F488321

General Info

Members Datasets Scaffolds Average Seq Length
1018 430 1012 240

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0781382|Ga0436360_0781382_1022_1873
Length 283
Sequence LRGIRHPFAIERIARWRKAALARMRDDTDAREEAVNLFDLAGKVAIVTGGNGGIGXXXXRGLAXXXXTVVLVGRNAAKGERAAAELGASFAKADVTKKAEVQKLVGDTVGAHGRLDILVNNAGTAVRKNPQDYDEAEWHLVIDTNLTSAFLCSQAAYFEMVKTGGGKIINIGSMMSLFGAPHAAPYGASKGGVMQLTRAHATAWARDNIQVNCVLPGWIDTELTAGARAQVSGLHESVLARTPAGRWGQPGDLSGIAVFLAAPASDFVTGTAIPVDGGYSIRG

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
3 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
4 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
5 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
222 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
293 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
296 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
408 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
409 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
410 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
414 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
415 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
420 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
421 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
422 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
423 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
424 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.1
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0.1
Rhizoplane 2.75
Rhizosphere 88.11
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000018 3300003320 Bacteria 23416
2 JGI25404J52841_10026926 3300003659 Bacteria 1237
3 Ga0065707_10149703 3300005295 Bacteria 1669
4 Ga0070658_10023601 3300005327 Bacteria 4935
5 Ga0070658_10151023 3300005327 Bacteria 1945
6 Ga0070676_10024000 3300005328 Bacteria 3432
7 Ga0070683_100017788 3300005329 Bacteria 6281
8 Ga0070683_100881702 3300005329 Bacteria 858
9 Ga0070690_100000085 3300005330 Bacteria 45980
10 Ga0070690_100042773 3300005330 Bacteria 2870
11 Ga0070690_100220151 3300005330 Bacteria 1330
12 Ga0070670_100010577 3300005331 Bacteria 7879
13 Ga0070670_100110067 3300005331 Bacteria 2373
14 Ga0068869_100000367 3300005334 Bacteria 24337
15 Ga0068869_100002177 3300005334 Bacteria 11779
16 Ga0068869_100017275 3300005334 Bacteria 4887
17 Ga0070666_10000048 3300005335 Bacteria 102191
18 Ga0070666_10006268 3300005335 Bacteria 7314
19 Ga0070680_100000256 3300005336 Bacteria 35098
20 Ga0070680_100000888 3300005336 Bacteria 21150
21 Ga0070680_100001789 3300005336 Bacteria 15777
22 Ga0070680_100046286 3300005336 Bacteria 3539
23 Ga0070680_100070828 3300005336 Bacteria 2864
24 Ga0070680_100107278 3300005336 Bacteria 2323
25 Ga0070682_100002233 3300005337 Bacteria 10739
26 Ga0070682_100004504 3300005337 Bacteria 7738
27 Ga0068868_100000639 3300005338 Bacteria 23608
28 Ga0068868_100006649 3300005338 Bacteria 8202
29 Ga0068868_100012946 3300005338 Bacteria 6103
30 Ga0068868_100151783 3300005338 Bacteria 1908
31 Ga0070660_100039715 3300005339 Bacteria 3578
32 Ga0070689_100000189 3300005340 Bacteria 37342
33 Ga0070689_100110891 3300005340 Bacteria 2182
34 Ga0070689_100308577 3300005340 Bacteria 1319
35 Ga0070691_10002347 3300005341 Bacteria 8387
36 Ga0070691_10003307 3300005341 Bacteria 7228
37 Ga0070691_10240066 3300005341 Bacteria 968
38 Ga0070687_100000020 3300005343 Bacteria 53469
39 Ga0070661_100000612 3300005344 Bacteria 26638
40 Ga0070661_100079391 3300005344 Bacteria 2421
41 Ga0070692_10000471 3300005345 Bacteria 12334
42 Ga0070668_100026398 3300005347 Bacteria 4407
43 Ga0070668_100374716 3300005347 Bacteria 1210
44 Ga0070669_100021844 3300005353 Bacteria 4576
45 Ga0070669_100036743 3300005353 Bacteria 3551
46 Ga0070669_100041335 3300005353 Bacteria 3353
47 Ga0070669_100093679 3300005353 Bacteria 2256
48 Ga0070669_100305777 3300005353 Bacteria 1280
49 Ga0070675_100110433 3300005354 Bacteria 2325
50 Ga0070671_100010297 3300005355 Bacteria 7502
51 Ga0070674_100027282 3300005356 Bacteria 3741
52 Ga0070673_100008357 3300005364 Bacteria 6879
53 Ga0070673_100030249 3300005364 Bacteria 4049
54 Ga0070673_100188299 3300005364 Bacteria 1771
55 Ga0070688_100011085 3300005365 Bacteria 5003
56 Ga0070688_100059943 3300005365 Unclassified 2402
57 Ga0070659_100002925 3300005366 Bacteria 12176
58 Ga0070667_100071591 3300005367 Bacteria 2953
59 Ga0070667_100101598 3300005367 Unclassified 2484
60 Ga0070667_100113538 3300005367 Bacteria 2351
61 Ga0070667_100773618 3300005367 Bacteria 891
62 Ga0070703_10038846 3300005406 Bacteria 1473
63 Ga0070703_10079852 3300005406 Bacteria 1112
64 Ga0070709_10070049 3300005434 Bacteria 2260
65 Ga0070714_100121822 3300005435 Bacteria 2321
66 Ga0070714_100265508 3300005435 Bacteria 1590
67 Ga0070713_100003400 3300005436 Bacteria 10510
68 Ga0070713_100203552 3300005436 Bacteria 1789
69 Ga0070710_10057606 3300005437 Bacteria 2202
70 Ga0070701_10000464 3300005438 Bacteria 13857
71 Ga0070701_10005008 3300005438 Bacteria 5432
72 Ga0070711_100185582 3300005439 Bacteria 1594
73 Ga0070705_100000022 3300005440 Bacteria 83218
74 Ga0070705_100000322 3300005440 Bacteria 28288
75 Ga0070700_100001393 3300005441 Bacteria 12014
76 Ga0070700_100001396 3300005441 Bacteria 12002
77 Ga0070694_100000049 3300005444 Bacteria 54670
78 Ga0070694_100002034 3300005444 Bacteria 11996
79 Ga0070708_100096119 3300005445 Unclassified 2706
80 Ga0070708_100168139 3300005445 Bacteria 2046
81 Ga0070708_100555762 3300005445 Bacteria 1083
82 Ga0070663_100003795 3300005455 Bacteria 8786
83 Ga0070678_100064905 3300005456 Bacteria 2708
84 Ga0070678_100599709 3300005456 Bacteria 983
85 Ga0070662_100002915 3300005457 Bacteria 10629
86 Ga0070662_100243229 3300005457 Bacteria 1444
87 Ga0070681_10000533 3300005458 Bacteria 31280
88 Ga0070681_10006219 3300005458 Bacteria 11603
89 Ga0070681_10006711 3300005458 Bacteria 11197
90 Ga0070681_10123644 3300005458 Bacteria 2520
91 Ga0068867_100001285 3300005459 Bacteria 17292
92 Ga0068867_100001553 3300005459 Bacteria 15945
93 Ga0068867_100002386 3300005459 Bacteria 13210
94 Ga0068867_100048100 3300005459 Bacteria 3137
95 Ga0068867_100137632 3300005459 Bacteria 1905
96 Ga0070706_100082148 3300005467 Bacteria 2984
97 Ga0070706_100186638 3300005467 Bacteria 1937
98 Ga0070698_100000092 3300005471 Bacteria 71585
99 Ga0070699_100013540 3300005518 Bacteria 7022
100 Ga0070699_100104120 3300005518 Bacteria 2489
101 Ga0070699_100111801 3300005518 Bacteria 2399
102 Ga0070699_100256247 3300005518 Bacteria 1564
103 Ga0070679_100001589 3300005530 Bacteria 20389
104 Ga0070679_100003538 3300005530 Bacteria 14307
105 Ga0070679_100005893 3300005530 Bacteria 11386
106 Ga0070679_100098373 3300005530 Bacteria 2913
107 Ga0070679_100766575 3300005530 Bacteria 908
108 Ga0070684_100513779 3300005535 Bacteria 1110
109 Ga0068853_100000249 3300005539 Bacteria 37969
110 Ga0068853_100001463 3300005539 Bacteria 17125
111 Ga0068853_100066925 3300005539 Unclassified 3120
112 Ga0068853_100210105 3300005539 Bacteria 1774
113 Ga0070672_100152594 3300005543 Bacteria 1911
114 Ga0070672_100175488 3300005543 Bacteria 1784
115 Ga0070672_100217278 3300005543 Bacteria 1602
116 Ga0070672_100224306 3300005543 Bacteria 1577
117 Ga0070672_100261711 3300005543 Bacteria 1459
118 Ga0070686_100000085 3300005544 Bacteria 66254
119 Ga0070695_100001199 3300005545 Bacteria 14271
120 Ga0070695_100002595 3300005545 Bacteria 10434
121 Ga0070695_100102504 3300005545 Bacteria 1930
122 Ga0070696_100000688 3300005546 Bacteria 21623
123 Ga0070696_100000891 3300005546 Bacteria 19359
124 Ga0070696_100001012 3300005546 Bacteria 18223
125 Ga0070693_100000063 3300005547 Bacteria 42812
126 Ga0070693_100000137 3300005547 Bacteria 33225
127 Ga0070693_100007957 3300005547 Bacteria 5203
128 Ga0070665_100002597 3300005548 Bacteria 19721
129 Ga0070665_100031297 3300005548 Bacteria 5355
130 Ga0070704_100000009 3300005549 Bacteria 67191
131 Ga0070704_100311022 3300005549 Bacteria 1316
132 Ga0068855_100001817 3300005563 Bacteria 26625
133 Ga0068855_100006101 3300005563 Bacteria 14695
134 Ga0068855_100010584 3300005563 Bacteria 11119
135 Ga0068855_100023786 3300005563 Bacteria 7339
136 Ga0068855_100031588 3300005563 Bacteria 6323
137 Ga0070664_100058537 3300005564 Bacteria 3277
138 Ga0070664_100869059 3300005564 Unclassified 845
139 Ga0068857_100008990 3300005577 Bacteria 8658
140 Ga0068857_100029661 3300005577 Bacteria 4828
141 Ga0068854_100031803 3300005578 Bacteria 3669
142 Ga0068854_100032697 3300005578 Bacteria 3621
143 Ga0068854_100166592 3300005578 Bacteria 1711
144 Ga0068856_100000451 3300005614 Bacteria 45442
145 Ga0068856_100004022 3300005614 Bacteria 14719
146 Ga0068856_100027691 3300005614 Bacteria 5529
147 Ga0068856_100080445 3300005614 Bacteria 3232
148 Ga0068856_100127906 3300005614 Bacteria 2544
149 Ga0070702_100000009 3300005615 Bacteria 60314
150 Ga0068852_100001866 3300005616 Bacteria 14339
151 Ga0068852_100710037 3300005616 Bacteria 1016
152 Ga0068859_100000051 3300005617 Bacteria 131188
153 Ga0068859_100000354 3300005617 Bacteria 45757
154 Ga0068859_100001622 3300005617 Bacteria 22989
155 Ga0068859_100074029 3300005617 Bacteria 3445
156 Ga0068859_100241747 3300005617 Bacteria 1895
157 Ga0068859_100251940 3300005617 Bacteria 1856
158 Ga0068859_100373848 3300005617 Bacteria 1521
159 Ga0068864_100005149 3300005618 Bacteria 10710
160 Ga0068864_100045246 3300005618 Bacteria 3775
161 Ga0068864_100183460 3300005618 Unclassified 1914
162 Ga0068866_10000182 3300005718 Bacteria 29433
163 Ga0068866_10056519 3300005718 Bacteria 2018
164 Ga0068866_10229254 3300005718 Bacteria 1125
165 Ga0068861_100000138 3300005719 Bacteria 36853
166 Ga0068861_100001214 3300005719 Bacteria 16045
167 Ga0068861_100069051 3300005719 Bacteria 2733
168 Ga0068861_100164993 3300005719 Bacteria 1831
169 Ga0068851_10075949 3300005834 Bacteria 1747
170 Ga0068870_10000714 3300005840 Bacteria 12742
171 Ga0068870_10006772 3300005840 Bacteria 5077
172 Ga0068863_100018653 3300005841 Bacteria 6638
173 Ga0068863_100089869 3300005841 Bacteria 2912
174 Ga0068863_100128871 3300005841 Bacteria 2415
175 Ga0068858_100007068 3300005842 Bacteria 10896
176 Ga0068858_100097323 3300005842 Unclassified 2743
177 Ga0068858_100172145 3300005842 Bacteria 2042
178 Ga0068858_100207956 3300005842 Bacteria 1852
179 Ga0068860_100000285 3300005843 Bacteria 72246
180 Ga0068860_100002900 3300005843 Bacteria 17780
181 Ga0068860_100003215 3300005843 Bacteria 16847
182 Ga0068860_100014489 3300005843 Bacteria 7719
183 Ga0068860_100033779 3300005843 Bacteria 4908
184 Ga0068860_100096734 3300005843 Bacteria 2814
185 Ga0068860_100114913 3300005843 Bacteria 2574
186 Ga0068862_100000821 3300005844 Bacteria 30739
187 Ga0068862_100001942 3300005844 Bacteria 18752
188 Ga0068862_100006112 3300005844 Bacteria 10020
189 Ga0068862_100011620 3300005844 Bacteria 7265
190 Ga0081455_10000345 3300005937 Bacteria 60779
191 Ga0081538_10004641 3300005981 Bacteria 12617
192 Ga0081540_1000012 3300005983 Bacteria 189939
193 Ga0081539_10058101 3300005985 Bacteria 2137
194 Ga0081539_10129531 3300005985 Bacteria 1241
195 Ga0070717_10002714 3300006028 Bacteria 12486
196 Ga0070717_10315138 3300006028 Bacteria 1393
197 Ga0075365_10023487 3300006038 Bacteria 3879
198 Ga0075365_10084598 3300006038 Bacteria 2153
199 Ga0075368_10070075 3300006042 Bacteria 1415
200 Ga0075364_10156586 3300006051 Bacteria 1537
201 Ga0075362_10037055 3300006177 Bacteria 2137
202 Ga0075362_10050508 3300006177 Bacteria 1859
203 Ga0075362_10110102 3300006177 Bacteria 1296
204 Ga0075362_10122894 3300006177 Bacteria 1230
205 Ga0075367_10001340 3300006178 Bacteria 10457
206 Ga0075367_10116476 3300006178 Bacteria 1644
207 Ga0075367_10125657 3300006178 Bacteria 1583
208 Ga0075369_10011173 3300006186 Bacteria 3526
209 Ga0075369_10023748 3300006186 Bacteria 2536
210 Ga0075366_10044655 3300006195 Bacteria 2627
211 Ga0075366_10056029 3300006195 Bacteria 2341
212 Ga0075366_10079455 3300006195 Bacteria 1958
213 Ga0075366_10114681 3300006195 Bacteria 1622
214 Ga0097621_100000392 3300006237 Bacteria 30517
215 Ga0097621_100044812 3300006237 Unclassified 3570
216 Ga0097621_100167279 3300006237 Bacteria 1893
217 Ga0075370_10046561 3300006353 Bacteria 2454
218 Ga0068871_100002537 3300006358 Bacteria 12465
219 Ga0068871_100016534 3300006358 Bacteria 5561
220 Ga0068871_100058868 3300006358 Bacteria 3129
221 Ga0075428_100013055 3300006844 Bacteria 9232
222 Ga0075428_100237121 3300006844 Bacteria 1968
223 Ga0075428_100397290 3300006844 Bacteria 1477
224 Ga0075430_100042341 3300006846 Bacteria 3851
225 Ga0075430_100210051 3300006846 Bacteria 1615
226 Ga0075430_100515742 3300006846 Bacteria 986
227 Ga0075431_100145991 3300006847 Bacteria 2438
228 Ga0075431_100619742 3300006847 Bacteria 1064
229 Ga0075433_10000401 3300006852 Bacteria 27591
230 Ga0075433_10000760 3300006852 Bacteria 22134
231 Ga0075433_10020333 3300006852 Bacteria 5548
232 Ga0075433_10028812 3300006852 Bacteria 4724
233 Ga0075434_100014160 3300006871 Bacteria 7618
234 Ga0075434_100042521 3300006871 Bacteria 4504
235 Ga0075434_100055791 3300006871 Bacteria 3926
236 Ga0075434_100080791 3300006871 Bacteria 3248
237 Ga0075434_100152268 3300006871 Bacteria 2333
238 Ga0075434_100190314 3300006871 Bacteria 2072
239 Ga0075434_100448331 3300006871 Bacteria 1312
240 Ga0075434_100648750 3300006871 Bacteria 1074
241 Ga0075429_100060798 3300006880 Bacteria 3290
242 Ga0075429_100086159 3300006880 Bacteria 2738
243 Ga0068865_100000052 3300006881 Bacteria 63932
244 Ga0068865_100011455 3300006881 Bacteria 5554
245 Ga0068865_100051260 3300006881 Bacteria 2856
246 Ga0068865_100071298 3300006881 Bacteria 2464
247 Ga0075436_100005645 3300006914 Bacteria 8588
248 Ga0097620_100000051 3300006931 Bacteria 131188
249 Ga0097620_100000354 3300006931 Bacteria 45757
250 Ga0097620_100001622 3300006931 Bacteria 22989
251 Ga0097620_100074026 3300006931 Bacteria 3445
252 Ga0097620_100241732 3300006931 Bacteria 1895
253 Ga0097620_100251942 3300006931 Bacteria 1856
254 Ga0097620_100373847 3300006931 Bacteria 1521
255 Ga0075435_100000197 3300007076 Bacteria 36483
256 Ga0075435_100002030 3300007076 Bacteria 13245
257 Ga0075435_100082648 3300007076 Bacteria 2640
258 Ga0099794_10029762 3300007265 Bacteria 2546
259 Ga0099795_10075030 3300007788 Bacteria 1283
260 Ga0105250_10104561 3300009092 Bacteria 1157
261 Ga0105240_10000599 3300009093 Bacteria 66936
262 Ga0105240_10000714 3300009093 Bacteria 60757
263 Ga0105240_10000986 3300009093 Bacteria 50790
264 Ga0105240_10007951 3300009093 Bacteria 15303
265 Ga0105240_10027170 3300009093 Bacteria 7498
266 Ga0105240_10030886 3300009093 Bacteria 6958
267 Ga0105240_10059514 3300009093 Bacteria 4767
268 Ga0105240_10113661 3300009093 Unclassified 3272
269 Ga0105240_10120202 3300009093 Unclassified 3164
270 Ga0105240_10289274 3300009093 Bacteria 1879
271 Ga0105240_10296585 3300009093 Bacteria 1851
272 Ga0111539_10000939 3300009094 Bacteria 38168
273 Ga0111539_10083813 3300009094 Bacteria 3748
274 Ga0111539_10096036 3300009094 Bacteria 3481
275 Ga0111539_11022217 3300009094 Bacteria 961
276 Ga0105245_10000086 3300009098 Bacteria 93019
277 Ga0105245_10030099 3300009098 Bacteria 4800
278 Ga0105245_10193411 3300009098 Bacteria 1950
279 Ga0105245_10398026 3300009098 Bacteria 1375
280 Ga0105247_10009082 3300009101 Bacteria 6049
281 Ga0114129_10000702 3300009147 Bacteria 42161
282 Ga0114129_10012278 3300009147 Bacteria 12188
283 Ga0114129_10045024 3300009147 Bacteria 6205
284 Ga0114129_10118530 3300009147 Bacteria 3646
285 Ga0114129_10127673 3300009147 Bacteria 3495
286 Ga0114129_10296365 3300009147 Bacteria 2157
287 Ga0114129_10605814 3300009147 Unclassified 1419
288 Ga0114129_10645701 3300009147 Bacteria 1366
289 Ga0105243_10000360 3300009148 Bacteria 48717
290 Ga0105243_10002378 3300009148 Bacteria 15750
291 Ga0105243_10030550 3300009148 Bacteria 4149
292 Ga0105243_10752183 3300009148 Bacteria 956
293 Ga0105243_10921822 3300009148 Bacteria 871
294 Ga0105241_10001255 3300009174 Bacteria 19339
295 Ga0105241_10003149 3300009174 Bacteria 12268
296 Ga0105241_10030164 3300009174 Bacteria 4051
297 Ga0105241_10069466 3300009174 Bacteria 2731
298 Ga0105242_10001063 3300009176 Bacteria 21578
299 Ga0105242_10011684 3300009176 Bacteria 6757
300 Ga0105242_10158219 3300009176 Bacteria 1981
301 Ga0105242_10237931 3300009176 Bacteria 1635
302 Ga0105248_10008655 3300009177 Bacteria 11181
303 Ga0105248_10283613 3300009177 Bacteria 1865
304 Ga0105248_10664272 3300009177 Bacteria 1176
305 Ga0105237_10000726 3300009545 Bacteria 45510
306 Ga0105237_10035194 3300009545 Bacteria 5068
307 Ga0105237_10057984 3300009545 Unclassified 3875
308 Ga0105238_10012878 3300009551 Bacteria 8441
309 Ga0105238_10086178 3300009551 Bacteria 3128
310 Ga0105238_10695214 3300009551 Bacteria 1029
311 Ga0105249_10007871 3300009553 Bacteria 9284
312 Ga0105249_10021338 3300009553 Bacteria 5798
313 Ga0105249_10030530 3300009553 Unclassified 4872
314 Ga0105249_10049328 3300009553 Bacteria 3839
315 Ga0105249_10158542 3300009553 Bacteria 2185
316 Ga0105249_10408697 3300009553 Bacteria 1389
317 Ga0099796_10061992 3300010159 Bacteria 1328
318 Ga0105239_10000249 3300010375 Bacteria 80515
319 Ga0105239_10000283 3300010375 Bacteria 74612
320 Ga0105239_10023475 3300010375 Bacteria 6793
321 Ga0105239_10092796 3300010375 Unclassified 3333
322 Ga0105239_10439302 3300010375 Bacteria 1479
323 Ga0105239_10477491 3300010375 Bacteria 1416
324 Ga0105246_10025425 3300011119 Bacteria 3859
325 Ga0157373_10001111 3300013100 Bacteria 20650
326 Ga0157370_10002349 3300013104 Bacteria 22855
327 Ga0157370_10020382 3300013104 Bacteria 6623
328 Ga0157369_10020406 3300013105 Bacteria 7405
329 Ga0157369_10044351 3300013105 Bacteria 4841
330 Ga0157374_10000013 3300013296 Bacteria 461240
331 Ga0157374_10040219 3300013296 Bacteria 4305
332 Ga0157374_10173481 3300013296 Bacteria 2104
333 Ga0157378_10000332 3300013297 Bacteria 46615
334 Ga0157378_10004814 3300013297 Bacteria 11831
335 Ga0157378_10009209 3300013297 Bacteria 8599
336 Ga0157378_10093845 3300013297 Bacteria 2732
337 Ga0163162_10001536 3300013306 Bacteria 21544
338 Ga0163162_10124289 3300013306 Bacteria 2686
339 Ga0163162_10211536 3300013306 Bacteria 2069
340 Ga0163162_10252828 3300013306 Bacteria 1894
341 Ga0157372_10001340 3300013307 Bacteria 26639
342 Ga0157372_10003789 3300013307 Bacteria 16237
343 Ga0157372_10006751 3300013307 Bacteria 12201
344 Ga0157372_10040392 3300013307 Bacteria 5153
345 Ga0157372_10046289 3300013307 Bacteria 4829
346 Ga0157372_10293850 3300013307 Bacteria 1889
347 Ga0157372_10439739 3300013307 Bacteria 1520
348 Ga0157375_10069953 3300013308 Bacteria 3517
349 Ga0157375_10075596 3300013308 Bacteria 3393
350 Ga0157375_10106530 3300013308 Bacteria 2895
351 Ga0157375_10234830 3300013308 Bacteria 1993
352 Ga0163163_10141196 3300014325 Bacteria 2451
353 Ga0163163_10328744 3300014325 Bacteria 1583
354 Ga0163163_10655010 3300014325 Bacteria 1114
355 Ga0157380_10012130 3300014326 Bacteria 6239
356 Ga0157380_10020426 3300014326 Bacteria 4950
357 Ga0157380_10074287 3300014326 Bacteria 2759
358 Ga0157380_10295564 3300014326 Bacteria 1489
359 Ga0182008_10008440 3300014497 Bacteria 5624
360 Ga0157377_10011155 3300014745 Bacteria 4475
361 Ga0157379_10004316 3300014968 Bacteria 12160
362 Ga0157379_10021876 3300014968 Bacteria 5666
363 Ga0157379_10036832 3300014968 Bacteria 4362
364 Ga0157376_10010278 3300014969 Bacteria 6835
365 Ga0157376_10037185 3300014969 Bacteria 3949
366 Ga0157376_10043193 3300014969 Unclassified 3698
367 Ga0157376_10374340 3300014969 Bacteria 1370
368 Ga0182005_1010389 3300015265 Bacteria 2681
369 Ga0182005_1041811 3300015265 Bacteria 1246
370 Ga0163161_10181726 3300017792 Bacteria 1613
371 Ga0163161_10231226 3300017792 Bacteria 1435
372 Ga0206353_10696245 3300020082 Bacteria 1346
373 Ga0213874_10048726 3300021377 Bacteria 1293
374 Ga0213876_10054483 3300021384 Bacteria 2111
375 Ga0213876_10075305 3300021384 Bacteria 1782
376 Ga0213876_10091069 3300021384 Bacteria 1615
377 Ga0213876_10130598 3300021384 Bacteria 1335
378 Ga0213875_10000825 3300021388 Bacteria 23073
379 Ga0213875_10021532 3300021388 Bacteria 3086
380 Ga0213875_10123793 3300021388 Bacteria 1208
381 Ga0213871_10019429 3300021441 Bacteria 1674
382 Ga0213871_10020792 3300021441 Bacteria 1630
383 Ga0224572_1007548 3300024225 Bacteria 1995
384 Ga0207656_10055788 3300025321 Bacteria 1720
385 Ga0207656_10114846 3300025321 Bacteria 1248
386 Ga0207653_10004318 3300025885 Bacteria 4465
387 Ga0207692_10008108 3300025898 Unclassified 4336
388 Ga0207692_10049633 3300025898 Bacteria 2119
389 Ga0207642_10002026 3300025899 Bacteria 6253
390 Ga0207642_10020222 3300025899 Bacteria 2594
391 Ga0207642_10201094 3300025899 Bacteria 1100
392 Ga0207710_10041252 3300025900 Unclassified 2046
393 Ga0207710_10051467 3300025900 Bacteria 1850
394 Ga0207688_10013304 3300025901 Bacteria 4471
395 Ga0207688_10023296 3300025901 Bacteria 3390
396 Ga0207680_10001111 3300025903 Bacteria 12669
397 Ga0207680_10177726 3300025903 Bacteria 1437
398 Ga0207680_10229565 3300025903 Bacteria 1275
399 Ga0207647_10011594 3300025904 Bacteria 6173
400 Ga0207685_10042090 3300025905 Bacteria 1713
401 Ga0207699_10056548 3300025906 Bacteria 2339
402 Ga0207699_10079929 3300025906 Bacteria 2024
403 Ga0207645_10001231 3300025907 Bacteria 21084
404 Ga0207645_10002022 3300025907 Bacteria 16287
405 Ga0207645_10007365 3300025907 Bacteria 7781
406 Ga0207645_10072227 3300025907 Bacteria 2208
407 Ga0207643_10000036 3300025908 Bacteria 89740
408 Ga0207705_10055696 3300025909 Bacteria 2851
409 Ga0207705_10100136 3300025909 Bacteria 2131
410 Ga0207684_10057910 3300025910 Bacteria 3288
411 Ga0207654_10000957 3300025911 Bacteria 15858
412 Ga0207654_10017766 3300025911 Bacteria 3724
413 Ga0207654_10238246 3300025911 Unclassified 1215
414 Ga0207707_10001333 3300025912 Bacteria 22977
415 Ga0207707_10005087 3300025912 Bacteria 11531
416 Ga0207707_10016894 3300025912 Bacteria 6356
417 Ga0207707_10022145 3300025912 Bacteria 5555
418 Ga0207707_10040055 3300025912 Bacteria 4094
419 Ga0207707_10117452 3300025912 Bacteria 2325
420 Ga0207695_10000447 3300025913 Bacteria 90113
421 Ga0207695_10000981 3300025913 Bacteria 50713
422 Ga0207695_10001513 3300025913 Bacteria 38611
423 Ga0207695_10070708 3300025913 Bacteria 3566
424 Ga0207695_10076603 3300025913 Unclassified 3400
425 Ga0207695_10095047 3300025913 Bacteria 2986
426 Ga0207695_10329866 3300025913 Bacteria 1415
427 Ga0207671_10003297 3300025914 Bacteria 16239
428 Ga0207671_10003862 3300025914 Bacteria 14653
429 Ga0207671_10011590 3300025914 Bacteria 7160
430 Ga0207671_10024218 3300025914 Bacteria 4568
431 Ga0207693_10137585 3300025915 Bacteria 1920
432 Ga0207693_10138535 3300025915 Bacteria 1913
433 Ga0207663_10037807 3300025916 Bacteria 2912
434 Ga0207660_10001071 3300025917 Bacteria 18194
435 Ga0207660_10014345 3300025917 Bacteria 5209
436 Ga0207660_10056512 3300025917 Bacteria 2808
437 Ga0207660_10093975 3300025917 Bacteria 2228
438 Ga0207662_10005034 3300025918 Bacteria 6998
439 Ga0207662_10079337 3300025918 Bacteria 2000
440 Ga0207657_10022694 3300025919 Bacteria 5864
441 Ga0207649_10031771 3300025920 Unclassified 3142
442 Ga0207649_10051738 3300025920 Bacteria 2545
443 Ga0207652_10002086 3300025921 Bacteria 17188
444 Ga0207652_10005743 3300025921 Bacteria 10070
445 Ga0207652_10006129 3300025921 Bacteria 9725
446 Ga0207652_10075011 3300025921 Bacteria 2946
447 Ga0207652_10389604 3300025921 Bacteria 1257
448 Ga0207681_10041283 3300025923 Bacteria 3075
449 Ga0207681_10104339 3300025923 Bacteria 2050
450 Ga0207681_10296319 3300025923 Bacteria 1278
451 Ga0207694_10013060 3300025924 Bacteria 6252
452 Ga0207694_10109317 3300025924 Bacteria 2198
453 Ga0207694_10180929 3300025924 Bacteria 1710
454 Ga0207694_10358801 3300025924 Bacteria 1207
455 Ga0207650_10022263 3300025925 Bacteria 4484
456 Ga0207650_10086755 3300025925 Bacteria 2383
457 Ga0207659_10182014 3300025926 Bacteria 1665
458 Ga0207687_10001602 3300025927 Bacteria 15584
459 Ga0207700_10020058 3300025928 Bacteria 4531
460 Ga0207664_10071023 3300025929 Bacteria 2803
461 Ga0207644_10106061 3300025931 Unclassified 2118
462 Ga0207644_10140886 3300025931 Bacteria 1857
463 Ga0207690_10000580 3300025932 Bacteria 23700
464 Ga0207690_10018108 3300025932 Bacteria 4316
465 Ga0207706_10007512 3300025933 Bacteria 10085
466 Ga0207686_10000270 3300025934 Bacteria 38522
467 Ga0207686_10012278 3300025934 Bacteria 4707
468 Ga0207709_10001682 3300025935 Bacteria 14896
469 Ga0207709_10028242 3300025935 Bacteria 3243
470 Ga0207709_10271990 3300025935 Bacteria 1247
471 Ga0207670_10002057 3300025936 Bacteria 10535
472 Ga0207669_10035175 3300025937 Bacteria 2847
473 Ga0207669_10372673 3300025937 Bacteria 1110
474 Ga0207669_10591160 3300025937 Bacteria 901
475 Ga0207704_10000300 3300025938 Bacteria 23352
476 Ga0207704_10007021 3300025938 Bacteria 5291
477 Ga0207704_10063938 3300025938 Bacteria 2296
478 Ga0207665_10023537 3300025939 Unclassified 4057
479 Ga0207665_10095580 3300025939 Bacteria 2065
480 Ga0207691_10011068 3300025940 Bacteria 8659
481 Ga0207691_10184588 3300025940 Bacteria 1821
482 Ga0207691_10200216 3300025940 Bacteria 1738
483 Ga0207691_10255017 3300025940 Bacteria 1513
484 Ga0207711_10739052 3300025941 Bacteria 917
485 Ga0207689_10000221 3300025942 Bacteria 50498
486 Ga0207689_10000691 3300025942 Bacteria 32302
487 Ga0207689_10001629 3300025942 Bacteria 21257
488 Ga0207689_10005271 3300025942 Bacteria 11586
489 Ga0207689_10016285 3300025942 Bacteria 6298
490 Ga0207689_10078866 3300025942 Bacteria 2706
491 Ga0207689_10158614 3300025942 Bacteria 1865
492 Ga0207689_10284416 3300025942 Bacteria 1369
493 Ga0207661_10021338 3300025944 Bacteria 4851
494 Ga0207661_10760263 3300025944 Bacteria 892
495 Ga0207679_10001048 3300025945 Bacteria 17592
496 Ga0207667_10000470 3300025949 Bacteria 53903
497 Ga0207667_10002649 3300025949 Bacteria 22123
498 Ga0207667_10019350 3300025949 Bacteria 7603
499 Ga0207667_10020540 3300025949 Bacteria 7340
500 Ga0207667_10033267 3300025949 Bacteria 5545
501 Ga0207667_10054740 3300025949 Bacteria 4196
502 Ga0207651_10056408 3300025960 Bacteria 2703
503 Ga0207651_10563008 3300025960 Bacteria 992
504 Ga0207712_10010320 3300025961 Bacteria 5930
505 Ga0207712_10017624 3300025961 Bacteria 4643
506 Ga0207712_10356374 3300025961 Bacteria 1218
507 Ga0207668_10577019 3300025972 Bacteria 977
508 Ga0207640_10008666 3300025981 Bacteria 5655
509 Ga0207640_10028508 3300025981 Bacteria 3415
510 Ga0207658_10135792 3300025986 Unclassified 1983
511 Ga0207658_10382200 3300025986 Bacteria 1233
512 Ga0207677_10001318 3300026023 Bacteria 13337
513 Ga0207677_10010758 3300026023 Bacteria 5187
514 Ga0207677_10157680 3300026023 Bacteria 1760
515 Ga0207677_10160363 3300026023 Bacteria 1747
516 Ga0207703_10007452 3300026035 Bacteria 8690
517 Ga0207703_10011205 3300026035 Bacteria 6976
518 Ga0207703_10055904 3300026035 Unclassified 3212
519 Ga0207703_10544239 3300026035 Bacteria 1094
520 Ga0207639_10002258 3300026041 Bacteria 12947
521 Ga0207639_10037344 3300026041 Bacteria 3608
522 Ga0207639_10158976 3300026041 Bacteria 1902
523 Ga0207639_10195143 3300026041 Bacteria 1732
524 Ga0207639_10626435 3300026041 Unclassified 994
525 Ga0207678_10004149 3300026067 Bacteria 13013
526 Ga0207678_10004263 3300026067 Bacteria 12822
527 Ga0207708_10000182 3300026075 Bacteria 49271
528 Ga0207702_10000478 3300026078 Bacteria 44978
529 Ga0207702_10001365 3300026078 Bacteria 24327
530 Ga0207702_10011253 3300026078 Bacteria 7459
531 Ga0207702_10052786 3300026078 Bacteria 3441
532 Ga0207702_10132840 3300026078 Bacteria 2242
533 Ga0207702_10304378 3300026078 Bacteria 1514
534 Ga0207641_10000917 3300026088 Bacteria 30463
535 Ga0207641_10034109 3300026088 Bacteria 4231
536 Ga0207641_10225130 3300026088 Bacteria 1741
537 Ga0207648_10000335 3300026089 Bacteria 51594
538 Ga0207648_10000431 3300026089 Bacteria 46287
539 Ga0207648_10001752 3300026089 Bacteria 23762
540 Ga0207648_10003980 3300026089 Bacteria 15344
541 Ga0207648_10134921 3300026089 Unclassified 2174
542 Ga0207648_10452331 3300026089 Bacteria 1169
543 Ga0207648_10530785 3300026089 Bacteria 1079
544 Ga0207676_10094151 3300026095 Bacteria 2468
545 Ga0207676_10211309 3300026095 Bacteria 1721
546 Ga0207676_10242588 3300026095 Bacteria 1617
547 Ga0207674_10001830 3300026116 Bacteria 27116
548 Ga0207674_10003552 3300026116 Bacteria 19027
549 Ga0207675_100000142 3300026118 Bacteria 61826
550 Ga0207675_100003028 3300026118 Bacteria 16486
551 Ga0207675_100003408 3300026118 Bacteria 15514
552 Ga0207675_100080727 3300026118 Bacteria 3049
553 Ga0207675_100110510 3300026118 Bacteria 2593
554 Ga0207683_10005101 3300026121 Bacteria 11268
555 Ga0207683_10076639 3300026121 Bacteria 2961
556 Ga0207683_10710516 3300026121 Bacteria 932
557 Ga0207698_10004374 3300026142 Bacteria 8601
558 Ga0207698_10069224 3300026142 Unclassified 2790
559 Ga0209967_1000788 3300027364 Bacteria 4060
560 Ga0209999_1020235 3300027543 Bacteria 1221
561 Ga0209966_1000629 3300027695 Bacteria 8042
562 Ga0209966_1033118 3300027695 Bacteria 1054
563 Ga0209998_10027075 3300027717 Bacteria 1255
564 Ga0207428_10018998 3300027907 Bacteria 5861
565 Ga0207428_10128446 3300027907 Bacteria 1941
566 Ga0207428_10294028 3300027907 Bacteria 1203
567 Ga0268266_10001354 3300028379 Bacteria 29590
568 Ga0268265_10001417 3300028380 Bacteria 20290
569 Ga0268265_10002935 3300028380 Bacteria 12490
570 Ga0268265_10008236 3300028380 Bacteria 7041
571 Ga0268265_10027105 3300028380 Bacteria 4085
572 Ga0268264_10000446 3300028381 Bacteria 56436
573 Ga0268264_10001724 3300028381 Bacteria 20126
574 Ga0268264_10007023 3300028381 Bacteria 9444
575 Ga0268264_10011385 3300028381 Bacteria 7348
576 Ga0268264_10011455 3300028381 Bacteria 7322
577 Ga0268264_10019070 3300028381 Bacteria 5608
578 Ga0268264_10079100 3300028381 Bacteria 2804
579 Ga0268264_11002755 3300028381 Bacteria 842
580 Ga0265334_10027674 3300028573 Bacteria 2282
581 Ga0307515_10000780 3300028794 Bacteria 73338
582 Ga0307515_10120366 3300028794 Bacteria 2979
583 Ga0307515_10165858 3300028794 Bacteria 2227
584 Ga0265338_10001087 3300028800 Bacteria 45161
585 Ga0265338_10073524 3300028800 Bacteria 2912
586 Ga0316177_1218224 3300030731 Bacteria 11197
587 Ga0316176_1009119 3300030732 Bacteria 30051
588 Ga0265330_10055867 3300031235 Bacteria 1723
589 Ga0265328_10093473 3300031239 Bacteria 1111
590 Ga0265325_10011356 3300031241 Bacteria 5118
591 Ga0265325_10040338 3300031241 Bacteria 2452
592 Ga0265325_10234771 3300031241 Bacteria 835
593 Ga0265340_10082256 3300031247 Bacteria 1514
594 Ga0265339_10009178 3300031249 Bacteria 6240
595 Ga0265331_10023684 3300031250 Bacteria 3116
596 Ga0265331_10102166 3300031250 Bacteria 1319
597 Ga0265316_10065851 3300031344 Bacteria 2805
598 Ga0265316_10173322 3300031344 Bacteria 1608
599 Ga0307513_10074102 3300031456 Bacteria 3542
600 Ga0307408_100000680 3300031548 Bacteria 28079
601 Ga0307408_100000772 3300031548 Bacteria 25748
602 Ga0307408_100187965 3300031548 Bacteria 1662
603 Ga0307408_100607829 3300031548 Bacteria 972
604 Ga0265313_10001509 3300031595 Bacteria 21674
605 Ga0265313_10027399 3300031595 Bacteria 2983
606 Ga0307508_10221917 3300031616 Bacteria 1490
607 Ga0265314_10028336 3300031711 Bacteria 4176
608 Ga0265314_10281754 3300031711 Bacteria 940
609 Ga0265342_10072640 3300031712 Bacteria 2002
610 Ga0265342_10294420 3300031712 Bacteria 856
611 Ga0307516_10027197 3300031730 Bacteria 5801
612 Ga0307405_10003388 3300031731 Bacteria 7316
613 Ga0307406_10011623 3300031901 Bacteria 5000
614 Ga0307407_10146169 3300031903 Bacteria 1531
615 Ga0307412_10052192 3300031911 Bacteria 2707
616 Ga0307412_10108218 3300031911 Bacteria 1980
617 Ga0307416_100191912 3300032002 Bacteria 1928
618 Ga0307416_100340555 3300032002 Bacteria 1512
619 Ga0307416_100560253 3300032002 Bacteria 1217
620 Ga0307414_10000016 3300032004 Bacteria 249029
621 Ga0307411_10411911 3300032005 Bacteria 1120
622 Ga0307415_100141034 3300032126 Bacteria 1841
623 Ga0373930_0010936 3300034816 Bacteria 1630
624 Ga0373948_0015981 3300034817 Bacteria 1383
625 Ga0373958_0017718 3300034819 Bacteria 1284
626 Ga0373958_0068708 3300034819 Bacteria 782
627 Ga0373926_0082549 3300035083 Bacteria 1190
628 Ga0373928_0004360 3300035084 Bacteria 2699
629 Ga0373940_0002085 3300035088 Bacteria 3803
630 Ga0373944_0039613 3300035089 Bacteria 1451
631 Ga0373949_0020677 3300035090 Bacteria 1508
632 Ga0373949_0060538 3300035090 Bacteria 973
633 Ga0373952_0007454 3300035092 Bacteria 2050
634 Ga0373923_0154820 3300035111 Bacteria 1043
635 Ga0373932_0006537 3300035112 Bacteria 2759
636 Ga0373941_0003696 3300035115 Bacteria 3483
637 Ga0373941_0014617 3300035115 Bacteria 2101
638 Ga0373941_0034044 3300035115 Bacteria 1534
639 Ga0373945_0003490 3300035116 Bacteria 4950
640 Ga0373956_0007441 3300035119 Bacteria 4412
641 Ga0373960_0043733 3300035121 Bacteria 1306
642 Ga0373943_0033444 3300035170 Bacteria 2449
643 Ga0373943_0180261 3300035170 Bacteria 1160
644 Ga0373946_0040564 3300035171 Bacteria 1905
645 Ga0373955_0013176 3300035172 Bacteria 3989
646 Ga0373955_0233727 3300035172 Bacteria 1100
647 Ga0373942_0047256 3300035207 Bacteria 1195
648 Ga0373942_0097509 3300035207 Bacteria 894
649 Ga0373961_0006309 3300035241 Bacteria 2850
650 Ga0373962_0013313 3300035242 Bacteria 2081
651 Ga0373962_0015296 3300035242 Bacteria 1966
652 Ga0373962_0026211 3300035242 Bacteria 1570
653 Ga0373962_0060218 3300035242 Bacteria 1114
654 Ga0373924_0131718 3300035410 Bacteria 1088
655 Ga0373931_0001739 3300035691 Bacteria 9437
656 Ga0373931_0011415 3300035691 Bacteria 4292
657 Ga0373931_0126329 3300035691 Bacteria 1467
658 Ga0373931_0138851 3300035691 Bacteria 1405
659 Ga0373931_0159877 3300035691 Bacteria 1320
660 Ga0373931_0161601 3300035691 Bacteria 1313
661 Ga0373931_0417780 3300035691 Bacteria 852
662 Ga0373935_0002957 3300035692 Bacteria 9799
663 Ga0373935_0010318 3300035692 Bacteria 5602
664 Ga0373927_0001543 3300035695 Bacteria 17297
665 Ga0373927_0050202 3300035695 Bacteria 2697
666 Ga0373927_0053201 3300035695 Bacteria 2618
667 Ga0373933_0005686 3300035724 Bacteria 6785
668 Ga0373947_0017843 3300035725 Bacteria 4083
669 Ga0373947_0026688 3300035725 Bacteria 3377
670 Ga0373937_0006609 3300036401 Bacteria 10013
671 Ga0373937_0367677 3300036401 Bacteria 1363
672 Ga0373937_0422382 3300036401 Bacteria 1265
673 Ga0373937_0628076 3300036401 Bacteria 1019
674 Ga0373925_0021920 3300037068 Bacteria 4657
675 Ga0373925_0063291 3300037068 Bacteria 2783
676 Ga0373925_0086777 3300037068 Bacteria 2388
677 Ga0373925_0098350 3300037068 Bacteria 2245
678 Ga0373925_0436447 3300037068 Bacteria 1071
679 Ga0395900_0002841 3300037418 Bacteria 18899
680 Ga0395898_0012313 3300037466 Bacteria 8844
681 Ga0436364_0033237 3300037853 Bacteria 23647
682 Ga0436364_0056330 3300037853 Bacteria 3260
683 Ga0436364_0110942 3300037853 Bacteria 1347
684 Ga0436364_0304718 3300037853 Bacteria 4030
685 Ga0436364_0431951 3300037853 Bacteria 888
686 Ga0436364_0475448 3300037853 Bacteria 15369
687 Ga0436364_0742249 3300037853 Bacteria 10808
688 Ga0436364_1204625 3300037853 Bacteria 4866
689 Ga0436364_1395508 3300037853 Bacteria 1371
690 Ga0395901_0255900 3300038443 Bacteria 1823
691 Ga0436365_0017438 3300039437 Bacteria 3666
692 Ga0436365_0132947 3300039437 Bacteria 841
693 Ga0436365_0232658 3300039437 Bacteria 2164
694 Ga0436365_0366029 3300039437 Unclassified 1783
695 Ga0436365_0367776 3300039437 Bacteria 15477
696 Ga0436365_0516288 3300039437 Bacteria 9306
697 Ga0436365_0854068 3300039437 Bacteria 4868
698 Ga0436365_1013679 3300039437 Bacteria 2272
699 Ga0436365_1085262 3300039437 Bacteria 31252
700 Ga0436365_1119339 3300039437 Unclassified 845
701 Ga0436365_1453878 3300039437 Bacteria 1125
702 Ga0436360_0023372 3300039438 Bacteria 16827
703 Ga0436360_0781382 3300039438 Bacteria 3412
704 Ga0436361_0051074 3300039447 Bacteria 3147
705 Ga0436363_1135077 3300039450 Bacteria 1603
706 Ga0436363_1305199 3300039450 Bacteria 1449
707 Ga0439466_0002570 3300041411 Bacteria 7106
708 Ga0439465_0000313 3300041413 Bacteria 13742
709 Ga0439431_0002613 3300041997 Bacteria 3974
710 Ga0439433_0000146 3300041999 Bacteria 10818
711 Ga0439445_0001088 3300042004 Bacteria 5805
712 Ga0439448_0003193 3300042005 Bacteria 4525
713 Ga0439432_001514 3300042006 Bacteria 8732
714 Ga0439449_0003854 3300042007 Bacteria 5814
715 Ga0439451_023991 3300042009 Bacteria 1229
716 Ga0439452_001104 3300042010 Bacteria 11863
717 Ga0439455_0003418 3300042012 Bacteria 3032
718 Ga0439446_0006709 3300042156 Bacteria 3011
719 Ga0439458_0057479 3300042157 Bacteria 967
720 Ga0439459_0002068 3300042438 Bacteria 3057
721 Ga0439460_0020002 3300042461 Bacteria 1817
722 Ga0466961_0189829 3300044693 Bacteria 1274
723 Ga0466963_0043041 3300044694 Bacteria 2967
724 Ga0466957_0097914 3300044842 Bacteria 1845
725 Ga0451576_0025200 3300045051 Bacteria 6410
726 Ga0451576_0026393 3300045051 Bacteria 6248
727 Ga0451576_0885048 3300045051 Bacteria 937
728 Ga0451576_0987397 3300045051 Bacteria 883
729 Ga0466967_0051569 3300045976 Bacteria 3606
730 Ga0466967_0141490 3300045976 Bacteria 2241
731 Ga0495629_0000222 3300046459 Bacteria 50600
732 Ga0495629_0191393 3300046459 Bacteria 1416
733 Ga0495638_0094375 3300046460 Bacteria 1798
734 Ga0495653_0316711 3300046463 Bacteria 1012
735 Ga0495580_0191272 3300046472 Bacteria 1411
736 Ga0495580_0413769 3300046472 Bacteria 908
737 Ga0495582_0009126 3300046473 Bacteria 5472
738 Ga0495639_0023702 3300046475 Bacteria 2698
739 Ga0495662_0195321 3300046476 Bacteria 997
740 Ga0495664_0026349 3300046477 Bacteria 3385
741 Ga0495594_0011694 3300046499 Bacteria 4563
742 Ga0495594_0036706 3300046499 Bacteria 2673
743 Ga0495596_0066620 3300046500 Bacteria 1400
744 Ga0495583_0016024 3300046506 Bacteria 4047
745 Ga0495620_0011112 3300046515 Bacteria 4714
746 Ga0495642_0128320 3300046528 Bacteria 1091
747 Ga0495654_0037248 3300046530 Bacteria 2440
748 Ga0495654_0107115 3300046530 Bacteria 1279
749 Ga0495665_0185269 3300046531 Bacteria 1081
750 Ga0495586_0058460 3300046535 Bacteria 2094
751 Ga0495597_0094854 3300046542 Bacteria 1263
752 Ga0495635_0031149 3300046663 Bacteria 3705
753 Ga0495659_0013095 3300046664 Bacteria 2698
754 Ga0495661_0104172 3300046665 Bacteria 1591
755 Ga0495588_0037850 3300046674 Bacteria 2452
756 Ga0495588_0071485 3300046674 Bacteria 1804
757 Ga0495657_0031006 3300046675 Bacteria 3740
758 Ga0495657_0056795 3300046675 Bacteria 2605
759 Ga0495647_0002929 3300046681 Bacteria 5409
760 Ga0495647_0004541 3300046681 Bacteria 4516
761 Ga0495658_0001062 3300046683 Bacteria 14503
762 Ga0495658_0035110 3300046683 Bacteria 2756
763 Ga0495613_0007724 3300046689 Bacteria 8000
764 Ga0495670_0135367 3300046691 Bacteria 1286
765 Ga0495581_0033186 3300047315 Bacteria 2989
766 Ga0495604_0111697 3300047317 Bacteria 1992
767 Ga0495674_0127408 3300047319 Bacteria 2146
768 Ga0495676_0146869 3300047321 Bacteria 1683
769 Ga0495680_0017400 3300047322 Bacteria 6140
770 Ga0495683_0103673 3300047323 Bacteria 1365
771 Ga0495673_0105577 3300047469 Bacteria 1133
772 Ga0495686_0001554 3300047472 Bacteria 24493
773 Ga0495593_0004258 3300047673 Bacteria 8516
774 Ga0496100_0004958 3300048903 Bacteria 7116
775 Ga0496100_0492526 3300048903 Bacteria 944
776 Ga0496101_0010804 3300048904 Bacteria 6040
777 Ga0496101_0025281 3300048904 Bacteria 4119
778 Ga0496101_0161270 3300048904 Bacteria 1720
779 Ga0496102_0017750 3300048905 Bacteria 6237
780 Ga0496102_0087362 3300048905 Bacteria 2881
781 Ga0496102_0344786 3300048905 Bacteria 1402
782 Ga0496103_0009241 3300048906 Bacteria 5840
783 Ga0496104_0003649 3300048907 Bacteria 13294
784 Ga0496104_0020599 3300048907 Bacteria 6047
785 Ga0496105_0040625 3300048908 Bacteria 3835
786 Ga0496105_0055070 3300048908 Unclassified 3284
787 Ga0496105_0708422 3300048908 Bacteria 772
788 Ga0496106_0011860 3300048909 Bacteria 6434
789 Ga0496106_0015661 3300048909 Bacteria 5608
790 Ga0496107_0032503 3300048910 Bacteria 3729
791 Ga0496108_0442640 3300048911 Bacteria 1135
792 Ga0496108_0455065 3300048911 Bacteria 1118
793 Ga0496110_0028940 3300048913 Bacteria 4762
794 Ga0496110_0601488 3300048913 Bacteria 997
795 Ga0496111_0075975 3300048914 Bacteria 2448
796 Ga0496111_0137323 3300048914 Bacteria 1811
797 Ga0496113_0092657 3300048916 Bacteria 2331
798 Ga0496114_0057007 3300048917 Bacteria 3261
799 Ga0496114_0820230 3300048917 Bacteria 809
800 Ga0496114_0946218 3300048917 Bacteria 744
801 Ga0496115_0143139 3300048918 Bacteria 1972
802 Ga0496116_0024577 3300048919 Bacteria 4450
803 Ga0496119_0054141 3300048922 Bacteria 2445
804 Ga0496121_0022068 3300048924 Bacteria 6198
805 Ga0496125_0006156 3300048928 Bacteria 13080
806 Ga0496125_0011331 3300048928 Bacteria 8929
807 Ga0501032_0120235 3300049569 Bacteria 1736
808 Ga0501033_0020528 3300049570 Bacteria 4991
809 Ga0501033_0022299 3300049570 Unclassified 4777
810 Ga0501033_0211373 3300049570 Bacteria 1383
811 Ga0501034_0000211 3300049571 Bacteria 110858
812 Ga0501034_0002398 3300049571 Bacteria 22707
813 Ga0501034_0071326 3300049571 Bacteria 3483
814 Ga0501034_0579508 3300049571 Bacteria 1029
815 Ga0501036_0000172 3300049572 Bacteria 42511
816 Ga0501036_0068822 3300049572 Bacteria 2995
817 Ga0501036_0135356 3300049572 Bacteria 2080
818 Ga0501037_0003588 3300049573 Bacteria 11261
819 Ga0501037_0010884 3300049573 Bacteria 6684
820 Ga0501037_0012297 3300049573 Bacteria 6299
821 Ga0501037_0244558 3300049573 Bacteria 1257
822 Ga0501038_0009989 3300049574 Bacteria 8690
823 Ga0501038_0485133 3300049574 Bacteria 947
824 Ga0501039_0041205 3300049575 Bacteria 3566
825 Ga0501039_0183575 3300049575 Bacteria 1645
826 Ga0501039_0297789 3300049575 Bacteria 1268
827 Ga0501040_0007181 3300049576 Bacteria 7215
828 Ga0501040_0261555 3300049576 Bacteria 1235
829 Ga0501041_0003733 3300049577 Bacteria 8756
830 Ga0501041_0050340 3300049577 Bacteria 2539
831 Ga0501042_0021279 3300049578 Bacteria 4517
832 Ga0501042_0288295 3300049578 Bacteria 1186
833 Ga0501043_0010430 3300049579 Bacteria 7280
834 Ga0501043_0013340 3300049579 Bacteria 6425
835 Ga0501043_0023537 3300049579 Bacteria 4830
836 Ga0501043_0164148 3300049579 Bacteria 1735
837 Ga0501043_0329329 3300049579 Bacteria 1163
838 Ga0501046_0000249 3300049580 Bacteria 55198
839 Ga0501046_0007428 3300049580 Bacteria 9634
840 Ga0501046_0028558 3300049580 Bacteria 4542
841 Ga0501046_0101883 3300049580 Bacteria 2202
842 Ga0501047_0000010 3300049581 Bacteria 429357
843 Ga0501047_0013674 3300049581 Bacteria 7704
844 Ga0501047_0014463 3300049581 Bacteria 7505
845 Ga0501047_0023276 3300049581 Bacteria 5948
846 Ga0501047_0139275 3300049581 Bacteria 2306
847 Ga0501047_0161027 3300049581 Bacteria 2116
848 Ga0501047_0546302 3300049581 Bacteria 983
849 Ga0501048_0014062 3300049582 Bacteria 5931
850 Ga0501048_0308426 3300049582 Bacteria 1126
851 Ga0501068_0008197 3300049584 Bacteria 5808
852 Ga0501069_0063768 3300049585 Bacteria 2058
853 Ga0501070_0009756 3300049586 Bacteria 8121
854 Ga0501070_0014041 3300049586 Bacteria 6742
855 Ga0501070_0050118 3300049586 Bacteria 3466
856 Ga0501070_0242705 3300049586 Bacteria 1474
857 Ga0501070_0445668 3300049586 Bacteria 1044
858 Ga0501071_0096340 3300049587 Bacteria 2178
859 Ga0501071_0119031 3300049587 Bacteria 1957
860 Ga0501071_0227462 3300049587 Bacteria 1405
861 Ga0501071_0292800 3300049587 Bacteria 1233
862 Ga0501071_0406244 3300049587 Bacteria 1040
863 Ga0501072_0014962 3300049588 Bacteria 5947
864 Ga0501072_0023506 3300049588 Bacteria 4788
865 Ga0501072_0031936 3300049588 Bacteria 4122
866 Ga0501072_0033674 3300049588 Bacteria 4015
867 Ga0501072_0200245 3300049588 Bacteria 1592
868 Ga0501073_0006056 3300049589 Bacteria 9024
869 Ga0501073_0058508 3300049589 Bacteria 2693
870 Ga0501073_0074862 3300049589 Bacteria 2357
871 Ga0501073_0101490 3300049589 Bacteria 1998
872 Ga0501073_0103508 3300049589 Bacteria 1976
873 Ga0501074_0007830 3300049590 Bacteria 7737
874 Ga0501074_0042094 3300049590 Bacteria 3306
875 Ga0501074_0181684 3300049590 Bacteria 1500
876 Ga0501074_0228845 3300049590 Bacteria 1324
877 Ga0501074_0460471 3300049590 Bacteria 901
878 Ga0501075_0007356 3300049591 Bacteria 7638
879 Ga0501075_0016908 3300049591 Bacteria 5260
880 Ga0501075_0127129 3300049591 Bacteria 1941
881 Ga0501075_0179549 3300049591 Bacteria 1615
882 Ga0501075_0450616 3300049591 Bacteria 981
883 Ga0501076_0012855 3300049592 Bacteria 6264
884 Ga0501076_0021329 3300049592 Bacteria 4968
885 Ga0501076_0037747 3300049592 Bacteria 3791
886 Ga0501076_0074597 3300049592 Bacteria 2718
887 Ga0501076_0082346 3300049592 Bacteria 2583
888 Ga0501076_0089403 3300049592 Bacteria 2476
889 Ga0501076_0479139 3300049592 Bacteria 1025
890 Ga0501076_0635123 3300049592 Bacteria 881
891 Ga0501077_0191484 3300049593 Bacteria 1299
892 Ga0501079_0006359 3300049741 Bacteria 8867
893 Ga0501079_0026705 3300049741 Bacteria 4427
894 Ga0501079_0026910 3300049741 Bacteria 4410
895 Ga0501079_0031070 3300049741 Bacteria 4104
896 Ga0501079_0101862 3300049741 Bacteria 2227
897 Ga0501079_0505862 3300049741 Bacteria 950
898 Ga0501080_0001018 3300049742 Bacteria 23056
899 Ga0501080_0018017 3300049742 Bacteria 6538
900 Ga0501080_0025212 3300049742 Bacteria 5519
901 Ga0501080_0096067 3300049742 Bacteria 2751
902 Ga0501080_0187906 3300049742 Bacteria 1899
903 Ga0501080_0707279 3300049742 Bacteria 888
904 Ga0501081_0003021 3300049743 Bacteria 10679
905 Ga0501081_0015582 3300049743 Bacteria 5017
906 Ga0501081_0145084 3300049743 Bacteria 1703
907 Ga0501081_0167622 3300049743 Bacteria 1585
908 Ga0501081_0429209 3300049743 Bacteria 980
909 Ga0501081_0634673 3300049743 Bacteria 800
910 Ga0501083_0003593 3300049744 Bacteria 10880
911 Ga0501083_0051179 3300049744 Bacteria 2778
912 Ga0501083_0062480 3300049744 Bacteria 2485
913 Ga0501035_0000914 3300049822 Bacteria 31246
914 Ga0501035_0040338 3300049822 Bacteria 4219
915 Ga0501035_0068266 3300049822 Bacteria 3153
916 Ga0501035_0079383 3300049822 Unclassified 2899
917 Ga0501044_0004598 3300049823 Bacteria 15432
918 Ga0501044_0007849 3300049823 Bacteria 11735
919 Ga0501045_0050988 3300049824 Bacteria 3020
920 Ga0501045_0219202 3300049824 Bacteria 1417
921 Ga0501045_0286192 3300049824 Bacteria 1227
922 Ga0501045_0341925 3300049824 Bacteria 1114
923 nmdc:mga03n38_130793_c1 3300050490 Bacteria 1244
924 nmdc:mga0yw44_19551_c1 3300050492 Bacteria 3738
925 nmdc:mga0k408_82411_c1 3300050493 Bacteria 1885
926 nmdc:mga06z11_20222_c1 3300050494 Bacteria 3074
927 nmdc:mga04h51_96336_c1 3300050495 Bacteria 1072
928 nmdc:mga05p37_139644_c1 3300050507 Bacteria 2969
929 nmdc:mga05p37_208769_c1 3300050507 Bacteria 2361
930 nmdc:mga05p37_20991_c1 3300050507 Bacteria 7906
931 nmdc:mga05p37_620132_c1 3300050507 Bacteria 1217
932 nmdc:mga05p37_63189_c1 3300050507 Bacteria 4556
933 nmdc:mga05p37_758780_c1 3300050507 Bacteria 1068
934 nmdc:mga09592_46464_c1 3300050508 Bacteria 3658
935 nmdc:mga09592_97419_c1 3300050508 Bacteria 2517
936 nmdc:mga0qj67_15283_c1 3300050509 Bacteria 5812
937 nmdc:mga0qj67_333837_c1 3300050509 Bacteria 1226
938 nmdc:mga0qj67_42201_c1 3300050509 Bacteria 3590
939 nmdc:mga0qj67_47790_c1 3300050509 Bacteria 3381
940 nmdc:mga0qj67_609727_c1 3300050509 Bacteria 873
941 nmdc:mga06r32_15674_c1 3300050510 Bacteria 6886
942 nmdc:mga06r32_293794_c1 3300050510 Bacteria 1611
943 nmdc:mga06r32_683780_c1 3300050510 Bacteria 993
944 nmdc:mga06r32_735859_c1 3300050510 Bacteria 950
945 nmdc:mga08y16_10783_c1 3300050511 Bacteria 9592
946 nmdc:mga08y16_155820_c1 3300050511 Bacteria 2374
947 nmdc:mga08y16_20928_c1 3300050511 Bacteria 6906
948 nmdc:mga08y16_45264_c1 3300050511 Bacteria 4611
949 nmdc:mga08y16_79356_c1 3300050511 Bacteria 3421
950 nmdc:mga0n895_12406_c1 3300050512 Bacteria 7644
951 nmdc:mga0n895_2301_c1 3300050512 Bacteria 14853
952 nmdc:mga0n895_426245_c1 3300050512 Bacteria 1341
953 nmdc:mga0n895_604931_c1 3300050512 Bacteria 1098
954 nmdc:mga0n895_60524_c1 3300050512 Bacteria 3736
955 nmdc:mga0rr50_1668_c1 3300050513 Bacteria 12233
956 nmdc:mga0rr50_3367_c1 3300050513 Bacteria 9180
957 nmdc:mga0rr50_50826_c1 3300050513 Bacteria 3073
958 nmdc:mga08x19_2230_c1 3300050514 Bacteria 11833
959 nmdc:mga08x19_237_c1 3300050514 Bacteria 42162
960 nmdc:mga08x19_519480_c1 3300050514 Bacteria 841
961 nmdc:mga0a205_12833_c1 3300050515 Bacteria 7772
962 nmdc:mga0a205_139410_c1 3300050515 Bacteria 2325
963 nmdc:mga0a205_229394_c1 3300050515 Bacteria 1740
964 nmdc:mga0a205_23303_c1 3300050515 Bacteria 5871
965 nmdc:mga0a205_4491_c1 3300050515 Bacteria 12520
966 nmdc:mga0a205_5156_c1 3300050515 Bacteria 11750
967 nmdc:mga0sz30_152358_c1 3300050516 Bacteria 1023
968 Ga0495601_0000770 3300053077 Bacteria 17275
969 Ga0495595_0002566 3300053084 Bacteria 7122
970 Ga0495619_0001318 3300053085 Bacteria 16299
971 Ga0495619_0125039 3300053085 Bacteria 1764
972 Ga0500644_0127129 3300053088 Bacteria 999
973 Ga0500581_018950 3300053089 Bacteria 3468
974 Ga0500641_0001992 3300053096 Bacteria 7247
975 Ga0500641_0029359 3300053096 Bacteria 2154
976 Ga0500641_0149189 3300053096 Bacteria 1009
977 Ga0500650_0000145 3300053098 Bacteria 18624
978 Ga0500556_0000004 3300053104 Bacteria 666287
979 Ga0500592_001234 3300053116 Bacteria 4172
980 Ga0500594_0005910 3300053118 Bacteria 2728
981 Ga0500595_003852 3300053119 Bacteria 6887
982 Ga0500642_0000074 3300053130 Bacteria 54356
983 Ga0500652_000065 3300053131 Bacteria 46129
984 Ga0500658_0072711 3300053134 Bacteria 1454
985 Ga0500559_0000381 3300053136 Bacteria 32402
986 Ga0500568_0009138 3300053139 Bacteria 4726
987 Ga0500568_0009152 3300053139 Bacteria 4723
988 Ga0500604_0016565 3300053151 Bacteria 2031
989 Ga0500616_0000014 3300053153 Bacteria 637918
990 Ga0500622_0006481 3300053156 Bacteria 6776
991 Ga0500633_0001663 3300053160 Bacteria 4306
992 Ga0500639_004690 3300053163 Bacteria 6954
993 Ga0500636_0002098 3300053177 Bacteria 11018
994 Ga0500636_0069558 3300053177 Bacteria 2042
995 Ga0500552_000090 3300053733 Bacteria 7450
996 Ga0500596_000143 3300053735 Bacteria 10778
997 Ga0501084_0001324 3300054114 Bacteria 19524
998 Ga0501084_0029231 3300054114 Bacteria 4610
999 Ga0501084_0071398 3300054114 Bacteria 2907
1000 Ga0501084_0078752 3300054114 Bacteria 2762
1001 Ga0501084_0103042 3300054114 Bacteria 2397
1002 Ga0590075_036856 3300059424 Bacteria 1247
1003 Ga0501082_0001749 3300060353 Bacteria 19128
1004 Ga0501082_0009462 3300060353 Bacteria 8390
1005 Ga0501082_0062192 3300060353 Bacteria 3213
1006 Ga0501082_0079276 3300060353 Bacteria 2833
1007 Ga0501082_0230860 3300060353 Bacteria 1610
1008 Ga0501082_0261755 3300060353 Bacteria 1505
1009 Ga0466962_0164274 3300061719 Bacteria 1080
1010 Ga0530510_0041519 3300061734 Bacteria 3321
1011 Ga0530510_0126458 3300061734 Bacteria 1879
1012 Ga0530510_0251865 3300061734 Bacteria 1316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053118 Ga0500594_0005910 Ga0500594_0005910_142_960 198
2 3300005327 Ga0070658_10151023 Ga0070658_101510232 199
3 3300005563 Ga0068855_100006101 Ga0068855_1000061013 200
4 3300009093 Ga0105240_10059514 Ga0105240_100595145 200
5 3300013307 Ga0157372_10293850 Ga0157372_102938502 200
6 3300025913 Ga0207695_10095047 Ga0207695_100950472 200
7 3300025921 Ga0207652_10389604 Ga0207652_103896042 200
8 3300025949 Ga0207667_10019350 Ga0207667_100193503 200
9 3300005436 Ga0070713_100003400 Ga0070713_1000034005 202
10 3300005616 Ga0068852_100710037 Ga0068852_1007100371 202
11 3300006028 Ga0070717_10002714 Ga0070717_1000271412 202
12 3300009177 Ga0105248_10283613 Ga0105248_102836132 202
13 3300009553 Ga0105249_10021338 Ga0105249_100213383 202
14 3300025915 Ga0207693_10137585 Ga0207693_101375852 202
15 3300025928 Ga0207700_10020058 Ga0207700_100200583 202
16 3300031616 Ga0307508_10221917 Ga0307508_102219172 202
17 3300014969 Ga0157376_10037185 Ga0157376_100371851 203
18 3300025899 Ga0207642_10201094 Ga0207642_102010942 203
19 3300031548 Ga0307408_100187965 Ga0307408_1001879652 203
20 3300031730 Ga0307516_10027197 Ga0307516_100271974 203
21 3300032002 Ga0307416_100191912 Ga0307416_1001919122 203
22 3300048913 Ga0496110_0601488 Ga0496110_0601488_202_972 203
23 3300025903 Ga0207680_10229565 Ga0207680_102295651 204
24 3300048908 Ga0496105_0708422 Ga0496105_0708422_21_716 204
25 3300048917 Ga0496114_0946218 Ga0496114_0946218_20_715 204
26 3300005543 Ga0070672_100175488 Ga0070672_1001754884 205
27 3300005614 Ga0068856_100000451 Ga0068856_10000045141 205
28 3300006177 Ga0075362_10050508 Ga0075362_100505082 205
29 3300026078 Ga0207702_10000478 Ga0207702_1000047840 205
30 3300009092 Ga0105250_10104561 Ga0105250_101045612 206
31 3300013308 Ga0157375_10106530 Ga0157375_101065303 207
32 3300025900 Ga0207710_10051467 Ga0207710_100514671 207
33 3300025940 Ga0207691_10184588 Ga0207691_101845882 207
34 3300047323 Ga0495683_0103673 Ga0495683_0103673_10_780 207
35 3300035691 Ga0373931_0138851 Ga0373931_0138851_500_1294 208
36 3300047469 Ga0495673_0105577 Ga0495673_0105577_58_828 209
37 3300048928 Ga0496125_0006156 Ga0496125_0006156_4296_5111 209
38 3300049742 Ga0501080_0025212 Ga0501080_0025212_687_1466 209
39 3300053177 Ga0500636_0069558 Ga0500636_0069558_948_1706 209
40 3300060353 Ga0501082_0062192 Ga0501082_0062192_2239_3018 209
41 3300009147 Ga0114129_10000702 Ga0114129_1000070239 212
42 3300025924 Ga0207694_10109317 Ga0207694_101093172 212
43 3300005336 Ga0070680_100107278 Ga0070680_1001072782 213
44 3300005518 Ga0070699_100104120 Ga0070699_1001041203 213
45 3300005546 Ga0070696_100001012 Ga0070696_1000010124 213
46 3300035170 Ga0373943_0180261 Ga0373943_0180261_413_1108 213
47 3300035242 Ga0373962_0060218 Ga0373962_0060218_35_730 213
48 3300037853 Ga0436364_1395508 Ga0436364_1395508_645_1340 213
49 3300046472 Ga0495580_0413769 Ga0495580_0413769_201_896 213
50 3300046664 Ga0495659_0013095 Ga0495659_0013095_1982_2677 213
51 3300046691 Ga0495670_0135367 Ga0495670_0135367_579_1274 213
52 3300048917 Ga0496114_0820230 Ga0496114_0820230_24_719 213
53 3300049585 Ga0501069_0063768 Ga0501069_0063768_373_1134 213
54 3300049586 Ga0501070_0050118 Ga0501070_0050118_1502_2263 213
55 3300049586 Ga0501070_0242705 Ga0501070_0242705_30_791 213
56 3300049588 Ga0501072_0014962 Ga0501072_0014962_1297_1992 213
57 3300049743 Ga0501081_0145084 Ga0501081_0145084_924_1619 213
58 3300049822 Ga0501035_0000914 Ga0501035_0000914_17877_18638 213
59 3300049824 Ga0501045_0219202 Ga0501045_0219202_491_1186 213
60 3300050514 nmdc:mga08x19_519480_c1 nmdc:mga08x19_519480_c1_125_820 213
61 3300061734 Ga0530510_0251865 Ga0530510_0251865_393_1088 213
62 3300037853 Ga0436364_0431951 Ga0436364_0431951_39_854 215
63 3300049581 Ga0501047_0139275 Ga0501047_0139275_858_1688 215
64 3300049581 Ga0501047_0161027 Ga0501047_0161027_605_1366 215
65 3300049588 Ga0501072_0200245 Ga0501072_0200245_575_1336 215
66 3300049571 Ga0501034_0579508 Ga0501034_0579508_246_1007 216
67 3300049589 Ga0501073_0058508 Ga0501073_0058508_1800_2561 216
68 3300053733 Ga0500552_000090 Ga0500552_000090_11_694 216
69 3300049592 Ga0501076_0037747 Ga0501076_0037747_2619_3446 217
70 3300049741 Ga0501079_0031070 Ga0501079_0031070_1013_1840 217
71 3300049744 Ga0501083_0051179 Ga0501083_0051179_893_1720 217
72 3300049822 Ga0501035_0068266 Ga0501035_0068266_179_1006 217
73 3300054114 Ga0501084_0029231 Ga0501084_0029231_1613_2440 217
74 3300032002 Ga0307416_100340555 Ga0307416_1003405552 218
75 3300037853 Ga0436364_0742249 Ga0436364_0742249_9969_10724 218
76 3300050495 nmdc:mga04h51_96336_c1 nmdc:mga04h51_96336_c1_10_705 218
77 3300028573 Ga0265334_10027674 Ga0265334_100276742 219
78 3300049577 Ga0501041_0050340 Ga0501041_0050340_1569_2381 219
79 3300049588 Ga0501072_0033674 Ga0501072_0033674_149_961 219
80 3300049592 Ga0501076_0021329 Ga0501076_0021329_1693_2505 219
81 3300049593 Ga0501077_0191484 Ga0501077_0191484_259_1071 219
82 3300049824 Ga0501045_0050988 Ga0501045_0050988_1693_2505 219
83 3300053136 Ga0500559_0000381 Ga0500559_0000381_25795_26565 219
84 3300053163 Ga0500639_004690 Ga0500639_004690_3159_3929 219
85 3300053735 Ga0500596_000143 Ga0500596_000143_9206_9976 219
86 3300060353 Ga0501082_0079276 Ga0501082_0079276_726_1538 219
87 3300037418 Ga0395900_0002841 Ga0395900_0002841_5988_6749 220
88 3300037466 Ga0395898_0012313 Ga0395898_0012313_220_981 220
89 3300038443 Ga0395901_0255900 Ga0395901_0255900_903_1664 220
90 3300045051 Ga0451576_0987397 Ga0451576_0987397_68_832 220
91 3300046530 Ga0495654_0107115 Ga0495654_0107115_515_1267 220
92 3300009551 Ga0105238_10695214 Ga0105238_106952141 221
93 3300005330 Ga0070690_100042773 Ga0070690_1000427732 222
94 3300005330 Ga0070690_100220151 Ga0070690_1002201512 222
95 3300005335 Ga0070666_10006268 Ga0070666_100062682 222
96 3300005338 Ga0068868_100012946 Ga0068868_1000129463 222
97 3300005340 Ga0070689_100110891 Ga0070689_1001108912 222
98 3300005347 Ga0070668_100026398 Ga0070668_1000263983 222
99 3300005353 Ga0070669_100021844 Ga0070669_1000218441 222
100 3300005354 Ga0070675_100110433 Ga0070675_1001104332 222
101 3300005364 Ga0070673_100188299 Ga0070673_1001882992 222
102 3300005365 Ga0070688_100011085 Ga0070688_1000110855 222
103 3300005367 Ga0070667_100113538 Ga0070667_1001135382 222
104 3300005456 Ga0070678_100064905 Ga0070678_1000649052 222
105 3300005459 Ga0068867_100137632 Ga0068867_1001376322 222
106 3300005543 Ga0070672_100217278 Ga0070672_1002172782 222
107 3300005548 Ga0070665_100031297 Ga0070665_1000312972 222
108 3300005614 Ga0068856_100080445 Ga0068856_1000804452 222
109 3300005617 Ga0068859_100074029 Ga0068859_1000740292 222
110 3300005719 Ga0068861_100164993 Ga0068861_1001649932 222
111 3300005843 Ga0068860_100003215 Ga0068860_10000321514 222
112 3300005843 Ga0068860_100114913 Ga0068860_1001149132 222
113 3300006237 Ga0097621_100167279 Ga0097621_1001672792 222
114 3300006358 Ga0068871_100058868 Ga0068871_1000588682 222
115 3300006852 Ga0075433_10000760 Ga0075433_1000076018 222
116 3300006871 Ga0075434_100042521 Ga0075434_1000425214 222
117 3300006881 Ga0068865_100051260 Ga0068865_1000512603 222
118 3300006914 Ga0075436_100005645 Ga0075436_1000056456 222
119 3300006931 Ga0097620_100074026 Ga0097620_1000740262 222
120 3300007076 Ga0075435_100000197 Ga0075435_10000019732 222
121 3300009177 Ga0105248_10008655 Ga0105248_100086553 222
122 3300013296 Ga0157374_10173481 Ga0157374_101734812 222
123 3300013306 Ga0163162_10211536 Ga0163162_102115362 222
124 3300014968 Ga0157379_10004316 Ga0157379_1000431610 222
125 3300014969 Ga0157376_10374340 Ga0157376_103743401 222
126 3300017792 Ga0163161_10231226 Ga0163161_102312262 222
127 3300025907 Ga0207645_10002022 Ga0207645_1000202214 222
128 3300025923 Ga0207681_10296319 Ga0207681_102963191 222
129 3300025926 Ga0207659_10182014 Ga0207659_101820141 222
130 3300025940 Ga0207691_10011068 Ga0207691_100110689 222
131 3300025942 Ga0207689_10005271 Ga0207689_100052714 222
132 3300025942 Ga0207689_10078866 Ga0207689_100788662 222
133 3300025986 Ga0207658_10382200 Ga0207658_103822002 222
134 3300026035 Ga0207703_10011205 Ga0207703_100112054 222
135 3300026078 Ga0207702_10052786 Ga0207702_100527862 222
136 3300026088 Ga0207641_10034109 Ga0207641_100341094 222
137 3300026089 Ga0207648_10001752 Ga0207648_100017526 222
138 3300026118 Ga0207675_100080727 Ga0207675_1000807274 222
139 3300026121 Ga0207683_10005101 Ga0207683_100051012 222
140 3300028381 Ga0268264_10011385 Ga0268264_100113852 222
141 3300031241 Ga0265325_10011356 Ga0265325_100113563 222
142 3300035410 Ga0373924_0131718 Ga0373924_0131718_48_815 222
143 3300048904 Ga0496101_0161270 Ga0496101_0161270_590_1357 222
144 3300048911 Ga0496108_0442640 Ga0496108_0442640_280_1047 222
145 3300049590 Ga0501074_0228845 Ga0501074_0228845_49_816 222
146 3300050511 nmdc:mga08y16_20928_c1 nmdc:mga08y16_20928_c1_935_1684 222
147 3300050512 nmdc:mga0n895_2301_c1 nmdc:mga0n895_2301_c1_3138_3887 222
148 3300050513 nmdc:mga0rr50_3367_c1 nmdc:mga0rr50_3367_c1_3138_3887 222
149 3300050514 nmdc:mga08x19_2230_c1 nmdc:mga08x19_2230_c1_5293_6042 222
150 3300050515 nmdc:mga0a205_5156_c1 nmdc:mga0a205_5156_c1_9659_10408 222
151 3300005330 Ga0070690_100000085 Ga0070690_10000008523 223
152 3300005334 Ga0068869_100000367 Ga0068869_10000036723 223
153 3300005336 Ga0070680_100000888 Ga0070680_10000088822 223
154 3300005337 Ga0070682_100004504 Ga0070682_1000045048 223
155 3300005338 Ga0068868_100000639 Ga0068868_10000063912 223
156 3300005340 Ga0070689_100000189 Ga0070689_10000018917 223
157 3300005341 Ga0070691_10002347 Ga0070691_100023474 223
158 3300005343 Ga0070687_100000020 Ga0070687_10000002030 223
159 3300005353 Ga0070669_100305777 Ga0070669_1003057772 223
160 3300005406 Ga0070703_10038846 Ga0070703_100388461 223
161 3300005438 Ga0070701_10000464 Ga0070701_1000046412 223
162 3300005440 Ga0070705_100000022 Ga0070705_10000002231 223
163 3300005441 Ga0070700_100001396 Ga0070700_1000013969 223
164 3300005444 Ga0070694_100000049 Ga0070694_1000000495 223
165 3300005445 Ga0070708_100168139 Ga0070708_1001681392 223
166 3300005458 Ga0070681_10006711 Ga0070681_100067113 223
167 3300005458 Ga0070681_10123644 Ga0070681_101236442 223
168 3300005459 Ga0068867_100001285 Ga0068867_10000128513 223
169 3300005530 Ga0070679_100005893 Ga0070679_1000058933 223
170 3300005539 Ga0068853_100210105 Ga0068853_1002101051 223
171 3300005543 Ga0070672_100152594 Ga0070672_1001525942 223
172 3300005544 Ga0070686_100000085 Ga0070686_10000008510 223
173 3300005545 Ga0070695_100001199 Ga0070695_1000011998 223
174 3300005546 Ga0070696_100000688 Ga0070696_10000068815 223
175 3300005547 Ga0070693_100000063 Ga0070693_10000006333 223
176 3300005549 Ga0070704_100000009 Ga0070704_10000000939 223
177 3300005563 Ga0068855_100010584 Ga0068855_1000105847 223
178 3300005578 Ga0068854_100032697 Ga0068854_1000326973 223
179 3300005614 Ga0068856_100027691 Ga0068856_1000276913 223
180 3300005615 Ga0070702_100000009 Ga0070702_10000000935 223
181 3300005617 Ga0068859_100000354 Ga0068859_10000035430 223
182 3300005718 Ga0068866_10000182 Ga0068866_1000018229 223
183 3300005719 Ga0068861_100000138 Ga0068861_10000013810 223
184 3300005840 Ga0068870_10006772 Ga0068870_100067724 223
185 3300005842 Ga0068858_100007068 Ga0068858_1000070688 223
186 3300005843 Ga0068860_100000285 Ga0068860_10000028558 223
187 3300005844 Ga0068862_100000821 Ga0068862_1000008213 223
188 3300006237 Ga0097621_100000392 Ga0097621_10000039230 223
189 3300006358 Ga0068871_100002537 Ga0068871_10000253712 223
190 3300006881 Ga0068865_100000052 Ga0068865_10000005231 223
191 3300006931 Ga0097620_100000354 Ga0097620_10000035417 223
192 3300009098 Ga0105245_10000086 Ga0105245_1000008682 223
193 3300009147 Ga0114129_10045024 Ga0114129_100450242 223
194 3300009148 Ga0105243_10000360 Ga0105243_1000036028 223
195 3300009148 Ga0105243_10921822 Ga0105243_109218221 223
196 3300009174 Ga0105241_10001255 Ga0105241_1000125512 223
197 3300009176 Ga0105242_10001063 Ga0105242_1000106315 223
198 3300009177 Ga0105248_10664272 Ga0105248_106642722 223
199 3300009553 Ga0105249_10007871 Ga0105249_100078717 223
200 3300011119 Ga0105246_10025425 Ga0105246_100254252 223
201 3300013100 Ga0157373_10001111 Ga0157373_1000111116 223
202 3300013105 Ga0157369_10044351 Ga0157369_100443511 223
203 3300013297 Ga0157378_10000332 Ga0157378_1000033217 223
204 3300013307 Ga0157372_10001340 Ga0157372_1000134016 223
205 3300013308 Ga0157375_10234830 Ga0157375_102348302 223
206 3300014325 Ga0163163_10328744 Ga0163163_103287441 223
207 3300014326 Ga0157380_10012130 Ga0157380_100121303 223
208 3300014745 Ga0157377_10011155 Ga0157377_100111553 223
209 3300014969 Ga0157376_10010278 Ga0157376_100102783 223
210 3300025899 Ga0207642_10002026 Ga0207642_100020263 223
211 3300025912 Ga0207707_10005087 Ga0207707_100050878 223
212 3300025912 Ga0207707_10040055 Ga0207707_100400553 223
213 3300025917 Ga0207660_10014345 Ga0207660_100143453 223
214 3300025918 Ga0207662_10005034 Ga0207662_100050346 223
215 3300025921 Ga0207652_10006129 Ga0207652_100061296 223
216 3300025927 Ga0207687_10001602 Ga0207687_1000160213 223
217 3300025934 Ga0207686_10000270 Ga0207686_1000027023 223
218 3300025935 Ga0207709_10001682 Ga0207709_1000168212 223
219 3300025936 Ga0207670_10002057 Ga0207670_100020578 223
220 3300025937 Ga0207669_10591160 Ga0207669_105911602 223
221 3300025938 Ga0207704_10000300 Ga0207704_1000030017 223
222 3300025940 Ga0207691_10200216 Ga0207691_102002162 223
223 3300025942 Ga0207689_10000691 Ga0207689_1000069130 223
224 3300025949 Ga0207667_10002649 Ga0207667_100026495 223
225 3300025961 Ga0207712_10010320 Ga0207712_100103204 223
226 3300025981 Ga0207640_10008666 Ga0207640_100086665 223
227 3300026023 Ga0207677_10001318 Ga0207677_100013183 223
228 3300026035 Ga0207703_10007452 Ga0207703_100074526 223
229 3300026041 Ga0207639_10158976 Ga0207639_101589762 223
230 3300026075 Ga0207708_10000182 Ga0207708_1000018249 223
231 3300026078 Ga0207702_10011253 Ga0207702_100112535 223
232 3300026089 Ga0207648_10000335 Ga0207648_1000033553 223
233 3300026095 Ga0207676_10242588 Ga0207676_102425882 223
234 3300026118 Ga0207675_100000142 Ga0207675_1000001426 223
235 3300028380 Ga0268265_10002935 Ga0268265_100029358 223
236 3300028381 Ga0268264_10000446 Ga0268264_1000044630 223
237 3300031595 Ga0265313_10001509 Ga0265313_1000150910 223
238 3300034817 Ga0373948_0015981 Ga0373948_0015981_73_810 223
239 3300035090 Ga0373949_0020677 Ga0373949_0020677_598_1335 223
240 3300035090 Ga0373949_0060538 Ga0373949_0060538_64_813 223
241 3300035116 Ga0373945_0003490 Ga0373945_0003490_3439_4188 223
242 3300035121 Ga0373960_0043733 Ga0373960_0043733_82_819 223
243 3300035170 Ga0373943_0033444 Ga0373943_0033444_87_836 223
244 3300035171 Ga0373946_0040564 Ga0373946_0040564_352_1101 223
245 3300035242 Ga0373962_0013313 Ga0373962_0013313_1114_1851 223
246 3300035691 Ga0373931_0011415 Ga0373931_0011415_2035_2784 223
247 3300035691 Ga0373931_0126329 Ga0373931_0126329_147_884 223
248 3300035692 Ga0373935_0010318 Ga0373935_0010318_4171_4920 223
249 3300035695 Ga0373927_0053201 Ga0373927_0053201_1784_2533 223
250 3300035725 Ga0373947_0017843 Ga0373947_0017843_3248_3997 223
251 3300037068 Ga0373925_0098350 Ga0373925_0098350_1142_1891 223
252 3300042005 Ga0439448_0003193 Ga0439448_0003193_136_873 223
253 3300042012 Ga0439455_0003418 Ga0439455_0003418_307_1044 223
254 3300042157 Ga0439458_0057479 Ga0439458_0057479_183_920 223
255 3300042438 Ga0439459_0002068 Ga0439459_0002068_2026_2763 223
256 3300045051 Ga0451576_0026393 Ga0451576_0026393_5234_5971 223
257 3300045051 Ga0451576_0885048 Ga0451576_0885048_114_893 223
258 3300046674 Ga0495588_0071485 Ga0495588_0071485_465_1214 223
259 3300046681 Ga0495647_0004541 Ga0495647_0004541_1075_1824 223
260 3300046683 Ga0495658_0035110 Ga0495658_0035110_490_1239 223
261 3300048905 Ga0496102_0087362 Ga0496102_0087362_1852_2589 223
262 3300048911 Ga0496108_0455065 Ga0496108_0455065_175_912 223
263 3300050507 nmdc:mga05p37_63189_c1 nmdc:mga05p37_63189_c1_1087_1824 223
264 3300050507 nmdc:mga05p37_758780_c1 nmdc:mga05p37_758780_c1_100_795 223
265 3300050515 nmdc:mga0a205_12833_c1 nmdc:mga0a205_12833_c1_1143_1880 223
266 3300053096 Ga0500641_0029359 Ga0500641_0029359_1327_2091 223
267 3300053139 Ga0500568_0009138 Ga0500568_0009138_384_1160 223
268 3300005985 Ga0081539_10058101 Ga0081539_100581012 224
269 3300006871 Ga0075434_100648750 Ga0075434_1006487501 224
270 3300009545 Ga0105237_10000726 Ga0105237_1000072614 224
271 3300025914 Ga0207671_10003297 Ga0207671_100032974 224
272 3300035084 Ga0373928_0004360 Ga0373928_0004360_1035_1784 224
273 3300035088 Ga0373940_0002085 Ga0373940_0002085_428_1177 224
274 3300035112 Ga0373932_0006537 Ga0373932_0006537_1972_2721 224
275 3300035115 Ga0373941_0034044 Ga0373941_0034044_457_1206 224
276 3300035207 Ga0373942_0097509 Ga0373942_0097509_39_788 224
277 3300035691 Ga0373931_0001739 Ga0373931_0001739_2396_3145 224
278 3300037068 Ga0373925_0436447 Ga0373925_0436447_24_719 224
279 3300045051 Ga0451576_0025200 Ga0451576_0025200_218_967 224
280 3300045976 Ga0466967_0141490 Ga0466967_0141490_521_1291 224
281 3300049570 Ga0501033_0211373 Ga0501033_0211373_312_1007 224
282 3300049572 Ga0501036_0135356 Ga0501036_0135356_22_717 224
283 3300049575 Ga0501039_0041205 Ga0501039_0041205_1979_2674 224
284 3300049576 Ga0501040_0007181 Ga0501040_0007181_937_1632 224
285 3300049577 Ga0501041_0003733 Ga0501041_0003733_5817_6512 224
286 3300049578 Ga0501042_0021279 Ga0501042_0021279_2985_3680 224
287 3300049579 Ga0501043_0164148 Ga0501043_0164148_417_1112 224
288 3300049580 Ga0501046_0000249 Ga0501046_0000249_1386_2081 224
289 3300049588 Ga0501072_0031936 Ga0501072_0031936_2212_2907 224
290 3300049590 Ga0501074_0007830 Ga0501074_0007830_1789_2484 224
291 3300049591 Ga0501075_0016908 Ga0501075_0016908_3962_4657 224
292 3300049741 Ga0501079_0006359 Ga0501079_0006359_3691_4386 224
293 3300049742 Ga0501080_0187906 Ga0501080_0187906_261_956 224
294 3300049743 Ga0501081_0003021 Ga0501081_0003021_5979_6674 224
295 3300049744 Ga0501083_0003593 Ga0501083_0003593_4955_5650 224
296 3300050512 nmdc:mga0n895_604931_c1 nmdc:mga0n895_604931_c1_299_1063 224
297 3300054114 Ga0501084_0001324 Ga0501084_0001324_15275_15970 224
298 3300060353 Ga0501082_0001749 Ga0501082_0001749_12576_13271 224
299 3300061734 Ga0530510_0041519 Ga0530510_0041519_1271_1966 224
300 3300005295 Ga0065707_10149703 Ga0065707_101497032 225
301 3300006852 Ga0075433_10028812 Ga0075433_100288126 225
302 3300024225 Ga0224572_1007548 Ga0224572_10075482 225
303 3300026095 Ga0207676_10094151 Ga0207676_100941512 225
304 3300031241 Ga0265325_10040338 Ga0265325_100403382 225
305 3300031249 Ga0265339_10009178 Ga0265339_100091782 225
306 3300039437 Ga0436365_1013679 Ga0436365_1013679_1225_1971 225
307 3300039450 Ga0436363_1305199 Ga0436363_1305199_586_1332 225
308 3300049582 Ga0501048_0308426 Ga0501048_0308426_16_711 225
309 3300049587 Ga0501071_0406244 Ga0501071_0406244_14_709 225
310 3300050513 nmdc:mga0rr50_50826_c1 nmdc:mga0rr50_50826_c1_787_1542 225
311 3300050515 nmdc:mga0a205_229394_c1 nmdc:mga0a205_229394_c1_469_1224 225
312 3300059424 Ga0590075_036856 Ga0590075_036856_249_1013 225
313 3300005336 Ga0070680_100046286 Ga0070680_1000462862 226
314 3300005441 Ga0070700_100001393 Ga0070700_1000013932 226
315 3300005459 Ga0068867_100001553 Ga0068867_10000155316 226
316 3300005543 Ga0070672_100261711 Ga0070672_1002617113 226
317 3300005718 Ga0068866_10229254 Ga0068866_102292541 226
318 3300005719 Ga0068861_100001214 Ga0068861_10000121417 226
319 3300005844 Ga0068862_100001942 Ga0068862_1000019426 226
320 3300006195 Ga0075366_10079455 Ga0075366_100794552 226
321 3300006844 Ga0075428_100237121 Ga0075428_1002371213 226
322 3300006881 Ga0068865_100011455 Ga0068865_1000114554 226
323 3300009148 Ga0105243_10002378 Ga0105243_1000237813 226
324 3300009553 Ga0105249_10049328 Ga0105249_100493283 226
325 3300014326 Ga0157380_10020426 Ga0157380_100204264 226
326 3300021388 Ga0213875_10123793 Ga0213875_101237931 226
327 3300025937 Ga0207669_10035175 Ga0207669_100351753 226
328 3300025938 Ga0207704_10007021 Ga0207704_100070214 226
329 3300025961 Ga0207712_10017624 Ga0207712_100176244 226
330 3300026089 Ga0207648_10000431 Ga0207648_1000043144 226
331 3300026118 Ga0207675_100003408 Ga0207675_10000340815 226
332 3300027364 Ga0209967_1000788 Ga0209967_10007882 226
333 3300027695 Ga0209966_1033118 Ga0209966_10331182 226
334 3300028380 Ga0268265_10001417 Ga0268265_1000141720 226
335 3300035691 Ga0373931_0159877 Ga0373931_0159877_552_1301 226
336 3300035691 Ga0373931_0417780 Ga0373931_0417780_32_781 226
337 3300035695 Ga0373927_0050202 Ga0373927_0050202_1270_2070 226
338 3300036401 Ga0373937_0422382 Ga0373937_0422382_137_886 226
339 3300037068 Ga0373925_0063291 Ga0373925_0063291_675_1475 226
340 3300037853 Ga0436364_0304718 Ga0436364_0304718_552_1397 226
341 3300039438 Ga0436360_0781382 Ga0436360_0781382_1022_1873 226
342 3300046459 Ga0495629_0191393 Ga0495629_0191393_371_1141 226
343 3300049574 Ga0501038_0485133 Ga0501038_0485133_181_930 226
344 3300049575 Ga0501039_0297789 Ga0501039_0297789_69_821 226
345 3300049579 Ga0501043_0329329 Ga0501043_0329329_305_1063 226
346 3300049591 Ga0501075_0179549 Ga0501075_0179549_264_1016 226
347 3300049592 Ga0501076_0089403 Ga0501076_0089403_544_1296 226
348 3300049742 Ga0501080_0707279 Ga0501080_0707279_81_848 226
349 3300050507 nmdc:mga05p37_139644_c1 nmdc:mga05p37_139644_c1_1065_1829 226
350 3300050509 nmdc:mga0qj67_609727_c1 nmdc:mga0qj67_609727_c1_103_852 226
351 3300054114 Ga0501084_0103042 Ga0501084_0103042_1092_1841 226
352 3300003659 JGI25404J52841_10026926 JGI25404J52841_100269261 227
353 3300005327 Ga0070658_10023601 Ga0070658_100236013 227
354 3300005328 Ga0070676_10024000 Ga0070676_100240003 227
355 3300005334 Ga0068869_100017275 Ga0068869_1000172757 227
356 3300005336 Ga0070680_100070828 Ga0070680_1000708284 227
357 3300005338 Ga0068868_100151783 Ga0068868_1001517832 227
358 3300005339 Ga0070660_100039715 Ga0070660_1000397151 227
359 3300005364 Ga0070673_100030249 Ga0070673_1000302493 227
360 3300005436 Ga0070713_100203552 Ga0070713_1002035522 227
361 3300005456 Ga0070678_100599709 Ga0070678_1005997091 227
362 3300005459 Ga0068867_100048100 Ga0068867_1000481002 227
363 3300005530 Ga0070679_100098373 Ga0070679_1000983734 227
364 3300005548 Ga0070665_100002597 Ga0070665_1000025973 227
365 3300005617 Ga0068859_100373848 Ga0068859_1003738482 227
366 3300005983 Ga0081540_1000012 Ga0081540_100001292 227
367 3300006051 Ga0075364_10156586 Ga0075364_101565862 227
368 3300006177 Ga0075362_10037055 Ga0075362_100370554 227
369 3300006178 Ga0075367_10001340 Ga0075367_100013409 227
370 3300006195 Ga0075366_10114681 Ga0075366_101146812 227
371 3300006846 Ga0075430_100515742 Ga0075430_1005157422 227
372 3300006847 Ga0075431_100619742 Ga0075431_1006197422 227
373 3300006880 Ga0075429_100086159 Ga0075429_1000861592 227
374 3300006931 Ga0097620_100373847 Ga0097620_1003738472 227
375 3300009093 Ga0105240_10289274 Ga0105240_102892742 227
376 3300009093 Ga0105240_10296585 Ga0105240_102965852 227
377 3300009098 Ga0105245_10193411 Ga0105245_101934112 227
378 3300009147 Ga0114129_10118530 Ga0114129_101185305 227
379 3300009148 Ga0105243_10030550 Ga0105243_100305506 227
380 3300009176 Ga0105242_10158219 Ga0105242_101582192 227
381 3300009176 Ga0105242_10237931 Ga0105242_102379311 227
382 3300013306 Ga0163162_10252828 Ga0163162_102528281 227
383 3300014325 Ga0163163_10655010 Ga0163163_106550102 227
384 3300014497 Ga0182008_10008440 Ga0182008_100084403 227
385 3300015265 Ga0182005_1010389 Ga0182005_10103892 227
386 3300017792 Ga0163161_10181726 Ga0163161_101817262 227
387 3300025901 Ga0207688_10023296 Ga0207688_100232962 227
388 3300025907 Ga0207645_10007365 Ga0207645_100073653 227
389 3300025909 Ga0207705_10100136 Ga0207705_101001362 227
390 3300025913 Ga0207695_10329866 Ga0207695_103298662 227
391 3300025917 Ga0207660_10093975 Ga0207660_100939753 227
392 3300025919 Ga0207657_10022694 Ga0207657_100226945 227
393 3300025921 Ga0207652_10075011 Ga0207652_100750112 227
394 3300025931 Ga0207644_10140886 Ga0207644_101408863 227
395 3300025935 Ga0207709_10028242 Ga0207709_100282423 227
396 3300025942 Ga0207689_10016285 Ga0207689_100162853 227
397 3300025960 Ga0207651_10056408 Ga0207651_100564082 227
398 3300026023 Ga0207677_10157680 Ga0207677_101576802 227
399 3300026023 Ga0207677_10160363 Ga0207677_101603632 227
400 3300026089 Ga0207648_10003980 Ga0207648_1000398011 227
401 3300026121 Ga0207683_10076639 Ga0207683_100766392 227
402 3300026121 Ga0207683_10710516 Ga0207683_107105161 227
403 3300027543 Ga0209999_1020235 Ga0209999_10202352 227
404 3300027695 Ga0209966_1000629 Ga0209966_10006298 227
405 3300027717 Ga0209998_10027075 Ga0209998_100270752 227
406 3300028379 Ga0268266_10001354 Ga0268266_1000135422 227
407 3300028800 Ga0265338_10001087 Ga0265338_100010875 227
408 3300031235 Ga0265330_10055867 Ga0265330_100558671 227
409 3300031239 Ga0265328_10093473 Ga0265328_100934731 227
410 3300031250 Ga0265331_10023684 Ga0265331_100236842 227
411 3300031344 Ga0265316_10173322 Ga0265316_101733222 227
412 3300031595 Ga0265313_10027399 Ga0265313_100273993 227
413 3300031711 Ga0265314_10028336 Ga0265314_100283362 227
414 3300031711 Ga0265314_10281754 Ga0265314_102817541 227
415 3300031712 Ga0265342_10072640 Ga0265342_100726401 227
416 3300031903 Ga0307407_10146169 Ga0307407_101461692 227
417 3300032005 Ga0307411_10411911 Ga0307411_104119112 227
418 3300032126 Ga0307415_100141034 Ga0307415_1001410342 227
419 3300035242 Ga0373962_0015296 Ga0373962_0015296_485_1234 227
420 3300035242 Ga0373962_0026211 Ga0373962_0026211_771_1466 227
421 3300042009 Ga0439451_023991 Ga0439451_023991_250_1002 227
422 3300042461 Ga0439460_0020002 Ga0439460_0020002_550_1302 227
423 3300046475 Ga0495639_0023702 Ga0495639_0023702_342_1100 227
424 3300046528 Ga0495642_0128320 Ga0495642_0128320_130_888 227
425 3300046535 Ga0495586_0058460 Ga0495586_0058460_628_1386 227
426 3300046674 Ga0495588_0037850 Ga0495588_0037850_1349_2107 227
427 3300046675 Ga0495657_0056795 Ga0495657_0056795_1072_1830 227
428 3300048903 Ga0496100_0004958 Ga0496100_0004958_5456_6214 227
429 3300048904 Ga0496101_0010804 Ga0496101_0010804_5091_5849 227
430 3300048905 Ga0496102_0017750 Ga0496102_0017750_1241_1999 227
431 3300048907 Ga0496104_0003649 Ga0496104_0003649_10727_11485 227
432 3300048908 Ga0496105_0040625 Ga0496105_0040625_595_1353 227
433 3300048909 Ga0496106_0011860 Ga0496106_0011860_2537_3295 227
434 3300048914 Ga0496111_0137323 Ga0496111_0137323_877_1635 227
435 3300048917 Ga0496114_0057007 Ga0496114_0057007_1923_2681 227
436 3300050492 nmdc:mga0yw44_19551_c1 nmdc:mga0yw44_19551_c1_1219_1983 227
437 3300050494 nmdc:mga06z11_20222_c1 nmdc:mga06z11_20222_c1_477_1241 227
438 3300050508 nmdc:mga09592_46464_c1 nmdc:mga09592_46464_c1_1374_2126 227
439 3300050509 nmdc:mga0qj67_15283_c1 nmdc:mga0qj67_15283_c1_917_1681 227
440 3300050509 nmdc:mga0qj67_42201_c1 nmdc:mga0qj67_42201_c1_223_975 227
441 3300050509 nmdc:mga0qj67_47790_c1 nmdc:mga0qj67_47790_c1_1084_1836 227
442 3300050510 nmdc:mga06r32_293794_c1 nmdc:mga06r32_293794_c1_417_1169 227
443 3300050510 nmdc:mga06r32_683780_c1 nmdc:mga06r32_683780_c1_15_767 227
444 3300053096 Ga0500641_0149189 Ga0500641_0149189_174_938 227
445 3300053119 Ga0500595_003852 Ga0500595_003852_3838_4590 227
446 3300005329 Ga0070683_100017788 Ga0070683_1000177883 228
447 3300005331 Ga0070670_100010577 Ga0070670_1000105771 228
448 3300005334 Ga0068869_100002177 Ga0068869_10000217712 228
449 3300005336 Ga0070680_100000256 Ga0070680_10000025630 228
450 3300005337 Ga0070682_100002233 Ga0070682_1000022331 228
451 3300005341 Ga0070691_10003307 Ga0070691_100033077 228
452 3300005344 Ga0070661_100000612 Ga0070661_10000061212 228
453 3300005345 Ga0070692_10000471 Ga0070692_100004714 228
454 3300005347 Ga0070668_100374716 Ga0070668_1003747162 228
455 3300005353 Ga0070669_100041335 Ga0070669_1000413352 228
456 3300005356 Ga0070674_100027282 Ga0070674_1000272823 228
457 3300005364 Ga0070673_100008357 Ga0070673_1000083578 228
458 3300005366 Ga0070659_100002925 Ga0070659_1000029252 228
459 3300005406 Ga0070703_10079852 Ga0070703_100798522 228
460 3300005438 Ga0070701_10005008 Ga0070701_100050082 228
461 3300005440 Ga0070705_100000322 Ga0070705_10000032221 228
462 3300005444 Ga0070694_100002034 Ga0070694_10000203412 228
463 3300005445 Ga0070708_100555762 Ga0070708_1005557621 228
464 3300005455 Ga0070663_100003795 Ga0070663_1000037958 228
465 3300005457 Ga0070662_100002915 Ga0070662_10000291510 228
466 3300005457 Ga0070662_100243229 Ga0070662_1002432291 228
467 3300005458 Ga0070681_10006219 Ga0070681_1000621912 228
468 3300005459 Ga0068867_100002386 Ga0068867_1000023864 228
469 3300005467 Ga0070706_100186638 Ga0070706_1001866383 228
470 3300005471 Ga0070698_100000092 Ga0070698_10000009266 228
471 3300005518 Ga0070699_100013540 Ga0070699_1000135403 228
472 3300005518 Ga0070699_100111801 Ga0070699_1001118012 228
473 3300005530 Ga0070679_100003538 Ga0070679_10000353812 228
474 3300005535 Ga0070684_100513779 Ga0070684_1005137791 228
475 3300005539 Ga0068853_100000249 Ga0068853_10000024916 228
476 3300005545 Ga0070695_100002595 Ga0070695_1000025958 228
477 3300005546 Ga0070696_100000891 Ga0070696_1000008919 228
478 3300005547 Ga0070693_100000137 Ga0070693_10000013732 228
479 3300005549 Ga0070704_100311022 Ga0070704_1003110222 228
480 3300005563 Ga0068855_100001817 Ga0068855_10000181722 228
481 3300005564 Ga0070664_100058537 Ga0070664_1000585372 228
482 3300005577 Ga0068857_100029661 Ga0068857_1000296612 228
483 3300005614 Ga0068856_100004022 Ga0068856_10000402212 228
484 3300005617 Ga0068859_100001622 Ga0068859_10000162222 228
485 3300005618 Ga0068864_100005149 Ga0068864_1000051498 228
486 3300005718 Ga0068866_10056519 Ga0068866_100565193 228
487 3300005840 Ga0068870_10000714 Ga0068870_1000071412 228
488 3300005841 Ga0068863_100089869 Ga0068863_1000898693 228
489 3300005842 Ga0068858_100172145 Ga0068858_1001721452 228
490 3300005844 Ga0068862_100011620 Ga0068862_1000116206 228
491 3300005937 Ga0081455_10000345 Ga0081455_1000034517 228
492 3300005985 Ga0081539_10129531 Ga0081539_101295312 228
493 3300006042 Ga0075368_10070075 Ga0075368_100700752 228
494 3300006186 Ga0075369_10023748 Ga0075369_100237482 228
495 3300006847 Ga0075431_100145991 Ga0075431_1001459913 228
496 3300006852 Ga0075433_10000401 Ga0075433_1000040115 228
497 3300006871 Ga0075434_100014160 Ga0075434_1000141606 228
498 3300006871 Ga0075434_100080791 Ga0075434_1000807912 228
499 3300006881 Ga0068865_100071298 Ga0068865_1000712982 228
500 3300006931 Ga0097620_100001622 Ga0097620_1000016221 228
501 3300007076 Ga0075435_100002030 Ga0075435_1000020304 228
502 3300007076 Ga0075435_100082648 Ga0075435_1000826481 228
503 3300007265 Ga0099794_10029762 Ga0099794_100297622 228
504 3300009094 Ga0111539_10096036 Ga0111539_100960363 228
505 3300009094 Ga0111539_11022217 Ga0111539_110222172 228
506 3300009553 Ga0105249_10408697 Ga0105249_104086971 228
507 3300010375 Ga0105239_10439302 Ga0105239_104393022 228
508 3300013296 Ga0157374_10040219 Ga0157374_100402194 228
509 3300013297 Ga0157378_10093845 Ga0157378_100938452 228
510 3300013308 Ga0157375_10075596 Ga0157375_100755962 228
511 3300014326 Ga0157380_10295564 Ga0157380_102955641 228
512 3300021384 Ga0213876_10054483 Ga0213876_100544832 228
513 3300021388 Ga0213875_10000825 Ga0213875_1000082516 228
514 3300021388 Ga0213875_10021532 Ga0213875_100215323 228
515 3300021441 Ga0213871_10019429 Ga0213871_100194292 228
516 3300025885 Ga0207653_10004318 Ga0207653_100043185 228
517 3300025899 Ga0207642_10020222 Ga0207642_100202222 228
518 3300025901 Ga0207688_10013304 Ga0207688_100133042 228
519 3300025903 Ga0207680_10177726 Ga0207680_101777262 228
520 3300025907 Ga0207645_10001231 Ga0207645_1000123120 228
521 3300025908 Ga0207643_10000036 Ga0207643_1000003616 228
522 3300025910 Ga0207684_10057910 Ga0207684_100579102 228
523 3300025911 Ga0207654_10017766 Ga0207654_100177664 228
524 3300025912 Ga0207707_10001333 Ga0207707_1000133312 228
525 3300025917 Ga0207660_10001071 Ga0207660_1000107118 228
526 3300025918 Ga0207662_10079337 Ga0207662_100793372 228
527 3300025920 Ga0207649_10051738 Ga0207649_100517383 228
528 3300025921 Ga0207652_10002086 Ga0207652_100020868 228
529 3300025923 Ga0207681_10104339 Ga0207681_101043392 228
530 3300025925 Ga0207650_10086755 Ga0207650_100867553 228
531 3300025932 Ga0207690_10000580 Ga0207690_1000058023 228
532 3300025933 Ga0207706_10007512 Ga0207706_100075124 228
533 3300025935 Ga0207709_10271990 Ga0207709_102719901 228
534 3300025937 Ga0207669_10372673 Ga0207669_103726732 228
535 3300025938 Ga0207704_10063938 Ga0207704_100639382 228
536 3300025939 Ga0207665_10095580 Ga0207665_100955802 228
537 3300025940 Ga0207691_10255017 Ga0207691_102550171 228
538 3300025941 Ga0207711_10739052 Ga0207711_107390521 228
539 3300025942 Ga0207689_10000221 Ga0207689_1000022116 228
540 3300025942 Ga0207689_10284416 Ga0207689_102844162 228
541 3300025944 Ga0207661_10021338 Ga0207661_100213383 228
542 3300025945 Ga0207679_10001048 Ga0207679_1000104815 228
543 3300025949 Ga0207667_10000470 Ga0207667_1000047036 228
544 3300026035 Ga0207703_10544239 Ga0207703_105442392 228
545 3300026041 Ga0207639_10195143 Ga0207639_101951432 228
546 3300026067 Ga0207678_10004149 Ga0207678_100041492 228
547 3300026067 Ga0207678_10004263 Ga0207678_100042634 228
548 3300026078 Ga0207702_10001365 Ga0207702_1000136516 228
549 3300026089 Ga0207648_10530785 Ga0207648_105307851 228
550 3300026116 Ga0207674_10001830 Ga0207674_1000183012 228
551 3300026118 Ga0207675_100003028 Ga0207675_1000030282 228
552 3300027907 Ga0207428_10018998 Ga0207428_100189986 228
553 3300027907 Ga0207428_10128446 Ga0207428_101284462 228
554 3300028380 Ga0268265_10008236 Ga0268265_100082363 228
555 3300028381 Ga0268264_10011455 Ga0268264_100114551 228
556 3300028794 Ga0307515_10165858 Ga0307515_101658582 228
557 3300031344 Ga0265316_10065851 Ga0265316_100658513 228
558 3300031911 Ga0307412_10108218 Ga0307412_101082182 228
559 3300034816 Ga0373930_0010936 Ga0373930_0010936_508_1272 228
560 3300035092 Ga0373952_0007454 Ga0373952_0007454_752_1516 228
561 3300035111 Ga0373923_0154820 Ga0373923_0154820_62_817 228
562 3300035115 Ga0373941_0014617 Ga0373941_0014617_53_817 228
563 3300035172 Ga0373955_0233727 Ga0373955_0233727_62_817 228
564 3300035207 Ga0373942_0047256 Ga0373942_0047256_332_1096 228
565 3300035241 Ga0373961_0006309 Ga0373961_0006309_1287_2051 228
566 3300035691 Ga0373931_0161601 Ga0373931_0161601_57_821 228
567 3300035724 Ga0373933_0005686 Ga0373933_0005686_902_1657 228
568 3300036401 Ga0373937_0367677 Ga0373937_0367677_520_1275 228
569 3300037853 Ga0436364_0033237 Ga0436364_0033237_2811_3569 228
570 3300037853 Ga0436364_0475448 Ga0436364_0475448_63_827 228
571 3300039437 Ga0436365_0017438 Ga0436365_0017438_2553_3311 228
572 3300046460 Ga0495638_0094375 Ga0495638_0094375_225_995 228
573 3300046463 Ga0495653_0316711 Ga0495653_0316711_243_998 228
574 3300046500 Ga0495596_0066620 Ga0495596_0066620_467_1237 228
575 3300046506 Ga0495583_0016024 Ga0495583_0016024_1112_1882 228
576 3300046515 Ga0495620_0011112 Ga0495620_0011112_1319_2089 228
577 3300046542 Ga0495597_0094854 Ga0495597_0094854_385_1155 228
578 3300046665 Ga0495661_0104172 Ga0495661_0104172_312_1082 228
579 3300048919 Ga0496116_0024577 Ga0496116_0024577_771_1541 228
580 3300048922 Ga0496119_0054141 Ga0496119_0054141_1426_2196 228
581 3300048924 Ga0496121_0022068 Ga0496121_0022068_2216_2986 228
582 3300048928 Ga0496125_0011331 Ga0496125_0011331_185_955 228
583 3300049571 Ga0501034_0000211 Ga0501034_0000211_70335_71102 228
584 3300049571 Ga0501034_0002398 Ga0501034_0002398_9790_10557 228
585 3300049572 Ga0501036_0000172 Ga0501036_0000172_14078_14845 228
586 3300049573 Ga0501037_0003588 Ga0501037_0003588_6182_6949 228
587 3300049573 Ga0501037_0244558 Ga0501037_0244558_358_1119 228
588 3300049579 Ga0501043_0023537 Ga0501043_0023537_956_1723 228
589 3300049580 Ga0501046_0028558 Ga0501046_0028558_3135_3902 228
590 3300049581 Ga0501047_0000010 Ga0501047_0000010_255864_256631 228
591 3300049581 Ga0501047_0546302 Ga0501047_0546302_170_937 228
592 3300049582 Ga0501048_0014062 Ga0501048_0014062_3574_4341 228
593 3300049586 Ga0501070_0009756 Ga0501070_0009756_1640_2407 228
594 3300049586 Ga0501070_0445668 Ga0501070_0445668_40_801 228
595 3300049587 Ga0501071_0227462 Ga0501071_0227462_432_1196 228
596 3300049589 Ga0501073_0103508 Ga0501073_0103508_1011_1772 228
597 3300049590 Ga0501074_0181684 Ga0501074_0181684_241_1008 228
598 3300049592 Ga0501076_0012855 Ga0501076_0012855_2018_2782 228
599 3300049742 Ga0501080_0001018 Ga0501080_0001018_15838_16605 228
600 3300049742 Ga0501080_0096067 Ga0501080_0096067_186_947 228
601 3300049823 Ga0501044_0004598 Ga0501044_0004598_7334_8101 228
602 3300050510 nmdc:mga06r32_15674_c1 nmdc:mga06r32_15674_c1_6001_6765 228
603 3300050511 nmdc:mga08y16_10783_c1 nmdc:mga08y16_10783_c1_3218_3988 228
604 3300050511 nmdc:mga08y16_155820_c1 nmdc:mga08y16_155820_c1_1224_1988 228
605 3300050512 nmdc:mga0n895_12406_c1 nmdc:mga0n895_12406_c1_5789_6553 228
606 3300050513 nmdc:mga0rr50_1668_c1 nmdc:mga0rr50_1668_c1_3578_4342 228
607 3300050514 nmdc:mga08x19_237_c1 nmdc:mga08x19_237_c1_2399_3154 228
608 3300050515 nmdc:mga0a205_4491_c1 nmdc:mga0a205_4491_c1_279_1043 228
609 3300050516 nmdc:mga0sz30_152358_c1 nmdc:mga0sz30_152358_c1_82_852 228
610 3300053088 Ga0500644_0127129 Ga0500644_0127129_158_928 228
611 3300053089 Ga0500581_018950 Ga0500581_018950_1544_2314 228
612 3300053096 Ga0500641_0001992 Ga0500641_0001992_511_1281 228
613 3300053098 Ga0500650_0000145 Ga0500650_0000145_3759_4529 228
614 3300053104 Ga0500556_0000004 Ga0500556_0000004_265535_266305 228
615 3300053130 Ga0500642_0000074 Ga0500642_0000074_32261_33031 228
616 3300053131 Ga0500652_000065 Ga0500652_000065_18246_19016 228
617 3300053134 Ga0500658_0072711 Ga0500658_0072711_510_1280 228
618 3300053139 Ga0500568_0009152 Ga0500568_0009152_321_1091 228
619 3300053151 Ga0500604_0016565 Ga0500604_0016565_50_820 228
620 3300053153 Ga0500616_0000014 Ga0500616_0000014_292698_293468 228
621 3300053156 Ga0500622_0006481 Ga0500622_0006481_1663_2433 228
622 3300053160 Ga0500633_0001663 Ga0500633_0001663_563_1333 228
623 3300060353 Ga0501082_0261755 Ga0501082_0261755_659_1426 228
624 3300005336 Ga0070680_100001789 Ga0070680_1000017895 229
625 3300005340 Ga0070689_100308577 Ga0070689_1003085772 229
626 3300005434 Ga0070709_10070049 Ga0070709_100700492 229
627 3300005458 Ga0070681_10000533 Ga0070681_1000053311 229
628 3300005530 Ga0070679_100001589 Ga0070679_1000015891 229
629 3300005563 Ga0068855_100031588 Ga0068855_1000315881 229
630 3300005719 Ga0068861_100069051 Ga0068861_1000690512 229
631 3300005841 Ga0068863_100128871 Ga0068863_1001288712 229
632 3300006028 Ga0070717_10315138 Ga0070717_103151382 229
633 3300006038 Ga0075365_10084598 Ga0075365_100845981 229
634 3300006177 Ga0075362_10110102 Ga0075362_101101021 229
635 3300006871 Ga0075434_100448331 Ga0075434_1004483312 229
636 3300007788 Ga0099795_10075030 Ga0099795_100750302 229
637 3300009093 Ga0105240_10007951 Ga0105240_1000795111 229
638 3300009147 Ga0114129_10296365 Ga0114129_102963652 229
639 3300010375 Ga0105239_10477491 Ga0105239_104774912 229
640 3300013308 Ga0157375_10069953 Ga0157375_100699532 229
641 3300021441 Ga0213871_10020792 Ga0213871_100207922 229
642 3300025905 Ga0207685_10042090 Ga0207685_100420902 229
643 3300025906 Ga0207699_10056548 Ga0207699_100565482 229
644 3300025912 Ga0207707_10022145 Ga0207707_100221458 229
645 3300025917 Ga0207660_10056512 Ga0207660_100565121 229
646 3300025921 Ga0207652_10005743 Ga0207652_100057435 229
647 3300025949 Ga0207667_10033267 Ga0207667_100332675 229
648 3300025972 Ga0207668_10577019 Ga0207668_105770191 229
649 3300026088 Ga0207641_10225130 Ga0207641_102251302 229
650 3300026118 Ga0207675_100110510 Ga0207675_1001105102 229
651 3300031247 Ga0265340_10082256 Ga0265340_100822562 229
652 3300035115 Ga0373941_0003696 Ga0373941_0003696_2433_3200 229
653 3300039438 Ga0436360_0023372 Ga0436360_0023372_10248_11012 229
654 3300048903 Ga0496100_0492526 Ga0496100_0492526_81_845 229
655 3300048913 Ga0496110_0028940 Ga0496110_0028940_940_1704 229
656 3300048914 Ga0496111_0075975 Ga0496111_0075975_1416_2180 229
657 3300048916 Ga0496113_0092657 Ga0496113_0092657_1514_2278 229
658 3300049569 Ga0501032_0120235 Ga0501032_0120235_281_1048 229
659 3300049570 Ga0501033_0020528 Ga0501033_0020528_3582_4349 229
660 3300049571 Ga0501034_0071326 Ga0501034_0071326_1679_2446 229
661 3300049572 Ga0501036_0068822 Ga0501036_0068822_277_1044 229
662 3300049573 Ga0501037_0010884 Ga0501037_0010884_1513_2280 229
663 3300049579 Ga0501043_0013340 Ga0501043_0013340_3743_4510 229
664 3300049580 Ga0501046_0101883 Ga0501046_0101883_1386_2144 229
665 3300049581 Ga0501047_0013674 Ga0501047_0013674_3056_3823 229
666 3300049587 Ga0501071_0096340 Ga0501071_0096340_382_1140 229
667 3300049587 Ga0501071_0119031 Ga0501071_0119031_918_1685 229
668 3300049588 Ga0501072_0023506 Ga0501072_0023506_183_941 229
669 3300049589 Ga0501073_0006056 Ga0501073_0006056_4598_5365 229
670 3300049590 Ga0501074_0042094 Ga0501074_0042094_215_973 229
671 3300049591 Ga0501075_0007356 Ga0501075_0007356_4240_4998 229
672 3300049592 Ga0501076_0082346 Ga0501076_0082346_1429_2187 229
673 3300049741 Ga0501079_0026705 Ga0501079_0026705_79_846 229
674 3300049741 Ga0501079_0026910 Ga0501079_0026910_2884_3642 229
675 3300049741 Ga0501079_0505862 Ga0501079_0505862_86_844 229
676 3300049743 Ga0501081_0015582 Ga0501081_0015582_4139_4897 229
677 3300049743 Ga0501081_0634673 Ga0501081_0634673_29_787 229
678 3300050512 nmdc:mga0n895_60524_c1 nmdc:mga0n895_60524_c1_589_1353 229
679 3300050515 nmdc:mga0a205_139410_c1 nmdc:mga0a205_139410_c1_713_1477 229
680 3300054114 Ga0501084_0078752 Ga0501084_0078752_447_1205 229
681 3300060353 Ga0501082_0009462 Ga0501082_0009462_5520_6278 229
682 3300005435 Ga0070714_100265508 Ga0070714_1002655081 230
683 3300005530 Ga0070679_100766575 Ga0070679_1007665751 230
684 3300006871 Ga0075434_100055791 Ga0075434_1000557912 230
685 3300010159 Ga0099796_10061992 Ga0099796_100619921 230
686 3300014326 Ga0157380_10074287 Ga0157380_100742873 230
687 3300028800 Ga0265338_10073524 Ga0265338_100735243 230
688 3300031241 Ga0265325_10234771 Ga0265325_102347711 230
689 3300031250 Ga0265331_10102166 Ga0265331_101021662 230
690 3300031712 Ga0265342_10294420 Ga0265342_102944201 230
691 3300034819 Ga0373958_0068708 Ga0373958_0068708_14_772 230
692 3300036401 Ga0373937_0628076 Ga0373937_0628076_209_970 230
693 3300039447 Ga0436361_0051074 Ga0436361_0051074_391_1155 230
694 3300044694 Ga0466963_0043041 Ga0466963_0043041_371_1132 230
695 3300044842 Ga0466957_0097914 Ga0466957_0097914_1037_1798 230
696 3300045976 Ga0466967_0051569 Ga0466967_0051569_1455_2216 230
697 3300049584 Ga0501068_0008197 Ga0501068_0008197_3091_3858 230
698 3300049744 Ga0501083_0062480 Ga0501083_0062480_255_1022 230
699 3300049822 Ga0501035_0040338 Ga0501035_0040338_1502_2269 230
700 3300050512 nmdc:mga0n895_426245_c1 nmdc:mga0n895_426245_c1_107_865 230
701 3300061719 Ga0466962_0164274 Ga0466962_0164274_131_892 230
702 iso_pu_bacteria 2883354860 2883359825 230
703 iso_pu_bacteria 2919450847 2919451029 230
704 iso_pu_bacteria 8001845381 8001848856 230
705 3300005329 Ga0070683_100881702 Ga0070683_1008817021 231
706 3300005341 Ga0070691_10240066 Ga0070691_102400661 231
707 3300005344 Ga0070661_100079391 Ga0070661_1000793912 231
708 3300005353 Ga0070669_100036743 Ga0070669_1000367432 231
709 3300005355 Ga0070671_100010297 Ga0070671_1000102979 231
710 3300005367 Ga0070667_100773618 Ga0070667_1007736181 231
711 3300005435 Ga0070714_100121822 Ga0070714_1001218221 231
712 3300005437 Ga0070710_10057606 Ga0070710_100576062 231
713 3300005439 Ga0070711_100185582 Ga0070711_1001855821 231
714 3300005445 Ga0070708_100096119 Ga0070708_1000961193 231
715 3300005467 Ga0070706_100082148 Ga0070706_1000821482 231
716 3300005518 Ga0070699_100256247 Ga0070699_1002562472 231
717 3300005543 Ga0070672_100224306 Ga0070672_1002243061 231
718 3300005545 Ga0070695_100102504 Ga0070695_1001025042 231
719 3300005547 Ga0070693_100007957 Ga0070693_1000079576 231
720 3300005842 Ga0068858_100207956 Ga0068858_1002079563 231
721 3300005843 Ga0068860_100096734 Ga0068860_1000967343 231
722 3300005981 Ga0081538_10004641 Ga0081538_100046419 231
723 3300006038 Ga0075365_10023487 Ga0075365_100234873 231
724 3300006177 Ga0075362_10122894 Ga0075362_101228942 231
725 3300006178 Ga0075367_10125657 Ga0075367_101256572 231
726 3300006186 Ga0075369_10011173 Ga0075369_100111733 231
727 3300006195 Ga0075366_10044655 Ga0075366_100446552 231
728 3300006195 Ga0075366_10056029 Ga0075366_100560292 231
729 3300006237 Ga0097621_100044812 Ga0097621_1000448122 231
730 3300006353 Ga0075370_10046561 Ga0075370_100465612 231
731 3300006358 Ga0068871_100016534 Ga0068871_1000165342 231
732 3300006844 Ga0075428_100013055 Ga0075428_1000130557 231
733 3300006844 Ga0075428_100397290 Ga0075428_1003972903 231
734 3300006846 Ga0075430_100042341 Ga0075430_1000423412 231
735 3300006846 Ga0075430_100210051 Ga0075430_1002100512 231
736 3300006852 Ga0075433_10020333 Ga0075433_100203336 231
737 3300006871 Ga0075434_100152268 Ga0075434_1001522683 231
738 3300006871 Ga0075434_100190314 Ga0075434_1001903142 231
739 3300006880 Ga0075429_100060798 Ga0075429_1000607984 231
740 3300009093 Ga0105240_10027170 Ga0105240_100271703 231
741 3300009094 Ga0111539_10000939 Ga0111539_1000093930 231
742 3300009098 Ga0105245_10030099 Ga0105245_100300993 231
743 3300009147 Ga0114129_10012278 Ga0114129_100122788 231
744 3300009147 Ga0114129_10127673 Ga0114129_101276733 231
745 3300009147 Ga0114129_10605814 Ga0114129_106058142 231
746 3300009147 Ga0114129_10645701 Ga0114129_106457012 231
747 3300009148 Ga0105243_10752183 Ga0105243_107521831 231
748 3300009176 Ga0105242_10011684 Ga0105242_100116844 231
749 3300009551 Ga0105238_10086178 Ga0105238_100861782 231
750 3300009553 Ga0105249_10158542 Ga0105249_101585423 231
751 3300013104 Ga0157370_10020382 Ga0157370_100203825 231
752 3300013306 Ga0163162_10124289 Ga0163162_101242893 231
753 3300014968 Ga0157379_10021876 Ga0157379_100218762 231
754 3300020082 Ga0206353_10696245 Ga0206353_106962452 231
755 3300021377 Ga0213874_10048726 Ga0213874_100487262 231
756 3300021384 Ga0213876_10075305 Ga0213876_100753051 231
757 3300021384 Ga0213876_10130598 Ga0213876_101305982 231
758 3300025321 Ga0207656_10114846 Ga0207656_101148462 231
759 3300025898 Ga0207692_10008108 Ga0207692_100081083 231
760 3300025898 Ga0207692_10049633 Ga0207692_100496332 231
761 3300025906 Ga0207699_10079929 Ga0207699_100799292 231
762 3300025907 Ga0207645_10072227 Ga0207645_100722272 231
763 3300025909 Ga0207705_10055696 Ga0207705_100556962 231
764 3300025912 Ga0207707_10016894 Ga0207707_100168942 231
765 3300025912 Ga0207707_10117452 Ga0207707_101174523 231
766 3300025915 Ga0207693_10138535 Ga0207693_101385353 231
767 3300025916 Ga0207663_10037807 Ga0207663_100378072 231
768 3300025920 Ga0207649_10031771 Ga0207649_100317713 231
769 3300025923 Ga0207681_10041283 Ga0207681_100412833 231
770 3300025924 Ga0207694_10358801 Ga0207694_103588012 231
771 3300025929 Ga0207664_10071023 Ga0207664_100710234 231
772 3300025932 Ga0207690_10018108 Ga0207690_100181086 231
773 3300025934 Ga0207686_10012278 Ga0207686_100122782 231
774 3300025939 Ga0207665_10023537 Ga0207665_100235374 231
775 3300025942 Ga0207689_10158614 Ga0207689_101586143 231
776 3300025944 Ga0207661_10760263 Ga0207661_107602631 231
777 3300026078 Ga0207702_10304378 Ga0207702_103043782 231
778 3300027907 Ga0207428_10294028 Ga0207428_102940282 231
779 3300028381 Ga0268264_10019070 Ga0268264_100190703 231
780 3300028381 Ga0268264_11002755 Ga0268264_110027551 231
781 3300028794 Ga0307515_10120366 Ga0307515_101203662 231
782 3300031456 Ga0307513_10074102 Ga0307513_100741023 231
783 3300031548 Ga0307408_100607829 Ga0307408_1006078291 231
784 3300031731 Ga0307405_10003388 Ga0307405_100033885 231
785 3300031901 Ga0307406_10011623 Ga0307406_100116233 231
786 3300031911 Ga0307412_10052192 Ga0307412_100521921 231
787 3300034819 Ga0373958_0017718 Ga0373958_0017718_32_796 231
788 3300035083 Ga0373926_0082549 Ga0373926_0082549_106_882 231
789 3300035089 Ga0373944_0039613 Ga0373944_0039613_94_870 231
790 3300035119 Ga0373956_0007441 Ga0373956_0007441_350_1114 231
791 3300035172 Ga0373955_0013176 Ga0373955_0013176_637_1401 231
792 3300035692 Ga0373935_0002957 Ga0373935_0002957_2473_3249 231
793 3300035695 Ga0373927_0001543 Ga0373927_0001543_8926_9696 231
794 3300035725 Ga0373947_0026688 Ga0373947_0026688_438_1214 231
795 3300036401 Ga0373937_0006609 Ga0373937_0006609_1638_2402 231
796 3300037068 Ga0373925_0021920 Ga0373925_0021920_1217_1993 231
797 3300037068 Ga0373925_0086777 Ga0373925_0086777_826_1596 231
798 3300037853 Ga0436364_0056330 Ga0436364_0056330_114_881 231
799 3300037853 Ga0436364_0110942 Ga0436364_0110942_337_1104 231
800 3300037853 Ga0436364_1204625 Ga0436364_1204625_672_1439 231
801 3300039437 Ga0436365_0132947 Ga0436365_0132947_34_801 231
802 3300039437 Ga0436365_0232658 Ga0436365_0232658_736_1497 231
803 3300039437 Ga0436365_0366029 Ga0436365_0366029_286_1053 231
804 3300039437 Ga0436365_0367776 Ga0436365_0367776_1620_2387 231
805 3300039437 Ga0436365_0854068 Ga0436365_0854068_2570_3331 231
806 3300039437 Ga0436365_1085262 Ga0436365_1085262_10867_11634 231
807 3300039437 Ga0436365_1119339 Ga0436365_1119339_44_826 231
808 3300039437 Ga0436365_1453878 Ga0436365_1453878_153_920 231
809 3300039450 Ga0436363_1135077 Ga0436363_1135077_562_1323 231
810 3300041411 Ga0439466_0002570 Ga0439466_0002570_3856_4614 231
811 3300041413 Ga0439465_0000313 Ga0439465_0000313_7444_8202 231
812 3300041997 Ga0439431_0002613 Ga0439431_0002613_521_1279 231
813 3300041999 Ga0439433_0000146 Ga0439433_0000146_2748_3506 231
814 3300042004 Ga0439445_0001088 Ga0439445_0001088_1524_2282 231
815 3300042006 Ga0439432_001514 Ga0439432_001514_7126_7884 231
816 3300042007 Ga0439449_0003854 Ga0439449_0003854_4163_4921 231
817 3300042010 Ga0439452_001104 Ga0439452_001104_9225_9983 231
818 3300042156 Ga0439446_0006709 Ga0439446_0006709_1021_1779 231
819 3300046459 Ga0495629_0000222 Ga0495629_0000222_41453_42229 231
820 3300046472 Ga0495580_0191272 Ga0495580_0191272_126_902 231
821 3300046473 Ga0495582_0009126 Ga0495582_0009126_4387_5163 231
822 3300046476 Ga0495662_0195321 Ga0495662_0195321_135_899 231
823 3300046477 Ga0495664_0026349 Ga0495664_0026349_911_1675 231
824 3300046499 Ga0495594_0011694 Ga0495594_0011694_1849_2613 231
825 3300046499 Ga0495594_0036706 Ga0495594_0036706_1034_1810 231
826 3300046530 Ga0495654_0037248 Ga0495654_0037248_1590_2360 231
827 3300046531 Ga0495665_0185269 Ga0495665_0185269_32_808 231
828 3300046663 Ga0495635_0031149 Ga0495635_0031149_1744_2508 231
829 3300046675 Ga0495657_0031006 Ga0495657_0031006_1835_2599 231
830 3300046681 Ga0495647_0002929 Ga0495647_0002929_2302_3078 231
831 3300046683 Ga0495658_0001062 Ga0495658_0001062_8242_9018 231
832 3300046689 Ga0495613_0007724 Ga0495613_0007724_2769_3545 231
833 3300047315 Ga0495581_0033186 Ga0495581_0033186_1784_2560 231
834 3300047317 Ga0495604_0111697 Ga0495604_0111697_822_1586 231
835 3300047319 Ga0495674_0127408 Ga0495674_0127408_1016_1780 231
836 3300047321 Ga0495676_0146869 Ga0495676_0146869_233_1009 231
837 3300047322 Ga0495680_0017400 Ga0495680_0017400_120_884 231
838 3300047673 Ga0495593_0004258 Ga0495593_0004258_6743_7519 231
839 3300048904 Ga0496101_0025281 Ga0496101_0025281_2147_2911 231
840 3300048905 Ga0496102_0344786 Ga0496102_0344786_534_1298 231
841 3300048906 Ga0496103_0009241 Ga0496103_0009241_715_1479 231
842 3300048907 Ga0496104_0020599 Ga0496104_0020599_3151_3915 231
843 3300048908 Ga0496105_0055070 Ga0496105_0055070_1972_2736 231
844 3300048909 Ga0496106_0015661 Ga0496106_0015661_2877_3641 231
845 3300048910 Ga0496107_0032503 Ga0496107_0032503_849_1613 231
846 3300048918 Ga0496115_0143139 Ga0496115_0143139_848_1612 231
847 3300049574 Ga0501038_0009989 Ga0501038_0009989_2294_3061 231
848 3300049575 Ga0501039_0183575 Ga0501039_0183575_728_1495 231
849 3300049580 Ga0501046_0007428 Ga0501046_0007428_1056_1823 231
850 3300049581 Ga0501047_0023276 Ga0501047_0023276_4063_4830 231
851 3300049586 Ga0501070_0014041 Ga0501070_0014041_5620_6387 231
852 3300049587 Ga0501071_0292800 Ga0501071_0292800_45_809 231
853 3300049589 Ga0501073_0074862 Ga0501073_0074862_568_1332 231
854 3300049589 Ga0501073_0101490 Ga0501073_0101490_730_1497 231
855 3300049590 Ga0501074_0460471 Ga0501074_0460471_106_864 231
856 3300049591 Ga0501075_0127129 Ga0501075_0127129_1148_1912 231
857 3300049591 Ga0501075_0450616 Ga0501075_0450616_33_800 231
858 3300049592 Ga0501076_0074597 Ga0501076_0074597_1249_2013 231
859 3300049592 Ga0501076_0479139 Ga0501076_0479139_58_822 231
860 3300049592 Ga0501076_0635123 Ga0501076_0635123_40_798 231
861 3300049741 Ga0501079_0101862 Ga0501079_0101862_220_978 231
862 3300049742 Ga0501080_0018017 Ga0501080_0018017_5632_6399 231
863 3300049743 Ga0501081_0167622 Ga0501081_0167622_701_1465 231
864 3300049743 Ga0501081_0429209 Ga0501081_0429209_83_841 231
865 3300049824 Ga0501045_0286192 Ga0501045_0286192_408_1166 231
866 3300049824 Ga0501045_0341925 Ga0501045_0341925_258_1022 231
867 3300050490 nmdc:mga03n38_130793_c1 nmdc:mga03n38_130793_c1_63_821 231
868 3300050493 nmdc:mga0k408_82411_c1 nmdc:mga0k408_82411_c1_328_1086 231
869 3300050507 nmdc:mga05p37_208769_c1 nmdc:mga05p37_208769_c1_293_1057 231
870 3300050507 nmdc:mga05p37_20991_c1 nmdc:mga05p37_20991_c1_3208_3966 231
871 3300050507 nmdc:mga05p37_620132_c1 nmdc:mga05p37_620132_c1_124_891 231
872 3300050508 nmdc:mga09592_97419_c1 nmdc:mga09592_97419_c1_305_1063 231
873 3300050509 nmdc:mga0qj67_333837_c1 nmdc:mga0qj67_333837_c1_320_1084 231
874 3300050510 nmdc:mga06r32_735859_c1 nmdc:mga06r32_735859_c1_56_820 231
875 3300050511 nmdc:mga08y16_45264_c1 nmdc:mga08y16_45264_c1_3830_4588 231
876 3300050515 nmdc:mga0a205_23303_c1 nmdc:mga0a205_23303_c1_1123_1881 231
877 3300053077 Ga0495601_0000770 Ga0495601_0000770_14694_15458 231
878 3300053084 Ga0495595_0002566 Ga0495595_0002566_6216_6980 231
879 3300053085 Ga0495619_0001318 Ga0495619_0001318_13476_14252 231
880 3300053085 Ga0495619_0125039 Ga0495619_0125039_266_1030 231
881 3300053116 Ga0500592_001234 Ga0500592_001234_103_873 231
882 3300053177 Ga0500636_0002098 Ga0500636_0002098_7549_8316 231
883 3300054114 Ga0501084_0071398 Ga0501084_0071398_156_923 231
884 3300060353 Ga0501082_0230860 Ga0501082_0230860_766_1530 231
885 3300061734 Ga0530510_0126458 Ga0530510_0126458_1051_1815 231
886 iso_pu_bacteria 2524023210 2524464100 231
887 3300021384 Ga0213876_10091069 Ga0213876_100910692 232
888 3300039437 Ga0436365_0516288 Ga0436365_0516288_643_1410 232
889 3300049576 Ga0501040_0261555 Ga0501040_0261555_86_856 232
890 3300049578 Ga0501042_0288295 Ga0501042_0288295_59_829 232
891 3300005563 Ga0068855_100023786 Ga0068855_1000237863 235
892 3300009093 Ga0105240_10120202 Ga0105240_101202022 235
893 3300010375 Ga0105239_10000283 Ga0105239_1000028344 235
894 3300025949 Ga0207667_10020540 Ga0207667_100205408 235
895 3300013296 Ga0157374_10000013 Ga0157374_10000013112 236
896 3300049570 Ga0501033_0022299 Ga0501033_0022299_2719_3501 236
897 3300049573 Ga0501037_0012297 Ga0501037_0012297_3405_4187 236
898 3300049579 Ga0501043_0010430 Ga0501043_0010430_6435_7217 236
899 3300049581 Ga0501047_0014463 Ga0501047_0014463_6220_7002 236
900 3300049822 Ga0501035_0079383 Ga0501035_0079383_247_1029 236
901 3300049823 Ga0501044_0007849 Ga0501044_0007849_611_1393 236
902 3300003320 rootH2_10000018 rootH2_1000001816 237
903 3300005331 Ga0070670_100110067 Ga0070670_1001100672 237
904 3300005335 Ga0070666_10000048 Ga0070666_1000004873 237
905 3300005338 Ga0068868_100006649 Ga0068868_1000066495 237
906 3300005353 Ga0070669_100093679 Ga0070669_1000936793 237
907 3300005365 Ga0070688_100059943 Ga0070688_1000599432 237
908 3300005367 Ga0070667_100071591 Ga0070667_1000715912 237
909 3300005367 Ga0070667_100101598 Ga0070667_1001015982 237
910 3300005539 Ga0068853_100001463 Ga0068853_1000014638 237
911 3300005539 Ga0068853_100066925 Ga0068853_1000669253 237
912 3300005564 Ga0070664_100869059 Ga0070664_1008690591 237
913 3300005577 Ga0068857_100008990 Ga0068857_1000089908 237
914 3300005578 Ga0068854_100031803 Ga0068854_1000318032 237
915 3300005578 Ga0068854_100166592 Ga0068854_1001665922 237
916 3300005614 Ga0068856_100127906 Ga0068856_1001279062 237
917 3300005616 Ga0068852_100001866 Ga0068852_1000018663 237
918 3300005617 Ga0068859_100000051 Ga0068859_10000005194 237
919 3300005617 Ga0068859_100241747 Ga0068859_1002417472 237
920 3300005617 Ga0068859_100251940 Ga0068859_1002519402 237
921 3300005618 Ga0068864_100045246 Ga0068864_1000452462 237
922 3300005618 Ga0068864_100183460 Ga0068864_1001834602 237
923 3300005834 Ga0068851_10075949 Ga0068851_100759492 237
924 3300005841 Ga0068863_100018653 Ga0068863_1000186534 237
925 3300005842 Ga0068858_100097323 Ga0068858_1000973232 237
926 3300005843 Ga0068860_100002900 Ga0068860_1000029003 237
927 3300005843 Ga0068860_100014489 Ga0068860_1000144893 237
928 3300005843 Ga0068860_100033779 Ga0068860_1000337792 237
929 3300005844 Ga0068862_100006112 Ga0068862_1000061129 237
930 3300006178 Ga0075367_10116476 Ga0075367_101164762 237
931 3300006931 Ga0097620_100000051 Ga0097620_10000005194 237
932 3300006931 Ga0097620_100241732 Ga0097620_1002417322 237
933 3300006931 Ga0097620_100251942 Ga0097620_1002519422 237
934 3300009093 Ga0105240_10000599 Ga0105240_100005996 237
935 3300009093 Ga0105240_10000714 Ga0105240_1000071433 237
936 3300009093 Ga0105240_10000986 Ga0105240_1000098646 237
937 3300009093 Ga0105240_10030886 Ga0105240_100308862 237
938 3300009093 Ga0105240_10113661 Ga0105240_101136612 237
939 3300009094 Ga0111539_10083813 Ga0111539_100838133 237
940 3300009098 Ga0105245_10398026 Ga0105245_103980262 237
941 3300009101 Ga0105247_10009082 Ga0105247_100090822 237
942 3300009174 Ga0105241_10003149 Ga0105241_100031493 237
943 3300009174 Ga0105241_10030164 Ga0105241_100301642 237
944 3300009174 Ga0105241_10069466 Ga0105241_100694662 237
945 3300009545 Ga0105237_10035194 Ga0105237_100351943 237
946 3300009545 Ga0105237_10057984 Ga0105237_100579842 237
947 3300009551 Ga0105238_10012878 Ga0105238_100128786 237
948 3300009553 Ga0105249_10030530 Ga0105249_100305302 237
949 3300010375 Ga0105239_10000249 Ga0105239_1000024924 237
950 3300010375 Ga0105239_10023475 Ga0105239_100234756 237
951 3300010375 Ga0105239_10092796 Ga0105239_100927963 237
952 3300013104 Ga0157370_10002349 Ga0157370_1000234916 237
953 3300013105 Ga0157369_10020406 Ga0157369_100204062 237
954 3300013297 Ga0157378_10004814 Ga0157378_100048144 237
955 3300013297 Ga0157378_10009209 Ga0157378_100092097 237
956 3300013306 Ga0163162_10001536 Ga0163162_100015362 237
957 3300013307 Ga0157372_10003789 Ga0157372_100037896 237
958 3300013307 Ga0157372_10006751 Ga0157372_1000675113 237
959 3300013307 Ga0157372_10040392 Ga0157372_100403923 237
960 3300013307 Ga0157372_10046289 Ga0157372_100462892 237
961 3300013307 Ga0157372_10439739 Ga0157372_104397392 237
962 3300014325 Ga0163163_10141196 Ga0163163_101411962 237
963 3300014968 Ga0157379_10036832 Ga0157379_100368322 237
964 3300014969 Ga0157376_10043193 Ga0157376_100431933 237
965 3300015265 Ga0182005_1041811 Ga0182005_10418112 237
966 3300025321 Ga0207656_10055788 Ga0207656_100557882 237
967 3300025900 Ga0207710_10041252 Ga0207710_100412522 237
968 3300025903 Ga0207680_10001111 Ga0207680_100011117 237
969 3300025904 Ga0207647_10011594 Ga0207647_100115945 237
970 3300025911 Ga0207654_10000957 Ga0207654_100009573 237
971 3300025911 Ga0207654_10238246 Ga0207654_102382462 237
972 3300025913 Ga0207695_10000447 Ga0207695_1000044740 237
973 3300025913 Ga0207695_10000981 Ga0207695_1000098111 237
974 3300025913 Ga0207695_10001513 Ga0207695_100015138 237
975 3300025913 Ga0207695_10070708 Ga0207695_100707083 237
976 3300025913 Ga0207695_10076603 Ga0207695_100766032 237
977 3300025914 Ga0207671_10003862 Ga0207671_100038622 237
978 3300025914 Ga0207671_10011590 Ga0207671_100115905 237
979 3300025914 Ga0207671_10024218 Ga0207671_100242183 237
980 3300025924 Ga0207694_10013060 Ga0207694_100130604 237
981 3300025924 Ga0207694_10180929 Ga0207694_101809292 237
982 3300025925 Ga0207650_10022263 Ga0207650_100222633 237
983 3300025931 Ga0207644_10106061 Ga0207644_101060612 237
984 3300025942 Ga0207689_10001629 Ga0207689_1000162911 237
985 3300025949 Ga0207667_10054740 Ga0207667_100547403 237
986 3300025960 Ga0207651_10563008 Ga0207651_105630082 237
987 3300025961 Ga0207712_10356374 Ga0207712_103563742 237
988 3300025981 Ga0207640_10028508 Ga0207640_100285082 237
989 3300025986 Ga0207658_10135792 Ga0207658_101357921 237
990 3300026023 Ga0207677_10010758 Ga0207677_100107586 237
991 3300026035 Ga0207703_10055904 Ga0207703_100559042 237
992 3300026041 Ga0207639_10002258 Ga0207639_100022583 237
993 3300026041 Ga0207639_10037344 Ga0207639_100373442 237
994 3300026041 Ga0207639_10626435 Ga0207639_106264352 237
995 3300026078 Ga0207702_10132840 Ga0207702_101328402 237
996 3300026088 Ga0207641_10000917 Ga0207641_1000091712 237
997 3300026089 Ga0207648_10134921 Ga0207648_101349212 237
998 3300026089 Ga0207648_10452331 Ga0207648_104523312 237
999 3300026095 Ga0207676_10211309 Ga0207676_102113092 237
1000 3300026116 Ga0207674_10003552 Ga0207674_100035528 237
1001 3300026142 Ga0207698_10004374 Ga0207698_100043746 237
1002 3300026142 Ga0207698_10069224 Ga0207698_100692242 237
1003 3300028380 Ga0268265_10027105 Ga0268265_100271054 237
1004 3300028381 Ga0268264_10001724 Ga0268264_100017249 237
1005 3300028381 Ga0268264_10007023 Ga0268264_1000702310 237
1006 3300028381 Ga0268264_10079100 Ga0268264_100791002 237
1007 3300028794 Ga0307515_10000780 Ga0307515_1000078040 237
1008 3300030731 Ga0316177_1218224 Ga0316177_12182247 237
1009 3300030732 Ga0316176_1009119 Ga0316176_100911918 237
1010 3300031548 Ga0307408_100000680 Ga0307408_10000068010 237
1011 3300031548 Ga0307408_100000772 Ga0307408_10000077219 237
1012 3300032002 Ga0307416_100560253 Ga0307416_1005602532 237
1013 3300032004 Ga0307414_10000016 Ga0307414_1000001610 237
1014 3300044693 Ga0466961_0189829 Ga0466961_0189829_89_859 237
1015 3300047472 Ga0495686_0001554 Ga0495686_0001554_23206_23982 237
1016 3300050511 nmdc:mga08y16_79356_c1 nmdc:mga08y16_79356_c1_572_1345 237
1017 iso_pu_bacteria 2911138879 2911140774 237
1018 iso_pu_bacteria 2919692658 2919696634 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

232

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

280

0.96

PF08659

KR

KR domain

43

211

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

45

214

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9589 30 234
5ovk-assembly1.cif.gz_C crystal structure maba bound to nadph from m. smegmatis 0.9556 47 237
1uzn-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9517 49 235
8jfa-assembly2.cif.gz_F-2 crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9499 12 234
8jfa-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9497 12 234
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 69 234 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 13 234 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 79 178 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 12 235 3.40.50.720
2pnfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9279 14 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3PBB4-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9625 9 237 GO:0016616
AF-A0A2D5MQM0-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9551 42 237 GO:0016616
AF-A0A847N440-F1-model_v4 SDR family oxidoreductase 0.9539 55 237 GO:0016491
AF-A0A351Z7X1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9532 50 237 GO:0016616
AF-A0A4Q7FB38-F1-model_v4 3-oxoacyl-ACP reductase 0.953 30 237 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map