F488321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 430 | 1012 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0781382|Ga0436360_0781382_1022_1873 |
| Length | 283 |
| Sequence | LRGIRHPFAIERIARWRKAALARMRDDTDAREEAVNLFDLAGKVAIVTGGNGGIGXXXXRGLAXXXXTVVLVGRNAAKGERAAAELGASFAKADVTKKAEVQKLVGDTVGAHGRLDILVNNAGTAVRKNPQDYDEAEWHLVIDTNLTSAFLCSQAAYFEMVKTGGGKIINIGSMMSLFGAPHAAPYGASKGGVMQLTRAHATAWARDNIQVNCVLPGWIDTELTAGARAQVSGLHESVLARTPAGRWGQPGDLSGIAVFLAAPASDFVTGTAIPVDGGYSIRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 2 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 3 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 4 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 5 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 222 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 285 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 291 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 292 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 293 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 294 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 295 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 296 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 297 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 411 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 414 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 420 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 422 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 424 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 430 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.81 |
| Nodule | 0.1 |
| Rhizoplane | 2.75 |
| Rhizosphere | 88.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000018 | 3300003320 | Bacteria | 23416 |
| 2 | JGI25404J52841_10026926 | 3300003659 | Bacteria | 1237 |
| 3 | Ga0065707_10149703 | 3300005295 | Bacteria | 1669 |
| 4 | Ga0070658_10023601 | 3300005327 | Bacteria | 4935 |
| 5 | Ga0070658_10151023 | 3300005327 | Bacteria | 1945 |
| 6 | Ga0070676_10024000 | 3300005328 | Bacteria | 3432 |
| 7 | Ga0070683_100017788 | 3300005329 | Bacteria | 6281 |
| 8 | Ga0070683_100881702 | 3300005329 | Bacteria | 858 |
| 9 | Ga0070690_100000085 | 3300005330 | Bacteria | 45980 |
| 10 | Ga0070690_100042773 | 3300005330 | Bacteria | 2870 |
| 11 | Ga0070690_100220151 | 3300005330 | Bacteria | 1330 |
| 12 | Ga0070670_100010577 | 3300005331 | Bacteria | 7879 |
| 13 | Ga0070670_100110067 | 3300005331 | Bacteria | 2373 |
| 14 | Ga0068869_100000367 | 3300005334 | Bacteria | 24337 |
| 15 | Ga0068869_100002177 | 3300005334 | Bacteria | 11779 |
| 16 | Ga0068869_100017275 | 3300005334 | Bacteria | 4887 |
| 17 | Ga0070666_10000048 | 3300005335 | Bacteria | 102191 |
| 18 | Ga0070666_10006268 | 3300005335 | Bacteria | 7314 |
| 19 | Ga0070680_100000256 | 3300005336 | Bacteria | 35098 |
| 20 | Ga0070680_100000888 | 3300005336 | Bacteria | 21150 |
| 21 | Ga0070680_100001789 | 3300005336 | Bacteria | 15777 |
| 22 | Ga0070680_100046286 | 3300005336 | Bacteria | 3539 |
| 23 | Ga0070680_100070828 | 3300005336 | Bacteria | 2864 |
| 24 | Ga0070680_100107278 | 3300005336 | Bacteria | 2323 |
| 25 | Ga0070682_100002233 | 3300005337 | Bacteria | 10739 |
| 26 | Ga0070682_100004504 | 3300005337 | Bacteria | 7738 |
| 27 | Ga0068868_100000639 | 3300005338 | Bacteria | 23608 |
| 28 | Ga0068868_100006649 | 3300005338 | Bacteria | 8202 |
| 29 | Ga0068868_100012946 | 3300005338 | Bacteria | 6103 |
| 30 | Ga0068868_100151783 | 3300005338 | Bacteria | 1908 |
| 31 | Ga0070660_100039715 | 3300005339 | Bacteria | 3578 |
| 32 | Ga0070689_100000189 | 3300005340 | Bacteria | 37342 |
| 33 | Ga0070689_100110891 | 3300005340 | Bacteria | 2182 |
| 34 | Ga0070689_100308577 | 3300005340 | Bacteria | 1319 |
| 35 | Ga0070691_10002347 | 3300005341 | Bacteria | 8387 |
| 36 | Ga0070691_10003307 | 3300005341 | Bacteria | 7228 |
| 37 | Ga0070691_10240066 | 3300005341 | Bacteria | 968 |
| 38 | Ga0070687_100000020 | 3300005343 | Bacteria | 53469 |
| 39 | Ga0070661_100000612 | 3300005344 | Bacteria | 26638 |
| 40 | Ga0070661_100079391 | 3300005344 | Bacteria | 2421 |
| 41 | Ga0070692_10000471 | 3300005345 | Bacteria | 12334 |
| 42 | Ga0070668_100026398 | 3300005347 | Bacteria | 4407 |
| 43 | Ga0070668_100374716 | 3300005347 | Bacteria | 1210 |
| 44 | Ga0070669_100021844 | 3300005353 | Bacteria | 4576 |
| 45 | Ga0070669_100036743 | 3300005353 | Bacteria | 3551 |
| 46 | Ga0070669_100041335 | 3300005353 | Bacteria | 3353 |
| 47 | Ga0070669_100093679 | 3300005353 | Bacteria | 2256 |
| 48 | Ga0070669_100305777 | 3300005353 | Bacteria | 1280 |
| 49 | Ga0070675_100110433 | 3300005354 | Bacteria | 2325 |
| 50 | Ga0070671_100010297 | 3300005355 | Bacteria | 7502 |
| 51 | Ga0070674_100027282 | 3300005356 | Bacteria | 3741 |
| 52 | Ga0070673_100008357 | 3300005364 | Bacteria | 6879 |
| 53 | Ga0070673_100030249 | 3300005364 | Bacteria | 4049 |
| 54 | Ga0070673_100188299 | 3300005364 | Bacteria | 1771 |
| 55 | Ga0070688_100011085 | 3300005365 | Bacteria | 5003 |
| 56 | Ga0070688_100059943 | 3300005365 | Unclassified | 2402 |
| 57 | Ga0070659_100002925 | 3300005366 | Bacteria | 12176 |
| 58 | Ga0070667_100071591 | 3300005367 | Bacteria | 2953 |
| 59 | Ga0070667_100101598 | 3300005367 | Unclassified | 2484 |
| 60 | Ga0070667_100113538 | 3300005367 | Bacteria | 2351 |
| 61 | Ga0070667_100773618 | 3300005367 | Bacteria | 891 |
| 62 | Ga0070703_10038846 | 3300005406 | Bacteria | 1473 |
| 63 | Ga0070703_10079852 | 3300005406 | Bacteria | 1112 |
| 64 | Ga0070709_10070049 | 3300005434 | Bacteria | 2260 |
| 65 | Ga0070714_100121822 | 3300005435 | Bacteria | 2321 |
| 66 | Ga0070714_100265508 | 3300005435 | Bacteria | 1590 |
| 67 | Ga0070713_100003400 | 3300005436 | Bacteria | 10510 |
| 68 | Ga0070713_100203552 | 3300005436 | Bacteria | 1789 |
| 69 | Ga0070710_10057606 | 3300005437 | Bacteria | 2202 |
| 70 | Ga0070701_10000464 | 3300005438 | Bacteria | 13857 |
| 71 | Ga0070701_10005008 | 3300005438 | Bacteria | 5432 |
| 72 | Ga0070711_100185582 | 3300005439 | Bacteria | 1594 |
| 73 | Ga0070705_100000022 | 3300005440 | Bacteria | 83218 |
| 74 | Ga0070705_100000322 | 3300005440 | Bacteria | 28288 |
| 75 | Ga0070700_100001393 | 3300005441 | Bacteria | 12014 |
| 76 | Ga0070700_100001396 | 3300005441 | Bacteria | 12002 |
| 77 | Ga0070694_100000049 | 3300005444 | Bacteria | 54670 |
| 78 | Ga0070694_100002034 | 3300005444 | Bacteria | 11996 |
| 79 | Ga0070708_100096119 | 3300005445 | Unclassified | 2706 |
| 80 | Ga0070708_100168139 | 3300005445 | Bacteria | 2046 |
| 81 | Ga0070708_100555762 | 3300005445 | Bacteria | 1083 |
| 82 | Ga0070663_100003795 | 3300005455 | Bacteria | 8786 |
| 83 | Ga0070678_100064905 | 3300005456 | Bacteria | 2708 |
| 84 | Ga0070678_100599709 | 3300005456 | Bacteria | 983 |
| 85 | Ga0070662_100002915 | 3300005457 | Bacteria | 10629 |
| 86 | Ga0070662_100243229 | 3300005457 | Bacteria | 1444 |
| 87 | Ga0070681_10000533 | 3300005458 | Bacteria | 31280 |
| 88 | Ga0070681_10006219 | 3300005458 | Bacteria | 11603 |
| 89 | Ga0070681_10006711 | 3300005458 | Bacteria | 11197 |
| 90 | Ga0070681_10123644 | 3300005458 | Bacteria | 2520 |
| 91 | Ga0068867_100001285 | 3300005459 | Bacteria | 17292 |
| 92 | Ga0068867_100001553 | 3300005459 | Bacteria | 15945 |
| 93 | Ga0068867_100002386 | 3300005459 | Bacteria | 13210 |
| 94 | Ga0068867_100048100 | 3300005459 | Bacteria | 3137 |
| 95 | Ga0068867_100137632 | 3300005459 | Bacteria | 1905 |
| 96 | Ga0070706_100082148 | 3300005467 | Bacteria | 2984 |
| 97 | Ga0070706_100186638 | 3300005467 | Bacteria | 1937 |
| 98 | Ga0070698_100000092 | 3300005471 | Bacteria | 71585 |
| 99 | Ga0070699_100013540 | 3300005518 | Bacteria | 7022 |
| 100 | Ga0070699_100104120 | 3300005518 | Bacteria | 2489 |
| 101 | Ga0070699_100111801 | 3300005518 | Bacteria | 2399 |
| 102 | Ga0070699_100256247 | 3300005518 | Bacteria | 1564 |
| 103 | Ga0070679_100001589 | 3300005530 | Bacteria | 20389 |
| 104 | Ga0070679_100003538 | 3300005530 | Bacteria | 14307 |
| 105 | Ga0070679_100005893 | 3300005530 | Bacteria | 11386 |
| 106 | Ga0070679_100098373 | 3300005530 | Bacteria | 2913 |
| 107 | Ga0070679_100766575 | 3300005530 | Bacteria | 908 |
| 108 | Ga0070684_100513779 | 3300005535 | Bacteria | 1110 |
| 109 | Ga0068853_100000249 | 3300005539 | Bacteria | 37969 |
| 110 | Ga0068853_100001463 | 3300005539 | Bacteria | 17125 |
| 111 | Ga0068853_100066925 | 3300005539 | Unclassified | 3120 |
| 112 | Ga0068853_100210105 | 3300005539 | Bacteria | 1774 |
| 113 | Ga0070672_100152594 | 3300005543 | Bacteria | 1911 |
| 114 | Ga0070672_100175488 | 3300005543 | Bacteria | 1784 |
| 115 | Ga0070672_100217278 | 3300005543 | Bacteria | 1602 |
| 116 | Ga0070672_100224306 | 3300005543 | Bacteria | 1577 |
| 117 | Ga0070672_100261711 | 3300005543 | Bacteria | 1459 |
| 118 | Ga0070686_100000085 | 3300005544 | Bacteria | 66254 |
| 119 | Ga0070695_100001199 | 3300005545 | Bacteria | 14271 |
| 120 | Ga0070695_100002595 | 3300005545 | Bacteria | 10434 |
| 121 | Ga0070695_100102504 | 3300005545 | Bacteria | 1930 |
| 122 | Ga0070696_100000688 | 3300005546 | Bacteria | 21623 |
| 123 | Ga0070696_100000891 | 3300005546 | Bacteria | 19359 |
| 124 | Ga0070696_100001012 | 3300005546 | Bacteria | 18223 |
| 125 | Ga0070693_100000063 | 3300005547 | Bacteria | 42812 |
| 126 | Ga0070693_100000137 | 3300005547 | Bacteria | 33225 |
| 127 | Ga0070693_100007957 | 3300005547 | Bacteria | 5203 |
| 128 | Ga0070665_100002597 | 3300005548 | Bacteria | 19721 |
| 129 | Ga0070665_100031297 | 3300005548 | Bacteria | 5355 |
| 130 | Ga0070704_100000009 | 3300005549 | Bacteria | 67191 |
| 131 | Ga0070704_100311022 | 3300005549 | Bacteria | 1316 |
| 132 | Ga0068855_100001817 | 3300005563 | Bacteria | 26625 |
| 133 | Ga0068855_100006101 | 3300005563 | Bacteria | 14695 |
| 134 | Ga0068855_100010584 | 3300005563 | Bacteria | 11119 |
| 135 | Ga0068855_100023786 | 3300005563 | Bacteria | 7339 |
| 136 | Ga0068855_100031588 | 3300005563 | Bacteria | 6323 |
| 137 | Ga0070664_100058537 | 3300005564 | Bacteria | 3277 |
| 138 | Ga0070664_100869059 | 3300005564 | Unclassified | 845 |
| 139 | Ga0068857_100008990 | 3300005577 | Bacteria | 8658 |
| 140 | Ga0068857_100029661 | 3300005577 | Bacteria | 4828 |
| 141 | Ga0068854_100031803 | 3300005578 | Bacteria | 3669 |
| 142 | Ga0068854_100032697 | 3300005578 | Bacteria | 3621 |
| 143 | Ga0068854_100166592 | 3300005578 | Bacteria | 1711 |
| 144 | Ga0068856_100000451 | 3300005614 | Bacteria | 45442 |
| 145 | Ga0068856_100004022 | 3300005614 | Bacteria | 14719 |
| 146 | Ga0068856_100027691 | 3300005614 | Bacteria | 5529 |
| 147 | Ga0068856_100080445 | 3300005614 | Bacteria | 3232 |
| 148 | Ga0068856_100127906 | 3300005614 | Bacteria | 2544 |
| 149 | Ga0070702_100000009 | 3300005615 | Bacteria | 60314 |
| 150 | Ga0068852_100001866 | 3300005616 | Bacteria | 14339 |
| 151 | Ga0068852_100710037 | 3300005616 | Bacteria | 1016 |
| 152 | Ga0068859_100000051 | 3300005617 | Bacteria | 131188 |
| 153 | Ga0068859_100000354 | 3300005617 | Bacteria | 45757 |
| 154 | Ga0068859_100001622 | 3300005617 | Bacteria | 22989 |
| 155 | Ga0068859_100074029 | 3300005617 | Bacteria | 3445 |
| 156 | Ga0068859_100241747 | 3300005617 | Bacteria | 1895 |
| 157 | Ga0068859_100251940 | 3300005617 | Bacteria | 1856 |
| 158 | Ga0068859_100373848 | 3300005617 | Bacteria | 1521 |
| 159 | Ga0068864_100005149 | 3300005618 | Bacteria | 10710 |
| 160 | Ga0068864_100045246 | 3300005618 | Bacteria | 3775 |
| 161 | Ga0068864_100183460 | 3300005618 | Unclassified | 1914 |
| 162 | Ga0068866_10000182 | 3300005718 | Bacteria | 29433 |
| 163 | Ga0068866_10056519 | 3300005718 | Bacteria | 2018 |
| 164 | Ga0068866_10229254 | 3300005718 | Bacteria | 1125 |
| 165 | Ga0068861_100000138 | 3300005719 | Bacteria | 36853 |
| 166 | Ga0068861_100001214 | 3300005719 | Bacteria | 16045 |
| 167 | Ga0068861_100069051 | 3300005719 | Bacteria | 2733 |
| 168 | Ga0068861_100164993 | 3300005719 | Bacteria | 1831 |
| 169 | Ga0068851_10075949 | 3300005834 | Bacteria | 1747 |
| 170 | Ga0068870_10000714 | 3300005840 | Bacteria | 12742 |
| 171 | Ga0068870_10006772 | 3300005840 | Bacteria | 5077 |
| 172 | Ga0068863_100018653 | 3300005841 | Bacteria | 6638 |
| 173 | Ga0068863_100089869 | 3300005841 | Bacteria | 2912 |
| 174 | Ga0068863_100128871 | 3300005841 | Bacteria | 2415 |
| 175 | Ga0068858_100007068 | 3300005842 | Bacteria | 10896 |
| 176 | Ga0068858_100097323 | 3300005842 | Unclassified | 2743 |
| 177 | Ga0068858_100172145 | 3300005842 | Bacteria | 2042 |
| 178 | Ga0068858_100207956 | 3300005842 | Bacteria | 1852 |
| 179 | Ga0068860_100000285 | 3300005843 | Bacteria | 72246 |
| 180 | Ga0068860_100002900 | 3300005843 | Bacteria | 17780 |
| 181 | Ga0068860_100003215 | 3300005843 | Bacteria | 16847 |
| 182 | Ga0068860_100014489 | 3300005843 | Bacteria | 7719 |
| 183 | Ga0068860_100033779 | 3300005843 | Bacteria | 4908 |
| 184 | Ga0068860_100096734 | 3300005843 | Bacteria | 2814 |
| 185 | Ga0068860_100114913 | 3300005843 | Bacteria | 2574 |
| 186 | Ga0068862_100000821 | 3300005844 | Bacteria | 30739 |
| 187 | Ga0068862_100001942 | 3300005844 | Bacteria | 18752 |
| 188 | Ga0068862_100006112 | 3300005844 | Bacteria | 10020 |
| 189 | Ga0068862_100011620 | 3300005844 | Bacteria | 7265 |
| 190 | Ga0081455_10000345 | 3300005937 | Bacteria | 60779 |
| 191 | Ga0081538_10004641 | 3300005981 | Bacteria | 12617 |
| 192 | Ga0081540_1000012 | 3300005983 | Bacteria | 189939 |
| 193 | Ga0081539_10058101 | 3300005985 | Bacteria | 2137 |
| 194 | Ga0081539_10129531 | 3300005985 | Bacteria | 1241 |
| 195 | Ga0070717_10002714 | 3300006028 | Bacteria | 12486 |
| 196 | Ga0070717_10315138 | 3300006028 | Bacteria | 1393 |
| 197 | Ga0075365_10023487 | 3300006038 | Bacteria | 3879 |
| 198 | Ga0075365_10084598 | 3300006038 | Bacteria | 2153 |
| 199 | Ga0075368_10070075 | 3300006042 | Bacteria | 1415 |
| 200 | Ga0075364_10156586 | 3300006051 | Bacteria | 1537 |
| 201 | Ga0075362_10037055 | 3300006177 | Bacteria | 2137 |
| 202 | Ga0075362_10050508 | 3300006177 | Bacteria | 1859 |
| 203 | Ga0075362_10110102 | 3300006177 | Bacteria | 1296 |
| 204 | Ga0075362_10122894 | 3300006177 | Bacteria | 1230 |
| 205 | Ga0075367_10001340 | 3300006178 | Bacteria | 10457 |
| 206 | Ga0075367_10116476 | 3300006178 | Bacteria | 1644 |
| 207 | Ga0075367_10125657 | 3300006178 | Bacteria | 1583 |
| 208 | Ga0075369_10011173 | 3300006186 | Bacteria | 3526 |
| 209 | Ga0075369_10023748 | 3300006186 | Bacteria | 2536 |
| 210 | Ga0075366_10044655 | 3300006195 | Bacteria | 2627 |
| 211 | Ga0075366_10056029 | 3300006195 | Bacteria | 2341 |
| 212 | Ga0075366_10079455 | 3300006195 | Bacteria | 1958 |
| 213 | Ga0075366_10114681 | 3300006195 | Bacteria | 1622 |
| 214 | Ga0097621_100000392 | 3300006237 | Bacteria | 30517 |
| 215 | Ga0097621_100044812 | 3300006237 | Unclassified | 3570 |
| 216 | Ga0097621_100167279 | 3300006237 | Bacteria | 1893 |
| 217 | Ga0075370_10046561 | 3300006353 | Bacteria | 2454 |
| 218 | Ga0068871_100002537 | 3300006358 | Bacteria | 12465 |
| 219 | Ga0068871_100016534 | 3300006358 | Bacteria | 5561 |
| 220 | Ga0068871_100058868 | 3300006358 | Bacteria | 3129 |
| 221 | Ga0075428_100013055 | 3300006844 | Bacteria | 9232 |
| 222 | Ga0075428_100237121 | 3300006844 | Bacteria | 1968 |
| 223 | Ga0075428_100397290 | 3300006844 | Bacteria | 1477 |
| 224 | Ga0075430_100042341 | 3300006846 | Bacteria | 3851 |
| 225 | Ga0075430_100210051 | 3300006846 | Bacteria | 1615 |
| 226 | Ga0075430_100515742 | 3300006846 | Bacteria | 986 |
| 227 | Ga0075431_100145991 | 3300006847 | Bacteria | 2438 |
| 228 | Ga0075431_100619742 | 3300006847 | Bacteria | 1064 |
| 229 | Ga0075433_10000401 | 3300006852 | Bacteria | 27591 |
| 230 | Ga0075433_10000760 | 3300006852 | Bacteria | 22134 |
| 231 | Ga0075433_10020333 | 3300006852 | Bacteria | 5548 |
| 232 | Ga0075433_10028812 | 3300006852 | Bacteria | 4724 |
| 233 | Ga0075434_100014160 | 3300006871 | Bacteria | 7618 |
| 234 | Ga0075434_100042521 | 3300006871 | Bacteria | 4504 |
| 235 | Ga0075434_100055791 | 3300006871 | Bacteria | 3926 |
| 236 | Ga0075434_100080791 | 3300006871 | Bacteria | 3248 |
| 237 | Ga0075434_100152268 | 3300006871 | Bacteria | 2333 |
| 238 | Ga0075434_100190314 | 3300006871 | Bacteria | 2072 |
| 239 | Ga0075434_100448331 | 3300006871 | Bacteria | 1312 |
| 240 | Ga0075434_100648750 | 3300006871 | Bacteria | 1074 |
| 241 | Ga0075429_100060798 | 3300006880 | Bacteria | 3290 |
| 242 | Ga0075429_100086159 | 3300006880 | Bacteria | 2738 |
| 243 | Ga0068865_100000052 | 3300006881 | Bacteria | 63932 |
| 244 | Ga0068865_100011455 | 3300006881 | Bacteria | 5554 |
| 245 | Ga0068865_100051260 | 3300006881 | Bacteria | 2856 |
| 246 | Ga0068865_100071298 | 3300006881 | Bacteria | 2464 |
| 247 | Ga0075436_100005645 | 3300006914 | Bacteria | 8588 |
| 248 | Ga0097620_100000051 | 3300006931 | Bacteria | 131188 |
| 249 | Ga0097620_100000354 | 3300006931 | Bacteria | 45757 |
| 250 | Ga0097620_100001622 | 3300006931 | Bacteria | 22989 |
| 251 | Ga0097620_100074026 | 3300006931 | Bacteria | 3445 |
| 252 | Ga0097620_100241732 | 3300006931 | Bacteria | 1895 |
| 253 | Ga0097620_100251942 | 3300006931 | Bacteria | 1856 |
| 254 | Ga0097620_100373847 | 3300006931 | Bacteria | 1521 |
| 255 | Ga0075435_100000197 | 3300007076 | Bacteria | 36483 |
| 256 | Ga0075435_100002030 | 3300007076 | Bacteria | 13245 |
| 257 | Ga0075435_100082648 | 3300007076 | Bacteria | 2640 |
| 258 | Ga0099794_10029762 | 3300007265 | Bacteria | 2546 |
| 259 | Ga0099795_10075030 | 3300007788 | Bacteria | 1283 |
| 260 | Ga0105250_10104561 | 3300009092 | Bacteria | 1157 |
| 261 | Ga0105240_10000599 | 3300009093 | Bacteria | 66936 |
| 262 | Ga0105240_10000714 | 3300009093 | Bacteria | 60757 |
| 263 | Ga0105240_10000986 | 3300009093 | Bacteria | 50790 |
| 264 | Ga0105240_10007951 | 3300009093 | Bacteria | 15303 |
| 265 | Ga0105240_10027170 | 3300009093 | Bacteria | 7498 |
| 266 | Ga0105240_10030886 | 3300009093 | Bacteria | 6958 |
| 267 | Ga0105240_10059514 | 3300009093 | Bacteria | 4767 |
| 268 | Ga0105240_10113661 | 3300009093 | Unclassified | 3272 |
| 269 | Ga0105240_10120202 | 3300009093 | Unclassified | 3164 |
| 270 | Ga0105240_10289274 | 3300009093 | Bacteria | 1879 |
| 271 | Ga0105240_10296585 | 3300009093 | Bacteria | 1851 |
| 272 | Ga0111539_10000939 | 3300009094 | Bacteria | 38168 |
| 273 | Ga0111539_10083813 | 3300009094 | Bacteria | 3748 |
| 274 | Ga0111539_10096036 | 3300009094 | Bacteria | 3481 |
| 275 | Ga0111539_11022217 | 3300009094 | Bacteria | 961 |
| 276 | Ga0105245_10000086 | 3300009098 | Bacteria | 93019 |
| 277 | Ga0105245_10030099 | 3300009098 | Bacteria | 4800 |
| 278 | Ga0105245_10193411 | 3300009098 | Bacteria | 1950 |
| 279 | Ga0105245_10398026 | 3300009098 | Bacteria | 1375 |
| 280 | Ga0105247_10009082 | 3300009101 | Bacteria | 6049 |
| 281 | Ga0114129_10000702 | 3300009147 | Bacteria | 42161 |
| 282 | Ga0114129_10012278 | 3300009147 | Bacteria | 12188 |
| 283 | Ga0114129_10045024 | 3300009147 | Bacteria | 6205 |
| 284 | Ga0114129_10118530 | 3300009147 | Bacteria | 3646 |
| 285 | Ga0114129_10127673 | 3300009147 | Bacteria | 3495 |
| 286 | Ga0114129_10296365 | 3300009147 | Bacteria | 2157 |
| 287 | Ga0114129_10605814 | 3300009147 | Unclassified | 1419 |
| 288 | Ga0114129_10645701 | 3300009147 | Bacteria | 1366 |
| 289 | Ga0105243_10000360 | 3300009148 | Bacteria | 48717 |
| 290 | Ga0105243_10002378 | 3300009148 | Bacteria | 15750 |
| 291 | Ga0105243_10030550 | 3300009148 | Bacteria | 4149 |
| 292 | Ga0105243_10752183 | 3300009148 | Bacteria | 956 |
| 293 | Ga0105243_10921822 | 3300009148 | Bacteria | 871 |
| 294 | Ga0105241_10001255 | 3300009174 | Bacteria | 19339 |
| 295 | Ga0105241_10003149 | 3300009174 | Bacteria | 12268 |
| 296 | Ga0105241_10030164 | 3300009174 | Bacteria | 4051 |
| 297 | Ga0105241_10069466 | 3300009174 | Bacteria | 2731 |
| 298 | Ga0105242_10001063 | 3300009176 | Bacteria | 21578 |
| 299 | Ga0105242_10011684 | 3300009176 | Bacteria | 6757 |
| 300 | Ga0105242_10158219 | 3300009176 | Bacteria | 1981 |
| 301 | Ga0105242_10237931 | 3300009176 | Bacteria | 1635 |
| 302 | Ga0105248_10008655 | 3300009177 | Bacteria | 11181 |
| 303 | Ga0105248_10283613 | 3300009177 | Bacteria | 1865 |
| 304 | Ga0105248_10664272 | 3300009177 | Bacteria | 1176 |
| 305 | Ga0105237_10000726 | 3300009545 | Bacteria | 45510 |
| 306 | Ga0105237_10035194 | 3300009545 | Bacteria | 5068 |
| 307 | Ga0105237_10057984 | 3300009545 | Unclassified | 3875 |
| 308 | Ga0105238_10012878 | 3300009551 | Bacteria | 8441 |
| 309 | Ga0105238_10086178 | 3300009551 | Bacteria | 3128 |
| 310 | Ga0105238_10695214 | 3300009551 | Bacteria | 1029 |
| 311 | Ga0105249_10007871 | 3300009553 | Bacteria | 9284 |
| 312 | Ga0105249_10021338 | 3300009553 | Bacteria | 5798 |
| 313 | Ga0105249_10030530 | 3300009553 | Unclassified | 4872 |
| 314 | Ga0105249_10049328 | 3300009553 | Bacteria | 3839 |
| 315 | Ga0105249_10158542 | 3300009553 | Bacteria | 2185 |
| 316 | Ga0105249_10408697 | 3300009553 | Bacteria | 1389 |
| 317 | Ga0099796_10061992 | 3300010159 | Bacteria | 1328 |
| 318 | Ga0105239_10000249 | 3300010375 | Bacteria | 80515 |
| 319 | Ga0105239_10000283 | 3300010375 | Bacteria | 74612 |
| 320 | Ga0105239_10023475 | 3300010375 | Bacteria | 6793 |
| 321 | Ga0105239_10092796 | 3300010375 | Unclassified | 3333 |
| 322 | Ga0105239_10439302 | 3300010375 | Bacteria | 1479 |
| 323 | Ga0105239_10477491 | 3300010375 | Bacteria | 1416 |
| 324 | Ga0105246_10025425 | 3300011119 | Bacteria | 3859 |
| 325 | Ga0157373_10001111 | 3300013100 | Bacteria | 20650 |
| 326 | Ga0157370_10002349 | 3300013104 | Bacteria | 22855 |
| 327 | Ga0157370_10020382 | 3300013104 | Bacteria | 6623 |
| 328 | Ga0157369_10020406 | 3300013105 | Bacteria | 7405 |
| 329 | Ga0157369_10044351 | 3300013105 | Bacteria | 4841 |
| 330 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 331 | Ga0157374_10040219 | 3300013296 | Bacteria | 4305 |
| 332 | Ga0157374_10173481 | 3300013296 | Bacteria | 2104 |
| 333 | Ga0157378_10000332 | 3300013297 | Bacteria | 46615 |
| 334 | Ga0157378_10004814 | 3300013297 | Bacteria | 11831 |
| 335 | Ga0157378_10009209 | 3300013297 | Bacteria | 8599 |
| 336 | Ga0157378_10093845 | 3300013297 | Bacteria | 2732 |
| 337 | Ga0163162_10001536 | 3300013306 | Bacteria | 21544 |
| 338 | Ga0163162_10124289 | 3300013306 | Bacteria | 2686 |
| 339 | Ga0163162_10211536 | 3300013306 | Bacteria | 2069 |
| 340 | Ga0163162_10252828 | 3300013306 | Bacteria | 1894 |
| 341 | Ga0157372_10001340 | 3300013307 | Bacteria | 26639 |
| 342 | Ga0157372_10003789 | 3300013307 | Bacteria | 16237 |
| 343 | Ga0157372_10006751 | 3300013307 | Bacteria | 12201 |
| 344 | Ga0157372_10040392 | 3300013307 | Bacteria | 5153 |
| 345 | Ga0157372_10046289 | 3300013307 | Bacteria | 4829 |
| 346 | Ga0157372_10293850 | 3300013307 | Bacteria | 1889 |
| 347 | Ga0157372_10439739 | 3300013307 | Bacteria | 1520 |
| 348 | Ga0157375_10069953 | 3300013308 | Bacteria | 3517 |
| 349 | Ga0157375_10075596 | 3300013308 | Bacteria | 3393 |
| 350 | Ga0157375_10106530 | 3300013308 | Bacteria | 2895 |
| 351 | Ga0157375_10234830 | 3300013308 | Bacteria | 1993 |
| 352 | Ga0163163_10141196 | 3300014325 | Bacteria | 2451 |
| 353 | Ga0163163_10328744 | 3300014325 | Bacteria | 1583 |
| 354 | Ga0163163_10655010 | 3300014325 | Bacteria | 1114 |
| 355 | Ga0157380_10012130 | 3300014326 | Bacteria | 6239 |
| 356 | Ga0157380_10020426 | 3300014326 | Bacteria | 4950 |
| 357 | Ga0157380_10074287 | 3300014326 | Bacteria | 2759 |
| 358 | Ga0157380_10295564 | 3300014326 | Bacteria | 1489 |
| 359 | Ga0182008_10008440 | 3300014497 | Bacteria | 5624 |
| 360 | Ga0157377_10011155 | 3300014745 | Bacteria | 4475 |
| 361 | Ga0157379_10004316 | 3300014968 | Bacteria | 12160 |
| 362 | Ga0157379_10021876 | 3300014968 | Bacteria | 5666 |
| 363 | Ga0157379_10036832 | 3300014968 | Bacteria | 4362 |
| 364 | Ga0157376_10010278 | 3300014969 | Bacteria | 6835 |
| 365 | Ga0157376_10037185 | 3300014969 | Bacteria | 3949 |
| 366 | Ga0157376_10043193 | 3300014969 | Unclassified | 3698 |
| 367 | Ga0157376_10374340 | 3300014969 | Bacteria | 1370 |
| 368 | Ga0182005_1010389 | 3300015265 | Bacteria | 2681 |
| 369 | Ga0182005_1041811 | 3300015265 | Bacteria | 1246 |
| 370 | Ga0163161_10181726 | 3300017792 | Bacteria | 1613 |
| 371 | Ga0163161_10231226 | 3300017792 | Bacteria | 1435 |
| 372 | Ga0206353_10696245 | 3300020082 | Bacteria | 1346 |
| 373 | Ga0213874_10048726 | 3300021377 | Bacteria | 1293 |
| 374 | Ga0213876_10054483 | 3300021384 | Bacteria | 2111 |
| 375 | Ga0213876_10075305 | 3300021384 | Bacteria | 1782 |
| 376 | Ga0213876_10091069 | 3300021384 | Bacteria | 1615 |
| 377 | Ga0213876_10130598 | 3300021384 | Bacteria | 1335 |
| 378 | Ga0213875_10000825 | 3300021388 | Bacteria | 23073 |
| 379 | Ga0213875_10021532 | 3300021388 | Bacteria | 3086 |
| 380 | Ga0213875_10123793 | 3300021388 | Bacteria | 1208 |
| 381 | Ga0213871_10019429 | 3300021441 | Bacteria | 1674 |
| 382 | Ga0213871_10020792 | 3300021441 | Bacteria | 1630 |
| 383 | Ga0224572_1007548 | 3300024225 | Bacteria | 1995 |
| 384 | Ga0207656_10055788 | 3300025321 | Bacteria | 1720 |
| 385 | Ga0207656_10114846 | 3300025321 | Bacteria | 1248 |
| 386 | Ga0207653_10004318 | 3300025885 | Bacteria | 4465 |
| 387 | Ga0207692_10008108 | 3300025898 | Unclassified | 4336 |
| 388 | Ga0207692_10049633 | 3300025898 | Bacteria | 2119 |
| 389 | Ga0207642_10002026 | 3300025899 | Bacteria | 6253 |
| 390 | Ga0207642_10020222 | 3300025899 | Bacteria | 2594 |
| 391 | Ga0207642_10201094 | 3300025899 | Bacteria | 1100 |
| 392 | Ga0207710_10041252 | 3300025900 | Unclassified | 2046 |
| 393 | Ga0207710_10051467 | 3300025900 | Bacteria | 1850 |
| 394 | Ga0207688_10013304 | 3300025901 | Bacteria | 4471 |
| 395 | Ga0207688_10023296 | 3300025901 | Bacteria | 3390 |
| 396 | Ga0207680_10001111 | 3300025903 | Bacteria | 12669 |
| 397 | Ga0207680_10177726 | 3300025903 | Bacteria | 1437 |
| 398 | Ga0207680_10229565 | 3300025903 | Bacteria | 1275 |
| 399 | Ga0207647_10011594 | 3300025904 | Bacteria | 6173 |
| 400 | Ga0207685_10042090 | 3300025905 | Bacteria | 1713 |
| 401 | Ga0207699_10056548 | 3300025906 | Bacteria | 2339 |
| 402 | Ga0207699_10079929 | 3300025906 | Bacteria | 2024 |
| 403 | Ga0207645_10001231 | 3300025907 | Bacteria | 21084 |
| 404 | Ga0207645_10002022 | 3300025907 | Bacteria | 16287 |
| 405 | Ga0207645_10007365 | 3300025907 | Bacteria | 7781 |
| 406 | Ga0207645_10072227 | 3300025907 | Bacteria | 2208 |
| 407 | Ga0207643_10000036 | 3300025908 | Bacteria | 89740 |
| 408 | Ga0207705_10055696 | 3300025909 | Bacteria | 2851 |
| 409 | Ga0207705_10100136 | 3300025909 | Bacteria | 2131 |
| 410 | Ga0207684_10057910 | 3300025910 | Bacteria | 3288 |
| 411 | Ga0207654_10000957 | 3300025911 | Bacteria | 15858 |
| 412 | Ga0207654_10017766 | 3300025911 | Bacteria | 3724 |
| 413 | Ga0207654_10238246 | 3300025911 | Unclassified | 1215 |
| 414 | Ga0207707_10001333 | 3300025912 | Bacteria | 22977 |
| 415 | Ga0207707_10005087 | 3300025912 | Bacteria | 11531 |
| 416 | Ga0207707_10016894 | 3300025912 | Bacteria | 6356 |
| 417 | Ga0207707_10022145 | 3300025912 | Bacteria | 5555 |
| 418 | Ga0207707_10040055 | 3300025912 | Bacteria | 4094 |
| 419 | Ga0207707_10117452 | 3300025912 | Bacteria | 2325 |
| 420 | Ga0207695_10000447 | 3300025913 | Bacteria | 90113 |
| 421 | Ga0207695_10000981 | 3300025913 | Bacteria | 50713 |
| 422 | Ga0207695_10001513 | 3300025913 | Bacteria | 38611 |
| 423 | Ga0207695_10070708 | 3300025913 | Bacteria | 3566 |
| 424 | Ga0207695_10076603 | 3300025913 | Unclassified | 3400 |
| 425 | Ga0207695_10095047 | 3300025913 | Bacteria | 2986 |
| 426 | Ga0207695_10329866 | 3300025913 | Bacteria | 1415 |
| 427 | Ga0207671_10003297 | 3300025914 | Bacteria | 16239 |
| 428 | Ga0207671_10003862 | 3300025914 | Bacteria | 14653 |
| 429 | Ga0207671_10011590 | 3300025914 | Bacteria | 7160 |
| 430 | Ga0207671_10024218 | 3300025914 | Bacteria | 4568 |
| 431 | Ga0207693_10137585 | 3300025915 | Bacteria | 1920 |
| 432 | Ga0207693_10138535 | 3300025915 | Bacteria | 1913 |
| 433 | Ga0207663_10037807 | 3300025916 | Bacteria | 2912 |
| 434 | Ga0207660_10001071 | 3300025917 | Bacteria | 18194 |
| 435 | Ga0207660_10014345 | 3300025917 | Bacteria | 5209 |
| 436 | Ga0207660_10056512 | 3300025917 | Bacteria | 2808 |
| 437 | Ga0207660_10093975 | 3300025917 | Bacteria | 2228 |
| 438 | Ga0207662_10005034 | 3300025918 | Bacteria | 6998 |
| 439 | Ga0207662_10079337 | 3300025918 | Bacteria | 2000 |
| 440 | Ga0207657_10022694 | 3300025919 | Bacteria | 5864 |
| 441 | Ga0207649_10031771 | 3300025920 | Unclassified | 3142 |
| 442 | Ga0207649_10051738 | 3300025920 | Bacteria | 2545 |
| 443 | Ga0207652_10002086 | 3300025921 | Bacteria | 17188 |
| 444 | Ga0207652_10005743 | 3300025921 | Bacteria | 10070 |
| 445 | Ga0207652_10006129 | 3300025921 | Bacteria | 9725 |
| 446 | Ga0207652_10075011 | 3300025921 | Bacteria | 2946 |
| 447 | Ga0207652_10389604 | 3300025921 | Bacteria | 1257 |
| 448 | Ga0207681_10041283 | 3300025923 | Bacteria | 3075 |
| 449 | Ga0207681_10104339 | 3300025923 | Bacteria | 2050 |
| 450 | Ga0207681_10296319 | 3300025923 | Bacteria | 1278 |
| 451 | Ga0207694_10013060 | 3300025924 | Bacteria | 6252 |
| 452 | Ga0207694_10109317 | 3300025924 | Bacteria | 2198 |
| 453 | Ga0207694_10180929 | 3300025924 | Bacteria | 1710 |
| 454 | Ga0207694_10358801 | 3300025924 | Bacteria | 1207 |
| 455 | Ga0207650_10022263 | 3300025925 | Bacteria | 4484 |
| 456 | Ga0207650_10086755 | 3300025925 | Bacteria | 2383 |
| 457 | Ga0207659_10182014 | 3300025926 | Bacteria | 1665 |
| 458 | Ga0207687_10001602 | 3300025927 | Bacteria | 15584 |
| 459 | Ga0207700_10020058 | 3300025928 | Bacteria | 4531 |
| 460 | Ga0207664_10071023 | 3300025929 | Bacteria | 2803 |
| 461 | Ga0207644_10106061 | 3300025931 | Unclassified | 2118 |
| 462 | Ga0207644_10140886 | 3300025931 | Bacteria | 1857 |
| 463 | Ga0207690_10000580 | 3300025932 | Bacteria | 23700 |
| 464 | Ga0207690_10018108 | 3300025932 | Bacteria | 4316 |
| 465 | Ga0207706_10007512 | 3300025933 | Bacteria | 10085 |
| 466 | Ga0207686_10000270 | 3300025934 | Bacteria | 38522 |
| 467 | Ga0207686_10012278 | 3300025934 | Bacteria | 4707 |
| 468 | Ga0207709_10001682 | 3300025935 | Bacteria | 14896 |
| 469 | Ga0207709_10028242 | 3300025935 | Bacteria | 3243 |
| 470 | Ga0207709_10271990 | 3300025935 | Bacteria | 1247 |
| 471 | Ga0207670_10002057 | 3300025936 | Bacteria | 10535 |
| 472 | Ga0207669_10035175 | 3300025937 | Bacteria | 2847 |
| 473 | Ga0207669_10372673 | 3300025937 | Bacteria | 1110 |
| 474 | Ga0207669_10591160 | 3300025937 | Bacteria | 901 |
| 475 | Ga0207704_10000300 | 3300025938 | Bacteria | 23352 |
| 476 | Ga0207704_10007021 | 3300025938 | Bacteria | 5291 |
| 477 | Ga0207704_10063938 | 3300025938 | Bacteria | 2296 |
| 478 | Ga0207665_10023537 | 3300025939 | Unclassified | 4057 |
| 479 | Ga0207665_10095580 | 3300025939 | Bacteria | 2065 |
| 480 | Ga0207691_10011068 | 3300025940 | Bacteria | 8659 |
| 481 | Ga0207691_10184588 | 3300025940 | Bacteria | 1821 |
| 482 | Ga0207691_10200216 | 3300025940 | Bacteria | 1738 |
| 483 | Ga0207691_10255017 | 3300025940 | Bacteria | 1513 |
| 484 | Ga0207711_10739052 | 3300025941 | Bacteria | 917 |
| 485 | Ga0207689_10000221 | 3300025942 | Bacteria | 50498 |
| 486 | Ga0207689_10000691 | 3300025942 | Bacteria | 32302 |
| 487 | Ga0207689_10001629 | 3300025942 | Bacteria | 21257 |
| 488 | Ga0207689_10005271 | 3300025942 | Bacteria | 11586 |
| 489 | Ga0207689_10016285 | 3300025942 | Bacteria | 6298 |
| 490 | Ga0207689_10078866 | 3300025942 | Bacteria | 2706 |
| 491 | Ga0207689_10158614 | 3300025942 | Bacteria | 1865 |
| 492 | Ga0207689_10284416 | 3300025942 | Bacteria | 1369 |
| 493 | Ga0207661_10021338 | 3300025944 | Bacteria | 4851 |
| 494 | Ga0207661_10760263 | 3300025944 | Bacteria | 892 |
| 495 | Ga0207679_10001048 | 3300025945 | Bacteria | 17592 |
| 496 | Ga0207667_10000470 | 3300025949 | Bacteria | 53903 |
| 497 | Ga0207667_10002649 | 3300025949 | Bacteria | 22123 |
| 498 | Ga0207667_10019350 | 3300025949 | Bacteria | 7603 |
| 499 | Ga0207667_10020540 | 3300025949 | Bacteria | 7340 |
| 500 | Ga0207667_10033267 | 3300025949 | Bacteria | 5545 |
| 501 | Ga0207667_10054740 | 3300025949 | Bacteria | 4196 |
| 502 | Ga0207651_10056408 | 3300025960 | Bacteria | 2703 |
| 503 | Ga0207651_10563008 | 3300025960 | Bacteria | 992 |
| 504 | Ga0207712_10010320 | 3300025961 | Bacteria | 5930 |
| 505 | Ga0207712_10017624 | 3300025961 | Bacteria | 4643 |
| 506 | Ga0207712_10356374 | 3300025961 | Bacteria | 1218 |
| 507 | Ga0207668_10577019 | 3300025972 | Bacteria | 977 |
| 508 | Ga0207640_10008666 | 3300025981 | Bacteria | 5655 |
| 509 | Ga0207640_10028508 | 3300025981 | Bacteria | 3415 |
| 510 | Ga0207658_10135792 | 3300025986 | Unclassified | 1983 |
| 511 | Ga0207658_10382200 | 3300025986 | Bacteria | 1233 |
| 512 | Ga0207677_10001318 | 3300026023 | Bacteria | 13337 |
| 513 | Ga0207677_10010758 | 3300026023 | Bacteria | 5187 |
| 514 | Ga0207677_10157680 | 3300026023 | Bacteria | 1760 |
| 515 | Ga0207677_10160363 | 3300026023 | Bacteria | 1747 |
| 516 | Ga0207703_10007452 | 3300026035 | Bacteria | 8690 |
| 517 | Ga0207703_10011205 | 3300026035 | Bacteria | 6976 |
| 518 | Ga0207703_10055904 | 3300026035 | Unclassified | 3212 |
| 519 | Ga0207703_10544239 | 3300026035 | Bacteria | 1094 |
| 520 | Ga0207639_10002258 | 3300026041 | Bacteria | 12947 |
| 521 | Ga0207639_10037344 | 3300026041 | Bacteria | 3608 |
| 522 | Ga0207639_10158976 | 3300026041 | Bacteria | 1902 |
| 523 | Ga0207639_10195143 | 3300026041 | Bacteria | 1732 |
| 524 | Ga0207639_10626435 | 3300026041 | Unclassified | 994 |
| 525 | Ga0207678_10004149 | 3300026067 | Bacteria | 13013 |
| 526 | Ga0207678_10004263 | 3300026067 | Bacteria | 12822 |
| 527 | Ga0207708_10000182 | 3300026075 | Bacteria | 49271 |
| 528 | Ga0207702_10000478 | 3300026078 | Bacteria | 44978 |
| 529 | Ga0207702_10001365 | 3300026078 | Bacteria | 24327 |
| 530 | Ga0207702_10011253 | 3300026078 | Bacteria | 7459 |
| 531 | Ga0207702_10052786 | 3300026078 | Bacteria | 3441 |
| 532 | Ga0207702_10132840 | 3300026078 | Bacteria | 2242 |
| 533 | Ga0207702_10304378 | 3300026078 | Bacteria | 1514 |
| 534 | Ga0207641_10000917 | 3300026088 | Bacteria | 30463 |
| 535 | Ga0207641_10034109 | 3300026088 | Bacteria | 4231 |
| 536 | Ga0207641_10225130 | 3300026088 | Bacteria | 1741 |
| 537 | Ga0207648_10000335 | 3300026089 | Bacteria | 51594 |
| 538 | Ga0207648_10000431 | 3300026089 | Bacteria | 46287 |
| 539 | Ga0207648_10001752 | 3300026089 | Bacteria | 23762 |
| 540 | Ga0207648_10003980 | 3300026089 | Bacteria | 15344 |
| 541 | Ga0207648_10134921 | 3300026089 | Unclassified | 2174 |
| 542 | Ga0207648_10452331 | 3300026089 | Bacteria | 1169 |
| 543 | Ga0207648_10530785 | 3300026089 | Bacteria | 1079 |
| 544 | Ga0207676_10094151 | 3300026095 | Bacteria | 2468 |
| 545 | Ga0207676_10211309 | 3300026095 | Bacteria | 1721 |
| 546 | Ga0207676_10242588 | 3300026095 | Bacteria | 1617 |
| 547 | Ga0207674_10001830 | 3300026116 | Bacteria | 27116 |
| 548 | Ga0207674_10003552 | 3300026116 | Bacteria | 19027 |
| 549 | Ga0207675_100000142 | 3300026118 | Bacteria | 61826 |
| 550 | Ga0207675_100003028 | 3300026118 | Bacteria | 16486 |
| 551 | Ga0207675_100003408 | 3300026118 | Bacteria | 15514 |
| 552 | Ga0207675_100080727 | 3300026118 | Bacteria | 3049 |
| 553 | Ga0207675_100110510 | 3300026118 | Bacteria | 2593 |
| 554 | Ga0207683_10005101 | 3300026121 | Bacteria | 11268 |
| 555 | Ga0207683_10076639 | 3300026121 | Bacteria | 2961 |
| 556 | Ga0207683_10710516 | 3300026121 | Bacteria | 932 |
| 557 | Ga0207698_10004374 | 3300026142 | Bacteria | 8601 |
| 558 | Ga0207698_10069224 | 3300026142 | Unclassified | 2790 |
| 559 | Ga0209967_1000788 | 3300027364 | Bacteria | 4060 |
| 560 | Ga0209999_1020235 | 3300027543 | Bacteria | 1221 |
| 561 | Ga0209966_1000629 | 3300027695 | Bacteria | 8042 |
| 562 | Ga0209966_1033118 | 3300027695 | Bacteria | 1054 |
| 563 | Ga0209998_10027075 | 3300027717 | Bacteria | 1255 |
| 564 | Ga0207428_10018998 | 3300027907 | Bacteria | 5861 |
| 565 | Ga0207428_10128446 | 3300027907 | Bacteria | 1941 |
| 566 | Ga0207428_10294028 | 3300027907 | Bacteria | 1203 |
| 567 | Ga0268266_10001354 | 3300028379 | Bacteria | 29590 |
| 568 | Ga0268265_10001417 | 3300028380 | Bacteria | 20290 |
| 569 | Ga0268265_10002935 | 3300028380 | Bacteria | 12490 |
| 570 | Ga0268265_10008236 | 3300028380 | Bacteria | 7041 |
| 571 | Ga0268265_10027105 | 3300028380 | Bacteria | 4085 |
| 572 | Ga0268264_10000446 | 3300028381 | Bacteria | 56436 |
| 573 | Ga0268264_10001724 | 3300028381 | Bacteria | 20126 |
| 574 | Ga0268264_10007023 | 3300028381 | Bacteria | 9444 |
| 575 | Ga0268264_10011385 | 3300028381 | Bacteria | 7348 |
| 576 | Ga0268264_10011455 | 3300028381 | Bacteria | 7322 |
| 577 | Ga0268264_10019070 | 3300028381 | Bacteria | 5608 |
| 578 | Ga0268264_10079100 | 3300028381 | Bacteria | 2804 |
| 579 | Ga0268264_11002755 | 3300028381 | Bacteria | 842 |
| 580 | Ga0265334_10027674 | 3300028573 | Bacteria | 2282 |
| 581 | Ga0307515_10000780 | 3300028794 | Bacteria | 73338 |
| 582 | Ga0307515_10120366 | 3300028794 | Bacteria | 2979 |
| 583 | Ga0307515_10165858 | 3300028794 | Bacteria | 2227 |
| 584 | Ga0265338_10001087 | 3300028800 | Bacteria | 45161 |
| 585 | Ga0265338_10073524 | 3300028800 | Bacteria | 2912 |
| 586 | Ga0316177_1218224 | 3300030731 | Bacteria | 11197 |
| 587 | Ga0316176_1009119 | 3300030732 | Bacteria | 30051 |
| 588 | Ga0265330_10055867 | 3300031235 | Bacteria | 1723 |
| 589 | Ga0265328_10093473 | 3300031239 | Bacteria | 1111 |
| 590 | Ga0265325_10011356 | 3300031241 | Bacteria | 5118 |
| 591 | Ga0265325_10040338 | 3300031241 | Bacteria | 2452 |
| 592 | Ga0265325_10234771 | 3300031241 | Bacteria | 835 |
| 593 | Ga0265340_10082256 | 3300031247 | Bacteria | 1514 |
| 594 | Ga0265339_10009178 | 3300031249 | Bacteria | 6240 |
| 595 | Ga0265331_10023684 | 3300031250 | Bacteria | 3116 |
| 596 | Ga0265331_10102166 | 3300031250 | Bacteria | 1319 |
| 597 | Ga0265316_10065851 | 3300031344 | Bacteria | 2805 |
| 598 | Ga0265316_10173322 | 3300031344 | Bacteria | 1608 |
| 599 | Ga0307513_10074102 | 3300031456 | Bacteria | 3542 |
| 600 | Ga0307408_100000680 | 3300031548 | Bacteria | 28079 |
| 601 | Ga0307408_100000772 | 3300031548 | Bacteria | 25748 |
| 602 | Ga0307408_100187965 | 3300031548 | Bacteria | 1662 |
| 603 | Ga0307408_100607829 | 3300031548 | Bacteria | 972 |
| 604 | Ga0265313_10001509 | 3300031595 | Bacteria | 21674 |
| 605 | Ga0265313_10027399 | 3300031595 | Bacteria | 2983 |
| 606 | Ga0307508_10221917 | 3300031616 | Bacteria | 1490 |
| 607 | Ga0265314_10028336 | 3300031711 | Bacteria | 4176 |
| 608 | Ga0265314_10281754 | 3300031711 | Bacteria | 940 |
| 609 | Ga0265342_10072640 | 3300031712 | Bacteria | 2002 |
| 610 | Ga0265342_10294420 | 3300031712 | Bacteria | 856 |
| 611 | Ga0307516_10027197 | 3300031730 | Bacteria | 5801 |
| 612 | Ga0307405_10003388 | 3300031731 | Bacteria | 7316 |
| 613 | Ga0307406_10011623 | 3300031901 | Bacteria | 5000 |
| 614 | Ga0307407_10146169 | 3300031903 | Bacteria | 1531 |
| 615 | Ga0307412_10052192 | 3300031911 | Bacteria | 2707 |
| 616 | Ga0307412_10108218 | 3300031911 | Bacteria | 1980 |
| 617 | Ga0307416_100191912 | 3300032002 | Bacteria | 1928 |
| 618 | Ga0307416_100340555 | 3300032002 | Bacteria | 1512 |
| 619 | Ga0307416_100560253 | 3300032002 | Bacteria | 1217 |
| 620 | Ga0307414_10000016 | 3300032004 | Bacteria | 249029 |
| 621 | Ga0307411_10411911 | 3300032005 | Bacteria | 1120 |
| 622 | Ga0307415_100141034 | 3300032126 | Bacteria | 1841 |
| 623 | Ga0373930_0010936 | 3300034816 | Bacteria | 1630 |
| 624 | Ga0373948_0015981 | 3300034817 | Bacteria | 1383 |
| 625 | Ga0373958_0017718 | 3300034819 | Bacteria | 1284 |
| 626 | Ga0373958_0068708 | 3300034819 | Bacteria | 782 |
| 627 | Ga0373926_0082549 | 3300035083 | Bacteria | 1190 |
| 628 | Ga0373928_0004360 | 3300035084 | Bacteria | 2699 |
| 629 | Ga0373940_0002085 | 3300035088 | Bacteria | 3803 |
| 630 | Ga0373944_0039613 | 3300035089 | Bacteria | 1451 |
| 631 | Ga0373949_0020677 | 3300035090 | Bacteria | 1508 |
| 632 | Ga0373949_0060538 | 3300035090 | Bacteria | 973 |
| 633 | Ga0373952_0007454 | 3300035092 | Bacteria | 2050 |
| 634 | Ga0373923_0154820 | 3300035111 | Bacteria | 1043 |
| 635 | Ga0373932_0006537 | 3300035112 | Bacteria | 2759 |
| 636 | Ga0373941_0003696 | 3300035115 | Bacteria | 3483 |
| 637 | Ga0373941_0014617 | 3300035115 | Bacteria | 2101 |
| 638 | Ga0373941_0034044 | 3300035115 | Bacteria | 1534 |
| 639 | Ga0373945_0003490 | 3300035116 | Bacteria | 4950 |
| 640 | Ga0373956_0007441 | 3300035119 | Bacteria | 4412 |
| 641 | Ga0373960_0043733 | 3300035121 | Bacteria | 1306 |
| 642 | Ga0373943_0033444 | 3300035170 | Bacteria | 2449 |
| 643 | Ga0373943_0180261 | 3300035170 | Bacteria | 1160 |
| 644 | Ga0373946_0040564 | 3300035171 | Bacteria | 1905 |
| 645 | Ga0373955_0013176 | 3300035172 | Bacteria | 3989 |
| 646 | Ga0373955_0233727 | 3300035172 | Bacteria | 1100 |
| 647 | Ga0373942_0047256 | 3300035207 | Bacteria | 1195 |
| 648 | Ga0373942_0097509 | 3300035207 | Bacteria | 894 |
| 649 | Ga0373961_0006309 | 3300035241 | Bacteria | 2850 |
| 650 | Ga0373962_0013313 | 3300035242 | Bacteria | 2081 |
| 651 | Ga0373962_0015296 | 3300035242 | Bacteria | 1966 |
| 652 | Ga0373962_0026211 | 3300035242 | Bacteria | 1570 |
| 653 | Ga0373962_0060218 | 3300035242 | Bacteria | 1114 |
| 654 | Ga0373924_0131718 | 3300035410 | Bacteria | 1088 |
| 655 | Ga0373931_0001739 | 3300035691 | Bacteria | 9437 |
| 656 | Ga0373931_0011415 | 3300035691 | Bacteria | 4292 |
| 657 | Ga0373931_0126329 | 3300035691 | Bacteria | 1467 |
| 658 | Ga0373931_0138851 | 3300035691 | Bacteria | 1405 |
| 659 | Ga0373931_0159877 | 3300035691 | Bacteria | 1320 |
| 660 | Ga0373931_0161601 | 3300035691 | Bacteria | 1313 |
| 661 | Ga0373931_0417780 | 3300035691 | Bacteria | 852 |
| 662 | Ga0373935_0002957 | 3300035692 | Bacteria | 9799 |
| 663 | Ga0373935_0010318 | 3300035692 | Bacteria | 5602 |
| 664 | Ga0373927_0001543 | 3300035695 | Bacteria | 17297 |
| 665 | Ga0373927_0050202 | 3300035695 | Bacteria | 2697 |
| 666 | Ga0373927_0053201 | 3300035695 | Bacteria | 2618 |
| 667 | Ga0373933_0005686 | 3300035724 | Bacteria | 6785 |
| 668 | Ga0373947_0017843 | 3300035725 | Bacteria | 4083 |
| 669 | Ga0373947_0026688 | 3300035725 | Bacteria | 3377 |
| 670 | Ga0373937_0006609 | 3300036401 | Bacteria | 10013 |
| 671 | Ga0373937_0367677 | 3300036401 | Bacteria | 1363 |
| 672 | Ga0373937_0422382 | 3300036401 | Bacteria | 1265 |
| 673 | Ga0373937_0628076 | 3300036401 | Bacteria | 1019 |
| 674 | Ga0373925_0021920 | 3300037068 | Bacteria | 4657 |
| 675 | Ga0373925_0063291 | 3300037068 | Bacteria | 2783 |
| 676 | Ga0373925_0086777 | 3300037068 | Bacteria | 2388 |
| 677 | Ga0373925_0098350 | 3300037068 | Bacteria | 2245 |
| 678 | Ga0373925_0436447 | 3300037068 | Bacteria | 1071 |
| 679 | Ga0395900_0002841 | 3300037418 | Bacteria | 18899 |
| 680 | Ga0395898_0012313 | 3300037466 | Bacteria | 8844 |
| 681 | Ga0436364_0033237 | 3300037853 | Bacteria | 23647 |
| 682 | Ga0436364_0056330 | 3300037853 | Bacteria | 3260 |
| 683 | Ga0436364_0110942 | 3300037853 | Bacteria | 1347 |
| 684 | Ga0436364_0304718 | 3300037853 | Bacteria | 4030 |
| 685 | Ga0436364_0431951 | 3300037853 | Bacteria | 888 |
| 686 | Ga0436364_0475448 | 3300037853 | Bacteria | 15369 |
| 687 | Ga0436364_0742249 | 3300037853 | Bacteria | 10808 |
| 688 | Ga0436364_1204625 | 3300037853 | Bacteria | 4866 |
| 689 | Ga0436364_1395508 | 3300037853 | Bacteria | 1371 |
| 690 | Ga0395901_0255900 | 3300038443 | Bacteria | 1823 |
| 691 | Ga0436365_0017438 | 3300039437 | Bacteria | 3666 |
| 692 | Ga0436365_0132947 | 3300039437 | Bacteria | 841 |
| 693 | Ga0436365_0232658 | 3300039437 | Bacteria | 2164 |
| 694 | Ga0436365_0366029 | 3300039437 | Unclassified | 1783 |
| 695 | Ga0436365_0367776 | 3300039437 | Bacteria | 15477 |
| 696 | Ga0436365_0516288 | 3300039437 | Bacteria | 9306 |
| 697 | Ga0436365_0854068 | 3300039437 | Bacteria | 4868 |
| 698 | Ga0436365_1013679 | 3300039437 | Bacteria | 2272 |
| 699 | Ga0436365_1085262 | 3300039437 | Bacteria | 31252 |
| 700 | Ga0436365_1119339 | 3300039437 | Unclassified | 845 |
| 701 | Ga0436365_1453878 | 3300039437 | Bacteria | 1125 |
| 702 | Ga0436360_0023372 | 3300039438 | Bacteria | 16827 |
| 703 | Ga0436360_0781382 | 3300039438 | Bacteria | 3412 |
| 704 | Ga0436361_0051074 | 3300039447 | Bacteria | 3147 |
| 705 | Ga0436363_1135077 | 3300039450 | Bacteria | 1603 |
| 706 | Ga0436363_1305199 | 3300039450 | Bacteria | 1449 |
| 707 | Ga0439466_0002570 | 3300041411 | Bacteria | 7106 |
| 708 | Ga0439465_0000313 | 3300041413 | Bacteria | 13742 |
| 709 | Ga0439431_0002613 | 3300041997 | Bacteria | 3974 |
| 710 | Ga0439433_0000146 | 3300041999 | Bacteria | 10818 |
| 711 | Ga0439445_0001088 | 3300042004 | Bacteria | 5805 |
| 712 | Ga0439448_0003193 | 3300042005 | Bacteria | 4525 |
| 713 | Ga0439432_001514 | 3300042006 | Bacteria | 8732 |
| 714 | Ga0439449_0003854 | 3300042007 | Bacteria | 5814 |
| 715 | Ga0439451_023991 | 3300042009 | Bacteria | 1229 |
| 716 | Ga0439452_001104 | 3300042010 | Bacteria | 11863 |
| 717 | Ga0439455_0003418 | 3300042012 | Bacteria | 3032 |
| 718 | Ga0439446_0006709 | 3300042156 | Bacteria | 3011 |
| 719 | Ga0439458_0057479 | 3300042157 | Bacteria | 967 |
| 720 | Ga0439459_0002068 | 3300042438 | Bacteria | 3057 |
| 721 | Ga0439460_0020002 | 3300042461 | Bacteria | 1817 |
| 722 | Ga0466961_0189829 | 3300044693 | Bacteria | 1274 |
| 723 | Ga0466963_0043041 | 3300044694 | Bacteria | 2967 |
| 724 | Ga0466957_0097914 | 3300044842 | Bacteria | 1845 |
| 725 | Ga0451576_0025200 | 3300045051 | Bacteria | 6410 |
| 726 | Ga0451576_0026393 | 3300045051 | Bacteria | 6248 |
| 727 | Ga0451576_0885048 | 3300045051 | Bacteria | 937 |
| 728 | Ga0451576_0987397 | 3300045051 | Bacteria | 883 |
| 729 | Ga0466967_0051569 | 3300045976 | Bacteria | 3606 |
| 730 | Ga0466967_0141490 | 3300045976 | Bacteria | 2241 |
| 731 | Ga0495629_0000222 | 3300046459 | Bacteria | 50600 |
| 732 | Ga0495629_0191393 | 3300046459 | Bacteria | 1416 |
| 733 | Ga0495638_0094375 | 3300046460 | Bacteria | 1798 |
| 734 | Ga0495653_0316711 | 3300046463 | Bacteria | 1012 |
| 735 | Ga0495580_0191272 | 3300046472 | Bacteria | 1411 |
| 736 | Ga0495580_0413769 | 3300046472 | Bacteria | 908 |
| 737 | Ga0495582_0009126 | 3300046473 | Bacteria | 5472 |
| 738 | Ga0495639_0023702 | 3300046475 | Bacteria | 2698 |
| 739 | Ga0495662_0195321 | 3300046476 | Bacteria | 997 |
| 740 | Ga0495664_0026349 | 3300046477 | Bacteria | 3385 |
| 741 | Ga0495594_0011694 | 3300046499 | Bacteria | 4563 |
| 742 | Ga0495594_0036706 | 3300046499 | Bacteria | 2673 |
| 743 | Ga0495596_0066620 | 3300046500 | Bacteria | 1400 |
| 744 | Ga0495583_0016024 | 3300046506 | Bacteria | 4047 |
| 745 | Ga0495620_0011112 | 3300046515 | Bacteria | 4714 |
| 746 | Ga0495642_0128320 | 3300046528 | Bacteria | 1091 |
| 747 | Ga0495654_0037248 | 3300046530 | Bacteria | 2440 |
| 748 | Ga0495654_0107115 | 3300046530 | Bacteria | 1279 |
| 749 | Ga0495665_0185269 | 3300046531 | Bacteria | 1081 |
| 750 | Ga0495586_0058460 | 3300046535 | Bacteria | 2094 |
| 751 | Ga0495597_0094854 | 3300046542 | Bacteria | 1263 |
| 752 | Ga0495635_0031149 | 3300046663 | Bacteria | 3705 |
| 753 | Ga0495659_0013095 | 3300046664 | Bacteria | 2698 |
| 754 | Ga0495661_0104172 | 3300046665 | Bacteria | 1591 |
| 755 | Ga0495588_0037850 | 3300046674 | Bacteria | 2452 |
| 756 | Ga0495588_0071485 | 3300046674 | Bacteria | 1804 |
| 757 | Ga0495657_0031006 | 3300046675 | Bacteria | 3740 |
| 758 | Ga0495657_0056795 | 3300046675 | Bacteria | 2605 |
| 759 | Ga0495647_0002929 | 3300046681 | Bacteria | 5409 |
| 760 | Ga0495647_0004541 | 3300046681 | Bacteria | 4516 |
| 761 | Ga0495658_0001062 | 3300046683 | Bacteria | 14503 |
| 762 | Ga0495658_0035110 | 3300046683 | Bacteria | 2756 |
| 763 | Ga0495613_0007724 | 3300046689 | Bacteria | 8000 |
| 764 | Ga0495670_0135367 | 3300046691 | Bacteria | 1286 |
| 765 | Ga0495581_0033186 | 3300047315 | Bacteria | 2989 |
| 766 | Ga0495604_0111697 | 3300047317 | Bacteria | 1992 |
| 767 | Ga0495674_0127408 | 3300047319 | Bacteria | 2146 |
| 768 | Ga0495676_0146869 | 3300047321 | Bacteria | 1683 |
| 769 | Ga0495680_0017400 | 3300047322 | Bacteria | 6140 |
| 770 | Ga0495683_0103673 | 3300047323 | Bacteria | 1365 |
| 771 | Ga0495673_0105577 | 3300047469 | Bacteria | 1133 |
| 772 | Ga0495686_0001554 | 3300047472 | Bacteria | 24493 |
| 773 | Ga0495593_0004258 | 3300047673 | Bacteria | 8516 |
| 774 | Ga0496100_0004958 | 3300048903 | Bacteria | 7116 |
| 775 | Ga0496100_0492526 | 3300048903 | Bacteria | 944 |
| 776 | Ga0496101_0010804 | 3300048904 | Bacteria | 6040 |
| 777 | Ga0496101_0025281 | 3300048904 | Bacteria | 4119 |
| 778 | Ga0496101_0161270 | 3300048904 | Bacteria | 1720 |
| 779 | Ga0496102_0017750 | 3300048905 | Bacteria | 6237 |
| 780 | Ga0496102_0087362 | 3300048905 | Bacteria | 2881 |
| 781 | Ga0496102_0344786 | 3300048905 | Bacteria | 1402 |
| 782 | Ga0496103_0009241 | 3300048906 | Bacteria | 5840 |
| 783 | Ga0496104_0003649 | 3300048907 | Bacteria | 13294 |
| 784 | Ga0496104_0020599 | 3300048907 | Bacteria | 6047 |
| 785 | Ga0496105_0040625 | 3300048908 | Bacteria | 3835 |
| 786 | Ga0496105_0055070 | 3300048908 | Unclassified | 3284 |
| 787 | Ga0496105_0708422 | 3300048908 | Bacteria | 772 |
| 788 | Ga0496106_0011860 | 3300048909 | Bacteria | 6434 |
| 789 | Ga0496106_0015661 | 3300048909 | Bacteria | 5608 |
| 790 | Ga0496107_0032503 | 3300048910 | Bacteria | 3729 |
| 791 | Ga0496108_0442640 | 3300048911 | Bacteria | 1135 |
| 792 | Ga0496108_0455065 | 3300048911 | Bacteria | 1118 |
| 793 | Ga0496110_0028940 | 3300048913 | Bacteria | 4762 |
| 794 | Ga0496110_0601488 | 3300048913 | Bacteria | 997 |
| 795 | Ga0496111_0075975 | 3300048914 | Bacteria | 2448 |
| 796 | Ga0496111_0137323 | 3300048914 | Bacteria | 1811 |
| 797 | Ga0496113_0092657 | 3300048916 | Bacteria | 2331 |
| 798 | Ga0496114_0057007 | 3300048917 | Bacteria | 3261 |
| 799 | Ga0496114_0820230 | 3300048917 | Bacteria | 809 |
| 800 | Ga0496114_0946218 | 3300048917 | Bacteria | 744 |
| 801 | Ga0496115_0143139 | 3300048918 | Bacteria | 1972 |
| 802 | Ga0496116_0024577 | 3300048919 | Bacteria | 4450 |
| 803 | Ga0496119_0054141 | 3300048922 | Bacteria | 2445 |
| 804 | Ga0496121_0022068 | 3300048924 | Bacteria | 6198 |
| 805 | Ga0496125_0006156 | 3300048928 | Bacteria | 13080 |
| 806 | Ga0496125_0011331 | 3300048928 | Bacteria | 8929 |
| 807 | Ga0501032_0120235 | 3300049569 | Bacteria | 1736 |
| 808 | Ga0501033_0020528 | 3300049570 | Bacteria | 4991 |
| 809 | Ga0501033_0022299 | 3300049570 | Unclassified | 4777 |
| 810 | Ga0501033_0211373 | 3300049570 | Bacteria | 1383 |
| 811 | Ga0501034_0000211 | 3300049571 | Bacteria | 110858 |
| 812 | Ga0501034_0002398 | 3300049571 | Bacteria | 22707 |
| 813 | Ga0501034_0071326 | 3300049571 | Bacteria | 3483 |
| 814 | Ga0501034_0579508 | 3300049571 | Bacteria | 1029 |
| 815 | Ga0501036_0000172 | 3300049572 | Bacteria | 42511 |
| 816 | Ga0501036_0068822 | 3300049572 | Bacteria | 2995 |
| 817 | Ga0501036_0135356 | 3300049572 | Bacteria | 2080 |
| 818 | Ga0501037_0003588 | 3300049573 | Bacteria | 11261 |
| 819 | Ga0501037_0010884 | 3300049573 | Bacteria | 6684 |
| 820 | Ga0501037_0012297 | 3300049573 | Bacteria | 6299 |
| 821 | Ga0501037_0244558 | 3300049573 | Bacteria | 1257 |
| 822 | Ga0501038_0009989 | 3300049574 | Bacteria | 8690 |
| 823 | Ga0501038_0485133 | 3300049574 | Bacteria | 947 |
| 824 | Ga0501039_0041205 | 3300049575 | Bacteria | 3566 |
| 825 | Ga0501039_0183575 | 3300049575 | Bacteria | 1645 |
| 826 | Ga0501039_0297789 | 3300049575 | Bacteria | 1268 |
| 827 | Ga0501040_0007181 | 3300049576 | Bacteria | 7215 |
| 828 | Ga0501040_0261555 | 3300049576 | Bacteria | 1235 |
| 829 | Ga0501041_0003733 | 3300049577 | Bacteria | 8756 |
| 830 | Ga0501041_0050340 | 3300049577 | Bacteria | 2539 |
| 831 | Ga0501042_0021279 | 3300049578 | Bacteria | 4517 |
| 832 | Ga0501042_0288295 | 3300049578 | Bacteria | 1186 |
| 833 | Ga0501043_0010430 | 3300049579 | Bacteria | 7280 |
| 834 | Ga0501043_0013340 | 3300049579 | Bacteria | 6425 |
| 835 | Ga0501043_0023537 | 3300049579 | Bacteria | 4830 |
| 836 | Ga0501043_0164148 | 3300049579 | Bacteria | 1735 |
| 837 | Ga0501043_0329329 | 3300049579 | Bacteria | 1163 |
| 838 | Ga0501046_0000249 | 3300049580 | Bacteria | 55198 |
| 839 | Ga0501046_0007428 | 3300049580 | Bacteria | 9634 |
| 840 | Ga0501046_0028558 | 3300049580 | Bacteria | 4542 |
| 841 | Ga0501046_0101883 | 3300049580 | Bacteria | 2202 |
| 842 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 843 | Ga0501047_0013674 | 3300049581 | Bacteria | 7704 |
| 844 | Ga0501047_0014463 | 3300049581 | Bacteria | 7505 |
| 845 | Ga0501047_0023276 | 3300049581 | Bacteria | 5948 |
| 846 | Ga0501047_0139275 | 3300049581 | Bacteria | 2306 |
| 847 | Ga0501047_0161027 | 3300049581 | Bacteria | 2116 |
| 848 | Ga0501047_0546302 | 3300049581 | Bacteria | 983 |
| 849 | Ga0501048_0014062 | 3300049582 | Bacteria | 5931 |
| 850 | Ga0501048_0308426 | 3300049582 | Bacteria | 1126 |
| 851 | Ga0501068_0008197 | 3300049584 | Bacteria | 5808 |
| 852 | Ga0501069_0063768 | 3300049585 | Bacteria | 2058 |
| 853 | Ga0501070_0009756 | 3300049586 | Bacteria | 8121 |
| 854 | Ga0501070_0014041 | 3300049586 | Bacteria | 6742 |
| 855 | Ga0501070_0050118 | 3300049586 | Bacteria | 3466 |
| 856 | Ga0501070_0242705 | 3300049586 | Bacteria | 1474 |
| 857 | Ga0501070_0445668 | 3300049586 | Bacteria | 1044 |
| 858 | Ga0501071_0096340 | 3300049587 | Bacteria | 2178 |
| 859 | Ga0501071_0119031 | 3300049587 | Bacteria | 1957 |
| 860 | Ga0501071_0227462 | 3300049587 | Bacteria | 1405 |
| 861 | Ga0501071_0292800 | 3300049587 | Bacteria | 1233 |
| 862 | Ga0501071_0406244 | 3300049587 | Bacteria | 1040 |
| 863 | Ga0501072_0014962 | 3300049588 | Bacteria | 5947 |
| 864 | Ga0501072_0023506 | 3300049588 | Bacteria | 4788 |
| 865 | Ga0501072_0031936 | 3300049588 | Bacteria | 4122 |
| 866 | Ga0501072_0033674 | 3300049588 | Bacteria | 4015 |
| 867 | Ga0501072_0200245 | 3300049588 | Bacteria | 1592 |
| 868 | Ga0501073_0006056 | 3300049589 | Bacteria | 9024 |
| 869 | Ga0501073_0058508 | 3300049589 | Bacteria | 2693 |
| 870 | Ga0501073_0074862 | 3300049589 | Bacteria | 2357 |
| 871 | Ga0501073_0101490 | 3300049589 | Bacteria | 1998 |
| 872 | Ga0501073_0103508 | 3300049589 | Bacteria | 1976 |
| 873 | Ga0501074_0007830 | 3300049590 | Bacteria | 7737 |
| 874 | Ga0501074_0042094 | 3300049590 | Bacteria | 3306 |
| 875 | Ga0501074_0181684 | 3300049590 | Bacteria | 1500 |
| 876 | Ga0501074_0228845 | 3300049590 | Bacteria | 1324 |
| 877 | Ga0501074_0460471 | 3300049590 | Bacteria | 901 |
| 878 | Ga0501075_0007356 | 3300049591 | Bacteria | 7638 |
| 879 | Ga0501075_0016908 | 3300049591 | Bacteria | 5260 |
| 880 | Ga0501075_0127129 | 3300049591 | Bacteria | 1941 |
| 881 | Ga0501075_0179549 | 3300049591 | Bacteria | 1615 |
| 882 | Ga0501075_0450616 | 3300049591 | Bacteria | 981 |
| 883 | Ga0501076_0012855 | 3300049592 | Bacteria | 6264 |
| 884 | Ga0501076_0021329 | 3300049592 | Bacteria | 4968 |
| 885 | Ga0501076_0037747 | 3300049592 | Bacteria | 3791 |
| 886 | Ga0501076_0074597 | 3300049592 | Bacteria | 2718 |
| 887 | Ga0501076_0082346 | 3300049592 | Bacteria | 2583 |
| 888 | Ga0501076_0089403 | 3300049592 | Bacteria | 2476 |
| 889 | Ga0501076_0479139 | 3300049592 | Bacteria | 1025 |
| 890 | Ga0501076_0635123 | 3300049592 | Bacteria | 881 |
| 891 | Ga0501077_0191484 | 3300049593 | Bacteria | 1299 |
| 892 | Ga0501079_0006359 | 3300049741 | Bacteria | 8867 |
| 893 | Ga0501079_0026705 | 3300049741 | Bacteria | 4427 |
| 894 | Ga0501079_0026910 | 3300049741 | Bacteria | 4410 |
| 895 | Ga0501079_0031070 | 3300049741 | Bacteria | 4104 |
| 896 | Ga0501079_0101862 | 3300049741 | Bacteria | 2227 |
| 897 | Ga0501079_0505862 | 3300049741 | Bacteria | 950 |
| 898 | Ga0501080_0001018 | 3300049742 | Bacteria | 23056 |
| 899 | Ga0501080_0018017 | 3300049742 | Bacteria | 6538 |
| 900 | Ga0501080_0025212 | 3300049742 | Bacteria | 5519 |
| 901 | Ga0501080_0096067 | 3300049742 | Bacteria | 2751 |
| 902 | Ga0501080_0187906 | 3300049742 | Bacteria | 1899 |
| 903 | Ga0501080_0707279 | 3300049742 | Bacteria | 888 |
| 904 | Ga0501081_0003021 | 3300049743 | Bacteria | 10679 |
| 905 | Ga0501081_0015582 | 3300049743 | Bacteria | 5017 |
| 906 | Ga0501081_0145084 | 3300049743 | Bacteria | 1703 |
| 907 | Ga0501081_0167622 | 3300049743 | Bacteria | 1585 |
| 908 | Ga0501081_0429209 | 3300049743 | Bacteria | 980 |
| 909 | Ga0501081_0634673 | 3300049743 | Bacteria | 800 |
| 910 | Ga0501083_0003593 | 3300049744 | Bacteria | 10880 |
| 911 | Ga0501083_0051179 | 3300049744 | Bacteria | 2778 |
| 912 | Ga0501083_0062480 | 3300049744 | Bacteria | 2485 |
| 913 | Ga0501035_0000914 | 3300049822 | Bacteria | 31246 |
| 914 | Ga0501035_0040338 | 3300049822 | Bacteria | 4219 |
| 915 | Ga0501035_0068266 | 3300049822 | Bacteria | 3153 |
| 916 | Ga0501035_0079383 | 3300049822 | Unclassified | 2899 |
| 917 | Ga0501044_0004598 | 3300049823 | Bacteria | 15432 |
| 918 | Ga0501044_0007849 | 3300049823 | Bacteria | 11735 |
| 919 | Ga0501045_0050988 | 3300049824 | Bacteria | 3020 |
| 920 | Ga0501045_0219202 | 3300049824 | Bacteria | 1417 |
| 921 | Ga0501045_0286192 | 3300049824 | Bacteria | 1227 |
| 922 | Ga0501045_0341925 | 3300049824 | Bacteria | 1114 |
| 923 | nmdc:mga03n38_130793_c1 | 3300050490 | Bacteria | 1244 |
| 924 | nmdc:mga0yw44_19551_c1 | 3300050492 | Bacteria | 3738 |
| 925 | nmdc:mga0k408_82411_c1 | 3300050493 | Bacteria | 1885 |
| 926 | nmdc:mga06z11_20222_c1 | 3300050494 | Bacteria | 3074 |
| 927 | nmdc:mga04h51_96336_c1 | 3300050495 | Bacteria | 1072 |
| 928 | nmdc:mga05p37_139644_c1 | 3300050507 | Bacteria | 2969 |
| 929 | nmdc:mga05p37_208769_c1 | 3300050507 | Bacteria | 2361 |
| 930 | nmdc:mga05p37_20991_c1 | 3300050507 | Bacteria | 7906 |
| 931 | nmdc:mga05p37_620132_c1 | 3300050507 | Bacteria | 1217 |
| 932 | nmdc:mga05p37_63189_c1 | 3300050507 | Bacteria | 4556 |
| 933 | nmdc:mga05p37_758780_c1 | 3300050507 | Bacteria | 1068 |
| 934 | nmdc:mga09592_46464_c1 | 3300050508 | Bacteria | 3658 |
| 935 | nmdc:mga09592_97419_c1 | 3300050508 | Bacteria | 2517 |
| 936 | nmdc:mga0qj67_15283_c1 | 3300050509 | Bacteria | 5812 |
| 937 | nmdc:mga0qj67_333837_c1 | 3300050509 | Bacteria | 1226 |
| 938 | nmdc:mga0qj67_42201_c1 | 3300050509 | Bacteria | 3590 |
| 939 | nmdc:mga0qj67_47790_c1 | 3300050509 | Bacteria | 3381 |
| 940 | nmdc:mga0qj67_609727_c1 | 3300050509 | Bacteria | 873 |
| 941 | nmdc:mga06r32_15674_c1 | 3300050510 | Bacteria | 6886 |
| 942 | nmdc:mga06r32_293794_c1 | 3300050510 | Bacteria | 1611 |
| 943 | nmdc:mga06r32_683780_c1 | 3300050510 | Bacteria | 993 |
| 944 | nmdc:mga06r32_735859_c1 | 3300050510 | Bacteria | 950 |
| 945 | nmdc:mga08y16_10783_c1 | 3300050511 | Bacteria | 9592 |
| 946 | nmdc:mga08y16_155820_c1 | 3300050511 | Bacteria | 2374 |
| 947 | nmdc:mga08y16_20928_c1 | 3300050511 | Bacteria | 6906 |
| 948 | nmdc:mga08y16_45264_c1 | 3300050511 | Bacteria | 4611 |
| 949 | nmdc:mga08y16_79356_c1 | 3300050511 | Bacteria | 3421 |
| 950 | nmdc:mga0n895_12406_c1 | 3300050512 | Bacteria | 7644 |
| 951 | nmdc:mga0n895_2301_c1 | 3300050512 | Bacteria | 14853 |
| 952 | nmdc:mga0n895_426245_c1 | 3300050512 | Bacteria | 1341 |
| 953 | nmdc:mga0n895_604931_c1 | 3300050512 | Bacteria | 1098 |
| 954 | nmdc:mga0n895_60524_c1 | 3300050512 | Bacteria | 3736 |
| 955 | nmdc:mga0rr50_1668_c1 | 3300050513 | Bacteria | 12233 |
| 956 | nmdc:mga0rr50_3367_c1 | 3300050513 | Bacteria | 9180 |
| 957 | nmdc:mga0rr50_50826_c1 | 3300050513 | Bacteria | 3073 |
| 958 | nmdc:mga08x19_2230_c1 | 3300050514 | Bacteria | 11833 |
| 959 | nmdc:mga08x19_237_c1 | 3300050514 | Bacteria | 42162 |
| 960 | nmdc:mga08x19_519480_c1 | 3300050514 | Bacteria | 841 |
| 961 | nmdc:mga0a205_12833_c1 | 3300050515 | Bacteria | 7772 |
| 962 | nmdc:mga0a205_139410_c1 | 3300050515 | Bacteria | 2325 |
| 963 | nmdc:mga0a205_229394_c1 | 3300050515 | Bacteria | 1740 |
| 964 | nmdc:mga0a205_23303_c1 | 3300050515 | Bacteria | 5871 |
| 965 | nmdc:mga0a205_4491_c1 | 3300050515 | Bacteria | 12520 |
| 966 | nmdc:mga0a205_5156_c1 | 3300050515 | Bacteria | 11750 |
| 967 | nmdc:mga0sz30_152358_c1 | 3300050516 | Bacteria | 1023 |
| 968 | Ga0495601_0000770 | 3300053077 | Bacteria | 17275 |
| 969 | Ga0495595_0002566 | 3300053084 | Bacteria | 7122 |
| 970 | Ga0495619_0001318 | 3300053085 | Bacteria | 16299 |
| 971 | Ga0495619_0125039 | 3300053085 | Bacteria | 1764 |
| 972 | Ga0500644_0127129 | 3300053088 | Bacteria | 999 |
| 973 | Ga0500581_018950 | 3300053089 | Bacteria | 3468 |
| 974 | Ga0500641_0001992 | 3300053096 | Bacteria | 7247 |
| 975 | Ga0500641_0029359 | 3300053096 | Bacteria | 2154 |
| 976 | Ga0500641_0149189 | 3300053096 | Bacteria | 1009 |
| 977 | Ga0500650_0000145 | 3300053098 | Bacteria | 18624 |
| 978 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 979 | Ga0500592_001234 | 3300053116 | Bacteria | 4172 |
| 980 | Ga0500594_0005910 | 3300053118 | Bacteria | 2728 |
| 981 | Ga0500595_003852 | 3300053119 | Bacteria | 6887 |
| 982 | Ga0500642_0000074 | 3300053130 | Bacteria | 54356 |
| 983 | Ga0500652_000065 | 3300053131 | Bacteria | 46129 |
| 984 | Ga0500658_0072711 | 3300053134 | Bacteria | 1454 |
| 985 | Ga0500559_0000381 | 3300053136 | Bacteria | 32402 |
| 986 | Ga0500568_0009138 | 3300053139 | Bacteria | 4726 |
| 987 | Ga0500568_0009152 | 3300053139 | Bacteria | 4723 |
| 988 | Ga0500604_0016565 | 3300053151 | Bacteria | 2031 |
| 989 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 990 | Ga0500622_0006481 | 3300053156 | Bacteria | 6776 |
| 991 | Ga0500633_0001663 | 3300053160 | Bacteria | 4306 |
| 992 | Ga0500639_004690 | 3300053163 | Bacteria | 6954 |
| 993 | Ga0500636_0002098 | 3300053177 | Bacteria | 11018 |
| 994 | Ga0500636_0069558 | 3300053177 | Bacteria | 2042 |
| 995 | Ga0500552_000090 | 3300053733 | Bacteria | 7450 |
| 996 | Ga0500596_000143 | 3300053735 | Bacteria | 10778 |
| 997 | Ga0501084_0001324 | 3300054114 | Bacteria | 19524 |
| 998 | Ga0501084_0029231 | 3300054114 | Bacteria | 4610 |
| 999 | Ga0501084_0071398 | 3300054114 | Bacteria | 2907 |
| 1000 | Ga0501084_0078752 | 3300054114 | Bacteria | 2762 |
| 1001 | Ga0501084_0103042 | 3300054114 | Bacteria | 2397 |
| 1002 | Ga0590075_036856 | 3300059424 | Bacteria | 1247 |
| 1003 | Ga0501082_0001749 | 3300060353 | Bacteria | 19128 |
| 1004 | Ga0501082_0009462 | 3300060353 | Bacteria | 8390 |
| 1005 | Ga0501082_0062192 | 3300060353 | Bacteria | 3213 |
| 1006 | Ga0501082_0079276 | 3300060353 | Bacteria | 2833 |
| 1007 | Ga0501082_0230860 | 3300060353 | Bacteria | 1610 |
| 1008 | Ga0501082_0261755 | 3300060353 | Bacteria | 1505 |
| 1009 | Ga0466962_0164274 | 3300061719 | Bacteria | 1080 |
| 1010 | Ga0530510_0041519 | 3300061734 | Bacteria | 3321 |
| 1011 | Ga0530510_0126458 | 3300061734 | Bacteria | 1879 |
| 1012 | Ga0530510_0251865 | 3300061734 | Bacteria | 1316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053118 | Ga0500594_0005910 | Ga0500594_0005910_142_960 | 198 |
| 2 | 3300005327 | Ga0070658_10151023 | Ga0070658_101510232 | 199 |
| 3 | 3300005563 | Ga0068855_100006101 | Ga0068855_1000061013 | 200 |
| 4 | 3300009093 | Ga0105240_10059514 | Ga0105240_100595145 | 200 |
| 5 | 3300013307 | Ga0157372_10293850 | Ga0157372_102938502 | 200 |
| 6 | 3300025913 | Ga0207695_10095047 | Ga0207695_100950472 | 200 |
| 7 | 3300025921 | Ga0207652_10389604 | Ga0207652_103896042 | 200 |
| 8 | 3300025949 | Ga0207667_10019350 | Ga0207667_100193503 | 200 |
| 9 | 3300005436 | Ga0070713_100003400 | Ga0070713_1000034005 | 202 |
| 10 | 3300005616 | Ga0068852_100710037 | Ga0068852_1007100371 | 202 |
| 11 | 3300006028 | Ga0070717_10002714 | Ga0070717_1000271412 | 202 |
| 12 | 3300009177 | Ga0105248_10283613 | Ga0105248_102836132 | 202 |
| 13 | 3300009553 | Ga0105249_10021338 | Ga0105249_100213383 | 202 |
| 14 | 3300025915 | Ga0207693_10137585 | Ga0207693_101375852 | 202 |
| 15 | 3300025928 | Ga0207700_10020058 | Ga0207700_100200583 | 202 |
| 16 | 3300031616 | Ga0307508_10221917 | Ga0307508_102219172 | 202 |
| 17 | 3300014969 | Ga0157376_10037185 | Ga0157376_100371851 | 203 |
| 18 | 3300025899 | Ga0207642_10201094 | Ga0207642_102010942 | 203 |
| 19 | 3300031548 | Ga0307408_100187965 | Ga0307408_1001879652 | 203 |
| 20 | 3300031730 | Ga0307516_10027197 | Ga0307516_100271974 | 203 |
| 21 | 3300032002 | Ga0307416_100191912 | Ga0307416_1001919122 | 203 |
| 22 | 3300048913 | Ga0496110_0601488 | Ga0496110_0601488_202_972 | 203 |
| 23 | 3300025903 | Ga0207680_10229565 | Ga0207680_102295651 | 204 |
| 24 | 3300048908 | Ga0496105_0708422 | Ga0496105_0708422_21_716 | 204 |
| 25 | 3300048917 | Ga0496114_0946218 | Ga0496114_0946218_20_715 | 204 |
| 26 | 3300005543 | Ga0070672_100175488 | Ga0070672_1001754884 | 205 |
| 27 | 3300005614 | Ga0068856_100000451 | Ga0068856_10000045141 | 205 |
| 28 | 3300006177 | Ga0075362_10050508 | Ga0075362_100505082 | 205 |
| 29 | 3300026078 | Ga0207702_10000478 | Ga0207702_1000047840 | 205 |
| 30 | 3300009092 | Ga0105250_10104561 | Ga0105250_101045612 | 206 |
| 31 | 3300013308 | Ga0157375_10106530 | Ga0157375_101065303 | 207 |
| 32 | 3300025900 | Ga0207710_10051467 | Ga0207710_100514671 | 207 |
| 33 | 3300025940 | Ga0207691_10184588 | Ga0207691_101845882 | 207 |
| 34 | 3300047323 | Ga0495683_0103673 | Ga0495683_0103673_10_780 | 207 |
| 35 | 3300035691 | Ga0373931_0138851 | Ga0373931_0138851_500_1294 | 208 |
| 36 | 3300047469 | Ga0495673_0105577 | Ga0495673_0105577_58_828 | 209 |
| 37 | 3300048928 | Ga0496125_0006156 | Ga0496125_0006156_4296_5111 | 209 |
| 38 | 3300049742 | Ga0501080_0025212 | Ga0501080_0025212_687_1466 | 209 |
| 39 | 3300053177 | Ga0500636_0069558 | Ga0500636_0069558_948_1706 | 209 |
| 40 | 3300060353 | Ga0501082_0062192 | Ga0501082_0062192_2239_3018 | 209 |
| 41 | 3300009147 | Ga0114129_10000702 | Ga0114129_1000070239 | 212 |
| 42 | 3300025924 | Ga0207694_10109317 | Ga0207694_101093172 | 212 |
| 43 | 3300005336 | Ga0070680_100107278 | Ga0070680_1001072782 | 213 |
| 44 | 3300005518 | Ga0070699_100104120 | Ga0070699_1001041203 | 213 |
| 45 | 3300005546 | Ga0070696_100001012 | Ga0070696_1000010124 | 213 |
| 46 | 3300035170 | Ga0373943_0180261 | Ga0373943_0180261_413_1108 | 213 |
| 47 | 3300035242 | Ga0373962_0060218 | Ga0373962_0060218_35_730 | 213 |
| 48 | 3300037853 | Ga0436364_1395508 | Ga0436364_1395508_645_1340 | 213 |
| 49 | 3300046472 | Ga0495580_0413769 | Ga0495580_0413769_201_896 | 213 |
| 50 | 3300046664 | Ga0495659_0013095 | Ga0495659_0013095_1982_2677 | 213 |
| 51 | 3300046691 | Ga0495670_0135367 | Ga0495670_0135367_579_1274 | 213 |
| 52 | 3300048917 | Ga0496114_0820230 | Ga0496114_0820230_24_719 | 213 |
| 53 | 3300049585 | Ga0501069_0063768 | Ga0501069_0063768_373_1134 | 213 |
| 54 | 3300049586 | Ga0501070_0050118 | Ga0501070_0050118_1502_2263 | 213 |
| 55 | 3300049586 | Ga0501070_0242705 | Ga0501070_0242705_30_791 | 213 |
| 56 | 3300049588 | Ga0501072_0014962 | Ga0501072_0014962_1297_1992 | 213 |
| 57 | 3300049743 | Ga0501081_0145084 | Ga0501081_0145084_924_1619 | 213 |
| 58 | 3300049822 | Ga0501035_0000914 | Ga0501035_0000914_17877_18638 | 213 |
| 59 | 3300049824 | Ga0501045_0219202 | Ga0501045_0219202_491_1186 | 213 |
| 60 | 3300050514 | nmdc:mga08x19_519480_c1 | nmdc:mga08x19_519480_c1_125_820 | 213 |
| 61 | 3300061734 | Ga0530510_0251865 | Ga0530510_0251865_393_1088 | 213 |
| 62 | 3300037853 | Ga0436364_0431951 | Ga0436364_0431951_39_854 | 215 |
| 63 | 3300049581 | Ga0501047_0139275 | Ga0501047_0139275_858_1688 | 215 |
| 64 | 3300049581 | Ga0501047_0161027 | Ga0501047_0161027_605_1366 | 215 |
| 65 | 3300049588 | Ga0501072_0200245 | Ga0501072_0200245_575_1336 | 215 |
| 66 | 3300049571 | Ga0501034_0579508 | Ga0501034_0579508_246_1007 | 216 |
| 67 | 3300049589 | Ga0501073_0058508 | Ga0501073_0058508_1800_2561 | 216 |
| 68 | 3300053733 | Ga0500552_000090 | Ga0500552_000090_11_694 | 216 |
| 69 | 3300049592 | Ga0501076_0037747 | Ga0501076_0037747_2619_3446 | 217 |
| 70 | 3300049741 | Ga0501079_0031070 | Ga0501079_0031070_1013_1840 | 217 |
| 71 | 3300049744 | Ga0501083_0051179 | Ga0501083_0051179_893_1720 | 217 |
| 72 | 3300049822 | Ga0501035_0068266 | Ga0501035_0068266_179_1006 | 217 |
| 73 | 3300054114 | Ga0501084_0029231 | Ga0501084_0029231_1613_2440 | 217 |
| 74 | 3300032002 | Ga0307416_100340555 | Ga0307416_1003405552 | 218 |
| 75 | 3300037853 | Ga0436364_0742249 | Ga0436364_0742249_9969_10724 | 218 |
| 76 | 3300050495 | nmdc:mga04h51_96336_c1 | nmdc:mga04h51_96336_c1_10_705 | 218 |
| 77 | 3300028573 | Ga0265334_10027674 | Ga0265334_100276742 | 219 |
| 78 | 3300049577 | Ga0501041_0050340 | Ga0501041_0050340_1569_2381 | 219 |
| 79 | 3300049588 | Ga0501072_0033674 | Ga0501072_0033674_149_961 | 219 |
| 80 | 3300049592 | Ga0501076_0021329 | Ga0501076_0021329_1693_2505 | 219 |
| 81 | 3300049593 | Ga0501077_0191484 | Ga0501077_0191484_259_1071 | 219 |
| 82 | 3300049824 | Ga0501045_0050988 | Ga0501045_0050988_1693_2505 | 219 |
| 83 | 3300053136 | Ga0500559_0000381 | Ga0500559_0000381_25795_26565 | 219 |
| 84 | 3300053163 | Ga0500639_004690 | Ga0500639_004690_3159_3929 | 219 |
| 85 | 3300053735 | Ga0500596_000143 | Ga0500596_000143_9206_9976 | 219 |
| 86 | 3300060353 | Ga0501082_0079276 | Ga0501082_0079276_726_1538 | 219 |
| 87 | 3300037418 | Ga0395900_0002841 | Ga0395900_0002841_5988_6749 | 220 |
| 88 | 3300037466 | Ga0395898_0012313 | Ga0395898_0012313_220_981 | 220 |
| 89 | 3300038443 | Ga0395901_0255900 | Ga0395901_0255900_903_1664 | 220 |
| 90 | 3300045051 | Ga0451576_0987397 | Ga0451576_0987397_68_832 | 220 |
| 91 | 3300046530 | Ga0495654_0107115 | Ga0495654_0107115_515_1267 | 220 |
| 92 | 3300009551 | Ga0105238_10695214 | Ga0105238_106952141 | 221 |
| 93 | 3300005330 | Ga0070690_100042773 | Ga0070690_1000427732 | 222 |
| 94 | 3300005330 | Ga0070690_100220151 | Ga0070690_1002201512 | 222 |
| 95 | 3300005335 | Ga0070666_10006268 | Ga0070666_100062682 | 222 |
| 96 | 3300005338 | Ga0068868_100012946 | Ga0068868_1000129463 | 222 |
| 97 | 3300005340 | Ga0070689_100110891 | Ga0070689_1001108912 | 222 |
| 98 | 3300005347 | Ga0070668_100026398 | Ga0070668_1000263983 | 222 |
| 99 | 3300005353 | Ga0070669_100021844 | Ga0070669_1000218441 | 222 |
| 100 | 3300005354 | Ga0070675_100110433 | Ga0070675_1001104332 | 222 |
| 101 | 3300005364 | Ga0070673_100188299 | Ga0070673_1001882992 | 222 |
| 102 | 3300005365 | Ga0070688_100011085 | Ga0070688_1000110855 | 222 |
| 103 | 3300005367 | Ga0070667_100113538 | Ga0070667_1001135382 | 222 |
| 104 | 3300005456 | Ga0070678_100064905 | Ga0070678_1000649052 | 222 |
| 105 | 3300005459 | Ga0068867_100137632 | Ga0068867_1001376322 | 222 |
| 106 | 3300005543 | Ga0070672_100217278 | Ga0070672_1002172782 | 222 |
| 107 | 3300005548 | Ga0070665_100031297 | Ga0070665_1000312972 | 222 |
| 108 | 3300005614 | Ga0068856_100080445 | Ga0068856_1000804452 | 222 |
| 109 | 3300005617 | Ga0068859_100074029 | Ga0068859_1000740292 | 222 |
| 110 | 3300005719 | Ga0068861_100164993 | Ga0068861_1001649932 | 222 |
| 111 | 3300005843 | Ga0068860_100003215 | Ga0068860_10000321514 | 222 |
| 112 | 3300005843 | Ga0068860_100114913 | Ga0068860_1001149132 | 222 |
| 113 | 3300006237 | Ga0097621_100167279 | Ga0097621_1001672792 | 222 |
| 114 | 3300006358 | Ga0068871_100058868 | Ga0068871_1000588682 | 222 |
| 115 | 3300006852 | Ga0075433_10000760 | Ga0075433_1000076018 | 222 |
| 116 | 3300006871 | Ga0075434_100042521 | Ga0075434_1000425214 | 222 |
| 117 | 3300006881 | Ga0068865_100051260 | Ga0068865_1000512603 | 222 |
| 118 | 3300006914 | Ga0075436_100005645 | Ga0075436_1000056456 | 222 |
| 119 | 3300006931 | Ga0097620_100074026 | Ga0097620_1000740262 | 222 |
| 120 | 3300007076 | Ga0075435_100000197 | Ga0075435_10000019732 | 222 |
| 121 | 3300009177 | Ga0105248_10008655 | Ga0105248_100086553 | 222 |
| 122 | 3300013296 | Ga0157374_10173481 | Ga0157374_101734812 | 222 |
| 123 | 3300013306 | Ga0163162_10211536 | Ga0163162_102115362 | 222 |
| 124 | 3300014968 | Ga0157379_10004316 | Ga0157379_1000431610 | 222 |
| 125 | 3300014969 | Ga0157376_10374340 | Ga0157376_103743401 | 222 |
| 126 | 3300017792 | Ga0163161_10231226 | Ga0163161_102312262 | 222 |
| 127 | 3300025907 | Ga0207645_10002022 | Ga0207645_1000202214 | 222 |
| 128 | 3300025923 | Ga0207681_10296319 | Ga0207681_102963191 | 222 |
| 129 | 3300025926 | Ga0207659_10182014 | Ga0207659_101820141 | 222 |
| 130 | 3300025940 | Ga0207691_10011068 | Ga0207691_100110689 | 222 |
| 131 | 3300025942 | Ga0207689_10005271 | Ga0207689_100052714 | 222 |
| 132 | 3300025942 | Ga0207689_10078866 | Ga0207689_100788662 | 222 |
| 133 | 3300025986 | Ga0207658_10382200 | Ga0207658_103822002 | 222 |
| 134 | 3300026035 | Ga0207703_10011205 | Ga0207703_100112054 | 222 |
| 135 | 3300026078 | Ga0207702_10052786 | Ga0207702_100527862 | 222 |
| 136 | 3300026088 | Ga0207641_10034109 | Ga0207641_100341094 | 222 |
| 137 | 3300026089 | Ga0207648_10001752 | Ga0207648_100017526 | 222 |
| 138 | 3300026118 | Ga0207675_100080727 | Ga0207675_1000807274 | 222 |
| 139 | 3300026121 | Ga0207683_10005101 | Ga0207683_100051012 | 222 |
| 140 | 3300028381 | Ga0268264_10011385 | Ga0268264_100113852 | 222 |
| 141 | 3300031241 | Ga0265325_10011356 | Ga0265325_100113563 | 222 |
| 142 | 3300035410 | Ga0373924_0131718 | Ga0373924_0131718_48_815 | 222 |
| 143 | 3300048904 | Ga0496101_0161270 | Ga0496101_0161270_590_1357 | 222 |
| 144 | 3300048911 | Ga0496108_0442640 | Ga0496108_0442640_280_1047 | 222 |
| 145 | 3300049590 | Ga0501074_0228845 | Ga0501074_0228845_49_816 | 222 |
| 146 | 3300050511 | nmdc:mga08y16_20928_c1 | nmdc:mga08y16_20928_c1_935_1684 | 222 |
| 147 | 3300050512 | nmdc:mga0n895_2301_c1 | nmdc:mga0n895_2301_c1_3138_3887 | 222 |
| 148 | 3300050513 | nmdc:mga0rr50_3367_c1 | nmdc:mga0rr50_3367_c1_3138_3887 | 222 |
| 149 | 3300050514 | nmdc:mga08x19_2230_c1 | nmdc:mga08x19_2230_c1_5293_6042 | 222 |
| 150 | 3300050515 | nmdc:mga0a205_5156_c1 | nmdc:mga0a205_5156_c1_9659_10408 | 222 |
| 151 | 3300005330 | Ga0070690_100000085 | Ga0070690_10000008523 | 223 |
| 152 | 3300005334 | Ga0068869_100000367 | Ga0068869_10000036723 | 223 |
| 153 | 3300005336 | Ga0070680_100000888 | Ga0070680_10000088822 | 223 |
| 154 | 3300005337 | Ga0070682_100004504 | Ga0070682_1000045048 | 223 |
| 155 | 3300005338 | Ga0068868_100000639 | Ga0068868_10000063912 | 223 |
| 156 | 3300005340 | Ga0070689_100000189 | Ga0070689_10000018917 | 223 |
| 157 | 3300005341 | Ga0070691_10002347 | Ga0070691_100023474 | 223 |
| 158 | 3300005343 | Ga0070687_100000020 | Ga0070687_10000002030 | 223 |
| 159 | 3300005353 | Ga0070669_100305777 | Ga0070669_1003057772 | 223 |
| 160 | 3300005406 | Ga0070703_10038846 | Ga0070703_100388461 | 223 |
| 161 | 3300005438 | Ga0070701_10000464 | Ga0070701_1000046412 | 223 |
| 162 | 3300005440 | Ga0070705_100000022 | Ga0070705_10000002231 | 223 |
| 163 | 3300005441 | Ga0070700_100001396 | Ga0070700_1000013969 | 223 |
| 164 | 3300005444 | Ga0070694_100000049 | Ga0070694_1000000495 | 223 |
| 165 | 3300005445 | Ga0070708_100168139 | Ga0070708_1001681392 | 223 |
| 166 | 3300005458 | Ga0070681_10006711 | Ga0070681_100067113 | 223 |
| 167 | 3300005458 | Ga0070681_10123644 | Ga0070681_101236442 | 223 |
| 168 | 3300005459 | Ga0068867_100001285 | Ga0068867_10000128513 | 223 |
| 169 | 3300005530 | Ga0070679_100005893 | Ga0070679_1000058933 | 223 |
| 170 | 3300005539 | Ga0068853_100210105 | Ga0068853_1002101051 | 223 |
| 171 | 3300005543 | Ga0070672_100152594 | Ga0070672_1001525942 | 223 |
| 172 | 3300005544 | Ga0070686_100000085 | Ga0070686_10000008510 | 223 |
| 173 | 3300005545 | Ga0070695_100001199 | Ga0070695_1000011998 | 223 |
| 174 | 3300005546 | Ga0070696_100000688 | Ga0070696_10000068815 | 223 |
| 175 | 3300005547 | Ga0070693_100000063 | Ga0070693_10000006333 | 223 |
| 176 | 3300005549 | Ga0070704_100000009 | Ga0070704_10000000939 | 223 |
| 177 | 3300005563 | Ga0068855_100010584 | Ga0068855_1000105847 | 223 |
| 178 | 3300005578 | Ga0068854_100032697 | Ga0068854_1000326973 | 223 |
| 179 | 3300005614 | Ga0068856_100027691 | Ga0068856_1000276913 | 223 |
| 180 | 3300005615 | Ga0070702_100000009 | Ga0070702_10000000935 | 223 |
| 181 | 3300005617 | Ga0068859_100000354 | Ga0068859_10000035430 | 223 |
| 182 | 3300005718 | Ga0068866_10000182 | Ga0068866_1000018229 | 223 |
| 183 | 3300005719 | Ga0068861_100000138 | Ga0068861_10000013810 | 223 |
| 184 | 3300005840 | Ga0068870_10006772 | Ga0068870_100067724 | 223 |
| 185 | 3300005842 | Ga0068858_100007068 | Ga0068858_1000070688 | 223 |
| 186 | 3300005843 | Ga0068860_100000285 | Ga0068860_10000028558 | 223 |
| 187 | 3300005844 | Ga0068862_100000821 | Ga0068862_1000008213 | 223 |
| 188 | 3300006237 | Ga0097621_100000392 | Ga0097621_10000039230 | 223 |
| 189 | 3300006358 | Ga0068871_100002537 | Ga0068871_10000253712 | 223 |
| 190 | 3300006881 | Ga0068865_100000052 | Ga0068865_10000005231 | 223 |
| 191 | 3300006931 | Ga0097620_100000354 | Ga0097620_10000035417 | 223 |
| 192 | 3300009098 | Ga0105245_10000086 | Ga0105245_1000008682 | 223 |
| 193 | 3300009147 | Ga0114129_10045024 | Ga0114129_100450242 | 223 |
| 194 | 3300009148 | Ga0105243_10000360 | Ga0105243_1000036028 | 223 |
| 195 | 3300009148 | Ga0105243_10921822 | Ga0105243_109218221 | 223 |
| 196 | 3300009174 | Ga0105241_10001255 | Ga0105241_1000125512 | 223 |
| 197 | 3300009176 | Ga0105242_10001063 | Ga0105242_1000106315 | 223 |
| 198 | 3300009177 | Ga0105248_10664272 | Ga0105248_106642722 | 223 |
| 199 | 3300009553 | Ga0105249_10007871 | Ga0105249_100078717 | 223 |
| 200 | 3300011119 | Ga0105246_10025425 | Ga0105246_100254252 | 223 |
| 201 | 3300013100 | Ga0157373_10001111 | Ga0157373_1000111116 | 223 |
| 202 | 3300013105 | Ga0157369_10044351 | Ga0157369_100443511 | 223 |
| 203 | 3300013297 | Ga0157378_10000332 | Ga0157378_1000033217 | 223 |
| 204 | 3300013307 | Ga0157372_10001340 | Ga0157372_1000134016 | 223 |
| 205 | 3300013308 | Ga0157375_10234830 | Ga0157375_102348302 | 223 |
| 206 | 3300014325 | Ga0163163_10328744 | Ga0163163_103287441 | 223 |
| 207 | 3300014326 | Ga0157380_10012130 | Ga0157380_100121303 | 223 |
| 208 | 3300014745 | Ga0157377_10011155 | Ga0157377_100111553 | 223 |
| 209 | 3300014969 | Ga0157376_10010278 | Ga0157376_100102783 | 223 |
| 210 | 3300025899 | Ga0207642_10002026 | Ga0207642_100020263 | 223 |
| 211 | 3300025912 | Ga0207707_10005087 | Ga0207707_100050878 | 223 |
| 212 | 3300025912 | Ga0207707_10040055 | Ga0207707_100400553 | 223 |
| 213 | 3300025917 | Ga0207660_10014345 | Ga0207660_100143453 | 223 |
| 214 | 3300025918 | Ga0207662_10005034 | Ga0207662_100050346 | 223 |
| 215 | 3300025921 | Ga0207652_10006129 | Ga0207652_100061296 | 223 |
| 216 | 3300025927 | Ga0207687_10001602 | Ga0207687_1000160213 | 223 |
| 217 | 3300025934 | Ga0207686_10000270 | Ga0207686_1000027023 | 223 |
| 218 | 3300025935 | Ga0207709_10001682 | Ga0207709_1000168212 | 223 |
| 219 | 3300025936 | Ga0207670_10002057 | Ga0207670_100020578 | 223 |
| 220 | 3300025937 | Ga0207669_10591160 | Ga0207669_105911602 | 223 |
| 221 | 3300025938 | Ga0207704_10000300 | Ga0207704_1000030017 | 223 |
| 222 | 3300025940 | Ga0207691_10200216 | Ga0207691_102002162 | 223 |
| 223 | 3300025942 | Ga0207689_10000691 | Ga0207689_1000069130 | 223 |
| 224 | 3300025949 | Ga0207667_10002649 | Ga0207667_100026495 | 223 |
| 225 | 3300025961 | Ga0207712_10010320 | Ga0207712_100103204 | 223 |
| 226 | 3300025981 | Ga0207640_10008666 | Ga0207640_100086665 | 223 |
| 227 | 3300026023 | Ga0207677_10001318 | Ga0207677_100013183 | 223 |
| 228 | 3300026035 | Ga0207703_10007452 | Ga0207703_100074526 | 223 |
| 229 | 3300026041 | Ga0207639_10158976 | Ga0207639_101589762 | 223 |
| 230 | 3300026075 | Ga0207708_10000182 | Ga0207708_1000018249 | 223 |
| 231 | 3300026078 | Ga0207702_10011253 | Ga0207702_100112535 | 223 |
| 232 | 3300026089 | Ga0207648_10000335 | Ga0207648_1000033553 | 223 |
| 233 | 3300026095 | Ga0207676_10242588 | Ga0207676_102425882 | 223 |
| 234 | 3300026118 | Ga0207675_100000142 | Ga0207675_1000001426 | 223 |
| 235 | 3300028380 | Ga0268265_10002935 | Ga0268265_100029358 | 223 |
| 236 | 3300028381 | Ga0268264_10000446 | Ga0268264_1000044630 | 223 |
| 237 | 3300031595 | Ga0265313_10001509 | Ga0265313_1000150910 | 223 |
| 238 | 3300034817 | Ga0373948_0015981 | Ga0373948_0015981_73_810 | 223 |
| 239 | 3300035090 | Ga0373949_0020677 | Ga0373949_0020677_598_1335 | 223 |
| 240 | 3300035090 | Ga0373949_0060538 | Ga0373949_0060538_64_813 | 223 |
| 241 | 3300035116 | Ga0373945_0003490 | Ga0373945_0003490_3439_4188 | 223 |
| 242 | 3300035121 | Ga0373960_0043733 | Ga0373960_0043733_82_819 | 223 |
| 243 | 3300035170 | Ga0373943_0033444 | Ga0373943_0033444_87_836 | 223 |
| 244 | 3300035171 | Ga0373946_0040564 | Ga0373946_0040564_352_1101 | 223 |
| 245 | 3300035242 | Ga0373962_0013313 | Ga0373962_0013313_1114_1851 | 223 |
| 246 | 3300035691 | Ga0373931_0011415 | Ga0373931_0011415_2035_2784 | 223 |
| 247 | 3300035691 | Ga0373931_0126329 | Ga0373931_0126329_147_884 | 223 |
| 248 | 3300035692 | Ga0373935_0010318 | Ga0373935_0010318_4171_4920 | 223 |
| 249 | 3300035695 | Ga0373927_0053201 | Ga0373927_0053201_1784_2533 | 223 |
| 250 | 3300035725 | Ga0373947_0017843 | Ga0373947_0017843_3248_3997 | 223 |
| 251 | 3300037068 | Ga0373925_0098350 | Ga0373925_0098350_1142_1891 | 223 |
| 252 | 3300042005 | Ga0439448_0003193 | Ga0439448_0003193_136_873 | 223 |
| 253 | 3300042012 | Ga0439455_0003418 | Ga0439455_0003418_307_1044 | 223 |
| 254 | 3300042157 | Ga0439458_0057479 | Ga0439458_0057479_183_920 | 223 |
| 255 | 3300042438 | Ga0439459_0002068 | Ga0439459_0002068_2026_2763 | 223 |
| 256 | 3300045051 | Ga0451576_0026393 | Ga0451576_0026393_5234_5971 | 223 |
| 257 | 3300045051 | Ga0451576_0885048 | Ga0451576_0885048_114_893 | 223 |
| 258 | 3300046674 | Ga0495588_0071485 | Ga0495588_0071485_465_1214 | 223 |
| 259 | 3300046681 | Ga0495647_0004541 | Ga0495647_0004541_1075_1824 | 223 |
| 260 | 3300046683 | Ga0495658_0035110 | Ga0495658_0035110_490_1239 | 223 |
| 261 | 3300048905 | Ga0496102_0087362 | Ga0496102_0087362_1852_2589 | 223 |
| 262 | 3300048911 | Ga0496108_0455065 | Ga0496108_0455065_175_912 | 223 |
| 263 | 3300050507 | nmdc:mga05p37_63189_c1 | nmdc:mga05p37_63189_c1_1087_1824 | 223 |
| 264 | 3300050507 | nmdc:mga05p37_758780_c1 | nmdc:mga05p37_758780_c1_100_795 | 223 |
| 265 | 3300050515 | nmdc:mga0a205_12833_c1 | nmdc:mga0a205_12833_c1_1143_1880 | 223 |
| 266 | 3300053096 | Ga0500641_0029359 | Ga0500641_0029359_1327_2091 | 223 |
| 267 | 3300053139 | Ga0500568_0009138 | Ga0500568_0009138_384_1160 | 223 |
| 268 | 3300005985 | Ga0081539_10058101 | Ga0081539_100581012 | 224 |
| 269 | 3300006871 | Ga0075434_100648750 | Ga0075434_1006487501 | 224 |
| 270 | 3300009545 | Ga0105237_10000726 | Ga0105237_1000072614 | 224 |
| 271 | 3300025914 | Ga0207671_10003297 | Ga0207671_100032974 | 224 |
| 272 | 3300035084 | Ga0373928_0004360 | Ga0373928_0004360_1035_1784 | 224 |
| 273 | 3300035088 | Ga0373940_0002085 | Ga0373940_0002085_428_1177 | 224 |
| 274 | 3300035112 | Ga0373932_0006537 | Ga0373932_0006537_1972_2721 | 224 |
| 275 | 3300035115 | Ga0373941_0034044 | Ga0373941_0034044_457_1206 | 224 |
| 276 | 3300035207 | Ga0373942_0097509 | Ga0373942_0097509_39_788 | 224 |
| 277 | 3300035691 | Ga0373931_0001739 | Ga0373931_0001739_2396_3145 | 224 |
| 278 | 3300037068 | Ga0373925_0436447 | Ga0373925_0436447_24_719 | 224 |
| 279 | 3300045051 | Ga0451576_0025200 | Ga0451576_0025200_218_967 | 224 |
| 280 | 3300045976 | Ga0466967_0141490 | Ga0466967_0141490_521_1291 | 224 |
| 281 | 3300049570 | Ga0501033_0211373 | Ga0501033_0211373_312_1007 | 224 |
| 282 | 3300049572 | Ga0501036_0135356 | Ga0501036_0135356_22_717 | 224 |
| 283 | 3300049575 | Ga0501039_0041205 | Ga0501039_0041205_1979_2674 | 224 |
| 284 | 3300049576 | Ga0501040_0007181 | Ga0501040_0007181_937_1632 | 224 |
| 285 | 3300049577 | Ga0501041_0003733 | Ga0501041_0003733_5817_6512 | 224 |
| 286 | 3300049578 | Ga0501042_0021279 | Ga0501042_0021279_2985_3680 | 224 |
| 287 | 3300049579 | Ga0501043_0164148 | Ga0501043_0164148_417_1112 | 224 |
| 288 | 3300049580 | Ga0501046_0000249 | Ga0501046_0000249_1386_2081 | 224 |
| 289 | 3300049588 | Ga0501072_0031936 | Ga0501072_0031936_2212_2907 | 224 |
| 290 | 3300049590 | Ga0501074_0007830 | Ga0501074_0007830_1789_2484 | 224 |
| 291 | 3300049591 | Ga0501075_0016908 | Ga0501075_0016908_3962_4657 | 224 |
| 292 | 3300049741 | Ga0501079_0006359 | Ga0501079_0006359_3691_4386 | 224 |
| 293 | 3300049742 | Ga0501080_0187906 | Ga0501080_0187906_261_956 | 224 |
| 294 | 3300049743 | Ga0501081_0003021 | Ga0501081_0003021_5979_6674 | 224 |
| 295 | 3300049744 | Ga0501083_0003593 | Ga0501083_0003593_4955_5650 | 224 |
| 296 | 3300050512 | nmdc:mga0n895_604931_c1 | nmdc:mga0n895_604931_c1_299_1063 | 224 |
| 297 | 3300054114 | Ga0501084_0001324 | Ga0501084_0001324_15275_15970 | 224 |
| 298 | 3300060353 | Ga0501082_0001749 | Ga0501082_0001749_12576_13271 | 224 |
| 299 | 3300061734 | Ga0530510_0041519 | Ga0530510_0041519_1271_1966 | 224 |
| 300 | 3300005295 | Ga0065707_10149703 | Ga0065707_101497032 | 225 |
| 301 | 3300006852 | Ga0075433_10028812 | Ga0075433_100288126 | 225 |
| 302 | 3300024225 | Ga0224572_1007548 | Ga0224572_10075482 | 225 |
| 303 | 3300026095 | Ga0207676_10094151 | Ga0207676_100941512 | 225 |
| 304 | 3300031241 | Ga0265325_10040338 | Ga0265325_100403382 | 225 |
| 305 | 3300031249 | Ga0265339_10009178 | Ga0265339_100091782 | 225 |
| 306 | 3300039437 | Ga0436365_1013679 | Ga0436365_1013679_1225_1971 | 225 |
| 307 | 3300039450 | Ga0436363_1305199 | Ga0436363_1305199_586_1332 | 225 |
| 308 | 3300049582 | Ga0501048_0308426 | Ga0501048_0308426_16_711 | 225 |
| 309 | 3300049587 | Ga0501071_0406244 | Ga0501071_0406244_14_709 | 225 |
| 310 | 3300050513 | nmdc:mga0rr50_50826_c1 | nmdc:mga0rr50_50826_c1_787_1542 | 225 |
| 311 | 3300050515 | nmdc:mga0a205_229394_c1 | nmdc:mga0a205_229394_c1_469_1224 | 225 |
| 312 | 3300059424 | Ga0590075_036856 | Ga0590075_036856_249_1013 | 225 |
| 313 | 3300005336 | Ga0070680_100046286 | Ga0070680_1000462862 | 226 |
| 314 | 3300005441 | Ga0070700_100001393 | Ga0070700_1000013932 | 226 |
| 315 | 3300005459 | Ga0068867_100001553 | Ga0068867_10000155316 | 226 |
| 316 | 3300005543 | Ga0070672_100261711 | Ga0070672_1002617113 | 226 |
| 317 | 3300005718 | Ga0068866_10229254 | Ga0068866_102292541 | 226 |
| 318 | 3300005719 | Ga0068861_100001214 | Ga0068861_10000121417 | 226 |
| 319 | 3300005844 | Ga0068862_100001942 | Ga0068862_1000019426 | 226 |
| 320 | 3300006195 | Ga0075366_10079455 | Ga0075366_100794552 | 226 |
| 321 | 3300006844 | Ga0075428_100237121 | Ga0075428_1002371213 | 226 |
| 322 | 3300006881 | Ga0068865_100011455 | Ga0068865_1000114554 | 226 |
| 323 | 3300009148 | Ga0105243_10002378 | Ga0105243_1000237813 | 226 |
| 324 | 3300009553 | Ga0105249_10049328 | Ga0105249_100493283 | 226 |
| 325 | 3300014326 | Ga0157380_10020426 | Ga0157380_100204264 | 226 |
| 326 | 3300021388 | Ga0213875_10123793 | Ga0213875_101237931 | 226 |
| 327 | 3300025937 | Ga0207669_10035175 | Ga0207669_100351753 | 226 |
| 328 | 3300025938 | Ga0207704_10007021 | Ga0207704_100070214 | 226 |
| 329 | 3300025961 | Ga0207712_10017624 | Ga0207712_100176244 | 226 |
| 330 | 3300026089 | Ga0207648_10000431 | Ga0207648_1000043144 | 226 |
| 331 | 3300026118 | Ga0207675_100003408 | Ga0207675_10000340815 | 226 |
| 332 | 3300027364 | Ga0209967_1000788 | Ga0209967_10007882 | 226 |
| 333 | 3300027695 | Ga0209966_1033118 | Ga0209966_10331182 | 226 |
| 334 | 3300028380 | Ga0268265_10001417 | Ga0268265_1000141720 | 226 |
| 335 | 3300035691 | Ga0373931_0159877 | Ga0373931_0159877_552_1301 | 226 |
| 336 | 3300035691 | Ga0373931_0417780 | Ga0373931_0417780_32_781 | 226 |
| 337 | 3300035695 | Ga0373927_0050202 | Ga0373927_0050202_1270_2070 | 226 |
| 338 | 3300036401 | Ga0373937_0422382 | Ga0373937_0422382_137_886 | 226 |
| 339 | 3300037068 | Ga0373925_0063291 | Ga0373925_0063291_675_1475 | 226 |
| 340 | 3300037853 | Ga0436364_0304718 | Ga0436364_0304718_552_1397 | 226 |
| 341 | 3300039438 | Ga0436360_0781382 | Ga0436360_0781382_1022_1873 | 226 |
| 342 | 3300046459 | Ga0495629_0191393 | Ga0495629_0191393_371_1141 | 226 |
| 343 | 3300049574 | Ga0501038_0485133 | Ga0501038_0485133_181_930 | 226 |
| 344 | 3300049575 | Ga0501039_0297789 | Ga0501039_0297789_69_821 | 226 |
| 345 | 3300049579 | Ga0501043_0329329 | Ga0501043_0329329_305_1063 | 226 |
| 346 | 3300049591 | Ga0501075_0179549 | Ga0501075_0179549_264_1016 | 226 |
| 347 | 3300049592 | Ga0501076_0089403 | Ga0501076_0089403_544_1296 | 226 |
| 348 | 3300049742 | Ga0501080_0707279 | Ga0501080_0707279_81_848 | 226 |
| 349 | 3300050507 | nmdc:mga05p37_139644_c1 | nmdc:mga05p37_139644_c1_1065_1829 | 226 |
| 350 | 3300050509 | nmdc:mga0qj67_609727_c1 | nmdc:mga0qj67_609727_c1_103_852 | 226 |
| 351 | 3300054114 | Ga0501084_0103042 | Ga0501084_0103042_1092_1841 | 226 |
| 352 | 3300003659 | JGI25404J52841_10026926 | JGI25404J52841_100269261 | 227 |
| 353 | 3300005327 | Ga0070658_10023601 | Ga0070658_100236013 | 227 |
| 354 | 3300005328 | Ga0070676_10024000 | Ga0070676_100240003 | 227 |
| 355 | 3300005334 | Ga0068869_100017275 | Ga0068869_1000172757 | 227 |
| 356 | 3300005336 | Ga0070680_100070828 | Ga0070680_1000708284 | 227 |
| 357 | 3300005338 | Ga0068868_100151783 | Ga0068868_1001517832 | 227 |
| 358 | 3300005339 | Ga0070660_100039715 | Ga0070660_1000397151 | 227 |
| 359 | 3300005364 | Ga0070673_100030249 | Ga0070673_1000302493 | 227 |
| 360 | 3300005436 | Ga0070713_100203552 | Ga0070713_1002035522 | 227 |
| 361 | 3300005456 | Ga0070678_100599709 | Ga0070678_1005997091 | 227 |
| 362 | 3300005459 | Ga0068867_100048100 | Ga0068867_1000481002 | 227 |
| 363 | 3300005530 | Ga0070679_100098373 | Ga0070679_1000983734 | 227 |
| 364 | 3300005548 | Ga0070665_100002597 | Ga0070665_1000025973 | 227 |
| 365 | 3300005617 | Ga0068859_100373848 | Ga0068859_1003738482 | 227 |
| 366 | 3300005983 | Ga0081540_1000012 | Ga0081540_100001292 | 227 |
| 367 | 3300006051 | Ga0075364_10156586 | Ga0075364_101565862 | 227 |
| 368 | 3300006177 | Ga0075362_10037055 | Ga0075362_100370554 | 227 |
| 369 | 3300006178 | Ga0075367_10001340 | Ga0075367_100013409 | 227 |
| 370 | 3300006195 | Ga0075366_10114681 | Ga0075366_101146812 | 227 |
| 371 | 3300006846 | Ga0075430_100515742 | Ga0075430_1005157422 | 227 |
| 372 | 3300006847 | Ga0075431_100619742 | Ga0075431_1006197422 | 227 |
| 373 | 3300006880 | Ga0075429_100086159 | Ga0075429_1000861592 | 227 |
| 374 | 3300006931 | Ga0097620_100373847 | Ga0097620_1003738472 | 227 |
| 375 | 3300009093 | Ga0105240_10289274 | Ga0105240_102892742 | 227 |
| 376 | 3300009093 | Ga0105240_10296585 | Ga0105240_102965852 | 227 |
| 377 | 3300009098 | Ga0105245_10193411 | Ga0105245_101934112 | 227 |
| 378 | 3300009147 | Ga0114129_10118530 | Ga0114129_101185305 | 227 |
| 379 | 3300009148 | Ga0105243_10030550 | Ga0105243_100305506 | 227 |
| 380 | 3300009176 | Ga0105242_10158219 | Ga0105242_101582192 | 227 |
| 381 | 3300009176 | Ga0105242_10237931 | Ga0105242_102379311 | 227 |
| 382 | 3300013306 | Ga0163162_10252828 | Ga0163162_102528281 | 227 |
| 383 | 3300014325 | Ga0163163_10655010 | Ga0163163_106550102 | 227 |
| 384 | 3300014497 | Ga0182008_10008440 | Ga0182008_100084403 | 227 |
| 385 | 3300015265 | Ga0182005_1010389 | Ga0182005_10103892 | 227 |
| 386 | 3300017792 | Ga0163161_10181726 | Ga0163161_101817262 | 227 |
| 387 | 3300025901 | Ga0207688_10023296 | Ga0207688_100232962 | 227 |
| 388 | 3300025907 | Ga0207645_10007365 | Ga0207645_100073653 | 227 |
| 389 | 3300025909 | Ga0207705_10100136 | Ga0207705_101001362 | 227 |
| 390 | 3300025913 | Ga0207695_10329866 | Ga0207695_103298662 | 227 |
| 391 | 3300025917 | Ga0207660_10093975 | Ga0207660_100939753 | 227 |
| 392 | 3300025919 | Ga0207657_10022694 | Ga0207657_100226945 | 227 |
| 393 | 3300025921 | Ga0207652_10075011 | Ga0207652_100750112 | 227 |
| 394 | 3300025931 | Ga0207644_10140886 | Ga0207644_101408863 | 227 |
| 395 | 3300025935 | Ga0207709_10028242 | Ga0207709_100282423 | 227 |
| 396 | 3300025942 | Ga0207689_10016285 | Ga0207689_100162853 | 227 |
| 397 | 3300025960 | Ga0207651_10056408 | Ga0207651_100564082 | 227 |
| 398 | 3300026023 | Ga0207677_10157680 | Ga0207677_101576802 | 227 |
| 399 | 3300026023 | Ga0207677_10160363 | Ga0207677_101603632 | 227 |
| 400 | 3300026089 | Ga0207648_10003980 | Ga0207648_1000398011 | 227 |
| 401 | 3300026121 | Ga0207683_10076639 | Ga0207683_100766392 | 227 |
| 402 | 3300026121 | Ga0207683_10710516 | Ga0207683_107105161 | 227 |
| 403 | 3300027543 | Ga0209999_1020235 | Ga0209999_10202352 | 227 |
| 404 | 3300027695 | Ga0209966_1000629 | Ga0209966_10006298 | 227 |
| 405 | 3300027717 | Ga0209998_10027075 | Ga0209998_100270752 | 227 |
| 406 | 3300028379 | Ga0268266_10001354 | Ga0268266_1000135422 | 227 |
| 407 | 3300028800 | Ga0265338_10001087 | Ga0265338_100010875 | 227 |
| 408 | 3300031235 | Ga0265330_10055867 | Ga0265330_100558671 | 227 |
| 409 | 3300031239 | Ga0265328_10093473 | Ga0265328_100934731 | 227 |
| 410 | 3300031250 | Ga0265331_10023684 | Ga0265331_100236842 | 227 |
| 411 | 3300031344 | Ga0265316_10173322 | Ga0265316_101733222 | 227 |
| 412 | 3300031595 | Ga0265313_10027399 | Ga0265313_100273993 | 227 |
| 413 | 3300031711 | Ga0265314_10028336 | Ga0265314_100283362 | 227 |
| 414 | 3300031711 | Ga0265314_10281754 | Ga0265314_102817541 | 227 |
| 415 | 3300031712 | Ga0265342_10072640 | Ga0265342_100726401 | 227 |
| 416 | 3300031903 | Ga0307407_10146169 | Ga0307407_101461692 | 227 |
| 417 | 3300032005 | Ga0307411_10411911 | Ga0307411_104119112 | 227 |
| 418 | 3300032126 | Ga0307415_100141034 | Ga0307415_1001410342 | 227 |
| 419 | 3300035242 | Ga0373962_0015296 | Ga0373962_0015296_485_1234 | 227 |
| 420 | 3300035242 | Ga0373962_0026211 | Ga0373962_0026211_771_1466 | 227 |
| 421 | 3300042009 | Ga0439451_023991 | Ga0439451_023991_250_1002 | 227 |
| 422 | 3300042461 | Ga0439460_0020002 | Ga0439460_0020002_550_1302 | 227 |
| 423 | 3300046475 | Ga0495639_0023702 | Ga0495639_0023702_342_1100 | 227 |
| 424 | 3300046528 | Ga0495642_0128320 | Ga0495642_0128320_130_888 | 227 |
| 425 | 3300046535 | Ga0495586_0058460 | Ga0495586_0058460_628_1386 | 227 |
| 426 | 3300046674 | Ga0495588_0037850 | Ga0495588_0037850_1349_2107 | 227 |
| 427 | 3300046675 | Ga0495657_0056795 | Ga0495657_0056795_1072_1830 | 227 |
| 428 | 3300048903 | Ga0496100_0004958 | Ga0496100_0004958_5456_6214 | 227 |
| 429 | 3300048904 | Ga0496101_0010804 | Ga0496101_0010804_5091_5849 | 227 |
| 430 | 3300048905 | Ga0496102_0017750 | Ga0496102_0017750_1241_1999 | 227 |
| 431 | 3300048907 | Ga0496104_0003649 | Ga0496104_0003649_10727_11485 | 227 |
| 432 | 3300048908 | Ga0496105_0040625 | Ga0496105_0040625_595_1353 | 227 |
| 433 | 3300048909 | Ga0496106_0011860 | Ga0496106_0011860_2537_3295 | 227 |
| 434 | 3300048914 | Ga0496111_0137323 | Ga0496111_0137323_877_1635 | 227 |
| 435 | 3300048917 | Ga0496114_0057007 | Ga0496114_0057007_1923_2681 | 227 |
| 436 | 3300050492 | nmdc:mga0yw44_19551_c1 | nmdc:mga0yw44_19551_c1_1219_1983 | 227 |
| 437 | 3300050494 | nmdc:mga06z11_20222_c1 | nmdc:mga06z11_20222_c1_477_1241 | 227 |
| 438 | 3300050508 | nmdc:mga09592_46464_c1 | nmdc:mga09592_46464_c1_1374_2126 | 227 |
| 439 | 3300050509 | nmdc:mga0qj67_15283_c1 | nmdc:mga0qj67_15283_c1_917_1681 | 227 |
| 440 | 3300050509 | nmdc:mga0qj67_42201_c1 | nmdc:mga0qj67_42201_c1_223_975 | 227 |
| 441 | 3300050509 | nmdc:mga0qj67_47790_c1 | nmdc:mga0qj67_47790_c1_1084_1836 | 227 |
| 442 | 3300050510 | nmdc:mga06r32_293794_c1 | nmdc:mga06r32_293794_c1_417_1169 | 227 |
| 443 | 3300050510 | nmdc:mga06r32_683780_c1 | nmdc:mga06r32_683780_c1_15_767 | 227 |
| 444 | 3300053096 | Ga0500641_0149189 | Ga0500641_0149189_174_938 | 227 |
| 445 | 3300053119 | Ga0500595_003852 | Ga0500595_003852_3838_4590 | 227 |
| 446 | 3300005329 | Ga0070683_100017788 | Ga0070683_1000177883 | 228 |
| 447 | 3300005331 | Ga0070670_100010577 | Ga0070670_1000105771 | 228 |
| 448 | 3300005334 | Ga0068869_100002177 | Ga0068869_10000217712 | 228 |
| 449 | 3300005336 | Ga0070680_100000256 | Ga0070680_10000025630 | 228 |
| 450 | 3300005337 | Ga0070682_100002233 | Ga0070682_1000022331 | 228 |
| 451 | 3300005341 | Ga0070691_10003307 | Ga0070691_100033077 | 228 |
| 452 | 3300005344 | Ga0070661_100000612 | Ga0070661_10000061212 | 228 |
| 453 | 3300005345 | Ga0070692_10000471 | Ga0070692_100004714 | 228 |
| 454 | 3300005347 | Ga0070668_100374716 | Ga0070668_1003747162 | 228 |
| 455 | 3300005353 | Ga0070669_100041335 | Ga0070669_1000413352 | 228 |
| 456 | 3300005356 | Ga0070674_100027282 | Ga0070674_1000272823 | 228 |
| 457 | 3300005364 | Ga0070673_100008357 | Ga0070673_1000083578 | 228 |
| 458 | 3300005366 | Ga0070659_100002925 | Ga0070659_1000029252 | 228 |
| 459 | 3300005406 | Ga0070703_10079852 | Ga0070703_100798522 | 228 |
| 460 | 3300005438 | Ga0070701_10005008 | Ga0070701_100050082 | 228 |
| 461 | 3300005440 | Ga0070705_100000322 | Ga0070705_10000032221 | 228 |
| 462 | 3300005444 | Ga0070694_100002034 | Ga0070694_10000203412 | 228 |
| 463 | 3300005445 | Ga0070708_100555762 | Ga0070708_1005557621 | 228 |
| 464 | 3300005455 | Ga0070663_100003795 | Ga0070663_1000037958 | 228 |
| 465 | 3300005457 | Ga0070662_100002915 | Ga0070662_10000291510 | 228 |
| 466 | 3300005457 | Ga0070662_100243229 | Ga0070662_1002432291 | 228 |
| 467 | 3300005458 | Ga0070681_10006219 | Ga0070681_1000621912 | 228 |
| 468 | 3300005459 | Ga0068867_100002386 | Ga0068867_1000023864 | 228 |
| 469 | 3300005467 | Ga0070706_100186638 | Ga0070706_1001866383 | 228 |
| 470 | 3300005471 | Ga0070698_100000092 | Ga0070698_10000009266 | 228 |
| 471 | 3300005518 | Ga0070699_100013540 | Ga0070699_1000135403 | 228 |
| 472 | 3300005518 | Ga0070699_100111801 | Ga0070699_1001118012 | 228 |
| 473 | 3300005530 | Ga0070679_100003538 | Ga0070679_10000353812 | 228 |
| 474 | 3300005535 | Ga0070684_100513779 | Ga0070684_1005137791 | 228 |
| 475 | 3300005539 | Ga0068853_100000249 | Ga0068853_10000024916 | 228 |
| 476 | 3300005545 | Ga0070695_100002595 | Ga0070695_1000025958 | 228 |
| 477 | 3300005546 | Ga0070696_100000891 | Ga0070696_1000008919 | 228 |
| 478 | 3300005547 | Ga0070693_100000137 | Ga0070693_10000013732 | 228 |
| 479 | 3300005549 | Ga0070704_100311022 | Ga0070704_1003110222 | 228 |
| 480 | 3300005563 | Ga0068855_100001817 | Ga0068855_10000181722 | 228 |
| 481 | 3300005564 | Ga0070664_100058537 | Ga0070664_1000585372 | 228 |
| 482 | 3300005577 | Ga0068857_100029661 | Ga0068857_1000296612 | 228 |
| 483 | 3300005614 | Ga0068856_100004022 | Ga0068856_10000402212 | 228 |
| 484 | 3300005617 | Ga0068859_100001622 | Ga0068859_10000162222 | 228 |
| 485 | 3300005618 | Ga0068864_100005149 | Ga0068864_1000051498 | 228 |
| 486 | 3300005718 | Ga0068866_10056519 | Ga0068866_100565193 | 228 |
| 487 | 3300005840 | Ga0068870_10000714 | Ga0068870_1000071412 | 228 |
| 488 | 3300005841 | Ga0068863_100089869 | Ga0068863_1000898693 | 228 |
| 489 | 3300005842 | Ga0068858_100172145 | Ga0068858_1001721452 | 228 |
| 490 | 3300005844 | Ga0068862_100011620 | Ga0068862_1000116206 | 228 |
| 491 | 3300005937 | Ga0081455_10000345 | Ga0081455_1000034517 | 228 |
| 492 | 3300005985 | Ga0081539_10129531 | Ga0081539_101295312 | 228 |
| 493 | 3300006042 | Ga0075368_10070075 | Ga0075368_100700752 | 228 |
| 494 | 3300006186 | Ga0075369_10023748 | Ga0075369_100237482 | 228 |
| 495 | 3300006847 | Ga0075431_100145991 | Ga0075431_1001459913 | 228 |
| 496 | 3300006852 | Ga0075433_10000401 | Ga0075433_1000040115 | 228 |
| 497 | 3300006871 | Ga0075434_100014160 | Ga0075434_1000141606 | 228 |
| 498 | 3300006871 | Ga0075434_100080791 | Ga0075434_1000807912 | 228 |
| 499 | 3300006881 | Ga0068865_100071298 | Ga0068865_1000712982 | 228 |
| 500 | 3300006931 | Ga0097620_100001622 | Ga0097620_1000016221 | 228 |
| 501 | 3300007076 | Ga0075435_100002030 | Ga0075435_1000020304 | 228 |
| 502 | 3300007076 | Ga0075435_100082648 | Ga0075435_1000826481 | 228 |
| 503 | 3300007265 | Ga0099794_10029762 | Ga0099794_100297622 | 228 |
| 504 | 3300009094 | Ga0111539_10096036 | Ga0111539_100960363 | 228 |
| 505 | 3300009094 | Ga0111539_11022217 | Ga0111539_110222172 | 228 |
| 506 | 3300009553 | Ga0105249_10408697 | Ga0105249_104086971 | 228 |
| 507 | 3300010375 | Ga0105239_10439302 | Ga0105239_104393022 | 228 |
| 508 | 3300013296 | Ga0157374_10040219 | Ga0157374_100402194 | 228 |
| 509 | 3300013297 | Ga0157378_10093845 | Ga0157378_100938452 | 228 |
| 510 | 3300013308 | Ga0157375_10075596 | Ga0157375_100755962 | 228 |
| 511 | 3300014326 | Ga0157380_10295564 | Ga0157380_102955641 | 228 |
| 512 | 3300021384 | Ga0213876_10054483 | Ga0213876_100544832 | 228 |
| 513 | 3300021388 | Ga0213875_10000825 | Ga0213875_1000082516 | 228 |
| 514 | 3300021388 | Ga0213875_10021532 | Ga0213875_100215323 | 228 |
| 515 | 3300021441 | Ga0213871_10019429 | Ga0213871_100194292 | 228 |
| 516 | 3300025885 | Ga0207653_10004318 | Ga0207653_100043185 | 228 |
| 517 | 3300025899 | Ga0207642_10020222 | Ga0207642_100202222 | 228 |
| 518 | 3300025901 | Ga0207688_10013304 | Ga0207688_100133042 | 228 |
| 519 | 3300025903 | Ga0207680_10177726 | Ga0207680_101777262 | 228 |
| 520 | 3300025907 | Ga0207645_10001231 | Ga0207645_1000123120 | 228 |
| 521 | 3300025908 | Ga0207643_10000036 | Ga0207643_1000003616 | 228 |
| 522 | 3300025910 | Ga0207684_10057910 | Ga0207684_100579102 | 228 |
| 523 | 3300025911 | Ga0207654_10017766 | Ga0207654_100177664 | 228 |
| 524 | 3300025912 | Ga0207707_10001333 | Ga0207707_1000133312 | 228 |
| 525 | 3300025917 | Ga0207660_10001071 | Ga0207660_1000107118 | 228 |
| 526 | 3300025918 | Ga0207662_10079337 | Ga0207662_100793372 | 228 |
| 527 | 3300025920 | Ga0207649_10051738 | Ga0207649_100517383 | 228 |
| 528 | 3300025921 | Ga0207652_10002086 | Ga0207652_100020868 | 228 |
| 529 | 3300025923 | Ga0207681_10104339 | Ga0207681_101043392 | 228 |
| 530 | 3300025925 | Ga0207650_10086755 | Ga0207650_100867553 | 228 |
| 531 | 3300025932 | Ga0207690_10000580 | Ga0207690_1000058023 | 228 |
| 532 | 3300025933 | Ga0207706_10007512 | Ga0207706_100075124 | 228 |
| 533 | 3300025935 | Ga0207709_10271990 | Ga0207709_102719901 | 228 |
| 534 | 3300025937 | Ga0207669_10372673 | Ga0207669_103726732 | 228 |
| 535 | 3300025938 | Ga0207704_10063938 | Ga0207704_100639382 | 228 |
| 536 | 3300025939 | Ga0207665_10095580 | Ga0207665_100955802 | 228 |
| 537 | 3300025940 | Ga0207691_10255017 | Ga0207691_102550171 | 228 |
| 538 | 3300025941 | Ga0207711_10739052 | Ga0207711_107390521 | 228 |
| 539 | 3300025942 | Ga0207689_10000221 | Ga0207689_1000022116 | 228 |
| 540 | 3300025942 | Ga0207689_10284416 | Ga0207689_102844162 | 228 |
| 541 | 3300025944 | Ga0207661_10021338 | Ga0207661_100213383 | 228 |
| 542 | 3300025945 | Ga0207679_10001048 | Ga0207679_1000104815 | 228 |
| 543 | 3300025949 | Ga0207667_10000470 | Ga0207667_1000047036 | 228 |
| 544 | 3300026035 | Ga0207703_10544239 | Ga0207703_105442392 | 228 |
| 545 | 3300026041 | Ga0207639_10195143 | Ga0207639_101951432 | 228 |
| 546 | 3300026067 | Ga0207678_10004149 | Ga0207678_100041492 | 228 |
| 547 | 3300026067 | Ga0207678_10004263 | Ga0207678_100042634 | 228 |
| 548 | 3300026078 | Ga0207702_10001365 | Ga0207702_1000136516 | 228 |
| 549 | 3300026089 | Ga0207648_10530785 | Ga0207648_105307851 | 228 |
| 550 | 3300026116 | Ga0207674_10001830 | Ga0207674_1000183012 | 228 |
| 551 | 3300026118 | Ga0207675_100003028 | Ga0207675_1000030282 | 228 |
| 552 | 3300027907 | Ga0207428_10018998 | Ga0207428_100189986 | 228 |
| 553 | 3300027907 | Ga0207428_10128446 | Ga0207428_101284462 | 228 |
| 554 | 3300028380 | Ga0268265_10008236 | Ga0268265_100082363 | 228 |
| 555 | 3300028381 | Ga0268264_10011455 | Ga0268264_100114551 | 228 |
| 556 | 3300028794 | Ga0307515_10165858 | Ga0307515_101658582 | 228 |
| 557 | 3300031344 | Ga0265316_10065851 | Ga0265316_100658513 | 228 |
| 558 | 3300031911 | Ga0307412_10108218 | Ga0307412_101082182 | 228 |
| 559 | 3300034816 | Ga0373930_0010936 | Ga0373930_0010936_508_1272 | 228 |
| 560 | 3300035092 | Ga0373952_0007454 | Ga0373952_0007454_752_1516 | 228 |
| 561 | 3300035111 | Ga0373923_0154820 | Ga0373923_0154820_62_817 | 228 |
| 562 | 3300035115 | Ga0373941_0014617 | Ga0373941_0014617_53_817 | 228 |
| 563 | 3300035172 | Ga0373955_0233727 | Ga0373955_0233727_62_817 | 228 |
| 564 | 3300035207 | Ga0373942_0047256 | Ga0373942_0047256_332_1096 | 228 |
| 565 | 3300035241 | Ga0373961_0006309 | Ga0373961_0006309_1287_2051 | 228 |
| 566 | 3300035691 | Ga0373931_0161601 | Ga0373931_0161601_57_821 | 228 |
| 567 | 3300035724 | Ga0373933_0005686 | Ga0373933_0005686_902_1657 | 228 |
| 568 | 3300036401 | Ga0373937_0367677 | Ga0373937_0367677_520_1275 | 228 |
| 569 | 3300037853 | Ga0436364_0033237 | Ga0436364_0033237_2811_3569 | 228 |
| 570 | 3300037853 | Ga0436364_0475448 | Ga0436364_0475448_63_827 | 228 |
| 571 | 3300039437 | Ga0436365_0017438 | Ga0436365_0017438_2553_3311 | 228 |
| 572 | 3300046460 | Ga0495638_0094375 | Ga0495638_0094375_225_995 | 228 |
| 573 | 3300046463 | Ga0495653_0316711 | Ga0495653_0316711_243_998 | 228 |
| 574 | 3300046500 | Ga0495596_0066620 | Ga0495596_0066620_467_1237 | 228 |
| 575 | 3300046506 | Ga0495583_0016024 | Ga0495583_0016024_1112_1882 | 228 |
| 576 | 3300046515 | Ga0495620_0011112 | Ga0495620_0011112_1319_2089 | 228 |
| 577 | 3300046542 | Ga0495597_0094854 | Ga0495597_0094854_385_1155 | 228 |
| 578 | 3300046665 | Ga0495661_0104172 | Ga0495661_0104172_312_1082 | 228 |
| 579 | 3300048919 | Ga0496116_0024577 | Ga0496116_0024577_771_1541 | 228 |
| 580 | 3300048922 | Ga0496119_0054141 | Ga0496119_0054141_1426_2196 | 228 |
| 581 | 3300048924 | Ga0496121_0022068 | Ga0496121_0022068_2216_2986 | 228 |
| 582 | 3300048928 | Ga0496125_0011331 | Ga0496125_0011331_185_955 | 228 |
| 583 | 3300049571 | Ga0501034_0000211 | Ga0501034_0000211_70335_71102 | 228 |
| 584 | 3300049571 | Ga0501034_0002398 | Ga0501034_0002398_9790_10557 | 228 |
| 585 | 3300049572 | Ga0501036_0000172 | Ga0501036_0000172_14078_14845 | 228 |
| 586 | 3300049573 | Ga0501037_0003588 | Ga0501037_0003588_6182_6949 | 228 |
| 587 | 3300049573 | Ga0501037_0244558 | Ga0501037_0244558_358_1119 | 228 |
| 588 | 3300049579 | Ga0501043_0023537 | Ga0501043_0023537_956_1723 | 228 |
| 589 | 3300049580 | Ga0501046_0028558 | Ga0501046_0028558_3135_3902 | 228 |
| 590 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_255864_256631 | 228 |
| 591 | 3300049581 | Ga0501047_0546302 | Ga0501047_0546302_170_937 | 228 |
| 592 | 3300049582 | Ga0501048_0014062 | Ga0501048_0014062_3574_4341 | 228 |
| 593 | 3300049586 | Ga0501070_0009756 | Ga0501070_0009756_1640_2407 | 228 |
| 594 | 3300049586 | Ga0501070_0445668 | Ga0501070_0445668_40_801 | 228 |
| 595 | 3300049587 | Ga0501071_0227462 | Ga0501071_0227462_432_1196 | 228 |
| 596 | 3300049589 | Ga0501073_0103508 | Ga0501073_0103508_1011_1772 | 228 |
| 597 | 3300049590 | Ga0501074_0181684 | Ga0501074_0181684_241_1008 | 228 |
| 598 | 3300049592 | Ga0501076_0012855 | Ga0501076_0012855_2018_2782 | 228 |
| 599 | 3300049742 | Ga0501080_0001018 | Ga0501080_0001018_15838_16605 | 228 |
| 600 | 3300049742 | Ga0501080_0096067 | Ga0501080_0096067_186_947 | 228 |
| 601 | 3300049823 | Ga0501044_0004598 | Ga0501044_0004598_7334_8101 | 228 |
| 602 | 3300050510 | nmdc:mga06r32_15674_c1 | nmdc:mga06r32_15674_c1_6001_6765 | 228 |
| 603 | 3300050511 | nmdc:mga08y16_10783_c1 | nmdc:mga08y16_10783_c1_3218_3988 | 228 |
| 604 | 3300050511 | nmdc:mga08y16_155820_c1 | nmdc:mga08y16_155820_c1_1224_1988 | 228 |
| 605 | 3300050512 | nmdc:mga0n895_12406_c1 | nmdc:mga0n895_12406_c1_5789_6553 | 228 |
| 606 | 3300050513 | nmdc:mga0rr50_1668_c1 | nmdc:mga0rr50_1668_c1_3578_4342 | 228 |
| 607 | 3300050514 | nmdc:mga08x19_237_c1 | nmdc:mga08x19_237_c1_2399_3154 | 228 |
| 608 | 3300050515 | nmdc:mga0a205_4491_c1 | nmdc:mga0a205_4491_c1_279_1043 | 228 |
| 609 | 3300050516 | nmdc:mga0sz30_152358_c1 | nmdc:mga0sz30_152358_c1_82_852 | 228 |
| 610 | 3300053088 | Ga0500644_0127129 | Ga0500644_0127129_158_928 | 228 |
| 611 | 3300053089 | Ga0500581_018950 | Ga0500581_018950_1544_2314 | 228 |
| 612 | 3300053096 | Ga0500641_0001992 | Ga0500641_0001992_511_1281 | 228 |
| 613 | 3300053098 | Ga0500650_0000145 | Ga0500650_0000145_3759_4529 | 228 |
| 614 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_265535_266305 | 228 |
| 615 | 3300053130 | Ga0500642_0000074 | Ga0500642_0000074_32261_33031 | 228 |
| 616 | 3300053131 | Ga0500652_000065 | Ga0500652_000065_18246_19016 | 228 |
| 617 | 3300053134 | Ga0500658_0072711 | Ga0500658_0072711_510_1280 | 228 |
| 618 | 3300053139 | Ga0500568_0009152 | Ga0500568_0009152_321_1091 | 228 |
| 619 | 3300053151 | Ga0500604_0016565 | Ga0500604_0016565_50_820 | 228 |
| 620 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_292698_293468 | 228 |
| 621 | 3300053156 | Ga0500622_0006481 | Ga0500622_0006481_1663_2433 | 228 |
| 622 | 3300053160 | Ga0500633_0001663 | Ga0500633_0001663_563_1333 | 228 |
| 623 | 3300060353 | Ga0501082_0261755 | Ga0501082_0261755_659_1426 | 228 |
| 624 | 3300005336 | Ga0070680_100001789 | Ga0070680_1000017895 | 229 |
| 625 | 3300005340 | Ga0070689_100308577 | Ga0070689_1003085772 | 229 |
| 626 | 3300005434 | Ga0070709_10070049 | Ga0070709_100700492 | 229 |
| 627 | 3300005458 | Ga0070681_10000533 | Ga0070681_1000053311 | 229 |
| 628 | 3300005530 | Ga0070679_100001589 | Ga0070679_1000015891 | 229 |
| 629 | 3300005563 | Ga0068855_100031588 | Ga0068855_1000315881 | 229 |
| 630 | 3300005719 | Ga0068861_100069051 | Ga0068861_1000690512 | 229 |
| 631 | 3300005841 | Ga0068863_100128871 | Ga0068863_1001288712 | 229 |
| 632 | 3300006028 | Ga0070717_10315138 | Ga0070717_103151382 | 229 |
| 633 | 3300006038 | Ga0075365_10084598 | Ga0075365_100845981 | 229 |
| 634 | 3300006177 | Ga0075362_10110102 | Ga0075362_101101021 | 229 |
| 635 | 3300006871 | Ga0075434_100448331 | Ga0075434_1004483312 | 229 |
| 636 | 3300007788 | Ga0099795_10075030 | Ga0099795_100750302 | 229 |
| 637 | 3300009093 | Ga0105240_10007951 | Ga0105240_1000795111 | 229 |
| 638 | 3300009147 | Ga0114129_10296365 | Ga0114129_102963652 | 229 |
| 639 | 3300010375 | Ga0105239_10477491 | Ga0105239_104774912 | 229 |
| 640 | 3300013308 | Ga0157375_10069953 | Ga0157375_100699532 | 229 |
| 641 | 3300021441 | Ga0213871_10020792 | Ga0213871_100207922 | 229 |
| 642 | 3300025905 | Ga0207685_10042090 | Ga0207685_100420902 | 229 |
| 643 | 3300025906 | Ga0207699_10056548 | Ga0207699_100565482 | 229 |
| 644 | 3300025912 | Ga0207707_10022145 | Ga0207707_100221458 | 229 |
| 645 | 3300025917 | Ga0207660_10056512 | Ga0207660_100565121 | 229 |
| 646 | 3300025921 | Ga0207652_10005743 | Ga0207652_100057435 | 229 |
| 647 | 3300025949 | Ga0207667_10033267 | Ga0207667_100332675 | 229 |
| 648 | 3300025972 | Ga0207668_10577019 | Ga0207668_105770191 | 229 |
| 649 | 3300026088 | Ga0207641_10225130 | Ga0207641_102251302 | 229 |
| 650 | 3300026118 | Ga0207675_100110510 | Ga0207675_1001105102 | 229 |
| 651 | 3300031247 | Ga0265340_10082256 | Ga0265340_100822562 | 229 |
| 652 | 3300035115 | Ga0373941_0003696 | Ga0373941_0003696_2433_3200 | 229 |
| 653 | 3300039438 | Ga0436360_0023372 | Ga0436360_0023372_10248_11012 | 229 |
| 654 | 3300048903 | Ga0496100_0492526 | Ga0496100_0492526_81_845 | 229 |
| 655 | 3300048913 | Ga0496110_0028940 | Ga0496110_0028940_940_1704 | 229 |
| 656 | 3300048914 | Ga0496111_0075975 | Ga0496111_0075975_1416_2180 | 229 |
| 657 | 3300048916 | Ga0496113_0092657 | Ga0496113_0092657_1514_2278 | 229 |
| 658 | 3300049569 | Ga0501032_0120235 | Ga0501032_0120235_281_1048 | 229 |
| 659 | 3300049570 | Ga0501033_0020528 | Ga0501033_0020528_3582_4349 | 229 |
| 660 | 3300049571 | Ga0501034_0071326 | Ga0501034_0071326_1679_2446 | 229 |
| 661 | 3300049572 | Ga0501036_0068822 | Ga0501036_0068822_277_1044 | 229 |
| 662 | 3300049573 | Ga0501037_0010884 | Ga0501037_0010884_1513_2280 | 229 |
| 663 | 3300049579 | Ga0501043_0013340 | Ga0501043_0013340_3743_4510 | 229 |
| 664 | 3300049580 | Ga0501046_0101883 | Ga0501046_0101883_1386_2144 | 229 |
| 665 | 3300049581 | Ga0501047_0013674 | Ga0501047_0013674_3056_3823 | 229 |
| 666 | 3300049587 | Ga0501071_0096340 | Ga0501071_0096340_382_1140 | 229 |
| 667 | 3300049587 | Ga0501071_0119031 | Ga0501071_0119031_918_1685 | 229 |
| 668 | 3300049588 | Ga0501072_0023506 | Ga0501072_0023506_183_941 | 229 |
| 669 | 3300049589 | Ga0501073_0006056 | Ga0501073_0006056_4598_5365 | 229 |
| 670 | 3300049590 | Ga0501074_0042094 | Ga0501074_0042094_215_973 | 229 |
| 671 | 3300049591 | Ga0501075_0007356 | Ga0501075_0007356_4240_4998 | 229 |
| 672 | 3300049592 | Ga0501076_0082346 | Ga0501076_0082346_1429_2187 | 229 |
| 673 | 3300049741 | Ga0501079_0026705 | Ga0501079_0026705_79_846 | 229 |
| 674 | 3300049741 | Ga0501079_0026910 | Ga0501079_0026910_2884_3642 | 229 |
| 675 | 3300049741 | Ga0501079_0505862 | Ga0501079_0505862_86_844 | 229 |
| 676 | 3300049743 | Ga0501081_0015582 | Ga0501081_0015582_4139_4897 | 229 |
| 677 | 3300049743 | Ga0501081_0634673 | Ga0501081_0634673_29_787 | 229 |
| 678 | 3300050512 | nmdc:mga0n895_60524_c1 | nmdc:mga0n895_60524_c1_589_1353 | 229 |
| 679 | 3300050515 | nmdc:mga0a205_139410_c1 | nmdc:mga0a205_139410_c1_713_1477 | 229 |
| 680 | 3300054114 | Ga0501084_0078752 | Ga0501084_0078752_447_1205 | 229 |
| 681 | 3300060353 | Ga0501082_0009462 | Ga0501082_0009462_5520_6278 | 229 |
| 682 | 3300005435 | Ga0070714_100265508 | Ga0070714_1002655081 | 230 |
| 683 | 3300005530 | Ga0070679_100766575 | Ga0070679_1007665751 | 230 |
| 684 | 3300006871 | Ga0075434_100055791 | Ga0075434_1000557912 | 230 |
| 685 | 3300010159 | Ga0099796_10061992 | Ga0099796_100619921 | 230 |
| 686 | 3300014326 | Ga0157380_10074287 | Ga0157380_100742873 | 230 |
| 687 | 3300028800 | Ga0265338_10073524 | Ga0265338_100735243 | 230 |
| 688 | 3300031241 | Ga0265325_10234771 | Ga0265325_102347711 | 230 |
| 689 | 3300031250 | Ga0265331_10102166 | Ga0265331_101021662 | 230 |
| 690 | 3300031712 | Ga0265342_10294420 | Ga0265342_102944201 | 230 |
| 691 | 3300034819 | Ga0373958_0068708 | Ga0373958_0068708_14_772 | 230 |
| 692 | 3300036401 | Ga0373937_0628076 | Ga0373937_0628076_209_970 | 230 |
| 693 | 3300039447 | Ga0436361_0051074 | Ga0436361_0051074_391_1155 | 230 |
| 694 | 3300044694 | Ga0466963_0043041 | Ga0466963_0043041_371_1132 | 230 |
| 695 | 3300044842 | Ga0466957_0097914 | Ga0466957_0097914_1037_1798 | 230 |
| 696 | 3300045976 | Ga0466967_0051569 | Ga0466967_0051569_1455_2216 | 230 |
| 697 | 3300049584 | Ga0501068_0008197 | Ga0501068_0008197_3091_3858 | 230 |
| 698 | 3300049744 | Ga0501083_0062480 | Ga0501083_0062480_255_1022 | 230 |
| 699 | 3300049822 | Ga0501035_0040338 | Ga0501035_0040338_1502_2269 | 230 |
| 700 | 3300050512 | nmdc:mga0n895_426245_c1 | nmdc:mga0n895_426245_c1_107_865 | 230 |
| 701 | 3300061719 | Ga0466962_0164274 | Ga0466962_0164274_131_892 | 230 |
| 702 | iso_pu_bacteria | 2883354860 | 2883359825 | 230 |
| 703 | iso_pu_bacteria | 2919450847 | 2919451029 | 230 |
| 704 | iso_pu_bacteria | 8001845381 | 8001848856 | 230 |
| 705 | 3300005329 | Ga0070683_100881702 | Ga0070683_1008817021 | 231 |
| 706 | 3300005341 | Ga0070691_10240066 | Ga0070691_102400661 | 231 |
| 707 | 3300005344 | Ga0070661_100079391 | Ga0070661_1000793912 | 231 |
| 708 | 3300005353 | Ga0070669_100036743 | Ga0070669_1000367432 | 231 |
| 709 | 3300005355 | Ga0070671_100010297 | Ga0070671_1000102979 | 231 |
| 710 | 3300005367 | Ga0070667_100773618 | Ga0070667_1007736181 | 231 |
| 711 | 3300005435 | Ga0070714_100121822 | Ga0070714_1001218221 | 231 |
| 712 | 3300005437 | Ga0070710_10057606 | Ga0070710_100576062 | 231 |
| 713 | 3300005439 | Ga0070711_100185582 | Ga0070711_1001855821 | 231 |
| 714 | 3300005445 | Ga0070708_100096119 | Ga0070708_1000961193 | 231 |
| 715 | 3300005467 | Ga0070706_100082148 | Ga0070706_1000821482 | 231 |
| 716 | 3300005518 | Ga0070699_100256247 | Ga0070699_1002562472 | 231 |
| 717 | 3300005543 | Ga0070672_100224306 | Ga0070672_1002243061 | 231 |
| 718 | 3300005545 | Ga0070695_100102504 | Ga0070695_1001025042 | 231 |
| 719 | 3300005547 | Ga0070693_100007957 | Ga0070693_1000079576 | 231 |
| 720 | 3300005842 | Ga0068858_100207956 | Ga0068858_1002079563 | 231 |
| 721 | 3300005843 | Ga0068860_100096734 | Ga0068860_1000967343 | 231 |
| 722 | 3300005981 | Ga0081538_10004641 | Ga0081538_100046419 | 231 |
| 723 | 3300006038 | Ga0075365_10023487 | Ga0075365_100234873 | 231 |
| 724 | 3300006177 | Ga0075362_10122894 | Ga0075362_101228942 | 231 |
| 725 | 3300006178 | Ga0075367_10125657 | Ga0075367_101256572 | 231 |
| 726 | 3300006186 | Ga0075369_10011173 | Ga0075369_100111733 | 231 |
| 727 | 3300006195 | Ga0075366_10044655 | Ga0075366_100446552 | 231 |
| 728 | 3300006195 | Ga0075366_10056029 | Ga0075366_100560292 | 231 |
| 729 | 3300006237 | Ga0097621_100044812 | Ga0097621_1000448122 | 231 |
| 730 | 3300006353 | Ga0075370_10046561 | Ga0075370_100465612 | 231 |
| 731 | 3300006358 | Ga0068871_100016534 | Ga0068871_1000165342 | 231 |
| 732 | 3300006844 | Ga0075428_100013055 | Ga0075428_1000130557 | 231 |
| 733 | 3300006844 | Ga0075428_100397290 | Ga0075428_1003972903 | 231 |
| 734 | 3300006846 | Ga0075430_100042341 | Ga0075430_1000423412 | 231 |
| 735 | 3300006846 | Ga0075430_100210051 | Ga0075430_1002100512 | 231 |
| 736 | 3300006852 | Ga0075433_10020333 | Ga0075433_100203336 | 231 |
| 737 | 3300006871 | Ga0075434_100152268 | Ga0075434_1001522683 | 231 |
| 738 | 3300006871 | Ga0075434_100190314 | Ga0075434_1001903142 | 231 |
| 739 | 3300006880 | Ga0075429_100060798 | Ga0075429_1000607984 | 231 |
| 740 | 3300009093 | Ga0105240_10027170 | Ga0105240_100271703 | 231 |
| 741 | 3300009094 | Ga0111539_10000939 | Ga0111539_1000093930 | 231 |
| 742 | 3300009098 | Ga0105245_10030099 | Ga0105245_100300993 | 231 |
| 743 | 3300009147 | Ga0114129_10012278 | Ga0114129_100122788 | 231 |
| 744 | 3300009147 | Ga0114129_10127673 | Ga0114129_101276733 | 231 |
| 745 | 3300009147 | Ga0114129_10605814 | Ga0114129_106058142 | 231 |
| 746 | 3300009147 | Ga0114129_10645701 | Ga0114129_106457012 | 231 |
| 747 | 3300009148 | Ga0105243_10752183 | Ga0105243_107521831 | 231 |
| 748 | 3300009176 | Ga0105242_10011684 | Ga0105242_100116844 | 231 |
| 749 | 3300009551 | Ga0105238_10086178 | Ga0105238_100861782 | 231 |
| 750 | 3300009553 | Ga0105249_10158542 | Ga0105249_101585423 | 231 |
| 751 | 3300013104 | Ga0157370_10020382 | Ga0157370_100203825 | 231 |
| 752 | 3300013306 | Ga0163162_10124289 | Ga0163162_101242893 | 231 |
| 753 | 3300014968 | Ga0157379_10021876 | Ga0157379_100218762 | 231 |
| 754 | 3300020082 | Ga0206353_10696245 | Ga0206353_106962452 | 231 |
| 755 | 3300021377 | Ga0213874_10048726 | Ga0213874_100487262 | 231 |
| 756 | 3300021384 | Ga0213876_10075305 | Ga0213876_100753051 | 231 |
| 757 | 3300021384 | Ga0213876_10130598 | Ga0213876_101305982 | 231 |
| 758 | 3300025321 | Ga0207656_10114846 | Ga0207656_101148462 | 231 |
| 759 | 3300025898 | Ga0207692_10008108 | Ga0207692_100081083 | 231 |
| 760 | 3300025898 | Ga0207692_10049633 | Ga0207692_100496332 | 231 |
| 761 | 3300025906 | Ga0207699_10079929 | Ga0207699_100799292 | 231 |
| 762 | 3300025907 | Ga0207645_10072227 | Ga0207645_100722272 | 231 |
| 763 | 3300025909 | Ga0207705_10055696 | Ga0207705_100556962 | 231 |
| 764 | 3300025912 | Ga0207707_10016894 | Ga0207707_100168942 | 231 |
| 765 | 3300025912 | Ga0207707_10117452 | Ga0207707_101174523 | 231 |
| 766 | 3300025915 | Ga0207693_10138535 | Ga0207693_101385353 | 231 |
| 767 | 3300025916 | Ga0207663_10037807 | Ga0207663_100378072 | 231 |
| 768 | 3300025920 | Ga0207649_10031771 | Ga0207649_100317713 | 231 |
| 769 | 3300025923 | Ga0207681_10041283 | Ga0207681_100412833 | 231 |
| 770 | 3300025924 | Ga0207694_10358801 | Ga0207694_103588012 | 231 |
| 771 | 3300025929 | Ga0207664_10071023 | Ga0207664_100710234 | 231 |
| 772 | 3300025932 | Ga0207690_10018108 | Ga0207690_100181086 | 231 |
| 773 | 3300025934 | Ga0207686_10012278 | Ga0207686_100122782 | 231 |
| 774 | 3300025939 | Ga0207665_10023537 | Ga0207665_100235374 | 231 |
| 775 | 3300025942 | Ga0207689_10158614 | Ga0207689_101586143 | 231 |
| 776 | 3300025944 | Ga0207661_10760263 | Ga0207661_107602631 | 231 |
| 777 | 3300026078 | Ga0207702_10304378 | Ga0207702_103043782 | 231 |
| 778 | 3300027907 | Ga0207428_10294028 | Ga0207428_102940282 | 231 |
| 779 | 3300028381 | Ga0268264_10019070 | Ga0268264_100190703 | 231 |
| 780 | 3300028381 | Ga0268264_11002755 | Ga0268264_110027551 | 231 |
| 781 | 3300028794 | Ga0307515_10120366 | Ga0307515_101203662 | 231 |
| 782 | 3300031456 | Ga0307513_10074102 | Ga0307513_100741023 | 231 |
| 783 | 3300031548 | Ga0307408_100607829 | Ga0307408_1006078291 | 231 |
| 784 | 3300031731 | Ga0307405_10003388 | Ga0307405_100033885 | 231 |
| 785 | 3300031901 | Ga0307406_10011623 | Ga0307406_100116233 | 231 |
| 786 | 3300031911 | Ga0307412_10052192 | Ga0307412_100521921 | 231 |
| 787 | 3300034819 | Ga0373958_0017718 | Ga0373958_0017718_32_796 | 231 |
| 788 | 3300035083 | Ga0373926_0082549 | Ga0373926_0082549_106_882 | 231 |
| 789 | 3300035089 | Ga0373944_0039613 | Ga0373944_0039613_94_870 | 231 |
| 790 | 3300035119 | Ga0373956_0007441 | Ga0373956_0007441_350_1114 | 231 |
| 791 | 3300035172 | Ga0373955_0013176 | Ga0373955_0013176_637_1401 | 231 |
| 792 | 3300035692 | Ga0373935_0002957 | Ga0373935_0002957_2473_3249 | 231 |
| 793 | 3300035695 | Ga0373927_0001543 | Ga0373927_0001543_8926_9696 | 231 |
| 794 | 3300035725 | Ga0373947_0026688 | Ga0373947_0026688_438_1214 | 231 |
| 795 | 3300036401 | Ga0373937_0006609 | Ga0373937_0006609_1638_2402 | 231 |
| 796 | 3300037068 | Ga0373925_0021920 | Ga0373925_0021920_1217_1993 | 231 |
| 797 | 3300037068 | Ga0373925_0086777 | Ga0373925_0086777_826_1596 | 231 |
| 798 | 3300037853 | Ga0436364_0056330 | Ga0436364_0056330_114_881 | 231 |
| 799 | 3300037853 | Ga0436364_0110942 | Ga0436364_0110942_337_1104 | 231 |
| 800 | 3300037853 | Ga0436364_1204625 | Ga0436364_1204625_672_1439 | 231 |
| 801 | 3300039437 | Ga0436365_0132947 | Ga0436365_0132947_34_801 | 231 |
| 802 | 3300039437 | Ga0436365_0232658 | Ga0436365_0232658_736_1497 | 231 |
| 803 | 3300039437 | Ga0436365_0366029 | Ga0436365_0366029_286_1053 | 231 |
| 804 | 3300039437 | Ga0436365_0367776 | Ga0436365_0367776_1620_2387 | 231 |
| 805 | 3300039437 | Ga0436365_0854068 | Ga0436365_0854068_2570_3331 | 231 |
| 806 | 3300039437 | Ga0436365_1085262 | Ga0436365_1085262_10867_11634 | 231 |
| 807 | 3300039437 | Ga0436365_1119339 | Ga0436365_1119339_44_826 | 231 |
| 808 | 3300039437 | Ga0436365_1453878 | Ga0436365_1453878_153_920 | 231 |
| 809 | 3300039450 | Ga0436363_1135077 | Ga0436363_1135077_562_1323 | 231 |
| 810 | 3300041411 | Ga0439466_0002570 | Ga0439466_0002570_3856_4614 | 231 |
| 811 | 3300041413 | Ga0439465_0000313 | Ga0439465_0000313_7444_8202 | 231 |
| 812 | 3300041997 | Ga0439431_0002613 | Ga0439431_0002613_521_1279 | 231 |
| 813 | 3300041999 | Ga0439433_0000146 | Ga0439433_0000146_2748_3506 | 231 |
| 814 | 3300042004 | Ga0439445_0001088 | Ga0439445_0001088_1524_2282 | 231 |
| 815 | 3300042006 | Ga0439432_001514 | Ga0439432_001514_7126_7884 | 231 |
| 816 | 3300042007 | Ga0439449_0003854 | Ga0439449_0003854_4163_4921 | 231 |
| 817 | 3300042010 | Ga0439452_001104 | Ga0439452_001104_9225_9983 | 231 |
| 818 | 3300042156 | Ga0439446_0006709 | Ga0439446_0006709_1021_1779 | 231 |
| 819 | 3300046459 | Ga0495629_0000222 | Ga0495629_0000222_41453_42229 | 231 |
| 820 | 3300046472 | Ga0495580_0191272 | Ga0495580_0191272_126_902 | 231 |
| 821 | 3300046473 | Ga0495582_0009126 | Ga0495582_0009126_4387_5163 | 231 |
| 822 | 3300046476 | Ga0495662_0195321 | Ga0495662_0195321_135_899 | 231 |
| 823 | 3300046477 | Ga0495664_0026349 | Ga0495664_0026349_911_1675 | 231 |
| 824 | 3300046499 | Ga0495594_0011694 | Ga0495594_0011694_1849_2613 | 231 |
| 825 | 3300046499 | Ga0495594_0036706 | Ga0495594_0036706_1034_1810 | 231 |
| 826 | 3300046530 | Ga0495654_0037248 | Ga0495654_0037248_1590_2360 | 231 |
| 827 | 3300046531 | Ga0495665_0185269 | Ga0495665_0185269_32_808 | 231 |
| 828 | 3300046663 | Ga0495635_0031149 | Ga0495635_0031149_1744_2508 | 231 |
| 829 | 3300046675 | Ga0495657_0031006 | Ga0495657_0031006_1835_2599 | 231 |
| 830 | 3300046681 | Ga0495647_0002929 | Ga0495647_0002929_2302_3078 | 231 |
| 831 | 3300046683 | Ga0495658_0001062 | Ga0495658_0001062_8242_9018 | 231 |
| 832 | 3300046689 | Ga0495613_0007724 | Ga0495613_0007724_2769_3545 | 231 |
| 833 | 3300047315 | Ga0495581_0033186 | Ga0495581_0033186_1784_2560 | 231 |
| 834 | 3300047317 | Ga0495604_0111697 | Ga0495604_0111697_822_1586 | 231 |
| 835 | 3300047319 | Ga0495674_0127408 | Ga0495674_0127408_1016_1780 | 231 |
| 836 | 3300047321 | Ga0495676_0146869 | Ga0495676_0146869_233_1009 | 231 |
| 837 | 3300047322 | Ga0495680_0017400 | Ga0495680_0017400_120_884 | 231 |
| 838 | 3300047673 | Ga0495593_0004258 | Ga0495593_0004258_6743_7519 | 231 |
| 839 | 3300048904 | Ga0496101_0025281 | Ga0496101_0025281_2147_2911 | 231 |
| 840 | 3300048905 | Ga0496102_0344786 | Ga0496102_0344786_534_1298 | 231 |
| 841 | 3300048906 | Ga0496103_0009241 | Ga0496103_0009241_715_1479 | 231 |
| 842 | 3300048907 | Ga0496104_0020599 | Ga0496104_0020599_3151_3915 | 231 |
| 843 | 3300048908 | Ga0496105_0055070 | Ga0496105_0055070_1972_2736 | 231 |
| 844 | 3300048909 | Ga0496106_0015661 | Ga0496106_0015661_2877_3641 | 231 |
| 845 | 3300048910 | Ga0496107_0032503 | Ga0496107_0032503_849_1613 | 231 |
| 846 | 3300048918 | Ga0496115_0143139 | Ga0496115_0143139_848_1612 | 231 |
| 847 | 3300049574 | Ga0501038_0009989 | Ga0501038_0009989_2294_3061 | 231 |
| 848 | 3300049575 | Ga0501039_0183575 | Ga0501039_0183575_728_1495 | 231 |
| 849 | 3300049580 | Ga0501046_0007428 | Ga0501046_0007428_1056_1823 | 231 |
| 850 | 3300049581 | Ga0501047_0023276 | Ga0501047_0023276_4063_4830 | 231 |
| 851 | 3300049586 | Ga0501070_0014041 | Ga0501070_0014041_5620_6387 | 231 |
| 852 | 3300049587 | Ga0501071_0292800 | Ga0501071_0292800_45_809 | 231 |
| 853 | 3300049589 | Ga0501073_0074862 | Ga0501073_0074862_568_1332 | 231 |
| 854 | 3300049589 | Ga0501073_0101490 | Ga0501073_0101490_730_1497 | 231 |
| 855 | 3300049590 | Ga0501074_0460471 | Ga0501074_0460471_106_864 | 231 |
| 856 | 3300049591 | Ga0501075_0127129 | Ga0501075_0127129_1148_1912 | 231 |
| 857 | 3300049591 | Ga0501075_0450616 | Ga0501075_0450616_33_800 | 231 |
| 858 | 3300049592 | Ga0501076_0074597 | Ga0501076_0074597_1249_2013 | 231 |
| 859 | 3300049592 | Ga0501076_0479139 | Ga0501076_0479139_58_822 | 231 |
| 860 | 3300049592 | Ga0501076_0635123 | Ga0501076_0635123_40_798 | 231 |
| 861 | 3300049741 | Ga0501079_0101862 | Ga0501079_0101862_220_978 | 231 |
| 862 | 3300049742 | Ga0501080_0018017 | Ga0501080_0018017_5632_6399 | 231 |
| 863 | 3300049743 | Ga0501081_0167622 | Ga0501081_0167622_701_1465 | 231 |
| 864 | 3300049743 | Ga0501081_0429209 | Ga0501081_0429209_83_841 | 231 |
| 865 | 3300049824 | Ga0501045_0286192 | Ga0501045_0286192_408_1166 | 231 |
| 866 | 3300049824 | Ga0501045_0341925 | Ga0501045_0341925_258_1022 | 231 |
| 867 | 3300050490 | nmdc:mga03n38_130793_c1 | nmdc:mga03n38_130793_c1_63_821 | 231 |
| 868 | 3300050493 | nmdc:mga0k408_82411_c1 | nmdc:mga0k408_82411_c1_328_1086 | 231 |
| 869 | 3300050507 | nmdc:mga05p37_208769_c1 | nmdc:mga05p37_208769_c1_293_1057 | 231 |
| 870 | 3300050507 | nmdc:mga05p37_20991_c1 | nmdc:mga05p37_20991_c1_3208_3966 | 231 |
| 871 | 3300050507 | nmdc:mga05p37_620132_c1 | nmdc:mga05p37_620132_c1_124_891 | 231 |
| 872 | 3300050508 | nmdc:mga09592_97419_c1 | nmdc:mga09592_97419_c1_305_1063 | 231 |
| 873 | 3300050509 | nmdc:mga0qj67_333837_c1 | nmdc:mga0qj67_333837_c1_320_1084 | 231 |
| 874 | 3300050510 | nmdc:mga06r32_735859_c1 | nmdc:mga06r32_735859_c1_56_820 | 231 |
| 875 | 3300050511 | nmdc:mga08y16_45264_c1 | nmdc:mga08y16_45264_c1_3830_4588 | 231 |
| 876 | 3300050515 | nmdc:mga0a205_23303_c1 | nmdc:mga0a205_23303_c1_1123_1881 | 231 |
| 877 | 3300053077 | Ga0495601_0000770 | Ga0495601_0000770_14694_15458 | 231 |
| 878 | 3300053084 | Ga0495595_0002566 | Ga0495595_0002566_6216_6980 | 231 |
| 879 | 3300053085 | Ga0495619_0001318 | Ga0495619_0001318_13476_14252 | 231 |
| 880 | 3300053085 | Ga0495619_0125039 | Ga0495619_0125039_266_1030 | 231 |
| 881 | 3300053116 | Ga0500592_001234 | Ga0500592_001234_103_873 | 231 |
| 882 | 3300053177 | Ga0500636_0002098 | Ga0500636_0002098_7549_8316 | 231 |
| 883 | 3300054114 | Ga0501084_0071398 | Ga0501084_0071398_156_923 | 231 |
| 884 | 3300060353 | Ga0501082_0230860 | Ga0501082_0230860_766_1530 | 231 |
| 885 | 3300061734 | Ga0530510_0126458 | Ga0530510_0126458_1051_1815 | 231 |
| 886 | iso_pu_bacteria | 2524023210 | 2524464100 | 231 |
| 887 | 3300021384 | Ga0213876_10091069 | Ga0213876_100910692 | 232 |
| 888 | 3300039437 | Ga0436365_0516288 | Ga0436365_0516288_643_1410 | 232 |
| 889 | 3300049576 | Ga0501040_0261555 | Ga0501040_0261555_86_856 | 232 |
| 890 | 3300049578 | Ga0501042_0288295 | Ga0501042_0288295_59_829 | 232 |
| 891 | 3300005563 | Ga0068855_100023786 | Ga0068855_1000237863 | 235 |
| 892 | 3300009093 | Ga0105240_10120202 | Ga0105240_101202022 | 235 |
| 893 | 3300010375 | Ga0105239_10000283 | Ga0105239_1000028344 | 235 |
| 894 | 3300025949 | Ga0207667_10020540 | Ga0207667_100205408 | 235 |
| 895 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013112 | 236 |
| 896 | 3300049570 | Ga0501033_0022299 | Ga0501033_0022299_2719_3501 | 236 |
| 897 | 3300049573 | Ga0501037_0012297 | Ga0501037_0012297_3405_4187 | 236 |
| 898 | 3300049579 | Ga0501043_0010430 | Ga0501043_0010430_6435_7217 | 236 |
| 899 | 3300049581 | Ga0501047_0014463 | Ga0501047_0014463_6220_7002 | 236 |
| 900 | 3300049822 | Ga0501035_0079383 | Ga0501035_0079383_247_1029 | 236 |
| 901 | 3300049823 | Ga0501044_0007849 | Ga0501044_0007849_611_1393 | 236 |
| 902 | 3300003320 | rootH2_10000018 | rootH2_1000001816 | 237 |
| 903 | 3300005331 | Ga0070670_100110067 | Ga0070670_1001100672 | 237 |
| 904 | 3300005335 | Ga0070666_10000048 | Ga0070666_1000004873 | 237 |
| 905 | 3300005338 | Ga0068868_100006649 | Ga0068868_1000066495 | 237 |
| 906 | 3300005353 | Ga0070669_100093679 | Ga0070669_1000936793 | 237 |
| 907 | 3300005365 | Ga0070688_100059943 | Ga0070688_1000599432 | 237 |
| 908 | 3300005367 | Ga0070667_100071591 | Ga0070667_1000715912 | 237 |
| 909 | 3300005367 | Ga0070667_100101598 | Ga0070667_1001015982 | 237 |
| 910 | 3300005539 | Ga0068853_100001463 | Ga0068853_1000014638 | 237 |
| 911 | 3300005539 | Ga0068853_100066925 | Ga0068853_1000669253 | 237 |
| 912 | 3300005564 | Ga0070664_100869059 | Ga0070664_1008690591 | 237 |
| 913 | 3300005577 | Ga0068857_100008990 | Ga0068857_1000089908 | 237 |
| 914 | 3300005578 | Ga0068854_100031803 | Ga0068854_1000318032 | 237 |
| 915 | 3300005578 | Ga0068854_100166592 | Ga0068854_1001665922 | 237 |
| 916 | 3300005614 | Ga0068856_100127906 | Ga0068856_1001279062 | 237 |
| 917 | 3300005616 | Ga0068852_100001866 | Ga0068852_1000018663 | 237 |
| 918 | 3300005617 | Ga0068859_100000051 | Ga0068859_10000005194 | 237 |
| 919 | 3300005617 | Ga0068859_100241747 | Ga0068859_1002417472 | 237 |
| 920 | 3300005617 | Ga0068859_100251940 | Ga0068859_1002519402 | 237 |
| 921 | 3300005618 | Ga0068864_100045246 | Ga0068864_1000452462 | 237 |
| 922 | 3300005618 | Ga0068864_100183460 | Ga0068864_1001834602 | 237 |
| 923 | 3300005834 | Ga0068851_10075949 | Ga0068851_100759492 | 237 |
| 924 | 3300005841 | Ga0068863_100018653 | Ga0068863_1000186534 | 237 |
| 925 | 3300005842 | Ga0068858_100097323 | Ga0068858_1000973232 | 237 |
| 926 | 3300005843 | Ga0068860_100002900 | Ga0068860_1000029003 | 237 |
| 927 | 3300005843 | Ga0068860_100014489 | Ga0068860_1000144893 | 237 |
| 928 | 3300005843 | Ga0068860_100033779 | Ga0068860_1000337792 | 237 |
| 929 | 3300005844 | Ga0068862_100006112 | Ga0068862_1000061129 | 237 |
| 930 | 3300006178 | Ga0075367_10116476 | Ga0075367_101164762 | 237 |
| 931 | 3300006931 | Ga0097620_100000051 | Ga0097620_10000005194 | 237 |
| 932 | 3300006931 | Ga0097620_100241732 | Ga0097620_1002417322 | 237 |
| 933 | 3300006931 | Ga0097620_100251942 | Ga0097620_1002519422 | 237 |
| 934 | 3300009093 | Ga0105240_10000599 | Ga0105240_100005996 | 237 |
| 935 | 3300009093 | Ga0105240_10000714 | Ga0105240_1000071433 | 237 |
| 936 | 3300009093 | Ga0105240_10000986 | Ga0105240_1000098646 | 237 |
| 937 | 3300009093 | Ga0105240_10030886 | Ga0105240_100308862 | 237 |
| 938 | 3300009093 | Ga0105240_10113661 | Ga0105240_101136612 | 237 |
| 939 | 3300009094 | Ga0111539_10083813 | Ga0111539_100838133 | 237 |
| 940 | 3300009098 | Ga0105245_10398026 | Ga0105245_103980262 | 237 |
| 941 | 3300009101 | Ga0105247_10009082 | Ga0105247_100090822 | 237 |
| 942 | 3300009174 | Ga0105241_10003149 | Ga0105241_100031493 | 237 |
| 943 | 3300009174 | Ga0105241_10030164 | Ga0105241_100301642 | 237 |
| 944 | 3300009174 | Ga0105241_10069466 | Ga0105241_100694662 | 237 |
| 945 | 3300009545 | Ga0105237_10035194 | Ga0105237_100351943 | 237 |
| 946 | 3300009545 | Ga0105237_10057984 | Ga0105237_100579842 | 237 |
| 947 | 3300009551 | Ga0105238_10012878 | Ga0105238_100128786 | 237 |
| 948 | 3300009553 | Ga0105249_10030530 | Ga0105249_100305302 | 237 |
| 949 | 3300010375 | Ga0105239_10000249 | Ga0105239_1000024924 | 237 |
| 950 | 3300010375 | Ga0105239_10023475 | Ga0105239_100234756 | 237 |
| 951 | 3300010375 | Ga0105239_10092796 | Ga0105239_100927963 | 237 |
| 952 | 3300013104 | Ga0157370_10002349 | Ga0157370_1000234916 | 237 |
| 953 | 3300013105 | Ga0157369_10020406 | Ga0157369_100204062 | 237 |
| 954 | 3300013297 | Ga0157378_10004814 | Ga0157378_100048144 | 237 |
| 955 | 3300013297 | Ga0157378_10009209 | Ga0157378_100092097 | 237 |
| 956 | 3300013306 | Ga0163162_10001536 | Ga0163162_100015362 | 237 |
| 957 | 3300013307 | Ga0157372_10003789 | Ga0157372_100037896 | 237 |
| 958 | 3300013307 | Ga0157372_10006751 | Ga0157372_1000675113 | 237 |
| 959 | 3300013307 | Ga0157372_10040392 | Ga0157372_100403923 | 237 |
| 960 | 3300013307 | Ga0157372_10046289 | Ga0157372_100462892 | 237 |
| 961 | 3300013307 | Ga0157372_10439739 | Ga0157372_104397392 | 237 |
| 962 | 3300014325 | Ga0163163_10141196 | Ga0163163_101411962 | 237 |
| 963 | 3300014968 | Ga0157379_10036832 | Ga0157379_100368322 | 237 |
| 964 | 3300014969 | Ga0157376_10043193 | Ga0157376_100431933 | 237 |
| 965 | 3300015265 | Ga0182005_1041811 | Ga0182005_10418112 | 237 |
| 966 | 3300025321 | Ga0207656_10055788 | Ga0207656_100557882 | 237 |
| 967 | 3300025900 | Ga0207710_10041252 | Ga0207710_100412522 | 237 |
| 968 | 3300025903 | Ga0207680_10001111 | Ga0207680_100011117 | 237 |
| 969 | 3300025904 | Ga0207647_10011594 | Ga0207647_100115945 | 237 |
| 970 | 3300025911 | Ga0207654_10000957 | Ga0207654_100009573 | 237 |
| 971 | 3300025911 | Ga0207654_10238246 | Ga0207654_102382462 | 237 |
| 972 | 3300025913 | Ga0207695_10000447 | Ga0207695_1000044740 | 237 |
| 973 | 3300025913 | Ga0207695_10000981 | Ga0207695_1000098111 | 237 |
| 974 | 3300025913 | Ga0207695_10001513 | Ga0207695_100015138 | 237 |
| 975 | 3300025913 | Ga0207695_10070708 | Ga0207695_100707083 | 237 |
| 976 | 3300025913 | Ga0207695_10076603 | Ga0207695_100766032 | 237 |
| 977 | 3300025914 | Ga0207671_10003862 | Ga0207671_100038622 | 237 |
| 978 | 3300025914 | Ga0207671_10011590 | Ga0207671_100115905 | 237 |
| 979 | 3300025914 | Ga0207671_10024218 | Ga0207671_100242183 | 237 |
| 980 | 3300025924 | Ga0207694_10013060 | Ga0207694_100130604 | 237 |
| 981 | 3300025924 | Ga0207694_10180929 | Ga0207694_101809292 | 237 |
| 982 | 3300025925 | Ga0207650_10022263 | Ga0207650_100222633 | 237 |
| 983 | 3300025931 | Ga0207644_10106061 | Ga0207644_101060612 | 237 |
| 984 | 3300025942 | Ga0207689_10001629 | Ga0207689_1000162911 | 237 |
| 985 | 3300025949 | Ga0207667_10054740 | Ga0207667_100547403 | 237 |
| 986 | 3300025960 | Ga0207651_10563008 | Ga0207651_105630082 | 237 |
| 987 | 3300025961 | Ga0207712_10356374 | Ga0207712_103563742 | 237 |
| 988 | 3300025981 | Ga0207640_10028508 | Ga0207640_100285082 | 237 |
| 989 | 3300025986 | Ga0207658_10135792 | Ga0207658_101357921 | 237 |
| 990 | 3300026023 | Ga0207677_10010758 | Ga0207677_100107586 | 237 |
| 991 | 3300026035 | Ga0207703_10055904 | Ga0207703_100559042 | 237 |
| 992 | 3300026041 | Ga0207639_10002258 | Ga0207639_100022583 | 237 |
| 993 | 3300026041 | Ga0207639_10037344 | Ga0207639_100373442 | 237 |
| 994 | 3300026041 | Ga0207639_10626435 | Ga0207639_106264352 | 237 |
| 995 | 3300026078 | Ga0207702_10132840 | Ga0207702_101328402 | 237 |
| 996 | 3300026088 | Ga0207641_10000917 | Ga0207641_1000091712 | 237 |
| 997 | 3300026089 | Ga0207648_10134921 | Ga0207648_101349212 | 237 |
| 998 | 3300026089 | Ga0207648_10452331 | Ga0207648_104523312 | 237 |
| 999 | 3300026095 | Ga0207676_10211309 | Ga0207676_102113092 | 237 |
| 1000 | 3300026116 | Ga0207674_10003552 | Ga0207674_100035528 | 237 |
| 1001 | 3300026142 | Ga0207698_10004374 | Ga0207698_100043746 | 237 |
| 1002 | 3300026142 | Ga0207698_10069224 | Ga0207698_100692242 | 237 |
| 1003 | 3300028380 | Ga0268265_10027105 | Ga0268265_100271054 | 237 |
| 1004 | 3300028381 | Ga0268264_10001724 | Ga0268264_100017249 | 237 |
| 1005 | 3300028381 | Ga0268264_10007023 | Ga0268264_1000702310 | 237 |
| 1006 | 3300028381 | Ga0268264_10079100 | Ga0268264_100791002 | 237 |
| 1007 | 3300028794 | Ga0307515_10000780 | Ga0307515_1000078040 | 237 |
| 1008 | 3300030731 | Ga0316177_1218224 | Ga0316177_12182247 | 237 |
| 1009 | 3300030732 | Ga0316176_1009119 | Ga0316176_100911918 | 237 |
| 1010 | 3300031548 | Ga0307408_100000680 | Ga0307408_10000068010 | 237 |
| 1011 | 3300031548 | Ga0307408_100000772 | Ga0307408_10000077219 | 237 |
| 1012 | 3300032002 | Ga0307416_100560253 | Ga0307416_1005602532 | 237 |
| 1013 | 3300032004 | Ga0307414_10000016 | Ga0307414_1000001610 | 237 |
| 1014 | 3300044693 | Ga0466961_0189829 | Ga0466961_0189829_89_859 | 237 |
| 1015 | 3300047472 | Ga0495686_0001554 | Ga0495686_0001554_23206_23982 | 237 |
| 1016 | 3300050511 | nmdc:mga08y16_79356_c1 | nmdc:mga08y16_79356_c1_572_1345 | 237 |
| 1017 | iso_pu_bacteria | 2911138879 | 2911140774 | 237 |
| 1018 | iso_pu_bacteria | 2919692658 | 2919696634 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ew8-assembly1.cif.gz_C | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9589 | 30 | 234 |
| 5ovk-assembly1.cif.gz_C | crystal structure maba bound to nadph from m. smegmatis | 0.9556 | 47 | 237 |
| 1uzn-assembly1.cif.gz_A-2 | maba from mycobacterium tuberculosis | 0.9517 | 49 | 235 |
| 8jfa-assembly2.cif.gz_F-2 | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori | 0.9499 | 12 | 234 |
| 8jfa-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori | 0.9497 | 12 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9469 | 69 | 234 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9365 | 13 | 234 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9356 | 79 | 178 | 3.40.50.720 |
| 4cqmK00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9334 | 12 | 235 | 3.40.50.720 |
| 2pnfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9279 | 14 | 234 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3PBB4-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9625 | 9 | 237 |
GO:0016616
|
| AF-A0A2D5MQM0-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9551 | 42 | 237 |
GO:0016616
|
| AF-A0A847N440-F1-model_v4 | SDR family oxidoreductase | 0.9539 | 55 | 237 |
GO:0016491
|
| AF-A0A351Z7X1-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9532 | 50 | 237 |
GO:0016616
|
| AF-A0A4Q7FB38-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.953 | 30 | 237 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar