019 Ga0587075_011981
2020 Ga0587075_034614
2021 Ga0587076_003254
2022 Ga0587076_005768
2023 Ga0587076_027891
2024 Ga0587076_038149
2025 Ga0587079_007398
2026 Ga0587079_065767
2027 Ga0587079_088196
2028 Ga0587079_099905
2029 Ga0587100_001147
2030 Ga0587100_010643
2031 Ga0587102_022671
2032 Ga0587102_027836
2033 Ga0587105_012726
2034 Ga0587107_023462
2035 Ga0587107_039413
2036 Ga0587108_013740
2037 Ga0587110_002704
2038 Ga0587114_010376
2039 Ga0587118_12569
2040 Ga0587119_015585
2041 Ga0587124_002348
2042 Ga0587124_051784
2043 Ga0587071_009437
2044 Ga0587071_032189
2045 Ga0587071_049276
2046 Ga0587071_061538
2047 Ga0587111_0000905
2048 Ga0587111_0008978
2049 Ga0501082_1108676
2050 Ga0501082_1290637
2051 Ga0466962_0008322
2052 Ga0466962_0011878
2053 Ga0466962_0031968
2054 Ga0466962_0532071

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

12

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8572 56 128
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8363 56 128
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.8209 56 122
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8094 95 126
3do6-assembly1.cif.gz_A crystal structure of putative formyltetrahydrofolate synthetase (tm1766) from thermotoga maritima at 1.85 a resolution 0.7515 83 126
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8209 56 122 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7588 95 127 3.40.50.2020
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7475 56 122 3.30.420.270
af_P9WIM5_63_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7114 79 127 3.40.50.150
3vthA04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6749 77 131 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2S9GU90-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9393 57 127 GO:0005886
GO:0015031
GO:0022857
AF-A0A5E9Q4F2-F1-model_v4 deleted 0.9368 54 127
AF-A0A2S9WYI7-F1-model_v4 Biopolymer transporter ExbD 0.9314 53 127 GO:0005886
GO:0015031
GO:0022857
AF-A0A1I7IB77-F1-model_v4 Biopolymer transport protein ExbD 0.9277 51 127 GO:0005886
GO:0015031
GO:0022857
AF-A0A4Q3LLI3-F1-model_v4 Biopolymer transporter ExbD 0.9198 53 133 GO:0005886
GO:0015031
GO:0022857

Map