F488211

General Info

Members Datasets Scaffolds Average Seq Length
1014 433 976 456

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100015454|Ga0070705_1000154542
Length 521
Sequence MIEARFYARPIRLPVRKLAQSGPRLNKDSAFCPIHRQKSGLLIETAVLETRSRAGLGSGVIGEVHVIGGGLAGSEATWQLAQAGVPAALHEMRPLRQTEAHKTGSFAELVCSNSFRSDEWETNAVGLLHEEMRRAGSLIMAAADGHKLPAGGALAVDRDGFAAAVTEKLEAHPLIEIVRGEIDGLPPAESDSVIVATGPLTSPSLAAAIQALTGEAELAFFDAIAPIVYRDSIDTGVCWFQSRYDKAGPGGGGADYINCPLDKAQYDAFLAALLAAEKAAFKEFEAATPYFEGCLPIEVMAERGSDTLRYGPMKPVGLSNPYKAGTRPYAVVQLRQDNSLGTLWNMVGFQTKLKHGEQVRVFRMIPGLEQAEFARLGGLHRNTFLNSPKLLDATLCLKADPRLRFAGQITGVEGYVESAAIGLITGRFAAAECLGRKLMPALGALLNHITGGHLSADSEGTRSFQPMNVNFGLFPPIATPPHPGGKGPRSFKGFDRKRALSRRALADLDVWLAPSASVAAE

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221580 Devosia sp. Root635 Isolate Unclassified
6 2643221591 Devosia sp. Root685 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221629 Devosia sp. Root105 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
14 2643221662 Devosia sp. Root413D1 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221674 Devosia sp. Root436 Isolate Unclassified
17 2643221733 Bosea sp. Root381 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2818991467 Bosea vestrisii 3192 Isolate Unclassified
24 2841760612 Bosea sp. Tri-49 Isolate Nodule
25 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
26 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
27 2844104063 Bosea sp. Tri-39 Isolate Nodule
28 2851182111 Bosea sp. Tri-44 Isolate Nodule
29 2851246043 Bosea sp. Tri-54 Isolate Nodule
30 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
31 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
32 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
33 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
34 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
35 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
36 2932401849 Devosia sp. 2618 Isolate Rhizosphere
37 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
38 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
243 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
257 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
273 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
280 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
370 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
371 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
372 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
373 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
374 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
375 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
376 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
382 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
405 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
408 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
409 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
410 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
413 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
414 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
415 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
416 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
425 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
426 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
432 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
433 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 0.79
Rhizoplane 2.56
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003493 3300001904 Bacteria 2725
2 JGI24741J21665_1004204 3300001915 Bacteria 3240
3 JGI24740J21852_10010082 3300001979 Bacteria 3660
4 JGI24740J21852_10026448 3300001979 Bacteria 1944
5 JGI24735J21928_10003799 3300002067 Bacteria 5117
6 JGI25151J46595_10000038 3300003187 Bacteria 180430
7 JGI25165J46597_1000425 3300003214 Bacteria 43589
8 JGI25165J46597_1003861 3300003214 Bacteria 3481
9 JGI25153J46596_10000006 3300003215 Bacteria 447760
10 Ga0055526_1000282 3300003771 Bacteria 42603
11 Ga0055526_1001779 3300003771 Bacteria 14969
12 Ga0055524_1000091 3300003775 Bacteria 113761
13 Ga0055536_1001904 3300003781 Bacteria 12099
14 Ga0055536_1007868 3300003781 Bacteria 4688
15 Ga0055530_10000013 3300003791 Bacteria 153390
16 Ga0055530_10004835 3300003791 Bacteria 6738
17 Ga0055530_10005482 3300003791 Bacteria 6010
18 Ga0055531_10000627 3300003794 Bacteria 30500
19 Ga0055531_10000667 3300003794 Bacteria 29334
20 Ga0055531_10000800 3300003794 Bacteria 26095
21 Ga0055531_10006022 3300003794 Bacteria 6957
22 Ga0065165_1000029 3300005262 Bacteria 220342
23 Ga0065165_1000667 3300005262 Bacteria 49547
24 Ga0065715_10000489 3300005293 Bacteria 17629
25 Ga0065715_10134850 3300005293 Bacteria 1932
26 Ga0070658_10023327 3300005327 Bacteria 4967
27 Ga0070658_10027486 3300005327 Bacteria 4565
28 Ga0070658_10033937 3300005327 Bacteria 4107
29 Ga0070658_10040543 3300005327 Bacteria 3757
30 Ga0070658_10069401 3300005327 Bacteria 2883
31 Ga0070658_10071045 3300005327 Bacteria 2851
32 Ga0070676_10001990 3300005328 Bacteria 10391
33 Ga0070676_10025735 3300005328 Bacteria 3328
34 Ga0070690_100047251 3300005330 Bacteria 2738
35 Ga0070670_100000050 3300005331 Bacteria 132470
36 Ga0070670_100001146 3300005331 Bacteria 21026
37 Ga0070670_100006180 3300005331 Bacteria 10122
38 Ga0070670_100008096 3300005331 Bacteria 8941
39 Ga0070670_100028559 3300005331 Bacteria 4800
40 Ga0070670_100040151 3300005331 Bacteria 4024
41 Ga0070670_100048561 3300005331 Bacteria 3652
42 Ga0068869_100003098 3300005334 Bacteria 10135
43 Ga0068869_100055111 3300005334 Bacteria 2897
44 Ga0070666_10000234 3300005335 Bacteria 37494
45 Ga0070680_100000336 3300005336 Bacteria 31461
46 Ga0070680_100022755 3300005336 Bacteria 4993
47 Ga0070680_100022987 3300005336 Bacteria 4969
48 Ga0070680_100045778 3300005336 Bacteria 3557
49 Ga0070682_100009658 3300005337 Bacteria 5461
50 Ga0070682_100012477 3300005337 Bacteria 4874
51 Ga0070660_100009530 3300005339 Bacteria 6835
52 Ga0070660_100036631 3300005339 Bacteria 3716
53 Ga0070691_10005886 3300005341 Bacteria 5597
54 Ga0070691_10044509 3300005341 Bacteria 2105
55 Ga0070661_100000415 3300005344 Bacteria 32936
56 Ga0070661_100019658 3300005344 Bacteria 4813
57 Ga0070661_100096602 3300005344 Bacteria 2193
58 Ga0070692_10008265 3300005345 Bacteria 4635
59 Ga0070668_100001563 3300005347 Bacteria 16519
60 Ga0070668_100001996 3300005347 Bacteria 14916
61 Ga0070668_100013222 3300005347 Bacteria 6156
62 Ga0070668_100023079 3300005347 Bacteria 4703
63 Ga0070668_100067102 3300005347 Bacteria 2786
64 Ga0070668_100076218 3300005347 Bacteria 2619
65 Ga0070668_100135103 3300005347 Bacteria 1983
66 Ga0070669_100000008 3300005353 Bacteria 226764
67 Ga0070669_100002352 3300005353 Bacteria 13674
68 Ga0070669_100045468 3300005353 Bacteria 3199
69 Ga0070675_100027852 3300005354 Bacteria 4543
70 Ga0070671_100000010 3300005355 Bacteria 202799
71 Ga0070674_100029240 3300005356 Bacteria 3627
72 Ga0070674_100078446 3300005356 Bacteria 2353
73 Ga0070673_100061252 3300005364 Bacteria 2985
74 Ga0070673_100257186 3300005364 Bacteria 1524
75 Ga0070688_100010364 3300005365 Bacteria 5137
76 Ga0070688_100118190 3300005365 Bacteria 1772
77 Ga0070659_100001844 3300005366 Bacteria 15225
78 Ga0070659_100001909 3300005366 Bacteria 14893
79 Ga0070667_100000140 3300005367 Bacteria 91817
80 Ga0070667_100014536 3300005367 Bacteria 6504
81 Ga0070667_100014955 3300005367 Bacteria 6410
82 Ga0070667_100023369 3300005367 Bacteria 5128
83 Ga0070667_100090483 3300005367 Bacteria 2630
84 Ga0070667_100214822 3300005367 Bacteria 1710
85 Ga0070714_100126231 3300005435 Bacteria 2281
86 Ga0070713_100087488 3300005436 Bacteria 2672
87 Ga0070705_100015454 3300005440 Bacteria 3949
88 Ga0070663_100003708 3300005455 Bacteria 8856
89 Ga0070663_100008421 3300005455 Bacteria 6344
90 Ga0070678_100006677 3300005456 Bacteria 6790
91 Ga0070678_100013030 3300005456 Bacteria 5196
92 Ga0070662_100001233 3300005457 Bacteria 15724
93 Ga0070662_100126397 3300005457 Bacteria 1966
94 Ga0070662_100127009 3300005457 Bacteria 1961
95 Ga0070681_10009284 3300005458 Bacteria 9672
96 Ga0070681_10009895 3300005458 Bacteria 9394
97 Ga0070681_10060810 3300005458 Bacteria 3753
98 Ga0070685_10013224 3300005466 Bacteria 4348
99 Ga0070685_10081286 3300005466 Bacteria 1943
100 Ga0070679_100012066 3300005530 Bacteria 8250
101 Ga0070679_100071563 3300005530 Bacteria 3458
102 Ga0070679_100080501 3300005530 Bacteria 3247
103 Ga0070679_100083661 3300005530 Bacteria 3179
104 Ga0070679_100114822 3300005530 Bacteria 2678
105 Ga0070679_100153856 3300005530 Bacteria 2275
106 Ga0070679_100161731 3300005530 Bacteria 2213
107 Ga0070697_100010332 3300005536 Bacteria 7278
108 Ga0068853_100053469 3300005539 Bacteria 3478
109 Ga0070672_100023443 3300005543 Bacteria 4550
110 Ga0070693_100001672 3300005547 Bacteria 10050
111 Ga0070693_100061671 3300005547 Bacteria 2181
112 Ga0070665_100000248 3300005548 Bacteria 89239
113 Ga0070665_100006854 3300005548 Bacteria 11582
114 Ga0070665_100007821 3300005548 Bacteria 10848
115 Ga0070665_100010246 3300005548 Bacteria 9485
116 Ga0070665_100012139 3300005548 Bacteria 8688
117 Ga0070665_100022755 3300005548 Bacteria 6309
118 Ga0070665_100022780 3300005548 Bacteria 6305
119 Ga0070665_100040780 3300005548 Bacteria 4666
120 Ga0070665_100073128 3300005548 Bacteria 3435
121 Ga0070665_100153619 3300005548 Bacteria 2304
122 Ga0068855_100000010 3300005563 Bacteria 246022
123 Ga0068855_100039414 3300005563 Bacteria 5608
124 Ga0068855_100044198 3300005563 Bacteria 5273
125 Ga0068855_100100860 3300005563 Bacteria 3323
126 Ga0068855_100114040 3300005563 Bacteria 3099
127 Ga0068855_100116015 3300005563 Bacteria 3069
128 Ga0068855_100122502 3300005563 Bacteria 2975
129 Ga0068855_100184885 3300005563 Bacteria 2354
130 Ga0070664_100004570 3300005564 Bacteria 11108
131 Ga0070664_100110447 3300005564 Bacteria 2399
132 Ga0070664_100136620 3300005564 Bacteria 2156
133 Ga0068857_100037113 3300005577 Bacteria 4316
134 Ga0068857_100070399 3300005577 Bacteria 3116
135 Ga0068857_100075817 3300005577 Bacteria 2999
136 Ga0068854_100000732 3300005578 Bacteria 19460
137 Ga0068854_100005086 3300005578 Bacteria 8286
138 Ga0068854_100027333 3300005578 Bacteria 3931
139 Ga0068854_100041361 3300005578 Bacteria 3256
140 Ga0068854_100080460 3300005578 Bacteria 2404
141 Ga0068854_100172581 3300005578 Bacteria 1684
142 Ga0068854_100179449 3300005578 Bacteria 1653
143 Ga0068856_100018794 3300005614 Bacteria 6702
144 Ga0068856_100026670 3300005614 Bacteria 5634
145 Ga0068856_100189330 3300005614 Bacteria 2071
146 Ga0068852_100000692 3300005616 Bacteria 22063
147 Ga0068852_100002080 3300005616 Bacteria 13668
148 Ga0068852_100007208 3300005616 Bacteria 8107
149 Ga0068852_100008296 3300005616 Bacteria 7646
150 Ga0068852_100019190 3300005616 Bacteria 5404
151 Ga0068859_100002317 3300005617 Bacteria 19344
152 Ga0068859_100015571 3300005617 Bacteria 7642
153 Ga0068859_100057662 3300005617 Bacteria 3912
154 Ga0068864_100000472 3300005618 Bacteria 34898
155 Ga0068864_100000533 3300005618 Bacteria 32621
156 Ga0068864_100014781 3300005618 Bacteria 6485
157 Ga0068864_100030976 3300005618 Bacteria 4536
158 Ga0068864_100085254 3300005618 Bacteria 2777
159 Ga0068866_10006662 3300005718 Bacteria 4817
160 Ga0068861_100011425 3300005719 Bacteria 6174
161 Ga0068861_100052353 3300005719 Bacteria 3102
162 Ga0068863_100002271 3300005841 Bacteria 19100
163 Ga0068863_100005428 3300005841 Bacteria 12555
164 Ga0068863_100029849 3300005841 Bacteria 5207
165 Ga0068863_100039041 3300005841 Bacteria 4518
166 Ga0068863_100084696 3300005841 Bacteria 3004
167 Ga0068863_100105700 3300005841 Bacteria 2678
168 Ga0068858_100000098 3300005842 Bacteria 90747
169 Ga0068858_100006839 3300005842 Bacteria 11087
170 Ga0068858_100020066 3300005842 Bacteria 6251
171 Ga0068858_100031490 3300005842 Bacteria 4926
172 Ga0068858_100055790 3300005842 Bacteria 3652
173 Ga0068858_100237180 3300005842 Bacteria 1730
174 Ga0068860_100000580 3300005843 Bacteria 43948
175 Ga0068860_100000583 3300005843 Bacteria 43765
176 Ga0068860_100022267 3300005843 Bacteria 6132
177 Ga0068860_100140979 3300005843 Bacteria 2317
178 Ga0068860_100282863 3300005843 Bacteria 1621
179 Ga0068862_100000443 3300005844 Bacteria 45038
180 Ga0068862_100004861 3300005844 Bacteria 11312
181 Ga0068862_100011082 3300005844 Bacteria 7448
182 Ga0068862_100014334 3300005844 Bacteria 6574
183 Ga0068862_100044274 3300005844 Bacteria 3796
184 Ga0068862_100100985 3300005844 Bacteria 2523
185 Ga0068862_100196208 3300005844 Bacteria 1819
186 Ga0081455_10001641 3300005937 Bacteria 27241
187 Ga0081455_10004974 3300005937 Bacteria 14702
188 Ga0081539_10013768 3300005985 Bacteria 6062
189 Ga0081539_10069354 3300005985 Bacteria 1898
190 Ga0075368_10004137 3300006042 Bacteria 4888
191 Ga0075368_10007426 3300006042 Bacteria 3868
192 Ga0075364_10003123 3300006051 Bacteria 9375
193 Ga0070715_10004104 3300006163 Bacteria 4734
194 Ga0070716_100014189 3300006173 Bacteria 4078
195 Ga0070712_100023883 3300006175 Bacteria 4043
196 Ga0070712_100045608 3300006175 Bacteria 3027
197 Ga0075362_10006143 3300006177 Bacteria 4454
198 Ga0075367_10031006 3300006178 Bacteria 3069
199 Ga0075366_10012514 3300006195 Bacteria 4813
200 Ga0097621_100000004 3300006237 Bacteria 144414
201 Ga0097621_100114654 3300006237 Bacteria 2280
202 Ga0097621_100245117 3300006237 Bacteria 1568
203 Ga0068871_100041474 3300006358 Bacteria 3691
204 Ga0068871_100166216 3300006358 Bacteria 1889
205 Ga0075428_100060508 3300006844 Bacteria 4147
206 Ga0075430_100036361 3300006846 Bacteria 4177
207 Ga0075431_100088461 3300006847 Bacteria 3196
208 Ga0075431_100176581 3300006847 Bacteria 2194
209 Ga0075433_10016841 3300006852 Bacteria 6039
210 Ga0075434_100208611 3300006871 Bacteria 1974
211 Ga0068865_100000723 3300006881 Bacteria 18580
212 Ga0068865_100022539 3300006881 Bacteria 4110
213 Ga0075436_100069795 3300006914 Bacteria 2428
214 Ga0097620_100002317 3300006931 Bacteria 19344
215 Ga0097620_100015570 3300006931 Bacteria 7642
216 Ga0097620_100057660 3300006931 Bacteria 3912
217 Ga0105240_10000189 3300009093 Bacteria 125396
218 Ga0105240_10003194 3300009093 Bacteria 25746
219 Ga0105240_10011563 3300009093 Bacteria 12282
220 Ga0105240_10017423 3300009093 Bacteria 9681
221 Ga0105240_10041926 3300009093 Bacteria 5837
222 Ga0105240_10044078 3300009093 Bacteria 5672
223 Ga0105240_10050693 3300009093 Bacteria 5231
224 Ga0105240_10068604 3300009093 Bacteria 4391
225 Ga0105240_10069728 3300009093 Bacteria 4350
226 Ga0105240_10246678 3300009093 Bacteria 2068
227 Ga0111539_10012292 3300009094 Bacteria 10731
228 Ga0111539_10221374 3300009094 Bacteria 2204
229 Ga0105245_10001293 3300009098 Bacteria 22573
230 Ga0105245_10047864 3300009098 Bacteria 3824
231 Ga0105245_10089674 3300009098 Bacteria 2827
232 Ga0105247_10000673 3300009101 Bacteria 26928
233 Ga0105247_10006738 3300009101 Bacteria 7087
234 Ga0105243_10002889 3300009148 Bacteria 14238
235 Ga0105243_10003266 3300009148 Bacteria 13205
236 Ga0105243_10029612 3300009148 Bacteria 4211
237 Ga0105241_10012391 3300009174 Bacteria 6248
238 Ga0105241_10082892 3300009174 Bacteria 2514
239 Ga0105242_10021185 3300009176 Bacteria 5102
240 Ga0105248_10004862 3300009177 Bacteria 14873
241 Ga0105248_10006553 3300009177 Bacteria 12766
242 Ga0105248_10022662 3300009177 Bacteria 6970
243 Ga0105248_10030181 3300009177 Bacteria 6052
244 Ga0105248_10041909 3300009177 Bacteria 5133
245 Ga0105237_10006217 3300009545 Bacteria 13306
246 Ga0105237_10038275 3300009545 Bacteria 4843
247 Ga0105237_10158072 3300009545 Bacteria 2264
248 Ga0105237_10164072 3300009545 Bacteria 2220
249 Ga0105238_10012191 3300009551 Bacteria 8665
250 Ga0105238_10016939 3300009551 Bacteria 7396
251 Ga0105238_10033513 3300009551 Bacteria 5227
252 Ga0105238_10036572 3300009551 Bacteria 4992
253 Ga0105238_10056284 3300009551 Bacteria 3946
254 Ga0105238_10056986 3300009551 Bacteria 3919
255 Ga0105238_10124630 3300009551 Bacteria 2556
256 Ga0105238_10151581 3300009551 Bacteria 2293
257 Ga0105249_10004149 3300009553 Bacteria 12511
258 Ga0105249_10033372 3300009553 Bacteria 4660
259 Ga0105239_10000157 3300010375 Bacteria 98327
260 Ga0105239_10022193 3300010375 Bacteria 6997
261 Ga0105239_10058604 3300010375 Bacteria 4226
262 Ga0105239_10148198 3300010375 Bacteria 2618
263 Ga0105239_10172760 3300010375 Bacteria 2417
264 Ga0105239_10175604 3300010375 Bacteria 2396
265 Ga0105246_10014991 3300011119 Bacteria 4884
266 Ga0105246_10034704 3300011119 Bacteria 3364
267 Ga0157373_10000106 3300013100 Bacteria 65255
268 Ga0157373_10000549 3300013100 Bacteria 29370
269 Ga0157373_10019946 3300013100 Bacteria 4877
270 Ga0157373_10099310 3300013100 Bacteria 2049
271 Ga0157371_10008210 3300013102 Bacteria 8349
272 Ga0157371_10015685 3300013102 Bacteria 5673
273 Ga0157370_10073701 3300013104 Bacteria 3221
274 Ga0157370_10295033 3300013104 Bacteria 1497
275 Ga0157369_10000202 3300013105 Bacteria 82819
276 Ga0157369_10004702 3300013105 Bacteria 16048
277 Ga0157369_10010154 3300013105 Bacteria 10746
278 Ga0157369_10018118 3300013105 Bacteria 7899
279 Ga0157369_10046948 3300013105 Bacteria 4692
280 Ga0157369_10137587 3300013105 Bacteria 2585
281 Ga0171462_1040 3300013250 Bacteria 73112
282 Ga0157374_10001715 3300013296 Bacteria 18394
283 Ga0157378_10007224 3300013297 Bacteria 9702
284 Ga0157378_10014358 3300013297 Bacteria 6935
285 Ga0157378_10025468 3300013297 Bacteria 5208
286 Ga0157378_10155814 3300013297 Bacteria 2132
287 Ga0163162_10052631 3300013306 Bacteria 4089
288 Ga0163162_10098343 3300013306 Bacteria 3016
289 Ga0157372_10015386 3300013307 Bacteria 8199
290 Ga0157372_10020017 3300013307 Bacteria 7215
291 Ga0157372_10028104 3300013307 Bacteria 6135
292 Ga0157372_10294811 3300013307 Bacteria 1886
293 Ga0157375_10002209 3300013308 Bacteria 16831
294 Ga0157375_10054963 3300013308 Bacteria 3923
295 Ga0157375_10151643 3300013308 Bacteria 2454
296 Ga0157375_10169873 3300013308 Bacteria 2328
297 Ga0163163_10031710 3300014325 Bacteria 5103
298 Ga0163163_10032695 3300014325 Bacteria 5026
299 Ga0163163_10153893 3300014325 Bacteria 2343
300 Ga0157380_10002753 3300014326 Bacteria 11937
301 Ga0157380_10006132 3300014326 Bacteria 8429
302 Ga0157380_10029593 3300014326 Bacteria 4187
303 Ga0157380_10067375 3300014326 Bacteria 2882
304 Ga0157379_10017057 3300014968 Bacteria 6393
305 Ga0157379_10017776 3300014968 Bacteria 6263
306 Ga0157379_10026633 3300014968 Bacteria 5147
307 Ga0157379_10067903 3300014968 Bacteria 3187
308 Ga0157379_10071957 3300014968 Bacteria 3093
309 Ga0157376_10016186 3300014969 Bacteria 5655
310 Ga0157376_10124306 3300014969 Bacteria 2291
311 Ga0157376_10161051 3300014969 Bacteria 2034
312 Ga0183365_10001 3300015684 Bacteria 2090444
313 Ga0163161_10078138 3300017792 Bacteria 2432
314 Ga0213873_10000006 3300021358 Bacteria 408723
315 Ga0213876_10000004 3300021384 Bacteria 943822
316 Ga0213876_10000125 3300021384 Bacteria 83238
317 Ga0213876_10001849 3300021384 Bacteria 12750
318 Ga0213876_10021790 3300021384 Bacteria 3389
319 Ga0213875_10001173 3300021388 Bacteria 17947
320 Ga0207427_101301 3300025231 Bacteria 9417
321 Ga0209233_1000013 3300025261 Bacteria 1013785
322 Ga0209233_1001390 3300025261 Bacteria 9590
323 Ga0209130_1000697 3300025284 Bacteria 30036
324 Ga0209675_1000808 3300025291 Bacteria 20627
325 Ga0209675_1001346 3300025291 Bacteria 14500
326 Ga0209675_1007120 3300025291 Bacteria 4346
327 Ga0209676_1000151 3300025292 Bacteria 167307
328 Ga0209676_1000221 3300025292 Bacteria 124715
329 Ga0209676_1000453 3300025292 Bacteria 69137
330 Ga0209676_1001788 3300025292 Bacteria 18043
331 Ga0209025_1000014 3300025294 Bacteria 865448
332 Ga0209025_1021699 3300025294 Bacteria 3445
333 Ga0209564_1000105 3300025295 Bacteria 218124
334 Ga0209564_1000150 3300025295 Bacteria 170318
335 Ga0209758_1000001 3300025297 Bacteria 1981790
336 Ga0209758_1000401 3300025297 Bacteria 74599
337 Ga0209050_1000031 3300025298 Bacteria 458181
338 Ga0209050_1000042 3300025298 Bacteria 402842
339 Ga0209050_1000822 3300025298 Bacteria 43254
340 Ga0209050_1001101 3300025298 Bacteria 32754
341 Ga0209256_1000108 3300025299 Bacteria 185884
342 Ga0209256_1000128 3300025299 Bacteria 163833
343 Ga0209256_1000743 3300025299 Bacteria 42721
344 Ga0207426_1007192 3300025302 Bacteria 4696
345 Ga0209257_1000073 3300025304 Bacteria 325833
346 Ga0209257_1000135 3300025304 Bacteria 205668
347 Ga0209257_1000413 3300025304 Bacteria 82516
348 Ga0209257_1000487 3300025304 Bacteria 71315
349 Ga0209257_1000760 3300025304 Bacteria 48318
350 Ga0209257_1002730 3300025304 Bacteria 16776
351 Ga0209257_1003297 3300025304 Bacteria 14064
352 Ga0207697_10000036 3300025315 Bacteria 49927
353 Ga0207697_10000845 3300025315 Bacteria 17297
354 Ga0207697_10021489 3300025315 Bacteria 2641
355 Ga0207682_10000389 3300025893 Bacteria 20256
356 Ga0207710_10001925 3300025900 Bacteria 9942
357 Ga0207710_10025882 3300025900 Bacteria 2534
358 Ga0207680_10000097 3300025903 Bacteria 40203
359 Ga0207647_10004963 3300025904 Bacteria 9808
360 Ga0207645_10031151 3300025907 Bacteria 3433
361 Ga0207645_10032477 3300025907 Bacteria 3355
362 Ga0207705_10000060 3300025909 Bacteria 152576
363 Ga0207705_10005248 3300025909 Bacteria 9712
364 Ga0207705_10012524 3300025909 Bacteria 6122
365 Ga0207705_10020398 3300025909 Bacteria 4737
366 Ga0207705_10024713 3300025909 Bacteria 4287
367 Ga0207705_10051612 3300025909 Bacteria 2960
368 Ga0207705_10079055 3300025909 Bacteria 2395
369 Ga0207654_10042006 3300025911 Bacteria 2585
370 Ga0207654_10055799 3300025911 Bacteria 2289
371 Ga0207654_10058582 3300025911 Bacteria 2243
372 Ga0207707_10009978 3300025912 Bacteria 8236
373 Ga0207707_10021925 3300025912 Bacteria 5583
374 Ga0207707_10040418 3300025912 Bacteria 4073
375 Ga0207707_10108805 3300025912 Bacteria 2423
376 Ga0207695_10000003 3300025913 Bacteria 1368691
377 Ga0207695_10000984 3300025913 Bacteria 50625
378 Ga0207695_10001296 3300025913 Bacteria 42421
379 Ga0207695_10004268 3300025913 Bacteria 19631
380 Ga0207695_10006268 3300025913 Bacteria 15485
381 Ga0207695_10006284 3300025913 Bacteria 15460
382 Ga0207695_10006822 3300025913 Bacteria 14705
383 Ga0207695_10017297 3300025913 Bacteria 8395
384 Ga0207695_10025668 3300025913 Bacteria 6592
385 Ga0207695_10030351 3300025913 Bacteria 5952
386 Ga0207695_10037479 3300025913 Bacteria 5231
387 Ga0207695_10054252 3300025913 Bacteria 4187
388 Ga0207671_10000701 3300025914 Bacteria 43166
389 Ga0207671_10007162 3300025914 Bacteria 9727
390 Ga0207671_10087469 3300025914 Bacteria 2343
391 Ga0207693_10001172 3300025915 Bacteria 23402
392 Ga0207693_10038804 3300025915 Bacteria 3749
393 Ga0207663_10056658 3300025916 Bacteria 2466
394 Ga0207660_10000221 3300025917 Bacteria 36706
395 Ga0207660_10014579 3300025917 Bacteria 5172
396 Ga0207660_10051165 3300025917 Bacteria 2936
397 Ga0207662_10019704 3300025918 Bacteria 3843
398 Ga0207657_10002252 3300025919 Bacteria 20914
399 Ga0207657_10007933 3300025919 Bacteria 10824
400 Ga0207657_10017872 3300025919 Bacteria 6786
401 Ga0207657_10019859 3300025919 Bacteria 6367
402 Ga0207657_10020383 3300025919 Bacteria 6266
403 Ga0207649_10000235 3300025920 Bacteria 45363
404 Ga0207649_10000448 3300025920 Bacteria 29660
405 Ga0207649_10002604 3300025920 Bacteria 10015
406 Ga0207649_10014458 3300025920 Bacteria 4421
407 Ga0207649_10060349 3300025920 Bacteria 2383
408 Ga0207652_10033185 3300025921 Bacteria 4345
409 Ga0207652_10112272 3300025921 Bacteria 2418
410 Ga0207652_10125765 3300025921 Bacteria 2283
411 Ga0207681_10000002 3300025923 Bacteria 985597
412 Ga0207681_10003001 3300025923 Bacteria 10603
413 Ga0207681_10071587 3300025923 Bacteria 2419
414 Ga0207694_10000011 3300025924 Bacteria 417640
415 Ga0207694_10016477 3300025924 Bacteria 5581
416 Ga0207694_10039585 3300025924 Bacteria 3627
417 Ga0207694_10129105 3300025924 Bacteria 2025
418 Ga0207694_10185176 3300025924 Bacteria 1690
419 Ga0207694_10201115 3300025924 Bacteria 1621
420 Ga0207650_10000062 3300025925 Bacteria 149776
421 Ga0207650_10000537 3300025925 Bacteria 30997
422 Ga0207650_10008947 3300025925 Bacteria 6844
423 Ga0207650_10017759 3300025925 Bacteria 4983
424 Ga0207659_10006280 3300025926 Bacteria 7271
425 Ga0207659_10019312 3300025926 Bacteria 4484
426 Ga0207687_10001382 3300025927 Bacteria 16576
427 Ga0207687_10029495 3300025927 Bacteria 3691
428 Ga0207664_10005602 3300025929 Bacteria 8594
429 Ga0207664_10123471 3300025929 Bacteria 2171
430 Ga0207644_10000002 3300025931 Bacteria 942221
431 Ga0207690_10000066 3300025932 Bacteria 91772
432 Ga0207690_10004547 3300025932 Bacteria 8193
433 Ga0207690_10009334 3300025932 Bacteria 5829
434 Ga0207690_10034528 3300025932 Bacteria 3259
435 Ga0207706_10000415 3300025933 Bacteria 45662
436 Ga0207706_10013108 3300025933 Bacteria 7541
437 Ga0207706_10017152 3300025933 Bacteria 6530
438 Ga0207706_10033035 3300025933 Bacteria 4606
439 Ga0207686_10142682 3300025934 Bacteria 1658
440 Ga0207709_10002218 3300025935 Bacteria 12386
441 Ga0207709_10093380 3300025935 Bacteria 1972
442 Ga0207709_10146240 3300025935 Bacteria 1631
443 Ga0207670_10016263 3300025936 Bacteria 4466
444 Ga0207670_10030117 3300025936 Bacteria 3465
445 Ga0207669_10023944 3300025937 Bacteria 3272
446 Ga0207704_10201169 3300025938 Bacteria 1458
447 Ga0207665_10001649 3300025939 Bacteria 15020
448 Ga0207691_10001641 3300025940 Bacteria 22196
449 Ga0207691_10014720 3300025940 Bacteria 7456
450 Ga0207711_10007924 3300025941 Bacteria 8886
451 Ga0207711_10066920 3300025941 Bacteria 3108
452 Ga0207711_10069337 3300025941 Bacteria 3056
453 Ga0207689_10028111 3300025942 Bacteria 4703
454 Ga0207689_10042506 3300025942 Bacteria 3759
455 Ga0207689_10155032 3300025942 Bacteria 1888
456 Ga0207661_10030751 3300025944 Bacteria 4139
457 Ga0207661_10172414 3300025944 Bacteria 1884
458 Ga0207679_10004181 3300025945 Bacteria 8967
459 Ga0207667_10000093 3300025949 Bacteria 145814
460 Ga0207667_10010340 3300025949 Bacteria 10911
461 Ga0207667_10031541 3300025949 Bacteria 5720
462 Ga0207667_10033965 3300025949 Bacteria 5480
463 Ga0207667_10121329 3300025949 Bacteria 2693
464 Ga0207667_10205203 3300025949 Bacteria 2021
465 Ga0207651_10128225 3300025960 Bacteria 1937
466 Ga0207712_10002299 3300025961 Bacteria 12407
467 Ga0207712_10055505 3300025961 Bacteria 2787
468 Ga0207668_10000046 3300025972 Bacteria 102051
469 Ga0207668_10000996 3300025972 Bacteria 16977
470 Ga0207668_10001421 3300025972 Bacteria 14084
471 Ga0207668_10003452 3300025972 Bacteria 9277
472 Ga0207668_10018563 3300025972 Bacteria 4380
473 Ga0207668_10032130 3300025972 Bacteria 3465
474 Ga0207640_10003091 3300025981 Bacteria 8958
475 Ga0207640_10005800 3300025981 Bacteria 6734
476 Ga0207640_10026267 3300025981 Bacteria 3533
477 Ga0207640_10042562 3300025981 Bacteria 2897
478 Ga0207658_10000264 3300025986 Bacteria 55170
479 Ga0207658_10003580 3300025986 Bacteria 10968
480 Ga0207658_10006846 3300025986 Bacteria 7767
481 Ga0207658_10015549 3300025986 Bacteria 5220
482 Ga0207677_10051800 3300026023 Bacteria 2785
483 Ga0207703_10000086 3300026035 Bacteria 107307
484 Ga0207703_10001492 3300026035 Bacteria 21341
485 Ga0207703_10002958 3300026035 Bacteria 14408
486 Ga0207703_10003329 3300026035 Bacteria 13494
487 Ga0207639_10015498 3300026041 Bacteria 5380
488 Ga0207639_10064483 3300026041 Bacteria 2840
489 Ga0207639_10076993 3300026041 Bacteria 2628
490 Ga0207678_10000698 3300026067 Bacteria 30592
491 Ga0207678_10000804 3300026067 Bacteria 28814
492 Ga0207678_10001001 3300026067 Bacteria 25726
493 Ga0207678_10017512 3300026067 Bacteria 6292
494 Ga0207678_10028782 3300026067 Bacteria 4850
495 Ga0207678_10150185 3300026067 Bacteria 1989
496 Ga0207708_10001156 3300026075 Bacteria 19859
497 Ga0207702_10008523 3300026078 Bacteria 8644
498 Ga0207702_10011107 3300026078 Bacteria 7517
499 Ga0207702_10024721 3300026078 Bacteria 4983
500 Ga0207641_10000012 3300026088 Bacteria 375486
501 Ga0207641_10001512 3300026088 Bacteria 22780
502 Ga0207641_10011597 3300026088 Bacteria 7234
503 Ga0207641_10040963 3300026088 Bacteria 3881
504 Ga0207641_10087523 3300026088 Bacteria 2718
505 Ga0207648_10019067 3300026089 Bacteria 6194
506 Ga0207676_10000445 3300026095 Bacteria 35000
507 Ga0207676_10000784 3300026095 Bacteria 24801
508 Ga0207676_10012291 3300026095 Bacteria 6129
509 Ga0207676_10022590 3300026095 Bacteria 4627
510 Ga0207676_10124390 3300026095 Bacteria 2181
511 Ga0207676_10154162 3300026095 Bacteria 1982
512 Ga0207674_10004754 3300026116 Bacteria 16280
513 Ga0207674_10050669 3300026116 Bacteria 4240
514 Ga0207674_10078164 3300026116 Bacteria 3314
515 Ga0207675_100000249 3300026118 Bacteria 51517
516 Ga0207675_100000358 3300026118 Bacteria 43765
517 Ga0207675_100060567 3300026118 Bacteria 3534
518 Ga0207683_10000527 3300026121 Bacteria 35492
519 Ga0207683_10021308 3300026121 Bacteria 5547
520 Ga0207683_10038603 3300026121 Bacteria 4164
521 Ga0207683_10079316 3300026121 Bacteria 2911
522 Ga0207683_10088260 3300026121 Bacteria 2759
523 Ga0207683_10167283 3300026121 Bacteria 1990
524 Ga0207698_10001333 3300026142 Bacteria 14406
525 Ga0207698_10021331 3300026142 Bacteria 4477
526 Ga0207698_10089425 3300026142 Bacteria 2515
527 Ga0207698_10105462 3300026142 Bacteria 2349
528 Ga0209974_10007907 3300027876 Bacteria 3647
529 Ga0268266_10000005 3300028379 Bacteria 1448194
530 Ga0268266_10000474 3300028379 Bacteria 57849
531 Ga0268266_10001455 3300028379 Bacteria 28167
532 Ga0268266_10005907 3300028379 Bacteria 11323
533 Ga0268266_10023201 3300028379 Bacteria 5284
534 Ga0268266_10024329 3300028379 Bacteria 5152
535 Ga0268266_10029304 3300028379 Bacteria 4680
536 Ga0268266_10036647 3300028379 Bacteria 4176
537 Ga0268266_10090362 3300028379 Bacteria 2684
538 Ga0268266_10122735 3300028379 Bacteria 2313
539 Ga0268266_10187165 3300028379 Bacteria 1888
540 Ga0268265_10000339 3300028380 Bacteria 50894
541 Ga0268265_10002810 3300028380 Bacteria 12814
542 Ga0268265_10029731 3300028380 Bacteria 3927
543 Ga0268264_10000010 3300028381 Bacteria 596543
544 Ga0268264_10000046 3300028381 Bacteria 364597
545 Ga0268264_10000358 3300028381 Bacteria 68359
546 Ga0265337_1001828 3300028556 Bacteria 10210
547 Ga0265337_1010633 3300028556 Bacteria 3212
548 Ga0307517_10025834 3300028786 Bacteria 7154
549 Ga0265338_10014834 3300028800 Bacteria 8621
550 Ga0265338_10020764 3300028800 Bacteria 6889
551 Ga0265338_10029551 3300028800 Bacteria 5428
552 Ga0307511_10050145 3300030521 Bacteria 3366
553 Ga0265330_10040206 3300031235 Bacteria 2077
554 Ga0265332_10007546 3300031238 Bacteria 4917
555 Ga0265325_10001499 3300031241 Bacteria 16417
556 Ga0265325_10002804 3300031241 Bacteria 11626
557 Ga0265340_10000071 3300031247 Bacteria 48537
558 Ga0265340_10002678 3300031247 Bacteria 10128
559 Ga0265340_10009105 3300031247 Bacteria 5338
560 Ga0265340_10009447 3300031247 Bacteria 5232
561 Ga0265340_10073391 3300031247 Bacteria 1619
562 Ga0265339_10002510 3300031249 Bacteria 13106
563 Ga0265339_10004519 3300031249 Bacteria 9474
564 Ga0265331_10000006 3300031250 Bacteria 418907
565 Ga0265331_10094110 3300031250 Bacteria 1383
566 Ga0265327_10000074 3300031251 Bacteria 214435
567 Ga0265327_10000381 3300031251 Bacteria 83617
568 Ga0265327_10001725 3300031251 Bacteria 25910
569 Ga0265327_10020337 3300031251 Bacteria 4049
570 Ga0265316_10020337 3300031344 Bacteria 5652
571 Ga0265316_10064684 3300031344 Bacteria 2833
572 Ga0265316_10101941 3300031344 Bacteria 2180
573 Ga0307513_10001008 3300031456 Bacteria 40757
574 Ga0307513_10004817 3300031456 Bacteria 17920
575 Ga0307408_100012825 3300031548 Bacteria 5558
576 Ga0307408_100049854 3300031548 Bacteria 3008
577 Ga0316579_10014412 3300031691 Bacteria 3416
578 Ga0265314_10002986 3300031711 Bacteria 16750
579 Ga0265314_10009963 3300031711 Bacteria 7968
580 Ga0265314_10028054 3300031711 Bacteria 4203
581 Ga0265342_10000100 3300031712 Bacteria 94554
582 Ga0265342_10011993 3300031712 Bacteria 5888
583 Ga0265342_10056439 3300031712 Bacteria 2327
584 Ga0265342_10099770 3300031712 Bacteria 1655
585 Ga0316576_10034936 3300031727 Bacteria 3585
586 Ga0316578_10048851 3300031728 Bacteria 2471
587 Ga0307516_10000004 3300031730 Bacteria 367451
588 Ga0307516_10024467 3300031730 Bacteria 6167
589 Ga0307516_10041770 3300031730 Bacteria 4555
590 Ga0307405_10004900 3300031731 Bacteria 6391
591 Ga0316577_10026372 3300031733 Bacteria 3235
592 Ga0307413_10027278 3300031824 Bacteria 3162
593 Ga0307410_10004727 3300031852 Bacteria 7088
594 Ga0307410_10014826 3300031852 Bacteria 4601
595 Ga0307410_10015919 3300031852 Bacteria 4471
596 Ga0307410_10038726 3300031852 Bacteria 3125
597 Ga0307410_10069070 3300031852 Bacteria 2443
598 Ga0307410_10076539 3300031852 Bacteria 2336
599 Ga0307406_10004114 3300031901 Bacteria 7920
600 Ga0307406_10042409 3300031901 Bacteria 2840
601 Ga0307406_10156355 3300031901 Bacteria 1633
602 Ga0307412_10004265 3300031911 Bacteria 7973
603 Ga0307412_10115500 3300031911 Bacteria 1924
604 Ga0307409_100009507 3300031995 Bacteria 5977
605 Ga0307409_100042393 3300031995 Bacteria 3408
606 Ga0307409_100091515 3300031995 Bacteria 2493
607 Ga0307416_100018999 3300032002 Bacteria 4860
608 Ga0307414_10008109 3300032004 Bacteria 5934
609 Ga0307414_10048172 3300032004 Bacteria 2938
610 Ga0307414_10057250 3300032004 Bacteria 2739
611 Ga0307414_10112576 3300032004 Bacteria 2075
612 Ga0307414_10130993 3300032004 Bacteria 1947
613 Ga0307414_10154727 3300032004 Bacteria 1813
614 Ga0307414_10241746 3300032004 Bacteria 1495
615 Ga0307411_10010448 3300032005 Bacteria 4949
616 Ga0307411_10089364 3300032005 Bacteria 2145
617 Ga0307411_10100930 3300032005 Bacteria 2040
618 Ga0307411_10154398 3300032005 Bacteria 1710
619 Ga0307415_100003761 3300032126 Bacteria 7778
620 Ga0307415_100009695 3300032126 Bacteria 5416
621 Ga0316583_10020047 3300032133 Bacteria 2396
622 Ga0316585_10021242 3300032137 Bacteria 1992
623 Ga0307510_10007774 3300033180 Bacteria 12786
624 Ga0307510_10132745 3300033180 Bacteria 2157
625 Ga0373939_0011890 3300035114 Bacteria 2208
626 Ga0373927_0001191 3300035695 Bacteria 19735
627 Ga0373927_0079266 3300035695 Bacteria 2127
628 Ga0373933_0058424 3300035724 Bacteria 2320
629 Ga0373947_0003164 3300035725 Bacteria 9796
630 Ga0373937_0257417 3300036401 Bacteria 1646
631 Ga0316582_0032276 3300036647 Bacteria 3207
632 Ga0373925_0000136 3300037068 Bacteria 77912
633 Ga0373925_0033525 3300037068 Bacteria 3784
634 Ga0395899_0000165 3300037312 Bacteria 102140
635 Ga0395899_0000399 3300037312 Bacteria 51229
636 Ga0395899_0014303 3300037312 Bacteria 6057
637 Ga0395899_0016202 3300037312 Bacteria 5681
638 Ga0395899_0067809 3300037312 Bacteria 2617
639 Ga0395899_0159151 3300037312 Bacteria 1596
640 Ga0395900_0000010 3300037418 Bacteria 461364
641 Ga0395900_0000949 3300037418 Bacteria 37825
642 Ga0395900_0033116 3300037418 Bacteria 5318
643 Ga0395900_0042970 3300037418 Bacteria 4656
644 Ga0395900_0047787 3300037418 Bacteria 4408
645 Ga0395900_0050318 3300037418 Bacteria 4292
646 Ga0395900_0122468 3300037418 Bacteria 2668
647 Ga0395900_0145234 3300037418 Bacteria 2426
648 Ga0395900_0211953 3300037418 Bacteria 1956
649 Ga0395898_0001666 3300037466 Bacteria 29798
650 Ga0395898_0002368 3300037466 Bacteria 22407
651 Ga0395898_0015228 3300037466 Bacteria 7894
652 Ga0395898_0074709 3300037466 Bacteria 3274
653 Ga0395898_0085974 3300037466 Bacteria 3031
654 Ga0395898_0110442 3300037466 Bacteria 2635
655 Ga0395898_0186904 3300037466 Bacteria 1980
656 Ga0395898_0321335 3300037466 Bacteria 1476
657 Ga0395905_0000130 3300037471 Bacteria 123719
658 Ga0395905_0000523 3300037471 Bacteria 52635
659 Ga0395905_0001118 3300037471 Bacteria 33620
660 Ga0395905_0004354 3300037471 Bacteria 14743
661 Ga0395905_0078393 3300037471 Bacteria 3096
662 Ga0395905_0186889 3300037471 Bacteria 1944
663 Ga0395905_0297071 3300037471 Bacteria 1502
664 Ga0436364_0050837 3300037853 Bacteria 2129
665 Ga0436364_1468866 3300037853 Bacteria 21170
666 Ga0395901_0000007 3300038443 Bacteria 497408
667 Ga0395901_0000064 3300038443 Bacteria 147477
668 Ga0395901_0003263 3300038443 Bacteria 16327
669 Ga0395901_0016805 3300038443 Bacteria 7456
670 Ga0395901_0062898 3300038443 Bacteria 3862
671 Ga0395901_0304594 3300038443 Bacteria 1651
672 Ga0237819_01482 3300038705 Bacteria 6016
673 Ga0400483_221937 3300039062 Bacteria 7652
674 Ga0436365_0749742 3300039437 Bacteria 107056
675 Ga0436365_1215130 3300039437 Bacteria 80243
676 Ga0436365_1242987 3300039437 Bacteria 27013
677 Ga0436361_0135818 3300039447 Bacteria 1710
678 Ga0436363_0800232 3300039450 Bacteria 3281
679 Ga0436363_0882399 3300039450 Bacteria 1850
680 Ga0436362_0094317 3300039453 Bacteria 79076
681 Ga0439445_0001896 3300042004 Bacteria 4610
682 Ga0450889_000351 3300042144 Bacteria 5152
683 Ga0439435_0004642 3300042436 Bacteria 2972
684 Ga0466969_0003245 3300044656 Bacteria 8649
685 Ga0466966_0013163 3300044684 Bacteria 5478
686 Ga0466961_0017719 3300044693 Bacteria 4576
687 Ga0466957_0003095 3300044842 Bacteria 9054
688 Ga0466957_0005423 3300044842 Bacteria 7161
689 Ga0466959_0010147 3300045049 Bacteria 6720
690 Ga0451576_0003258 3300045051 Bacteria 22524
691 Ga0466958_0001266 3300045836 Bacteria 11847
692 Ga0466958_0002358 3300045836 Bacteria 9451
693 Ga0466967_0004158 3300045976 Bacteria 9684
694 Ga0466967_0044107 3300045976 Bacteria 3865
695 Ga0495603_0001675 3300046455 Bacteria 13009
696 Ga0495629_0001791 3300046459 Bacteria 16823
697 Ga0495638_0000800 3300046460 Bacteria 33205
698 Ga0495580_0000080 3300046472 Bacteria 61309
699 Ga0495582_0000988 3300046473 Bacteria 15917
700 Ga0495582_0077552 3300046473 Bacteria 1843
701 Ga0495639_0002279 3300046475 Bacteria 8409
702 Ga0495594_0000223 3300046499 Bacteria 27605
703 Ga0495610_0000336 3300046512 Bacteria 49714
704 Ga0495610_0047880 3300046512 Bacteria 2101
705 Ga0495637_0024359 3300046520 Bacteria 2739
706 Ga0495643_0031941 3300046522 Bacteria 2926
707 Ga0495663_0003127 3300046525 Bacteria 4836
708 Ga0495642_0014466 3300046528 Bacteria 3058
709 Ga0495665_0017316 3300046531 Bacteria 3876
710 Ga0495665_0043953 3300046531 Bacteria 2375
711 Ga0495598_0007163 3300046537 Bacteria 2547
712 Ga0495609_0022864 3300046538 Bacteria 2879
713 Ga0495621_0000635 3300046539 Bacteria 8827
714 Ga0495621_0000933 3300046539 Bacteria 7438
715 Ga0495621_0006571 3300046539 Bacteria 3402
716 Ga0495597_0002439 3300046542 Bacteria 11798
717 Ga0495597_0015124 3300046542 Bacteria 3657
718 Ga0495622_0002022 3300046557 Bacteria 9909
719 Ga0495622_0004437 3300046557 Bacteria 6513
720 Ga0495668_0000001 3300046616 Bacteria 1013420
721 Ga0495668_0009345 3300046616 Bacteria 6028
722 Ga0495634_0002584 3300046642 Bacteria 14931
723 Ga0495611_0007262 3300046648 Bacteria 4707
724 Ga0495625_0000652 3300046660 Bacteria 49796
725 Ga0495625_0003289 3300046660 Bacteria 16312
726 Ga0495625_0007216 3300046660 Bacteria 9726
727 Ga0495625_0066964 3300046660 Bacteria 2528
728 Ga0495659_0028770 3300046664 Bacteria 1925
729 Ga0495588_0001787 3300046674 Bacteria 9163
730 Ga0495658_0001573 3300046683 Bacteria 11906
731 Ga0495669_0000001 3300046684 Bacteria 291866
732 Ga0495669_0000267 3300046684 Bacteria 29896
733 Ga0495669_0009330 3300046684 Bacteria 4134
734 Ga0495669_0019082 3300046684 Bacteria 2957
735 Ga0495613_0000333 3300046689 Bacteria 42597
736 Ga0495670_0007177 3300046691 Bacteria 5486
737 Ga0495670_0036629 3300046691 Bacteria 2444
738 Ga0495649_0000519 3300046694 Bacteria 32837
739 Ga0495660_0001590 3300046810 Bacteria 15256
740 Ga0495581_0005135 3300047315 Bacteria 7576
741 Ga0495676_0007241 3300047321 Bacteria 10167
742 Ga0495677_0022018 3300047445 Bacteria 2310
743 Ga0495679_008727 3300047446 Bacteria 4100
744 Ga0495686_0000055 3300047472 Bacteria 255566
745 Ga0495593_0000085 3300047673 Bacteria 41086
746 Ga0495614_0011605 3300048089 Bacteria 3874
747 Ga0496100_0044733 3300048903 Bacteria 2837
748 Ga0496101_0006844 3300048904 Bacteria 7358
749 Ga0496101_0045339 3300048904 Bacteria 3148
750 Ga0496102_0000143 3300048905 Bacteria 96813
751 Ga0496102_0036426 3300048905 Bacteria 4432
752 Ga0496102_0045483 3300048905 Bacteria 3985
753 Ga0496102_0291072 3300048905 Bacteria 1539
754 Ga0496103_0000098 3300048906 Bacteria 96109
755 Ga0496103_0049805 3300048906 Bacteria 2590
756 Ga0496104_0001549 3300048907 Bacteria 19809
757 Ga0496105_0004701 3300048908 Bacteria 10295
758 Ga0496105_0005017 3300048908 Bacteria 10019
759 Ga0496106_0157107 3300048909 Bacteria 1796
760 Ga0496107_0008427 3300048910 Bacteria 7132
761 Ga0496108_0047875 3300048911 Bacteria 3574
762 Ga0496108_0100383 3300048911 Bacteria 2468
763 Ga0496109_0083013 3300048912 Bacteria 2954
764 Ga0496109_0205167 3300048912 Bacteria 1853
765 Ga0496112_0034209 3300048915 Bacteria 4944
766 Ga0496113_0076581 3300048916 Bacteria 2556
767 Ga0496114_0015522 3300048917 Bacteria 6124
768 Ga0496115_0000396 3300048918 Bacteria 35918
769 Ga0496115_0000643 3300048918 Bacteria 26252
770 Ga0496115_0006459 3300048918 Bacteria 8596
771 Ga0496115_0061107 3300048918 Bacteria 3037
772 Ga0496115_0082523 3300048918 Bacteria 2619
773 Ga0496116_0000726 3300048919 Bacteria 42098
774 Ga0496117_0000121 3300048920 Bacteria 171532
775 Ga0496117_0037383 3300048920 Bacteria 3617
776 Ga0496117_0088755 3300048920 Bacteria 1999
777 Ga0496118_0000095 3300048921 Bacteria 164850
778 Ga0496118_0000677 3300048921 Bacteria 55423
779 Ga0496118_0014843 3300048921 Bacteria 7258
780 Ga0496118_0017247 3300048921 Bacteria 6583
781 Ga0496118_0048915 3300048921 Bacteria 3260
782 Ga0496119_0023813 3300048922 Bacteria 4328
783 Ga0496121_0000009 3300048924 Bacteria 836971
784 Ga0496121_0013184 3300048924 Bacteria 8910
785 Ga0496122_0001187 3300048925 Bacteria 44594
786 Ga0496123_0002266 3300048926 Bacteria 24245
787 Ga0496124_0000119 3300048927 Bacteria 163996
788 Ga0496124_0004955 3300048927 Bacteria 15261
789 Ga0496125_0000217 3300048928 Bacteria 117498
790 Ga0496125_0055255 3300048928 Bacteria 3237
791 Ga0496125_0106196 3300048928 Bacteria 2050
792 Ga0496126_0044544 3300048929 Bacteria 4085
793 Ga0495682_0002152 3300049460 Bacteria 9553
794 Ga0501031_0112002 3300049568 Bacteria 1782
795 Ga0501032_0004021 3300049569 Bacteria 11148
796 Ga0501032_0011363 3300049569 Bacteria 6395
797 Ga0501032_0048415 3300049569 Bacteria 2870
798 Ga0501033_0014661 3300049570 Bacteria 5951
799 Ga0501033_0015038 3300049570 Bacteria 5873
800 Ga0501033_0020758 3300049570 Bacteria 4962
801 Ga0501033_0022279 3300049570 Bacteria 4780
802 Ga0501033_0043351 3300049570 Bacteria 3351
803 Ga0501034_0000013 3300049571 Bacteria 297898
804 Ga0501034_0001509 3300049571 Bacteria 30551
805 Ga0501034_0007585 3300049571 Bacteria 11543
806 Ga0501034_0015313 3300049571 Bacteria 7882
807 Ga0501034_0063575 3300049571 Bacteria 3704
808 Ga0501034_0084499 3300049571 Bacteria 3176
809 Ga0501034_0148031 3300049571 Bacteria 2324
810 Ga0501034_0181167 3300049571 Bacteria 2072
811 Ga0501034_0254955 3300049571 Bacteria 1698
812 Ga0501034_0309920 3300049571 Bacteria 1513
813 Ga0501036_0018741 3300049572 Bacteria 5805
814 Ga0501036_0025076 3300049572 Bacteria 5029
815 Ga0501036_0043700 3300049572 Bacteria 3795
816 Ga0501036_0113934 3300049572 Bacteria 2285
817 Ga0501037_0000487 3300049573 Bacteria 32144
818 Ga0501037_0039423 3300049573 Bacteria 3477
819 Ga0501037_0045502 3300049573 Bacteria 3222
820 Ga0501037_0047476 3300049573 Bacteria 3147
821 Ga0501037_0119016 3300049573 Bacteria 1900
822 Ga0501038_0000009 3300049574 Bacteria 190794
823 Ga0501038_0010838 3300049574 Bacteria 8329
824 Ga0501038_0042587 3300049574 Bacteria 3954
825 Ga0501038_0046649 3300049574 Bacteria 3756
826 Ga0501038_0086165 3300049574 Bacteria 2640
827 Ga0501043_0024083 3300049579 Bacteria 4777
828 Ga0501043_0029427 3300049579 Bacteria 4315
829 Ga0501043_0031524 3300049579 Bacteria 4167
830 Ga0501043_0043621 3300049579 Bacteria 3525
831 Ga0501043_0053345 3300049579 Bacteria 3175
832 Ga0501043_0163288 3300049579 Bacteria 1740
833 Ga0501046_0003767 3300049580 Bacteria 13882
834 Ga0501046_0013968 3300049580 Bacteria 6784
835 Ga0501046_0034820 3300049580 Bacteria 4062
836 Ga0501047_0002124 3300049581 Bacteria 18973
837 Ga0501047_0003221 3300049581 Bacteria 15472
838 Ga0501047_0006557 3300049581 Bacteria 10960
839 Ga0501047_0009447 3300049581 Bacteria 9212
840 Ga0501047_0012825 3300049581 Bacteria 7941
841 Ga0501047_0026719 3300049581 Bacteria 5556
842 Ga0501047_0049086 3300049581 Bacteria 4075
843 Ga0501047_0081130 3300049581 Bacteria 3118
844 Ga0501047_0090764 3300049581 Bacteria 2932
845 Ga0501047_0110229 3300049581 Bacteria 2635
846 Ga0501047_0166649 3300049581 Bacteria 2073
847 Ga0501047_0173664 3300049581 Bacteria 2024
848 Ga0501048_0000242 3300049582 Bacteria 36361
849 Ga0501048_0072157 3300049582 Bacteria 2437
850 Ga0501048_0097818 3300049582 Bacteria 2071
851 Ga0501067_0000380 3300049583 Bacteria 24178
852 Ga0501067_0028515 3300049583 Bacteria 3093
853 Ga0501069_0020369 3300049585 Bacteria 3593
854 Ga0501069_0038330 3300049585 Bacteria 2646
855 Ga0501070_0000109 3300049586 Bacteria 72583
856 Ga0501070_0031932 3300049586 Bacteria 4410
857 Ga0501070_0127895 3300049586 Bacteria 2099
858 Ga0501071_0160797 3300049587 Bacteria 1678
859 Ga0501072_0001994 3300049588 Bacteria 15210
860 Ga0501073_0017964 3300049589 Bacteria 5115
861 Ga0501073_0091643 3300049589 Bacteria 2112
862 Ga0501073_0133789 3300049589 Bacteria 1719
863 Ga0501074_0011873 3300049590 Bacteria 6332
864 Ga0501074_0119975 3300049590 Bacteria 1881
865 Ga0501075_0025225 3300049591 Bacteria 4368
866 Ga0501075_0050247 3300049591 Bacteria 3134
867 Ga0501076_0030823 3300049592 Bacteria 4178
868 Ga0501077_0038016 3300049593 Bacteria 3064
869 Ga0501223_000067 3300049663 Bacteria 31945
870 Ga0501223_005421 3300049663 Bacteria 2680
871 Ga0501224_000036 3300049664 Bacteria 30236
872 Ga0501233_005491 3300049668 Bacteria 2355
873 Ga0501257_000014 3300049686 Bacteria 50280
874 Ga0501225_0000018 3300049705 Bacteria 59791
875 Ga0501079_0023950 3300049741 Bacteria 4683
876 Ga0501079_0109946 3300049741 Bacteria 2141
877 Ga0501080_0000003 3300049742 Bacteria 214890
878 Ga0501080_0011909 3300049742 Bacteria 7966
879 Ga0501080_0013395 3300049742 Bacteria 7542
880 Ga0501080_0036324 3300049742 Bacteria 4600
881 Ga0501080_0055866 3300049742 Bacteria 3677
882 Ga0501080_0068094 3300049742 Bacteria 3311
883 Ga0501080_0075893 3300049742 Bacteria 3126
884 Ga0501081_0104852 3300049743 Bacteria 2002
885 Ga0501081_0190352 3300049743 Bacteria 1486
886 Ga0501083_0058356 3300049744 Bacteria 2582
887 Ga0501083_0128328 3300049744 Bacteria 1662
888 Ga0501273_004451 3300049770 Bacteria 1540
889 Ga0501280_000272 3300049776 Bacteria 13149
890 Ga0501035_0000058 3300049822 Bacteria 135089
891 Ga0501035_0008525 3300049822 Bacteria 9543
892 Ga0501035_0010025 3300049822 Bacteria 8791
893 Ga0501035_0027886 3300049822 Bacteria 5160
894 Ga0501035_0074748 3300049822 Bacteria 2997
895 Ga0501035_0087634 3300049822 Bacteria 2743
896 Ga0501044_0000023 3300049823 Bacteria 196555
897 Ga0501044_0005359 3300049823 Bacteria 14252
898 Ga0501044_0005940 3300049823 Bacteria 13522
899 Ga0501044_0008325 3300049823 Bacteria 11365
900 Ga0501044_0008931 3300049823 Bacteria 10955
901 Ga0501044_0015477 3300049823 Bacteria 8215
902 Ga0501044_0017237 3300049823 Bacteria 7747
903 Ga0501044_0025782 3300049823 Bacteria 6232
904 Ga0501044_0025973 3300049823 Bacteria 6204
905 Ga0501044_0051080 3300049823 Bacteria 4264
906 Ga0501044_0080320 3300049823 Bacteria 3303
907 Ga0501044_0091812 3300049823 Bacteria 3062
908 Ga0501044_0095430 3300049823 Bacteria 2997
909 Ga0501044_0102275 3300049823 Bacteria 2881
910 Ga0501045_0031636 3300049824 Bacteria 3832
911 Ga0501226_000063 3300049853 Bacteria 35700
912 nmdc:mga00v17_2502_c1 3300050491 Bacteria 9409
913 nmdc:mga0k408_42307_c1 3300050493 Bacteria 2624
914 nmdc:mga06z11_28570_c1 3300050494 Bacteria 2678
915 nmdc:mga07m45_2641_c1 3300050496 Bacteria 8439
916 nmdc:mga05p37_102778_c1 3300050507 Bacteria 3519
917 nmdc:mga0qj67_13980_c1 3300050509 Bacteria 6062
918 nmdc:mga06r32_146215_c1 3300050510 Bacteria 2341
919 nmdc:mga08y16_191730_c1 3300050511 Bacteria 2120
920 nmdc:mga08y16_230153_c1 3300050511 Bacteria 1917
921 nmdc:mga08y16_266301_c1 3300050511 Bacteria 1769
922 nmdc:mga0n895_162800_c1 3300050512 Bacteria 2263
923 nmdc:mga0n895_32032_c1 3300050512 Bacteria 5041
924 nmdc:mga0rr50_86467_c1 3300050513 Bacteria 2432
925 nmdc:mga08x19_7707_c1 3300050514 Bacteria 6393
926 nmdc:mga0a205_24271_c2 3300050515 Bacteria 2660
927 nmdc:mga0sz30_23010_c2 3300050516 Bacteria 2172
928 Ga0495601_0053411 3300053077 Bacteria 2554
929 Ga0500635_0000847 3300053080 Bacteria 7530
930 Ga0495595_0036105 3300053084 Bacteria 2241
931 Ga0495619_0042290 3300053085 Bacteria 2983
932 Ga0500643_000407 3300053087 Bacteria 32885
933 Ga0500643_003227 3300053087 Bacteria 7939
934 Ga0500643_011792 3300053087 Bacteria 3165
935 Ga0500643_012437 3300053087 Bacteria 3048
936 Ga0500643_014657 3300053087 Bacteria 2714
937 Ga0500651_0000538 3300053093 Bacteria 19288
938 Ga0500651_0089878 3300053093 Bacteria 1892
939 Ga0500641_0002349 3300053096 Bacteria 6704
940 Ga0500641_0004883 3300053096 Bacteria 4746
941 Ga0500641_0035728 3300053096 Bacteria 1984
942 Ga0500555_015110 3300053103 Bacteria 2226
943 Ga0500556_0000049 3300053104 Bacteria 122572
944 Ga0500556_0000774 3300053104 Bacteria 18901
945 Ga0500562_000163 3300053108 Bacteria 18798
946 Ga0500562_000549 3300053108 Bacteria 9070
947 Ga0500562_001824 3300053108 Bacteria 5336
948 Ga0500592_001393 3300053116 Bacteria 3909
949 Ga0500592_009106 3300053116 Bacteria 1577
950 Ga0500593_000095 3300053117 Bacteria 33178
951 Ga0500594_0000406 3300053118 Bacteria 9542
952 Ga0500595_006788 3300053119 Bacteria 4820
953 Ga0500595_010491 3300053119 Bacteria 3680
954 Ga0500608_072404 3300053122 Bacteria 1637
955 Ga0500614_001488 3300053123 Bacteria 5584
956 Ga0500618_000123 3300053125 Bacteria 63600
957 Ga0500642_0000002 3300053130 Bacteria 795093
958 Ga0500642_0003276 3300053130 Bacteria 4872
959 Ga0500568_0001107 3300053139 Bacteria 18110
960 Ga0500604_0000695 3300053151 Bacteria 9220
961 Ga0500616_0001288 3300053153 Bacteria 24938
962 Ga0500616_0074146 3300053153 Bacteria 1726
963 Ga0500622_0003465 3300053156 Bacteria 10508
964 Ga0500624_000294 3300053157 Bacteria 17081
965 Ga0500627_0000005 3300053158 Bacteria 167950
966 Ga0500634_0000212 3300053161 Bacteria 18816
967 Ga0500636_0003201 3300053177 Bacteria 9166
968 Ga0500636_0017824 3300053177 Bacteria 4196
969 Ga0500570_000470 3300053724 Bacteria 15608
970 Ga0500645_001493 3300053730 Bacteria 11730
971 Ga0500645_002380 3300053730 Bacteria 8462
972 Ga0501084_0013927 3300054114 Bacteria 6657
973 Ga0501082_0007213 3300060353 Bacteria 9583
974 Ga0501082_0022186 3300060353 Bacteria 5472
975 Ga0466962_0026280 3300061719 Bacteria 2795
976 Ga0530510_0005973 3300061734 Bacteria 8446

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0190352 Ga0501081_0190352_24_1187 351
2 3300037466 Ga0395898_0186904 Ga0395898_0186904_15_1226 364
3 3300044656 Ga0466969_0003245 Ga0466969_0003245_7477_8622 371
4 3300046539 Ga0495621_0006571 Ga0495621_0006571_2221_3384 371
5 3300048905 Ga0496102_0291072 Ga0496102_0291072_18_1178 371
6 3300037471 Ga0395905_0297071 Ga0395905_0297071_268_1464 389
7 3300039447 Ga0436361_0135818 Ga0436361_0135818_410_1696 395
8 3300046542 Ga0495597_0015124 Ga0495597_0015124_2346_3644 396
9 3300037466 Ga0395898_0074709 Ga0395898_0074709_1928_3235 397
10 3300053077 Ga0495601_0053411 Ga0495601_0053411_1209_2516 397
11 3300053084 Ga0495595_0036105 Ga0495595_0036105_904_2211 397
12 3300048918 Ga0496115_0000396 Ga0496115_0000396_5016_6320 401
13 3300036647 Ga0316582_0032276 Ga0316582_0032276_108_1430 402
14 3300053087 Ga0500643_012437 Ga0500643_012437_1777_3030 402
15 3300015684 Ga0183365_10001 Ga0183365_100011959 403
16 3300005347 Ga0070668_100023079 Ga0070668_1000230792 407
17 3300005436 Ga0070713_100087488 Ga0070713_1000874883 408
18 3300025916 Ga0207663_10056658 Ga0207663_100566582 408
19 3300048908 Ga0496105_0005017 Ga0496105_0005017_8394_9734 409
20 3300049590 Ga0501074_0119975 Ga0501074_0119975_287_1690 409
21 3300003781 Ga0055536_1001904 Ga0055536_10019049 410
22 3300025292 Ga0209676_1001788 Ga0209676_100178814 410
23 3300049571 Ga0501034_0148031 Ga0501034_0148031_289_1623 412
24 3300049581 Ga0501047_0110229 Ga0501047_0110229_506_1840 412
25 3300049823 Ga0501044_0102275 Ga0501044_0102275_541_1875 412
26 3300035724 Ga0373933_0058424 Ga0373933_0058424_198_1532 415
27 3300025291 Ga0209675_1007120 Ga0209675_10071203 416
28 3300049742 Ga0501080_0011909 Ga0501080_0011909_205_1581 416
29 3300060353 Ga0501082_0007213 Ga0501082_0007213_6532_7908 416
30 3300005327 Ga0070658_10040543 Ga0070658_100405434 417
31 3300025909 Ga0207705_10079055 Ga0207705_100790552 417
32 3300025913 Ga0207695_10006268 Ga0207695_1000626814 417
33 3300046660 Ga0495625_0003289 Ga0495625_0003289_1303_2619 417
34 3300049581 Ga0501047_0012825 Ga0501047_0012825_1038_2351 417
35 3300049581 Ga0501047_0173664 Ga0501047_0173664_466_1869 417
36 3300049583 Ga0501067_0028515 Ga0501067_0028515_306_1619 417
37 3300049588 Ga0501072_0001994 Ga0501072_0001994_3386_4699 417
38 3300049742 Ga0501080_0068094 Ga0501080_0068094_828_2141 417
39 3300049570 Ga0501033_0022279 Ga0501033_0022279_681_2051 418
40 3300049571 Ga0501034_0084499 Ga0501034_0084499_949_2361 418
41 3300049582 Ga0501048_0097818 Ga0501048_0097818_23_1426 418
42 3300049587 Ga0501071_0160797 Ga0501071_0160797_66_1469 418
43 3300049589 Ga0501073_0133789 Ga0501073_0133789_135_1538 418
44 3300049591 Ga0501075_0050247 Ga0501075_0050247_1342_2745 418
45 3300049743 Ga0501081_0104852 Ga0501081_0104852_14_1417 418
46 3300009545 Ga0105237_10038275 Ga0105237_100382755 419
47 3300049586 Ga0501070_0127895 Ga0501070_0127895_71_1399 419
48 3300026116 Ga0207674_10050669 Ga0207674_100506694 420
49 3300028800 Ga0265338_10014834 Ga0265338_100148347 420
50 3300035695 Ga0373927_0001191 Ga0373927_0001191_1225_2628 420
51 3300037068 Ga0373925_0000136 Ga0373925_0000136_4065_5468 420
52 3300048916 Ga0496113_0076581 Ga0496113_0076581_226_1629 420
53 3300049579 Ga0501043_0163288 Ga0501043_0163288_139_1455 421
54 3300049589 Ga0501073_0091643 Ga0501073_0091643_466_1782 421
55 3300049742 Ga0501080_0013395 Ga0501080_0013395_708_2024 421
56 3300054114 Ga0501084_0013927 Ga0501084_0013927_3739_5055 421
57 3300046684 Ga0495669_0019082 Ga0495669_0019082_515_1879 422
58 3300049582 Ga0501048_0000242 Ga0501048_0000242_23791_25224 422
59 3300005262 Ga0065165_1000029 Ga0065165_1000029176 423
60 3300005618 Ga0068864_100000472 Ga0068864_10000047225 423
61 3300005841 Ga0068863_100005428 Ga0068863_1000054289 423
62 3300005842 Ga0068858_100000098 Ga0068858_10000009865 423
63 3300014325 Ga0163163_10031710 Ga0163163_100317103 423
64 3300026035 Ga0207703_10000086 Ga0207703_1000008680 423
65 3300026088 Ga0207641_10000012 Ga0207641_1000001241 423
66 3300026095 Ga0207676_10000445 Ga0207676_1000044524 423
67 3300031235 Ga0265330_10040206 Ga0265330_100402062 423
68 3300031247 Ga0265340_10000071 Ga0265340_1000007111 423
69 3300031250 Ga0265331_10094110 Ga0265331_100941101 423
70 3300031344 Ga0265316_10020337 Ga0265316_100203373 423
71 3300031344 Ga0265316_10101941 Ga0265316_101019411 423
72 3300031712 Ga0265342_10056439 Ga0265342_100564391 423
73 3300048918 Ga0496115_0082523 Ga0496115_0082523_1111_2514 423
74 3300005347 Ga0070668_100076218 Ga0070668_1000762181 424
75 3300005844 Ga0068862_100004861 Ga0068862_1000048619 424
76 3300009551 Ga0105238_10056986 Ga0105238_100569863 424
77 3300036401 Ga0373937_0257417 Ga0373937_0257417_261_1634 424
78 iso_pu_bacteria 2928531327 2928533013 424
79 3300031730 Ga0307516_10041770 Ga0307516_100417705 425
80 3300048927 Ga0496124_0004955 Ga0496124_0004955_1691_3091 425
81 3300049572 Ga0501036_0025076 Ga0501036_0025076_3666_4982 425
82 3300049581 Ga0501047_0006557 Ga0501047_0006557_2661_3977 425
83 3300049585 Ga0501069_0020369 Ga0501069_0020369_25_1341 425
84 3300049590 Ga0501074_0011873 Ga0501074_0011873_1743_3059 425
85 3300049741 Ga0501079_0023950 Ga0501079_0023950_1603_2919 425
86 3300049822 Ga0501035_0087634 Ga0501035_0087634_496_1812 425
87 3300049823 Ga0501044_0015477 Ga0501044_0015477_5519_6835 425
88 3300053130 Ga0500642_0003276 Ga0500642_0003276_712_2055 425
89 iso_pu_bacteria 2739367756 2739793030 425
90 3300003781 Ga0055536_1007868 Ga0055536_10078684 426
91 3300003791 Ga0055530_10000013 Ga0055530_10000013111 426
92 3300003794 Ga0055531_10000627 Ga0055531_1000062718 426
93 3300003794 Ga0055531_10006022 Ga0055531_100060227 426
94 3300006195 Ga0075366_10012514 Ga0075366_100125144 426
95 3300009094 Ga0111539_10221374 Ga0111539_102213742 426
96 3300021384 Ga0213876_10000125 Ga0213876_1000012546 426
97 3300025291 Ga0209675_1000808 Ga0209675_100080814 426
98 3300025292 Ga0209676_1000221 Ga0209676_1000221109 426
99 3300025294 Ga0209025_1021699 Ga0209025_10216991 426
100 3300025298 Ga0209050_1000042 Ga0209050_1000042278 426
101 3300025304 Ga0209257_1000135 Ga0209257_1000135109 426
102 3300025304 Ga0209257_1000487 Ga0209257_100048717 426
103 3300025909 Ga0207705_10005248 Ga0207705_100052489 426
104 3300025919 Ga0207657_10002252 Ga0207657_1000225222 426
105 3300025932 Ga0207690_10004547 Ga0207690_100045478 426
106 3300028556 Ga0265337_1010633 Ga0265337_10106332 426
107 3300039437 Ga0436365_0749742 Ga0436365_0749742_101243_102691 426
108 3300046660 Ga0495625_0066964 Ga0495625_0066964_474_1883 426
109 3300048924 Ga0496121_0000009 Ga0496121_0000009_761768_763174 426
110 3300049686 Ga0501257_000014 Ga0501257_000014_31488_32813 426
111 3300049741 Ga0501079_0109946 Ga0501079_0109946_382_1725 426
112 3300049776 Ga0501280_000272 Ga0501280_000272_1839_3164 426
113 3300050493 nmdc:mga0k408_42307_c1 nmdc:mga0k408_42307_c1_1188_2597 426
114 3300050511 nmdc:mga08y16_191730_c1 nmdc:mga08y16_191730_c1_678_2021 426
115 3300053156 Ga0500622_0003465 Ga0500622_0003465_7149_8573 426
116 iso_pu_bacteria 2582581305 2585259781 426
117 iso_pu_bacteria 2585428106 2587919210 426
118 iso_pu_bacteria 2643221591 2643963229 426
119 iso_pu_bacteria 2643221640 2644225040 426
120 iso_pu_bacteria 2643221642 2644232348 426
121 iso_pu_bacteria 2643221733 2644729152 426
122 3300005331 Ga0070670_100000050 Ga0070670_10000005018 427
123 3300005456 Ga0070678_100013030 Ga0070678_1000130305 427
124 3300005937 Ga0081455_10004974 Ga0081455_100049744 427
125 3300006358 Ga0068871_100166216 Ga0068871_1001662162 427
126 3300006847 Ga0075431_100088461 Ga0075431_1000884612 427
127 3300006852 Ga0075433_10016841 Ga0075433_1001684110 427
128 3300013297 Ga0157378_10007224 Ga0157378_100072247 427
129 3300013297 Ga0157378_10025468 Ga0157378_100254683 427
130 3300013306 Ga0163162_10098343 Ga0163162_100983433 427
131 3300014968 Ga0157379_10017776 Ga0157379_100177765 427
132 3300014968 Ga0157379_10026633 Ga0157379_100266332 427
133 3300026121 Ga0207683_10021308 Ga0207683_100213084 427
134 3300035695 Ga0373927_0079266 Ga0373927_0079266_531_1922 427
135 3300035725 Ga0373947_0003164 Ga0373947_0003164_3448_4839 427
136 3300037853 Ga0436364_0050837 Ga0436364_0050837_335_1711 427
137 3300046455 Ga0495603_0001675 Ga0495603_0001675_5931_7322 427
138 3300046459 Ga0495629_0001791 Ga0495629_0001791_160_1551 427
139 3300046472 Ga0495580_0000080 Ga0495580_0000080_14246_15637 427
140 3300046473 Ga0495582_0000988 Ga0495582_0000988_10894_12285 427
141 3300046475 Ga0495639_0002279 Ga0495639_0002279_3415_4806 427
142 3300046499 Ga0495594_0000223 Ga0495594_0000223_11070_12461 427
143 3300046531 Ga0495665_0017316 Ga0495665_0017316_1747_3138 427
144 3300046557 Ga0495622_0002022 Ga0495622_0002022_42_1433 427
145 3300046642 Ga0495634_0002584 Ga0495634_0002584_12867_14258 427
146 3300046674 Ga0495588_0001787 Ga0495588_0001787_2636_4027 427
147 3300046683 Ga0495658_0001573 Ga0495658_0001573_5632_7023 427
148 3300046689 Ga0495613_0000333 Ga0495613_0000333_5554_6945 427
149 3300046694 Ga0495649_0000519 Ga0495649_0000519_10753_12147 427
150 3300047315 Ga0495581_0005135 Ga0495581_0005135_1632_3023 427
151 3300047321 Ga0495676_0007241 Ga0495676_0007241_7868_9259 427
152 3300047446 Ga0495679_008727 Ga0495679_008727_2377_3822 427
153 3300047673 Ga0495593_0000085 Ga0495593_0000085_3506_4897 427
154 3300048089 Ga0495614_0011605 Ga0495614_0011605_2423_3814 427
155 3300049569 Ga0501032_0004021 Ga0501032_0004021_8206_9639 427
156 3300049569 Ga0501032_0048415 Ga0501032_0048415_418_1776 427
157 3300049570 Ga0501033_0014661 Ga0501033_0014661_13_1371 427
158 3300049571 Ga0501034_0000013 Ga0501034_0000013_183349_184782 427
159 3300049571 Ga0501034_0015313 Ga0501034_0015313_2101_3459 427
160 3300049572 Ga0501036_0043700 Ga0501036_0043700_1981_3414 427
161 3300049572 Ga0501036_0113934 Ga0501036_0113934_438_1796 427
162 3300049573 Ga0501037_0000487 Ga0501037_0000487_21414_22847 427
163 3300049574 Ga0501038_0010838 Ga0501038_0010838_4972_6405 427
164 3300049579 Ga0501043_0053345 Ga0501043_0053345_689_2122 427
165 3300049580 Ga0501046_0003767 Ga0501046_0003767_10806_12239 427
166 3300049581 Ga0501047_0009447 Ga0501047_0009447_7026_8459 427
167 3300049582 Ga0501048_0072157 Ga0501048_0072157_56_1489 427
168 3300049583 Ga0501067_0000380 Ga0501067_0000380_14591_16024 427
169 3300049586 Ga0501070_0031932 Ga0501070_0031932_2013_3446 427
170 3300049589 Ga0501073_0017964 Ga0501073_0017964_279_1712 427
171 3300049742 Ga0501080_0000003 Ga0501080_0000003_175879_177312 427
172 3300049742 Ga0501080_0036324 Ga0501080_0036324_2819_4177 427
173 3300049744 Ga0501083_0128328 Ga0501083_0128328_123_1481 427
174 3300049822 Ga0501035_0000058 Ga0501035_0000058_19202_20635 427
175 3300049823 Ga0501044_0000023 Ga0501044_0000023_80617_82050 427
176 3300049823 Ga0501044_0080320 Ga0501044_0080320_303_1661 427
177 3300049824 Ga0501045_0031636 Ga0501045_0031636_1515_2948 427
178 3300050512 nmdc:mga0n895_162800_c1 nmdc:mga0n895_162800_c1_642_2045 427
179 3300053125 Ga0500618_000123 Ga0500618_000123_38741_40186 427
180 iso_pu_bacteria 2643221580 2643912417 427
181 iso_pu_bacteria 2643221674 2644410736 427
182 iso_pu_bacteria 2643221734 2644735514 427
183 iso_pu_bacteria 2917699015 2917699375 427
184 iso_pu_bacteria 2932401849 2932403476 427
185 3300003791 Ga0055530_10005482 Ga0055530_100054822 428
186 3300003794 Ga0055531_10000667 Ga0055531_1000066710 428
187 3300003794 Ga0055531_10000800 Ga0055531_1000080024 428
188 3300005548 Ga0070665_100022755 Ga0070665_1000227557 428
189 3300010375 Ga0105239_10148198 Ga0105239_101481982 428
190 3300013307 Ga0157372_10028104 Ga0157372_100281046 428
191 3300013308 Ga0157375_10054963 Ga0157375_100549635 428
192 3300025292 Ga0209676_1000151 Ga0209676_100015129 428
193 3300025298 Ga0209050_1001101 Ga0209050_100110113 428
194 3300025304 Ga0209257_1000413 Ga0209257_100041345 428
195 3300025304 Ga0209257_1000760 Ga0209257_100076023 428
196 3300026041 Ga0207639_10076993 Ga0207639_100769932 428
197 3300032004 Ga0307414_10008109 Ga0307414_100081092 428
198 3300046660 Ga0495625_0007216 Ga0495625_0007216_2257_3660 428
199 3300046810 Ga0495660_0001590 Ga0495660_0001590_5741_7204 428
200 3300048921 Ga0496118_0014843 Ga0496118_0014843_1373_2779 428
201 3300053087 Ga0500643_011792 Ga0500643_011792_918_2300 428
202 3300053108 Ga0500562_000549 Ga0500562_000549_6084_7466 428
203 3300053730 Ga0500645_002380 Ga0500645_002380_4673_6055 428
204 iso_pu_bacteria 2643221598 2644002096 428
205 iso_pu_bacteria 2643221614 2644085507 428
206 iso_pu_bacteria 2643221661 2644343059 428
207 iso_pu_bacteria 2643221666 2644366359 428
208 iso_pu_bacteria 2818991435 2819539327 428
209 iso_pu_bacteria 2818991454 2819647799 428
210 3300005330 Ga0070690_100047251 Ga0070690_1000472512 429
211 3300005345 Ga0070692_10008265 Ga0070692_100082654 429
212 3300005364 Ga0070673_100257186 Ga0070673_1002571861 429
213 3300005365 Ga0070688_100118190 Ga0070688_1001181901 429
214 3300005435 Ga0070714_100126231 Ga0070714_1001262311 429
215 3300005440 Ga0070705_100015454 Ga0070705_1000154542 429
216 3300005530 Ga0070679_100080501 Ga0070679_1000805014 429
217 3300005536 Ga0070697_100010332 Ga0070697_1000103323 429
218 3300005547 Ga0070693_100001672 Ga0070693_1000016722 429
219 3300005548 Ga0070665_100073128 Ga0070665_1000731282 429
220 3300005548 Ga0070665_100153619 Ga0070665_1001536192 429
221 3300005563 Ga0068855_100116015 Ga0068855_1001160152 429
222 3300005564 Ga0070664_100136620 Ga0070664_1001366202 429
223 3300005578 Ga0068854_100080460 Ga0068854_1000804603 429
224 3300005842 Ga0068858_100031490 Ga0068858_1000314903 429
225 3300005843 Ga0068860_100022267 Ga0068860_1000222674 429
226 3300005844 Ga0068862_100044274 Ga0068862_1000442744 429
227 3300005844 Ga0068862_100100985 Ga0068862_1001009852 429
228 3300006163 Ga0070715_10004104 Ga0070715_100041042 429
229 3300006844 Ga0075428_100060508 Ga0075428_1000605083 429
230 3300006881 Ga0068865_100022539 Ga0068865_1000225393 429
231 3300009101 Ga0105247_10006738 Ga0105247_100067384 429
232 3300009148 Ga0105243_10002889 Ga0105243_100028899 429
233 3300009148 Ga0105243_10029612 Ga0105243_100296123 429
234 3300009177 Ga0105248_10022662 Ga0105248_1002266211 429
235 3300009177 Ga0105248_10041909 Ga0105248_100419095 429
236 3300009551 Ga0105238_10056284 Ga0105238_100562841 429
237 3300009553 Ga0105249_10033372 Ga0105249_100333724 429
238 3300013102 Ga0157371_10015685 Ga0157371_100156852 429
239 3300013297 Ga0157378_10014358 Ga0157378_100143588 429
240 3300013308 Ga0157375_10002209 Ga0157375_100022092 429
241 3300014325 Ga0163163_10032695 Ga0163163_100326952 429
242 3300014969 Ga0157376_10124306 Ga0157376_101243062 429
243 3300025904 Ga0207647_10004963 Ga0207647_100049637 429
244 3300025915 Ga0207693_10001172 Ga0207693_100011727 429
245 3300025924 Ga0207694_10129105 Ga0207694_101291052 429
246 3300025932 Ga0207690_10034528 Ga0207690_100345282 429
247 3300025935 Ga0207709_10146240 Ga0207709_101462401 429
248 3300025936 Ga0207670_10016263 Ga0207670_100162632 429
249 3300025940 Ga0207691_10014720 Ga0207691_100147204 429
250 3300025941 Ga0207711_10066920 Ga0207711_100669202 429
251 3300025972 Ga0207668_10003452 Ga0207668_100034527 429
252 3300026067 Ga0207678_10000698 Ga0207678_100006982 429
253 3300026121 Ga0207683_10000527 Ga0207683_1000052729 429
254 3300028379 Ga0268266_10090362 Ga0268266_100903621 429
255 3300028380 Ga0268265_10029731 Ga0268265_100297312 429
256 3300032004 Ga0307414_10048172 Ga0307414_100481723 429
257 3300035114 Ga0373939_0011890 Ga0373939_0011890_780_2183 429
258 3300037312 Ga0395899_0000399 Ga0395899_0000399_27862_29319 429
259 3300037312 Ga0395899_0014303 Ga0395899_0014303_4652_6034 429
260 3300037418 Ga0395900_0000010 Ga0395900_0000010_287071_288528 429
261 3300037418 Ga0395900_0033116 Ga0395900_0033116_2483_3865 429
262 3300037418 Ga0395900_0122468 Ga0395900_0122468_261_1664 429
263 3300037466 Ga0395898_0001666 Ga0395898_0001666_4598_6055 429
264 3300037466 Ga0395898_0110442 Ga0395898_0110442_1069_2451 429
265 3300037471 Ga0395905_0000130 Ga0395905_0000130_24927_26357 429
266 3300037471 Ga0395905_0001118 Ga0395905_0001118_1003_2406 429
267 3300037471 Ga0395905_0004354 Ga0395905_0004354_7355_8812 429
268 3300038443 Ga0395901_0000007 Ga0395901_0000007_371435_372892 429
269 3300038443 Ga0395901_0062898 Ga0395901_0062898_182_1585 429
270 3300046460 Ga0495638_0000800 Ga0495638_0000800_20114_21520 429
271 3300046512 Ga0495610_0000336 Ga0495610_0000336_20759_22204 429
272 3300048903 Ga0496100_0044733 Ga0496100_0044733_109_1512 429
273 3300048907 Ga0496104_0001549 Ga0496104_0001549_7939_9342 429
274 3300048908 Ga0496105_0004701 Ga0496105_0004701_8375_9778 429
275 3300048910 Ga0496107_0008427 Ga0496107_0008427_4306_5709 429
276 3300048911 Ga0496108_0100383 Ga0496108_0100383_970_2373 429
277 3300048912 Ga0496109_0205167 Ga0496109_0205167_438_1841 429
278 3300048917 Ga0496114_0015522 Ga0496114_0015522_2049_3452 429
279 3300048918 Ga0496115_0006459 Ga0496115_0006459_2524_3927 429
280 3300048921 Ga0496118_0000677 Ga0496118_0000677_20177_21484 429
281 3300048928 Ga0496125_0000217 Ga0496125_0000217_61827_63209 429
282 3300049571 Ga0501034_0007585 Ga0501034_0007585_5728_7113 429
283 3300049571 Ga0501034_0309920 Ga0501034_0309920_99_1484 429
284 3300049579 Ga0501043_0031524 Ga0501043_0031524_560_1921 429
285 3300049591 Ga0501075_0025225 Ga0501075_0025225_1562_2950 429
286 3300049593 Ga0501077_0038016 Ga0501077_0038016_165_1553 429
287 3300049823 Ga0501044_0091812 Ga0501044_0091812_467_1828 429
288 3300050507 nmdc:mga05p37_102778_c1 nmdc:mga05p37_102778_c1_433_1836 429
289 3300053085 Ga0495619_0042290 Ga0495619_0042290_1451_2854 429
290 3300053151 Ga0500604_0000695 Ga0500604_0000695_5806_7188 429
291 3300053161 Ga0500634_0000212 Ga0500634_0000212_998_2383 429
292 iso_pu_bacteria 2643221563 2643835843 429
293 iso_pu_bacteria 2643221608 2644056769 429
294 iso_pu_bacteria 2643221736 2644746757 429
295 iso_pu_bacteria 2841760612 2841762604 429
296 iso_pu_bacteria 2841911363 2841913526 429
297 iso_pu_bacteria 2841917233 2841919273 429
298 iso_pu_bacteria 2844104063 2844110388 429
299 iso_pu_bacteria 2851182111 2851187046 429
300 iso_pu_bacteria 2851246043 2851252050 429
301 iso_pu_bacteria 2852653556 2852655017 429
302 iso_pu_bacteria 2852680915 2852681522 429
303 iso_pu_bacteria 8057529695 8057535338 429
304 3300003214 JGI25165J46597_1003861 JGI25165J46597_10038614 430
305 3300005366 Ga0070659_100001909 Ga0070659_10000190911 430
306 3300005458 Ga0070681_10009284 Ga0070681_100092845 430
307 3300005530 Ga0070679_100161731 Ga0070679_1001617312 430
308 3300005539 Ga0068853_100053469 Ga0068853_1000534692 430
309 3300005563 Ga0068855_100044198 Ga0068855_1000441982 430
310 3300005618 Ga0068864_100085254 Ga0068864_1000852541 430
311 3300005843 Ga0068860_100282863 Ga0068860_1002828632 430
312 3300014325 Ga0163163_10153893 Ga0163163_101538932 430
313 3300025231 Ga0207427_101301 Ga0207427_1013017 430
314 3300025261 Ga0209233_1001390 Ga0209233_10013905 430
315 3300025299 Ga0209256_1000743 Ga0209256_100074315 430
316 3300025914 Ga0207671_10000701 Ga0207671_1000070132 430
317 3300025942 Ga0207689_10155032 Ga0207689_101550321 430
318 3300028379 Ga0268266_10000474 Ga0268266_100004749 430
319 3300028556 Ga0265337_1001828 Ga0265337_10018287 430
320 3300028786 Ga0307517_10025834 Ga0307517_100258344 430
321 3300028800 Ga0265338_10020764 Ga0265338_100207643 430
322 3300031241 Ga0265325_10001499 Ga0265325_100014995 430
323 3300031249 Ga0265339_10004519 Ga0265339_1000451911 430
324 3300031251 Ga0265327_10020337 Ga0265327_100203372 430
325 3300032004 Ga0307414_10241746 Ga0307414_102417461 430
326 3300039450 Ga0436363_0882399 Ga0436363_0882399_180_1553 430
327 3300046473 Ga0495582_0077552 Ga0495582_0077552_17_1357 430
328 3300046520 Ga0495637_0024359 Ga0495637_0024359_180_1502 430
329 3300046522 Ga0495643_0031941 Ga0495643_0031941_912_2234 430
330 3300046531 Ga0495665_0043953 Ga0495665_0043953_419_1759 430
331 3300053087 Ga0500643_000407 Ga0500643_000407_8903_10225 430
332 3300053093 Ga0500651_0000538 Ga0500651_0000538_6814_8136 430
333 3300053096 Ga0500641_0002349 Ga0500641_0002349_314_1636 430
334 3300053108 Ga0500562_000163 Ga0500562_000163_16358_17746 430
335 3300053116 Ga0500592_009106 Ga0500592_009106_43_1365 430
336 3300053123 Ga0500614_001488 Ga0500614_001488_3261_4583 430
337 3300053724 Ga0500570_000470 Ga0500570_000470_4186_5508 430
338 iso_pu_bacteria 2643221629 2644166842 430
339 iso_pu_bacteria 2643221662 2644349356 430
340 3300003187 JGI25151J46595_10000038 JGI25151J46595_10000038119 431
341 3300003771 Ga0055526_1000282 Ga0055526_100028217 431
342 3300003771 Ga0055526_1001779 Ga0055526_10017793 431
343 3300003775 Ga0055524_1000091 Ga0055524_100009157 431
344 3300005331 Ga0070670_100048561 Ga0070670_1000485613 431
345 3300005347 Ga0070668_100067102 Ga0070668_1000671023 431
346 3300005367 Ga0070667_100090483 Ga0070667_1000904833 431
347 3300005548 Ga0070665_100022780 Ga0070665_1000227804 431
348 3300005618 Ga0068864_100014781 Ga0068864_1000147813 431
349 3300005841 Ga0068863_100105700 Ga0068863_1001057003 431
350 3300005842 Ga0068858_100237180 Ga0068858_1002371801 431
351 3300005843 Ga0068860_100000583 Ga0068860_10000058323 431
352 3300005843 Ga0068860_100140979 Ga0068860_1001409792 431
353 3300005844 Ga0068862_100196208 Ga0068862_1001962082 431
354 3300006881 Ga0068865_100000723 Ga0068865_1000007235 431
355 3300009093 Ga0105240_10003194 Ga0105240_100031945 431
356 3300009093 Ga0105240_10050693 Ga0105240_100506933 431
357 3300009177 Ga0105248_10006553 Ga0105248_100065539 431
358 3300010375 Ga0105239_10000157 Ga0105239_1000015722 431
359 3300013250 Ga0171462_1040 Ga0171462_104052 431
360 3300013308 Ga0157375_10169873 Ga0157375_101698731 431
361 3300025291 Ga0209675_1001346 Ga0209675_100134614 431
362 3300025294 Ga0209025_1000014 Ga0209025_1000014114 431
363 3300025295 Ga0209564_1000105 Ga0209564_100010588 431
364 3300025295 Ga0209564_1000150 Ga0209564_100015088 431
365 3300025299 Ga0209256_1000108 Ga0209256_100010888 431
366 3300025299 Ga0209256_1000128 Ga0209256_100012823 431
367 3300025913 Ga0207695_10001296 Ga0207695_1000129620 431
368 3300025913 Ga0207695_10037479 Ga0207695_100374793 431
369 3300025914 Ga0207671_10007162 Ga0207671_100071628 431
370 3300025925 Ga0207650_10008947 Ga0207650_100089473 431
371 3300025935 Ga0207709_10093380 Ga0207709_100933802 431
372 3300025941 Ga0207711_10007924 Ga0207711_100079245 431
373 3300025972 Ga0207668_10018563 Ga0207668_100185633 431
374 3300026088 Ga0207641_10087523 Ga0207641_100875231 431
375 3300026095 Ga0207676_10012291 Ga0207676_100122915 431
376 3300026095 Ga0207676_10124390 Ga0207676_101243902 431
377 3300026121 Ga0207683_10167283 Ga0207683_101672832 431
378 3300028379 Ga0268266_10036647 Ga0268266_100366472 431
379 3300028381 Ga0268264_10000046 Ga0268264_1000004623 431
380 3300031456 Ga0307513_10004817 Ga0307513_1000481713 431
381 3300031548 Ga0307408_100049854 Ga0307408_1000498544 431
382 3300031730 Ga0307516_10000004 Ga0307516_10000004201 431
383 3300031852 Ga0307410_10004727 Ga0307410_100047275 431
384 3300032002 Ga0307416_100018999 Ga0307416_1000189995 431
385 3300032005 Ga0307411_10010448 Ga0307411_100104484 431
386 3300032126 Ga0307415_100003761 Ga0307415_1000037615 431
387 3300033180 Ga0307510_10007774 Ga0307510_100077742 431
388 3300037068 Ga0373925_0033525 Ga0373925_0033525_1583_2983 431
389 3300046528 Ga0495642_0014466 Ga0495642_0014466_948_2348 431
390 3300046648 Ga0495611_0007262 Ga0495611_0007262_3209_4609 431
391 3300047472 Ga0495686_0000055 Ga0495686_0000055_5027_6355 431
392 3300048905 Ga0496102_0000143 Ga0496102_0000143_34296_35612 431
393 3300048905 Ga0496102_0036426 Ga0496102_0036426_2375_3775 431
394 3300048906 Ga0496103_0000098 Ga0496103_0000098_34280_35596 431
395 3300048915 Ga0496112_0034209 Ga0496112_0034209_3226_4626 431
396 3300048919 Ga0496116_0000726 Ga0496116_0000726_5920_7236 431
397 3300048920 Ga0496117_0000121 Ga0496117_0000121_68050_69366 431
398 3300048920 Ga0496117_0088755 Ga0496117_0088755_344_1654 431
399 3300048921 Ga0496118_0000095 Ga0496118_0000095_102167_103483 431
400 3300048921 Ga0496118_0017247 Ga0496118_0017247_779_2104 431
401 3300048921 Ga0496118_0048915 Ga0496118_0048915_1523_2833 431
402 3300048922 Ga0496119_0023813 Ga0496119_0023813_217_1545 431
403 3300048924 Ga0496121_0013184 Ga0496121_0013184_7464_8789 431
404 3300048927 Ga0496124_0000119 Ga0496124_0000119_102167_103483 431
405 3300048928 Ga0496125_0106196 Ga0496125_0106196_197_1603 431
406 3300049581 Ga0501047_0002124 Ga0501047_0002124_2797_4200 431
407 3300049581 Ga0501047_0049086 Ga0501047_0049086_872_2269 431
408 3300049663 Ga0501223_005421 Ga0501223_005421_783_2159 431
409 3300049770 Ga0501273_004451 Ga0501273_004451_132_1508 431
410 3300050514 nmdc:mga08x19_7707_c1 nmdc:mga08x19_7707_c1_163_1569 431
411 3300053153 Ga0500616_0074146 Ga0500616_0074146_189_1592 431
412 iso_pu_bacteria 2884960567 2884960873 431
413 3300005262 Ga0065165_1000667 Ga0065165_100066713 432
414 3300005327 Ga0070658_10069401 Ga0070658_100694012 432
415 3300005344 Ga0070661_100019658 Ga0070661_1000196582 432
416 3300005366 Ga0070659_100001844 Ga0070659_1000018442 432
417 3300005530 Ga0070679_100083661 Ga0070679_1000836614 432
418 3300005530 Ga0070679_100114822 Ga0070679_1001148223 432
419 3300005548 Ga0070665_100000248 Ga0070665_1000002486 432
420 3300005563 Ga0068855_100000010 Ga0068855_100000010120 432
421 3300005578 Ga0068854_100172581 Ga0068854_1001725811 432
422 3300005578 Ga0068854_100179449 Ga0068854_1001794492 432
423 3300005616 Ga0068852_100002080 Ga0068852_1000020807 432
424 3300005616 Ga0068852_100007208 Ga0068852_1000072084 432
425 3300005937 Ga0081455_10001641 Ga0081455_1000164126 432
426 3300009093 Ga0105240_10000189 Ga0105240_1000018968 432
427 3300009551 Ga0105238_10036572 Ga0105238_100365725 432
428 3300010375 Ga0105239_10022193 Ga0105239_100221933 432
429 3300013100 Ga0157373_10000549 Ga0157373_100005494 432
430 3300013105 Ga0157369_10010154 Ga0157369_100101547 432
431 3300013105 Ga0157369_10046948 Ga0157369_100469482 432
432 3300013307 Ga0157372_10020017 Ga0157372_100200172 432
433 3300025284 Ga0209130_1000697 Ga0209130_100069713 432
434 3300025302 Ga0207426_1007192 Ga0207426_10071923 432
435 3300025900 Ga0207710_10025882 Ga0207710_100258823 432
436 3300025913 Ga0207695_10000003 Ga0207695_10000003495 432
437 3300025920 Ga0207649_10014458 Ga0207649_100144584 432
438 3300025924 Ga0207694_10000011 Ga0207694_10000011266 432
439 3300025929 Ga0207664_10005602 Ga0207664_100056024 432
440 3300025929 Ga0207664_10123471 Ga0207664_101234712 432
441 3300025932 Ga0207690_10000066 Ga0207690_1000006639 432
442 3300025932 Ga0207690_10009334 Ga0207690_100093342 432
443 3300025949 Ga0207667_10000093 Ga0207667_10000093106 432
444 3300025981 Ga0207640_10042562 Ga0207640_100425621 432
445 3300028379 Ga0268266_10000005 Ga0268266_100000051200 432
446 3300028800 Ga0265338_10029551 Ga0265338_100295517 432
447 3300030521 Ga0307511_10050145 Ga0307511_100501451 432
448 3300031247 Ga0265340_10002678 Ga0265340_100026785 432
449 3300031251 Ga0265327_10000074 Ga0265327_10000074146 432
450 3300031251 Ga0265327_10001725 Ga0265327_1000172516 432
451 3300031711 Ga0265314_10009963 Ga0265314_100099635 432
452 3300031712 Ga0265342_10011993 Ga0265342_100119933 432
453 3300031712 Ga0265342_10099770 Ga0265342_100997701 432
454 3300031730 Ga0307516_10024467 Ga0307516_100244672 432
455 3300033180 Ga0307510_10132745 Ga0307510_101327451 432
456 3300042436 Ga0439435_0004642 Ga0439435_0004642_1309_2715 432
457 3300045051 Ga0451576_0003258 Ga0451576_0003258_2249_3679 432
458 3300046512 Ga0495610_0047880 Ga0495610_0047880_608_2020 432
459 3300048918 Ga0496115_0000643 Ga0496115_0000643_19495_20907 432
460 3300048920 Ga0496117_0037383 Ga0496117_0037383_1767_3233 432
461 3300048928 Ga0496125_0055255 Ga0496125_0055255_1543_2949 432
462 3300049460 Ga0495682_0002152 Ga0495682_0002152_4301_5632 432
463 3300049570 Ga0501033_0015038 Ga0501033_0015038_1761_3143 432
464 3300049571 Ga0501034_0001509 Ga0501034_0001509_8837_10228 432
465 3300049571 Ga0501034_0063575 Ga0501034_0063575_494_1894 432
466 3300049573 Ga0501037_0045502 Ga0501037_0045502_138_1520 432
467 3300049573 Ga0501037_0047476 Ga0501037_0047476_299_1633 432
468 3300049574 Ga0501038_0086165 Ga0501038_0086165_1217_2551 432
469 3300049579 Ga0501043_0029427 Ga0501043_0029427_773_2107 432
470 3300049581 Ga0501047_0026719 Ga0501047_0026719_2991_4373 432
471 3300049586 Ga0501070_0000109 Ga0501070_0000109_2662_3996 432
472 3300049742 Ga0501080_0075893 Ga0501080_0075893_662_1996 432
473 3300049822 Ga0501035_0008525 Ga0501035_0008525_3897_5231 432
474 3300049822 Ga0501035_0074748 Ga0501035_0074748_294_1640 432
475 3300049823 Ga0501044_0008325 Ga0501044_0008325_3882_5264 432
476 3300049823 Ga0501044_0008931 Ga0501044_0008931_5838_7172 432
477 3300049823 Ga0501044_0017237 Ga0501044_0017237_4489_5823 432
478 3300049823 Ga0501044_0025782 Ga0501044_0025782_3604_4938 432
479 3300049823 Ga0501044_0095430 Ga0501044_0095430_711_2045 432
480 3300050511 nmdc:mga08y16_266301_c1 nmdc:mga08y16_266301_c1_222_1628 432
481 3300053096 Ga0500641_0004883 Ga0500641_0004883_84_1514 432
482 3300053096 Ga0500641_0035728 Ga0500641_0035728_225_1622 432
483 3300053116 Ga0500592_001393 Ga0500592_001393_716_2029 432
484 iso_pu_bacteria 2643221547 2643756489 432
485 iso_pu_bacteria 2818991467 2819721055 432
486 3300003214 JGI25165J46597_1000425 JGI25165J46597_100042541 433
487 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006361 433
488 3300003791 Ga0055530_10004835 Ga0055530_100048354 433
489 3300005331 Ga0070670_100006180 Ga0070670_10000618010 433
490 3300005335 Ga0070666_10000234 Ga0070666_1000023427 433
491 3300005336 Ga0070680_100022755 Ga0070680_1000227555 433
492 3300005336 Ga0070680_100022987 Ga0070680_1000229873 433
493 3300005341 Ga0070691_10005886 Ga0070691_100058866 433
494 3300005344 Ga0070661_100000415 Ga0070661_10000041514 433
495 3300005347 Ga0070668_100001563 Ga0070668_10000156312 433
496 3300005347 Ga0070668_100001996 Ga0070668_10000199613 433
497 3300005353 Ga0070669_100000008 Ga0070669_10000000883 433
498 3300005355 Ga0070671_100000010 Ga0070671_100000010188 433
499 3300005367 Ga0070667_100000140 Ga0070667_10000014039 433
500 3300005367 Ga0070667_100014536 Ga0070667_1000145367 433
501 3300005367 Ga0070667_100214822 Ga0070667_1002148222 433
502 3300005458 Ga0070681_10009895 Ga0070681_100098955 433
503 3300005530 Ga0070679_100012066 Ga0070679_1000120666 433
504 3300005548 Ga0070665_100006854 Ga0070665_1000068548 433
505 3300005548 Ga0070665_100007821 Ga0070665_1000078212 433
506 3300005548 Ga0070665_100040780 Ga0070665_1000407803 433
507 3300005563 Ga0068855_100114040 Ga0068855_1001140403 433
508 3300005563 Ga0068855_100122502 Ga0068855_1001225022 433
509 3300005617 Ga0068859_100002317 Ga0068859_1000023174 433
510 3300005618 Ga0068864_100000533 Ga0068864_10000053318 433
511 3300005618 Ga0068864_100030976 Ga0068864_1000309762 433
512 3300005719 Ga0068861_100011425 Ga0068861_1000114254 433
513 3300005841 Ga0068863_100002271 Ga0068863_10000227118 433
514 3300005841 Ga0068863_100029849 Ga0068863_1000298494 433
515 3300005842 Ga0068858_100006839 Ga0068858_10000683910 433
516 3300005842 Ga0068858_100020066 Ga0068858_1000200666 433
517 3300005843 Ga0068860_100000580 Ga0068860_10000058017 433
518 3300005844 Ga0068862_100000443 Ga0068862_10000044330 433
519 3300005844 Ga0068862_100011082 Ga0068862_1000110828 433
520 3300005985 Ga0081539_10013768 Ga0081539_100137681 433
521 3300006042 Ga0075368_10004137 Ga0075368_100041372 433
522 3300006051 Ga0075364_10003123 Ga0075364_100031239 433
523 3300006178 Ga0075367_10031006 Ga0075367_100310062 433
524 3300006237 Ga0097621_100245117 Ga0097621_1002451172 433
525 3300006358 Ga0068871_100041474 Ga0068871_1000414743 433
526 3300006931 Ga0097620_100002317 Ga0097620_10000231714 433
527 3300009093 Ga0105240_10011563 Ga0105240_1001156311 433
528 3300009093 Ga0105240_10041926 Ga0105240_100419263 433
529 3300009093 Ga0105240_10044078 Ga0105240_100440782 433
530 3300009098 Ga0105245_10001293 Ga0105245_1000129318 433
531 3300009101 Ga0105247_10000673 Ga0105247_1000067314 433
532 3300009177 Ga0105248_10004862 Ga0105248_1000486214 433
533 3300009551 Ga0105238_10012191 Ga0105238_100121918 433
534 3300009553 Ga0105249_10004149 Ga0105249_1000414910 433
535 3300010375 Ga0105239_10172760 Ga0105239_101727602 433
536 3300010375 Ga0105239_10175604 Ga0105239_101756042 433
537 3300013297 Ga0157378_10155814 Ga0157378_101558141 433
538 3300013306 Ga0163162_10052631 Ga0163162_100526312 433
539 3300013307 Ga0157372_10015386 Ga0157372_100153863 433
540 3300014968 Ga0157379_10071957 Ga0157379_100719573 433
541 3300021384 Ga0213876_10021790 Ga0213876_100217902 433
542 3300025261 Ga0209233_1000013 Ga0209233_1000013252 433
543 3300025292 Ga0209676_1000453 Ga0209676_100045329 433
544 3300025297 Ga0209758_1000001 Ga0209758_10000011465 433
545 3300025297 Ga0209758_1000401 Ga0209758_100040156 433
546 3300025298 Ga0209050_1000031 Ga0209050_1000031224 433
547 3300025298 Ga0209050_1000822 Ga0209050_100082220 433
548 3300025304 Ga0209257_1000073 Ga0209257_1000073156 433
549 3300025304 Ga0209257_1002730 Ga0209257_100273010 433
550 3300025304 Ga0209257_1003297 Ga0209257_10032977 433
551 3300025315 Ga0207697_10000036 Ga0207697_1000003641 433
552 3300025315 Ga0207697_10021489 Ga0207697_100214892 433
553 3300025903 Ga0207680_10000097 Ga0207680_1000009713 433
554 3300025911 Ga0207654_10055799 Ga0207654_100557991 433
555 3300025912 Ga0207707_10009978 Ga0207707_100099786 433
556 3300025912 Ga0207707_10108805 Ga0207707_101088052 433
557 3300025913 Ga0207695_10000984 Ga0207695_1000098429 433
558 3300025913 Ga0207695_10004268 Ga0207695_100042686 433
559 3300025913 Ga0207695_10006822 Ga0207695_100068225 433
560 3300025913 Ga0207695_10017297 Ga0207695_100172975 433
561 3300025917 Ga0207660_10051165 Ga0207660_100511652 433
562 3300025920 Ga0207649_10000448 Ga0207649_1000044824 433
563 3300025923 Ga0207681_10000002 Ga0207681_10000002175 433
564 3300025924 Ga0207694_10016477 Ga0207694_100164775 433
565 3300025925 Ga0207650_10000062 Ga0207650_10000062130 433
566 3300025927 Ga0207687_10001382 Ga0207687_1000138219 433
567 3300025931 Ga0207644_10000002 Ga0207644_10000002174 433
568 3300025941 Ga0207711_10069337 Ga0207711_100693372 433
569 3300025949 Ga0207667_10010340 Ga0207667_100103406 433
570 3300025949 Ga0207667_10033965 Ga0207667_100339654 433
571 3300025961 Ga0207712_10002299 Ga0207712_100022995 433
572 3300025972 Ga0207668_10000046 Ga0207668_1000004671 433
573 3300025972 Ga0207668_10001421 Ga0207668_100014212 433
574 3300025986 Ga0207658_10000264 Ga0207658_1000026439 433
575 3300025986 Ga0207658_10003580 Ga0207658_100035808 433
576 3300025986 Ga0207658_10006846 Ga0207658_100068469 433
577 3300026035 Ga0207703_10001492 Ga0207703_1000149215 433
578 3300026035 Ga0207703_10003329 Ga0207703_100033293 433
579 3300026088 Ga0207641_10001512 Ga0207641_1000151223 433
580 3300026088 Ga0207641_10011597 Ga0207641_100115976 433
581 3300026088 Ga0207641_10040963 Ga0207641_100409633 433
582 3300026095 Ga0207676_10000784 Ga0207676_100007844 433
583 3300026095 Ga0207676_10022590 Ga0207676_100225902 433
584 3300026118 Ga0207675_100000358 Ga0207675_10000035843 433
585 3300026121 Ga0207683_10079316 Ga0207683_100793163 433
586 3300026142 Ga0207698_10105462 Ga0207698_101054621 433
587 3300028379 Ga0268266_10001455 Ga0268266_100014559 433
588 3300028379 Ga0268266_10029304 Ga0268266_100293043 433
589 3300028380 Ga0268265_10000339 Ga0268265_1000033929 433
590 3300028380 Ga0268265_10002810 Ga0268265_100028109 433
591 3300028381 Ga0268264_10000010 Ga0268264_10000010393 433
592 3300028381 Ga0268264_10000358 Ga0268264_1000035818 433
593 3300031241 Ga0265325_10002804 Ga0265325_1000280410 433
594 3300031247 Ga0265340_10073391 Ga0265340_100733911 433
595 3300031250 Ga0265331_10000006 Ga0265331_1000000674 433
596 3300031251 Ga0265327_10000381 Ga0265327_1000038110 433
597 3300031344 Ga0265316_10064684 Ga0265316_100646843 433
598 3300031456 Ga0307513_10001008 Ga0307513_1000100824 433
599 3300031711 Ga0265314_10002986 Ga0265314_100029864 433
600 3300031711 Ga0265314_10028054 Ga0265314_100280544 433
601 3300032137 Ga0316585_10021242 Ga0316585_100212421 433
602 3300037418 Ga0395900_0211953 Ga0395900_0211953_48_1502 433
603 3300039450 Ga0436363_0800232 Ga0436363_0800232_1297_2637 433
604 3300046542 Ga0495597_0002439 Ga0495597_0002439_8588_9994 433
605 3300046557 Ga0495622_0004437 Ga0495622_0004437_3207_4613 433
606 3300046616 Ga0495668_0000001 Ga0495668_0000001_861015_862361 433
607 3300046616 Ga0495668_0009345 Ga0495668_0009345_1516_2922 433
608 3300046660 Ga0495625_0000652 Ga0495625_0000652_19456_20802 433
609 3300046684 Ga0495669_0000001 Ga0495669_0000001_273863_275266 433
610 3300046684 Ga0495669_0000267 Ga0495669_0000267_20756_22156 433
611 3300046684 Ga0495669_0009330 Ga0495669_0009330_68_1477 433
612 3300049568 Ga0501031_0112002 Ga0501031_0112002_131_1468 433
613 3300049569 Ga0501032_0011363 Ga0501032_0011363_3320_4657 433
614 3300049570 Ga0501033_0020758 Ga0501033_0020758_315_1652 433
615 3300049572 Ga0501036_0018741 Ga0501036_0018741_1249_2586 433
616 3300049573 Ga0501037_0039423 Ga0501037_0039423_354_1691 433
617 3300049573 Ga0501037_0119016 Ga0501037_0119016_291_1640 433
618 3300049574 Ga0501038_0042587 Ga0501038_0042587_2130_3467 433
619 3300049579 Ga0501043_0024083 Ga0501043_0024083_334_1683 433
620 3300049580 Ga0501046_0013968 Ga0501046_0013968_191_1549 433
621 3300049580 Ga0501046_0034820 Ga0501046_0034820_1561_2910 433
622 3300049581 Ga0501047_0003221 Ga0501047_0003221_9588_10937 433
623 3300049585 Ga0501069_0038330 Ga0501069_0038330_793_2136 433
624 3300049744 Ga0501083_0058356 Ga0501083_0058356_284_1627 433
625 3300049822 Ga0501035_0010025 Ga0501035_0010025_3516_4853 433
626 3300049823 Ga0501044_0005359 Ga0501044_0005359_1348_2697 433
627 3300049823 Ga0501044_0005940 Ga0501044_0005940_6474_7811 433
628 3300050491 nmdc:mga00v17_2502_c1 nmdc:mga00v17_2502_c1_1635_3035 433
629 3300050496 nmdc:mga07m45_2641_c1 nmdc:mga07m45_2641_c1_4037_5437 433
630 3300050516 nmdc:mga0sz30_23010_c2 nmdc:mga0sz30_23010_c2_543_1943 433
631 3300053080 Ga0500635_0000847 Ga0500635_0000847_150_1556 433
632 3300053087 Ga0500643_014657 Ga0500643_014657_889_2238 433
633 3300053093 Ga0500651_0089878 Ga0500651_0089878_364_1770 433
634 3300053103 Ga0500555_015110 Ga0500555_015110_89_1492 433
635 3300053117 Ga0500593_000095 Ga0500593_000095_5767_7176 433
636 3300053119 Ga0500595_006788 Ga0500595_006788_2476_3882 433
637 3300053119 Ga0500595_010491 Ga0500595_010491_2173_3588 433
638 3300053122 Ga0500608_072404 Ga0500608_072404_205_1611 433
639 3300053139 Ga0500568_0001107 Ga0500568_0001107_747_2093 433
640 3300053157 Ga0500624_000294 Ga0500624_000294_4561_5910 433
641 3300053158 Ga0500627_0000005 Ga0500627_0000005_70528_71877 433
642 3300053177 Ga0500636_0003201 Ga0500636_0003201_3034_4383 433
643 3300053177 Ga0500636_0017824 Ga0500636_0017824_2652_4058 433
644 iso_pu_bacteria 2882806704 2882807726 433
645 iso_pu_bacteria 643348564 643599929 433
646 3300001915 JGI24741J21665_1004204 JGI24741J21665_10042043 434
647 3300001979 JGI24740J21852_10010082 JGI24740J21852_100100823 434
648 3300002067 JGI24735J21928_10003799 JGI24735J21928_100037993 434
649 3300005327 Ga0070658_10071045 Ga0070658_100710452 434
650 3300005328 Ga0070676_10025735 Ga0070676_100257354 434
651 3300005334 Ga0068869_100003098 Ga0068869_1000030989 434
652 3300005334 Ga0068869_100055111 Ga0068869_1000551111 434
653 3300005336 Ga0070680_100045778 Ga0070680_1000457784 434
654 3300005337 Ga0070682_100009658 Ga0070682_1000096585 434
655 3300005337 Ga0070682_100012477 Ga0070682_1000124772 434
656 3300005339 Ga0070660_100036631 Ga0070660_1000366312 434
657 3300005341 Ga0070691_10044509 Ga0070691_100445092 434
658 3300005344 Ga0070661_100096602 Ga0070661_1000966022 434
659 3300005347 Ga0070668_100135103 Ga0070668_1001351032 434
660 3300005353 Ga0070669_100045468 Ga0070669_1000454683 434
661 3300005354 Ga0070675_100027852 Ga0070675_1000278522 434
662 3300005356 Ga0070674_100029240 Ga0070674_1000292402 434
663 3300005364 Ga0070673_100061252 Ga0070673_1000612524 434
664 3300005365 Ga0070688_100010364 Ga0070688_1000103644 434
665 3300005455 Ga0070663_100003708 Ga0070663_1000037083 434
666 3300005457 Ga0070662_100127009 Ga0070662_1001270092 434
667 3300005458 Ga0070681_10060810 Ga0070681_100608102 434
668 3300005466 Ga0070685_10013224 Ga0070685_100132245 434
669 3300005466 Ga0070685_10081286 Ga0070685_100812862 434
670 3300005530 Ga0070679_100153856 Ga0070679_1001538562 434
671 3300005547 Ga0070693_100061671 Ga0070693_1000616712 434
672 3300005548 Ga0070665_100010246 Ga0070665_1000102466 434
673 3300005548 Ga0070665_100012139 Ga0070665_1000121394 434
674 3300005563 Ga0068855_100039414 Ga0068855_1000394144 434
675 3300005577 Ga0068857_100037113 Ga0068857_1000371133 434
676 3300005577 Ga0068857_100070399 Ga0068857_1000703993 434
677 3300005577 Ga0068857_100075817 Ga0068857_1000758173 434
678 3300005578 Ga0068854_100027333 Ga0068854_1000273334 434
679 3300005614 Ga0068856_100026670 Ga0068856_1000266702 434
680 3300005617 Ga0068859_100057662 Ga0068859_1000576622 434
681 3300005841 Ga0068863_100039041 Ga0068863_1000390415 434
682 3300005841 Ga0068863_100084696 Ga0068863_1000846963 434
683 3300005842 Ga0068858_100055790 Ga0068858_1000557904 434
684 3300006042 Ga0075368_10007426 Ga0075368_100074263 434
685 3300006173 Ga0070716_100014189 Ga0070716_1000141892 434
686 3300006175 Ga0070712_100023883 Ga0070712_1000238833 434
687 3300006175 Ga0070712_100045608 Ga0070712_1000456082 434
688 3300006177 Ga0075362_10006143 Ga0075362_100061435 434
689 3300006237 Ga0097621_100000004 Ga0097621_10000000430 434
690 3300006237 Ga0097621_100114654 Ga0097621_1001146541 434
691 3300006871 Ga0075434_100208611 Ga0075434_1002086112 434
692 3300006914 Ga0075436_100069795 Ga0075436_1000697952 434
693 3300006931 Ga0097620_100057660 Ga0097620_1000576602 434
694 3300009093 Ga0105240_10068604 Ga0105240_100686044 434
695 3300009093 Ga0105240_10069728 Ga0105240_100697283 434
696 3300009093 Ga0105240_10246678 Ga0105240_102466782 434
697 3300009098 Ga0105245_10047864 Ga0105245_100478644 434
698 3300009098 Ga0105245_10089674 Ga0105245_100896743 434
699 3300009148 Ga0105243_10003266 Ga0105243_100032664 434
700 3300009174 Ga0105241_10012391 Ga0105241_100123917 434
701 3300009174 Ga0105241_10082892 Ga0105241_100828922 434
702 3300009176 Ga0105242_10021185 Ga0105242_100211855 434
703 3300009177 Ga0105248_10030181 Ga0105248_100301812 434
704 3300009545 Ga0105237_10006217 Ga0105237_100062177 434
705 3300009545 Ga0105237_10158072 Ga0105237_101580721 434
706 3300009545 Ga0105237_10164072 Ga0105237_101640722 434
707 3300009551 Ga0105238_10033513 Ga0105238_100335134 434
708 3300009551 Ga0105238_10151581 Ga0105238_101515811 434
709 3300010375 Ga0105239_10058604 Ga0105239_100586044 434
710 3300011119 Ga0105246_10014991 Ga0105246_100149915 434
711 3300011119 Ga0105246_10034704 Ga0105246_100347041 434
712 3300013308 Ga0157375_10151643 Ga0157375_101516432 434
713 3300014968 Ga0157379_10017057 Ga0157379_100170572 434
714 3300014968 Ga0157379_10067903 Ga0157379_100679033 434
715 3300014969 Ga0157376_10016186 Ga0157376_100161862 434
716 3300014969 Ga0157376_10161051 Ga0157376_101610513 434
717 3300017792 Ga0163161_10078138 Ga0163161_100781381 434
718 3300025900 Ga0207710_10001925 Ga0207710_100019258 434
719 3300025907 Ga0207645_10032477 Ga0207645_100324774 434
720 3300025911 Ga0207654_10042006 Ga0207654_100420062 434
721 3300025911 Ga0207654_10058582 Ga0207654_100585822 434
722 3300025912 Ga0207707_10040418 Ga0207707_100404182 434
723 3300025913 Ga0207695_10006284 Ga0207695_100062843 434
724 3300025913 Ga0207695_10025668 Ga0207695_100256684 434
725 3300025913 Ga0207695_10054252 Ga0207695_100542525 434
726 3300025914 Ga0207671_10087469 Ga0207671_100874692 434
727 3300025915 Ga0207693_10038804 Ga0207693_100388043 434
728 3300025917 Ga0207660_10014579 Ga0207660_100145795 434
729 3300025918 Ga0207662_10019704 Ga0207662_100197042 434
730 3300025919 Ga0207657_10019859 Ga0207657_100198596 434
731 3300025921 Ga0207652_10125765 Ga0207652_101257652 434
732 3300025924 Ga0207694_10185176 Ga0207694_101851762 434
733 3300025924 Ga0207694_10201115 Ga0207694_102011151 434
734 3300025926 Ga0207659_10019312 Ga0207659_100193125 434
735 3300025927 Ga0207687_10029495 Ga0207687_100294952 434
736 3300025933 Ga0207706_10017152 Ga0207706_100171522 434
737 3300025934 Ga0207686_10142682 Ga0207686_101426821 434
738 3300025935 Ga0207709_10002218 Ga0207709_100022185 434
739 3300025936 Ga0207670_10030117 Ga0207670_100301171 434
740 3300025938 Ga0207704_10201169 Ga0207704_102011691 434
741 3300025939 Ga0207665_10001649 Ga0207665_100016493 434
742 3300025942 Ga0207689_10028111 Ga0207689_100281115 434
743 3300025942 Ga0207689_10042506 Ga0207689_100425061 434
744 3300025944 Ga0207661_10030751 Ga0207661_100307514 434
745 3300025949 Ga0207667_10121329 Ga0207667_101213293 434
746 3300025961 Ga0207712_10055505 Ga0207712_100555053 434
747 3300025981 Ga0207640_10026267 Ga0207640_100262673 434
748 3300026023 Ga0207677_10051800 Ga0207677_100518004 434
749 3300026035 Ga0207703_10002958 Ga0207703_100029589 434
750 3300026041 Ga0207639_10015498 Ga0207639_100154984 434
751 3300026041 Ga0207639_10064483 Ga0207639_100644832 434
752 3300026067 Ga0207678_10017512 Ga0207678_100175124 434
753 3300026075 Ga0207708_10001156 Ga0207708_1000115615 434
754 3300026089 Ga0207648_10019067 Ga0207648_100190673 434
755 3300026116 Ga0207674_10004754 Ga0207674_1000475422 434
756 3300026116 Ga0207674_10078164 Ga0207674_100781643 434
757 3300026118 Ga0207675_100000249 Ga0207675_10000024936 434
758 3300026121 Ga0207683_10038603 Ga0207683_100386034 434
759 3300026121 Ga0207683_10088260 Ga0207683_100882602 434
760 3300028379 Ga0268266_10005907 Ga0268266_100059078 434
761 3300028379 Ga0268266_10023201 Ga0268266_100232012 434
762 3300028379 Ga0268266_10024329 Ga0268266_100243292 434
763 3300028379 Ga0268266_10122735 Ga0268266_101227353 434
764 3300028379 Ga0268266_10187165 Ga0268266_101871652 434
765 3300031238 Ga0265332_10007546 Ga0265332_100075463 434
766 3300031247 Ga0265340_10009105 Ga0265340_100091054 434
767 3300031247 Ga0265340_10009447 Ga0265340_100094472 434
768 3300031249 Ga0265339_10002510 Ga0265339_100025105 434
769 3300031691 Ga0316579_10014412 Ga0316579_100144123 434
770 3300031712 Ga0265342_10000100 Ga0265342_1000010084 434
771 3300031727 Ga0316576_10034936 Ga0316576_100349362 434
772 3300031728 Ga0316578_10048851 Ga0316578_100488512 434
773 3300031733 Ga0316577_10026372 Ga0316577_100263723 434
774 3300032133 Ga0316583_10020047 Ga0316583_100200471 434
775 3300037418 Ga0395900_0145234 Ga0395900_0145234_701_2059 434
776 3300046538 Ga0495609_0022864 Ga0495609_0022864_447_1799 434
777 3300048904 Ga0496101_0006844 Ga0496101_0006844_1492_2925 434
778 3300048904 Ga0496101_0045339 Ga0496101_0045339_781_2184 434
779 3300048905 Ga0496102_0045483 Ga0496102_0045483_1937_3370 434
780 3300048906 Ga0496103_0049805 Ga0496103_0049805_1059_2492 434
781 3300048909 Ga0496106_0157107 Ga0496106_0157107_193_1626 434
782 3300048912 Ga0496109_0083013 Ga0496109_0083013_142_1545 434
783 3300048918 Ga0496115_0061107 Ga0496115_0061107_848_2281 434
784 3300049570 Ga0501033_0043351 Ga0501033_0043351_1531_2889 434
785 3300049571 Ga0501034_0181167 Ga0501034_0181167_126_1484 434
786 3300049571 Ga0501034_0254955 Ga0501034_0254955_113_1447 434
787 3300049574 Ga0501038_0000009 Ga0501038_0000009_91994_93367 434
788 3300049574 Ga0501038_0046649 Ga0501038_0046649_2200_3615 434
789 3300049579 Ga0501043_0043621 Ga0501043_0043621_771_2129 434
790 3300049581 Ga0501047_0081130 Ga0501047_0081130_104_1537 434
791 3300049581 Ga0501047_0166649 Ga0501047_0166649_174_1589 434
792 3300049592 Ga0501076_0030823 Ga0501076_0030823_2419_3834 434
793 3300049663 Ga0501223_000067 Ga0501223_000067_4512_5927 434
794 3300049664 Ga0501224_000036 Ga0501224_000036_4720_6135 434
795 3300049668 Ga0501233_005491 Ga0501233_005491_32_1447 434
796 3300049705 Ga0501225_0000018 Ga0501225_0000018_24074_25489 434
797 3300049742 Ga0501080_0055866 Ga0501080_0055866_2141_3499 434
798 3300049822 Ga0501035_0027886 Ga0501035_0027886_1528_2943 434
799 3300049823 Ga0501044_0025973 Ga0501044_0025973_1336_2751 434
800 3300049823 Ga0501044_0051080 Ga0501044_0051080_2359_3717 434
801 3300049853 Ga0501226_000063 Ga0501226_000063_24102_25517 434
802 3300050494 nmdc:mga06z11_28570_c1 nmdc:mga06z11_28570_c1_217_1629 434
803 3300050512 nmdc:mga0n895_32032_c1 nmdc:mga0n895_32032_c1_378_1787 434
804 3300050513 nmdc:mga0rr50_86467_c1 nmdc:mga0rr50_86467_c1_657_2066 434
805 3300050515 nmdc:mga0a205_24271_c2 nmdc:mga0a205_24271_c2_697_2100 434
806 3300053104 Ga0500556_0000049 Ga0500556_0000049_6820_8169 434
807 3300053104 Ga0500556_0000774 Ga0500556_0000774_86_1516 434
808 3300053130 Ga0500642_0000002 Ga0500642_0000002_126335_127684 434
809 3300053153 Ga0500616_0001288 Ga0500616_0001288_20451_21881 434
810 3300053730 Ga0500645_001493 Ga0500645_001493_1524_2873 434
811 3300060353 Ga0501082_0022186 Ga0501082_0022186_3909_5324 434
812 3300061734 Ga0530510_0005973 Ga0530510_0005973_52_1467 434
813 3300006846 Ga0075430_100036361 Ga0075430_1000363613 435
814 3300021384 Ga0213876_10001849 Ga0213876_100018496 435
815 3300021388 Ga0213875_10001173 Ga0213875_100011735 435
816 3300037853 Ga0436364_1468866 Ga0436364_1468866_5985_7352 435
817 3300038705 Ga0237819_01482 Ga0237819_01482_4369_5766 435
818 3300039062 Ga0400483_221937 Ga0400483_221937_4998_6374 435
819 3300039437 Ga0436365_1242987 Ga0436365_1242987_7503_8855 435
820 3300048911 Ga0496108_0047875 Ga0496108_0047875_127_1491 435
821 3300048925 Ga0496122_0001187 Ga0496122_0001187_37537_38910 435
822 3300048926 Ga0496123_0002266 Ga0496123_0002266_7211_8584 435
823 3300048929 Ga0496126_0044544 Ga0496126_0044544_1144_2517 435
824 3300050509 nmdc:mga0qj67_13980_c1 nmdc:mga0qj67_13980_c1_3847_5175 435
825 3300053118 Ga0500594_0000406 Ga0500594_0000406_4369_5730 435
826 3300005293 Ga0065715_10000489 Ga0065715_100004893 436
827 3300005328 Ga0070676_10001990 Ga0070676_1000199015 436
828 3300005331 Ga0070670_100008096 Ga0070670_1000080965 436
829 3300005347 Ga0070668_100013222 Ga0070668_1000132225 436
830 3300005353 Ga0070669_100002352 Ga0070669_10000235215 436
831 3300005356 Ga0070674_100078446 Ga0070674_1000784462 436
832 3300005367 Ga0070667_100023369 Ga0070667_1000233694 436
833 3300005456 Ga0070678_100006677 Ga0070678_1000066774 436
834 3300005457 Ga0070662_100001233 Ga0070662_1000012335 436
835 3300005543 Ga0070672_100023443 Ga0070672_1000234434 436
836 3300005564 Ga0070664_100004570 Ga0070664_1000045707 436
837 3300005617 Ga0068859_100015571 Ga0068859_1000155712 436
838 3300005719 Ga0068861_100052353 Ga0068861_1000523534 436
839 3300005844 Ga0068862_100014334 Ga0068862_1000143344 436
840 3300006847 Ga0075431_100176581 Ga0075431_1001765813 436
841 3300006931 Ga0097620_100015570 Ga0097620_1000155708 436
842 3300009094 Ga0111539_10012292 Ga0111539_100122924 436
843 3300014326 Ga0157380_10006132 Ga0157380_100061327 436
844 3300014326 Ga0157380_10029593 Ga0157380_100295932 436
845 3300014326 Ga0157380_10067375 Ga0157380_100673752 436
846 3300025315 Ga0207697_10000845 Ga0207697_100008454 436
847 3300025893 Ga0207682_10000389 Ga0207682_1000038922 436
848 3300025907 Ga0207645_10031151 Ga0207645_100311514 436
849 3300025923 Ga0207681_10003001 Ga0207681_100030012 436
850 3300025926 Ga0207659_10006280 Ga0207659_100062805 436
851 3300025933 Ga0207706_10000415 Ga0207706_1000041532 436
852 3300025937 Ga0207669_10023944 Ga0207669_100239444 436
853 3300025940 Ga0207691_10001641 Ga0207691_100016417 436
854 3300025945 Ga0207679_10004181 Ga0207679_100041814 436
855 3300025960 Ga0207651_10128225 Ga0207651_101282252 436
856 3300025972 Ga0207668_10000996 Ga0207668_100009962 436
857 3300025986 Ga0207658_10015549 Ga0207658_100155494 436
858 3300026067 Ga0207678_10001001 Ga0207678_1000100122 436
859 3300026067 Ga0207678_10150185 Ga0207678_101501852 436
860 3300026118 Ga0207675_100060567 Ga0207675_1000605672 436
861 3300027876 Ga0209974_10007907 Ga0209974_100079073 436
862 3300031824 Ga0307413_10027278 Ga0307413_100272783 436
863 3300031852 Ga0307410_10038726 Ga0307410_100387264 436
864 3300031852 Ga0307410_10076539 Ga0307410_100765393 436
865 3300031901 Ga0307406_10156355 Ga0307406_101563552 436
866 3300031911 Ga0307412_10115500 Ga0307412_101155002 436
867 3300031995 Ga0307409_100091515 Ga0307409_1000915152 436
868 3300032004 Ga0307414_10057250 Ga0307414_100572502 436
869 3300032004 Ga0307414_10154727 Ga0307414_101547272 436
870 3300032005 Ga0307411_10089364 Ga0307411_100893642 436
871 3300032005 Ga0307411_10154398 Ga0307411_101543981 436
872 3300037418 Ga0395900_0000949 Ga0395900_0000949_27298_28632 436
873 3300037466 Ga0395898_0002368 Ga0395898_0002368_8195_9532 436
874 3300037471 Ga0395905_0000523 Ga0395905_0000523_44777_46111 436
875 3300038443 Ga0395901_0003263 Ga0395901_0003263_12948_14282 436
876 3300042004 Ga0439445_0001896 Ga0439445_0001896_1051_2385 436
877 3300046525 Ga0495663_0003127 Ga0495663_0003127_1899_3233 436
878 3300046537 Ga0495598_0007163 Ga0495598_0007163_188_1522 436
879 3300046539 Ga0495621_0000933 Ga0495621_0000933_3220_4554 436
880 3300050510 nmdc:mga06r32_146215_c1 nmdc:mga06r32_146215_c1_740_2074 436
881 3300005293 Ga0065715_10134850 Ga0065715_101348502 437
882 3300005327 Ga0070658_10023327 Ga0070658_100233274 437
883 3300005327 Ga0070658_10027486 Ga0070658_100274865 437
884 3300005530 Ga0070679_100071563 Ga0070679_1000715635 437
885 3300025909 Ga0207705_10020398 Ga0207705_100203983 437
886 3300025909 Ga0207705_10024713 Ga0207705_100247133 437
887 3300046539 Ga0495621_0000635 Ga0495621_0000635_3265_4614 437
888 3300046691 Ga0495670_0007177 Ga0495670_0007177_1969_3318 437
889 3300021358 Ga0213873_10000006 Ga0213873_10000006284 438
890 3300021384 Ga0213876_10000004 Ga0213876_10000004790 438
891 3300031852 Ga0307410_10015919 Ga0307410_100159196 438
892 3300039437 Ga0436365_1215130 Ga0436365_1215130_59775_61118 438
893 3300039453 Ga0436362_0094317 Ga0436362_0094317_59775_61118 438
894 3300005331 Ga0070670_100040151 Ga0070670_1000401511 439
895 3300005336 Ga0070680_100000336 Ga0070680_10000033627 439
896 3300005578 Ga0068854_100041361 Ga0068854_1000413614 439
897 3300005616 Ga0068852_100019190 Ga0068852_1000191906 439
898 3300005985 Ga0081539_10069354 Ga0081539_100693542 439
899 3300009551 Ga0105238_10124630 Ga0105238_101246302 439
900 3300025909 Ga0207705_10012524 Ga0207705_100125244 439
901 3300025917 Ga0207660_10000221 Ga0207660_1000022129 439
902 3300025921 Ga0207652_10112272 Ga0207652_101122722 439
903 3300025925 Ga0207650_10017759 Ga0207650_100177595 439
904 3300025949 Ga0207667_10205203 Ga0207667_102052032 439
905 3300026142 Ga0207698_10089425 Ga0207698_100894252 439
906 3300031852 Ga0307410_10069070 Ga0307410_100690702 439
907 3300031901 Ga0307406_10042409 Ga0307406_100424093 439
908 3300031995 Ga0307409_100009507 Ga0307409_1000095076 439
909 3300031995 Ga0307409_100042393 Ga0307409_1000423932 439
910 3300032005 Ga0307411_10100930 Ga0307411_101009302 439
911 3300037312 Ga0395899_0067809 Ga0395899_0067809_876_2222 439
912 3300037466 Ga0395898_0321335 Ga0395898_0321335_78_1427 439
913 3300037471 Ga0395905_0078393 Ga0395905_0078393_1500_2846 439
914 3300037471 Ga0395905_0186889 Ga0395905_0186889_62_1408 439
915 3300038443 Ga0395901_0304594 Ga0395901_0304594_78_1424 439
916 3300044842 Ga0466957_0003095 Ga0466957_0003095_5821_7167 439
917 3300045836 Ga0466958_0002358 Ga0466958_0002358_6152_7498 439
918 3300045976 Ga0466967_0004158 Ga0466967_0004158_3946_5292 439
919 3300005327 Ga0070658_10033937 Ga0070658_100339372 440
920 3300005331 Ga0070670_100001146 Ga0070670_10000114614 440
921 3300014326 Ga0157380_10002753 Ga0157380_1000275313 440
922 3300025919 Ga0207657_10007933 Ga0207657_1000793314 440
923 3300025919 Ga0207657_10020383 Ga0207657_100203833 440
924 3300025925 Ga0207650_10000537 Ga0207650_100005378 440
925 3300026095 Ga0207676_10154162 Ga0207676_101541622 440
926 3300032004 Ga0307414_10112576 Ga0307414_101125762 440
927 3300032004 Ga0307414_10130993 Ga0307414_101309932 440
928 3300037312 Ga0395899_0000165 Ga0395899_0000165_67114_68472 440
929 3300037466 Ga0395898_0085974 Ga0395898_0085974_1611_2969 440
930 3300038443 Ga0395901_0000064 Ga0395901_0000064_121419_122777 440
931 3300005331 Ga0070670_100028559 Ga0070670_1000285593 441
932 3300005563 Ga0068855_100184885 Ga0068855_1001848853 441
933 3300005564 Ga0070664_100110447 Ga0070664_1001104472 441
934 3300025909 Ga0207705_10051612 Ga0207705_100516122 441
935 3300025912 Ga0207707_10021925 Ga0207707_100219253 441
936 3300025920 Ga0207649_10060349 Ga0207649_100603492 441
937 3300025921 Ga0207652_10033185 Ga0207652_100331852 441
938 3300025972 Ga0207668_10032130 Ga0207668_100321302 441
939 3300031548 Ga0307408_100012825 Ga0307408_1000128254 441
940 3300031731 Ga0307405_10004900 Ga0307405_100049006 441
941 3300031852 Ga0307410_10014826 Ga0307410_100148264 441
942 3300031901 Ga0307406_10004114 Ga0307406_100041145 441
943 3300031911 Ga0307412_10004265 Ga0307412_100042654 441
944 3300032126 Ga0307415_100009695 Ga0307415_1000096954 441
945 3300042144 Ga0450889_000351 Ga0450889_000351_2102_3523 441
946 3300045976 Ga0466967_0044107 Ga0466967_0044107_1751_3148 441
947 3300046664 Ga0495659_0028770 Ga0495659_0028770_408_1811 441
948 3300046691 Ga0495670_0036629 Ga0495670_0036629_31_1434 441
949 3300047445 Ga0495677_0022018 Ga0495677_0022018_285_1688 441
950 3300049581 Ga0501047_0090764 Ga0501047_0090764_1480_2892 441
951 3300050511 nmdc:mga08y16_230153_c1 nmdc:mga08y16_230153_c1_315_1724 441
952 3300013100 Ga0157373_10000106 Ga0157373_1000010624 442
953 3300025920 Ga0207649_10000235 Ga0207649_1000023518 442
954 3300005367 Ga0070667_100014955 Ga0070667_1000149556 443
955 3300005457 Ga0070662_100126397 Ga0070662_1001263971 443
956 3300025933 Ga0207706_10013108 Ga0207706_100131086 443
957 3300026067 Ga0207678_10000804 Ga0207678_1000080419 443
958 3300053087 Ga0500643_003227 Ga0500643_003227_6415_7806 443
959 3300005339 Ga0070660_100009530 Ga0070660_1000095306 444
960 3300005455 Ga0070663_100008421 Ga0070663_1000084214 444
961 3300005563 Ga0068855_100100860 Ga0068855_1001008603 444
962 3300005578 Ga0068854_100000732 Ga0068854_1000007325 444
963 3300005614 Ga0068856_100018794 Ga0068856_1000187946 444
964 3300005614 Ga0068856_100189330 Ga0068856_1001893302 444
965 3300005616 Ga0068852_100000692 Ga0068852_10000069210 444
966 3300005616 Ga0068852_100008296 Ga0068852_1000082967 444
967 3300005718 Ga0068866_10006662 Ga0068866_100066624 444
968 3300009093 Ga0105240_10017423 Ga0105240_1001742310 444
969 3300009551 Ga0105238_10016939 Ga0105238_100169395 444
970 3300013100 Ga0157373_10019946 Ga0157373_100199462 444
971 3300013100 Ga0157373_10099310 Ga0157373_100993102 444
972 3300013102 Ga0157371_10008210 Ga0157371_100082107 444
973 3300013104 Ga0157370_10073701 Ga0157370_100737011 444
974 3300013104 Ga0157370_10295033 Ga0157370_102950331 444
975 3300013105 Ga0157369_10000202 Ga0157369_1000020227 444
976 3300013105 Ga0157369_10004702 Ga0157369_100047027 444
977 3300013105 Ga0157369_10018118 Ga0157369_100181184 444
978 3300013105 Ga0157369_10137587 Ga0157369_101375872 444
979 3300013296 Ga0157374_10001715 Ga0157374_100017156 444
980 3300013307 Ga0157372_10294811 Ga0157372_102948111 444
981 3300025909 Ga0207705_10000060 Ga0207705_10000060102 444
982 3300025913 Ga0207695_10030351 Ga0207695_100303516 444
983 3300025919 Ga0207657_10017872 Ga0207657_100178726 444
984 3300025920 Ga0207649_10002604 Ga0207649_1000260410 444
985 3300025923 Ga0207681_10071587 Ga0207681_100715872 444
986 3300025924 Ga0207694_10039585 Ga0207694_100395852 444
987 3300025933 Ga0207706_10033035 Ga0207706_100330354 444
988 3300025944 Ga0207661_10172414 Ga0207661_101724142 444
989 3300025949 Ga0207667_10031541 Ga0207667_100315416 444
990 3300025981 Ga0207640_10003091 Ga0207640_100030912 444
991 3300026067 Ga0207678_10028782 Ga0207678_100287823 444
992 3300026078 Ga0207702_10011107 Ga0207702_100111072 444
993 3300026078 Ga0207702_10024721 Ga0207702_100247216 444
994 3300026142 Ga0207698_10001333 Ga0207698_100013332 444
995 3300026142 Ga0207698_10021331 Ga0207698_100213315 444
996 3300037312 Ga0395899_0016202 Ga0395899_0016202_896_2272 444
997 3300037312 Ga0395899_0159151 Ga0395899_0159151_117_1493 444
998 3300037418 Ga0395900_0042970 Ga0395900_0042970_123_1499 444
999 3300037418 Ga0395900_0047787 Ga0395900_0047787_2144_3520 444
1000 3300037418 Ga0395900_0050318 Ga0395900_0050318_495_1871 444
1001 3300037466 Ga0395898_0015228 Ga0395898_0015228_1231_2607 444
1002 3300038443 Ga0395901_0016805 Ga0395901_0016805_618_1994 444
1003 3300044684 Ga0466966_0013163 Ga0466966_0013163_2097_3470 444
1004 3300044693 Ga0466961_0017719 Ga0466961_0017719_536_1909 444
1005 3300044842 Ga0466957_0005423 Ga0466957_0005423_4925_6298 444
1006 3300045049 Ga0466959_0010147 Ga0466959_0010147_4329_5702 444
1007 3300045836 Ga0466958_0001266 Ga0466958_0001266_6033_7406 444
1008 3300061719 Ga0466962_0026280 Ga0466962_0026280_74_1447 444
1009 3300053108 Ga0500562_001824 Ga0500562_001824_3107_4570 445
1010 3300001904 JGI24736J21556_1003493 JGI24736J21556_10034934 452
1011 3300001979 JGI24740J21852_10026448 JGI24740J21852_100264482 452
1012 3300005578 Ga0068854_100005086 Ga0068854_1000050866 452
1013 3300025981 Ga0207640_10005800 Ga0207640_100058005 452
1014 3300026078 Ga0207702_10008523 Ga0207702_100085237 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01134

GIDA

Glucose inhibited division protein A

63

437

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oqy-assembly1.cif.gz_B streptomyces sp. gf3546 imine reductase 0.9815 4 30
4oqy-assembly1.cif.gz_A streptomyces sp. gf3546 imine reductase 0.9807 4 30
4zn0-assembly2.cif.gz_B structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei 0.9791 3 30
8i4n-assembly1.cif.gz_B crystal strcuture of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum 0.9765 3 31
8eei-assembly1.cif.gz_B unbound c. ammoniagenes monoamine oxidase (mao) 0.9754 5 30
ID Description Score Start End Superfamily
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.001 5 30 3.50.50.60
af_P37127_327_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9961 5 31 3.50.50.60
4oqyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9815 4 30 3.40.50.720
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 6 32 3.40.50.720
af_Q2FYG1_1_188_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9774 5 30 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A530GM07-F1-model_v4 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO 0.9734 163 314 GO:0002098
GO:0005829
GO:0008168
GO:0030488
GO:0050660
AF-A0A2V9ZTW9-F1-model_v4 Methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO 0.9699 159 314 GO:0008168
GO:0032259
AF-A0A0F2R944-F1-model_v4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) 0.9676 5 440 GO:0002098
GO:0005829
GO:0030488
GO:0047151
GO:0050660
AF-A5G7S3-F1-model_v4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) 0.967 5 438 GO:0002098
GO:0005829
GO:0030488
GO:0047151
GO:0050660
AF-A0A7V7BZ01-F1-model_v4 Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) 0.967 5 436 GO:0002098
GO:0005829
GO:0030488
GO:0047151
GO:0050660

Feature Viewer

pLDDT pTM Quality
88.66 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map