F488211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1014 | 433 | 976 | 456 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100015454|Ga0070705_1000154542 |
| Length | 521 |
| Sequence | MIEARFYARPIRLPVRKLAQSGPRLNKDSAFCPIHRQKSGLLIETAVLETRSRAGLGSGVIGEVHVIGGGLAGSEATWQLAQAGVPAALHEMRPLRQTEAHKTGSFAELVCSNSFRSDEWETNAVGLLHEEMRRAGSLIMAAADGHKLPAGGALAVDRDGFAAAVTEKLEAHPLIEIVRGEIDGLPPAESDSVIVATGPLTSPSLAAAIQALTGEAELAFFDAIAPIVYRDSIDTGVCWFQSRYDKAGPGGGGADYINCPLDKAQYDAFLAALLAAEKAAFKEFEAATPYFEGCLPIEVMAERGSDTLRYGPMKPVGLSNPYKAGTRPYAVVQLRQDNSLGTLWNMVGFQTKLKHGEQVRVFRMIPGLEQAEFARLGGLHRNTFLNSPKLLDATLCLKADPRLRFAGQITGVEGYVESAAIGLITGRFAAAECLGRKLMPALGALLNHITGGHLSADSEGTRSFQPMNVNFGLFPPIATPPHPGGKGPRSFKGFDRKRALSRRALADLDVWLAPSASVAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 6 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 7 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 8 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 9 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 10 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 11 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 12 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 13 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 14 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 15 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 16 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 17 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 18 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 19 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 20 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 21 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 22 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 23 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 24 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 25 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 26 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 27 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 28 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 29 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 30 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 31 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 32 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 33 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 34 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 35 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 36 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 37 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 38 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 39 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 40 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 232 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 243 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 256 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 257 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 273 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 279 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 280 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 281 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 346 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 347 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 373 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 376 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 382 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 410 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 412 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 413 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 414 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 416 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 425 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 427 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 432 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 433 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.25 |
| Metatranscriptomes | 0 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.06 |
| Nodule | 0.79 |
| Rhizoplane | 2.56 |
| Rhizosphere | 80.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003493 | 3300001904 | Bacteria | 2725 |
| 2 | JGI24741J21665_1004204 | 3300001915 | Bacteria | 3240 |
| 3 | JGI24740J21852_10010082 | 3300001979 | Bacteria | 3660 |
| 4 | JGI24740J21852_10026448 | 3300001979 | Bacteria | 1944 |
| 5 | JGI24735J21928_10003799 | 3300002067 | Bacteria | 5117 |
| 6 | JGI25151J46595_10000038 | 3300003187 | Bacteria | 180430 |
| 7 | JGI25165J46597_1000425 | 3300003214 | Bacteria | 43589 |
| 8 | JGI25165J46597_1003861 | 3300003214 | Bacteria | 3481 |
| 9 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 10 | Ga0055526_1000282 | 3300003771 | Bacteria | 42603 |
| 11 | Ga0055526_1001779 | 3300003771 | Bacteria | 14969 |
| 12 | Ga0055524_1000091 | 3300003775 | Bacteria | 113761 |
| 13 | Ga0055536_1001904 | 3300003781 | Bacteria | 12099 |
| 14 | Ga0055536_1007868 | 3300003781 | Bacteria | 4688 |
| 15 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 16 | Ga0055530_10004835 | 3300003791 | Bacteria | 6738 |
| 17 | Ga0055530_10005482 | 3300003791 | Bacteria | 6010 |
| 18 | Ga0055531_10000627 | 3300003794 | Bacteria | 30500 |
| 19 | Ga0055531_10000667 | 3300003794 | Bacteria | 29334 |
| 20 | Ga0055531_10000800 | 3300003794 | Bacteria | 26095 |
| 21 | Ga0055531_10006022 | 3300003794 | Bacteria | 6957 |
| 22 | Ga0065165_1000029 | 3300005262 | Bacteria | 220342 |
| 23 | Ga0065165_1000667 | 3300005262 | Bacteria | 49547 |
| 24 | Ga0065715_10000489 | 3300005293 | Bacteria | 17629 |
| 25 | Ga0065715_10134850 | 3300005293 | Bacteria | 1932 |
| 26 | Ga0070658_10023327 | 3300005327 | Bacteria | 4967 |
| 27 | Ga0070658_10027486 | 3300005327 | Bacteria | 4565 |
| 28 | Ga0070658_10033937 | 3300005327 | Bacteria | 4107 |
| 29 | Ga0070658_10040543 | 3300005327 | Bacteria | 3757 |
| 30 | Ga0070658_10069401 | 3300005327 | Bacteria | 2883 |
| 31 | Ga0070658_10071045 | 3300005327 | Bacteria | 2851 |
| 32 | Ga0070676_10001990 | 3300005328 | Bacteria | 10391 |
| 33 | Ga0070676_10025735 | 3300005328 | Bacteria | 3328 |
| 34 | Ga0070690_100047251 | 3300005330 | Bacteria | 2738 |
| 35 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 36 | Ga0070670_100001146 | 3300005331 | Bacteria | 21026 |
| 37 | Ga0070670_100006180 | 3300005331 | Bacteria | 10122 |
| 38 | Ga0070670_100008096 | 3300005331 | Bacteria | 8941 |
| 39 | Ga0070670_100028559 | 3300005331 | Bacteria | 4800 |
| 40 | Ga0070670_100040151 | 3300005331 | Bacteria | 4024 |
| 41 | Ga0070670_100048561 | 3300005331 | Bacteria | 3652 |
| 42 | Ga0068869_100003098 | 3300005334 | Bacteria | 10135 |
| 43 | Ga0068869_100055111 | 3300005334 | Bacteria | 2897 |
| 44 | Ga0070666_10000234 | 3300005335 | Bacteria | 37494 |
| 45 | Ga0070680_100000336 | 3300005336 | Bacteria | 31461 |
| 46 | Ga0070680_100022755 | 3300005336 | Bacteria | 4993 |
| 47 | Ga0070680_100022987 | 3300005336 | Bacteria | 4969 |
| 48 | Ga0070680_100045778 | 3300005336 | Bacteria | 3557 |
| 49 | Ga0070682_100009658 | 3300005337 | Bacteria | 5461 |
| 50 | Ga0070682_100012477 | 3300005337 | Bacteria | 4874 |
| 51 | Ga0070660_100009530 | 3300005339 | Bacteria | 6835 |
| 52 | Ga0070660_100036631 | 3300005339 | Bacteria | 3716 |
| 53 | Ga0070691_10005886 | 3300005341 | Bacteria | 5597 |
| 54 | Ga0070691_10044509 | 3300005341 | Bacteria | 2105 |
| 55 | Ga0070661_100000415 | 3300005344 | Bacteria | 32936 |
| 56 | Ga0070661_100019658 | 3300005344 | Bacteria | 4813 |
| 57 | Ga0070661_100096602 | 3300005344 | Bacteria | 2193 |
| 58 | Ga0070692_10008265 | 3300005345 | Bacteria | 4635 |
| 59 | Ga0070668_100001563 | 3300005347 | Bacteria | 16519 |
| 60 | Ga0070668_100001996 | 3300005347 | Bacteria | 14916 |
| 61 | Ga0070668_100013222 | 3300005347 | Bacteria | 6156 |
| 62 | Ga0070668_100023079 | 3300005347 | Bacteria | 4703 |
| 63 | Ga0070668_100067102 | 3300005347 | Bacteria | 2786 |
| 64 | Ga0070668_100076218 | 3300005347 | Bacteria | 2619 |
| 65 | Ga0070668_100135103 | 3300005347 | Bacteria | 1983 |
| 66 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 67 | Ga0070669_100002352 | 3300005353 | Bacteria | 13674 |
| 68 | Ga0070669_100045468 | 3300005353 | Bacteria | 3199 |
| 69 | Ga0070675_100027852 | 3300005354 | Bacteria | 4543 |
| 70 | Ga0070671_100000010 | 3300005355 | Bacteria | 202799 |
| 71 | Ga0070674_100029240 | 3300005356 | Bacteria | 3627 |
| 72 | Ga0070674_100078446 | 3300005356 | Bacteria | 2353 |
| 73 | Ga0070673_100061252 | 3300005364 | Bacteria | 2985 |
| 74 | Ga0070673_100257186 | 3300005364 | Bacteria | 1524 |
| 75 | Ga0070688_100010364 | 3300005365 | Bacteria | 5137 |
| 76 | Ga0070688_100118190 | 3300005365 | Bacteria | 1772 |
| 77 | Ga0070659_100001844 | 3300005366 | Bacteria | 15225 |
| 78 | Ga0070659_100001909 | 3300005366 | Bacteria | 14893 |
| 79 | Ga0070667_100000140 | 3300005367 | Bacteria | 91817 |
| 80 | Ga0070667_100014536 | 3300005367 | Bacteria | 6504 |
| 81 | Ga0070667_100014955 | 3300005367 | Bacteria | 6410 |
| 82 | Ga0070667_100023369 | 3300005367 | Bacteria | 5128 |
| 83 | Ga0070667_100090483 | 3300005367 | Bacteria | 2630 |
| 84 | Ga0070667_100214822 | 3300005367 | Bacteria | 1710 |
| 85 | Ga0070714_100126231 | 3300005435 | Bacteria | 2281 |
| 86 | Ga0070713_100087488 | 3300005436 | Bacteria | 2672 |
| 87 | Ga0070705_100015454 | 3300005440 | Bacteria | 3949 |
| 88 | Ga0070663_100003708 | 3300005455 | Bacteria | 8856 |
| 89 | Ga0070663_100008421 | 3300005455 | Bacteria | 6344 |
| 90 | Ga0070678_100006677 | 3300005456 | Bacteria | 6790 |
| 91 | Ga0070678_100013030 | 3300005456 | Bacteria | 5196 |
| 92 | Ga0070662_100001233 | 3300005457 | Bacteria | 15724 |
| 93 | Ga0070662_100126397 | 3300005457 | Bacteria | 1966 |
| 94 | Ga0070662_100127009 | 3300005457 | Bacteria | 1961 |
| 95 | Ga0070681_10009284 | 3300005458 | Bacteria | 9672 |
| 96 | Ga0070681_10009895 | 3300005458 | Bacteria | 9394 |
| 97 | Ga0070681_10060810 | 3300005458 | Bacteria | 3753 |
| 98 | Ga0070685_10013224 | 3300005466 | Bacteria | 4348 |
| 99 | Ga0070685_10081286 | 3300005466 | Bacteria | 1943 |
| 100 | Ga0070679_100012066 | 3300005530 | Bacteria | 8250 |
| 101 | Ga0070679_100071563 | 3300005530 | Bacteria | 3458 |
| 102 | Ga0070679_100080501 | 3300005530 | Bacteria | 3247 |
| 103 | Ga0070679_100083661 | 3300005530 | Bacteria | 3179 |
| 104 | Ga0070679_100114822 | 3300005530 | Bacteria | 2678 |
| 105 | Ga0070679_100153856 | 3300005530 | Bacteria | 2275 |
| 106 | Ga0070679_100161731 | 3300005530 | Bacteria | 2213 |
| 107 | Ga0070697_100010332 | 3300005536 | Bacteria | 7278 |
| 108 | Ga0068853_100053469 | 3300005539 | Bacteria | 3478 |
| 109 | Ga0070672_100023443 | 3300005543 | Bacteria | 4550 |
| 110 | Ga0070693_100001672 | 3300005547 | Bacteria | 10050 |
| 111 | Ga0070693_100061671 | 3300005547 | Bacteria | 2181 |
| 112 | Ga0070665_100000248 | 3300005548 | Bacteria | 89239 |
| 113 | Ga0070665_100006854 | 3300005548 | Bacteria | 11582 |
| 114 | Ga0070665_100007821 | 3300005548 | Bacteria | 10848 |
| 115 | Ga0070665_100010246 | 3300005548 | Bacteria | 9485 |
| 116 | Ga0070665_100012139 | 3300005548 | Bacteria | 8688 |
| 117 | Ga0070665_100022755 | 3300005548 | Bacteria | 6309 |
| 118 | Ga0070665_100022780 | 3300005548 | Bacteria | 6305 |
| 119 | Ga0070665_100040780 | 3300005548 | Bacteria | 4666 |
| 120 | Ga0070665_100073128 | 3300005548 | Bacteria | 3435 |
| 121 | Ga0070665_100153619 | 3300005548 | Bacteria | 2304 |
| 122 | Ga0068855_100000010 | 3300005563 | Bacteria | 246022 |
| 123 | Ga0068855_100039414 | 3300005563 | Bacteria | 5608 |
| 124 | Ga0068855_100044198 | 3300005563 | Bacteria | 5273 |
| 125 | Ga0068855_100100860 | 3300005563 | Bacteria | 3323 |
| 126 | Ga0068855_100114040 | 3300005563 | Bacteria | 3099 |
| 127 | Ga0068855_100116015 | 3300005563 | Bacteria | 3069 |
| 128 | Ga0068855_100122502 | 3300005563 | Bacteria | 2975 |
| 129 | Ga0068855_100184885 | 3300005563 | Bacteria | 2354 |
| 130 | Ga0070664_100004570 | 3300005564 | Bacteria | 11108 |
| 131 | Ga0070664_100110447 | 3300005564 | Bacteria | 2399 |
| 132 | Ga0070664_100136620 | 3300005564 | Bacteria | 2156 |
| 133 | Ga0068857_100037113 | 3300005577 | Bacteria | 4316 |
| 134 | Ga0068857_100070399 | 3300005577 | Bacteria | 3116 |
| 135 | Ga0068857_100075817 | 3300005577 | Bacteria | 2999 |
| 136 | Ga0068854_100000732 | 3300005578 | Bacteria | 19460 |
| 137 | Ga0068854_100005086 | 3300005578 | Bacteria | 8286 |
| 138 | Ga0068854_100027333 | 3300005578 | Bacteria | 3931 |
| 139 | Ga0068854_100041361 | 3300005578 | Bacteria | 3256 |
| 140 | Ga0068854_100080460 | 3300005578 | Bacteria | 2404 |
| 141 | Ga0068854_100172581 | 3300005578 | Bacteria | 1684 |
| 142 | Ga0068854_100179449 | 3300005578 | Bacteria | 1653 |
| 143 | Ga0068856_100018794 | 3300005614 | Bacteria | 6702 |
| 144 | Ga0068856_100026670 | 3300005614 | Bacteria | 5634 |
| 145 | Ga0068856_100189330 | 3300005614 | Bacteria | 2071 |
| 146 | Ga0068852_100000692 | 3300005616 | Bacteria | 22063 |
| 147 | Ga0068852_100002080 | 3300005616 | Bacteria | 13668 |
| 148 | Ga0068852_100007208 | 3300005616 | Bacteria | 8107 |
| 149 | Ga0068852_100008296 | 3300005616 | Bacteria | 7646 |
| 150 | Ga0068852_100019190 | 3300005616 | Bacteria | 5404 |
| 151 | Ga0068859_100002317 | 3300005617 | Bacteria | 19344 |
| 152 | Ga0068859_100015571 | 3300005617 | Bacteria | 7642 |
| 153 | Ga0068859_100057662 | 3300005617 | Bacteria | 3912 |
| 154 | Ga0068864_100000472 | 3300005618 | Bacteria | 34898 |
| 155 | Ga0068864_100000533 | 3300005618 | Bacteria | 32621 |
| 156 | Ga0068864_100014781 | 3300005618 | Bacteria | 6485 |
| 157 | Ga0068864_100030976 | 3300005618 | Bacteria | 4536 |
| 158 | Ga0068864_100085254 | 3300005618 | Bacteria | 2777 |
| 159 | Ga0068866_10006662 | 3300005718 | Bacteria | 4817 |
| 160 | Ga0068861_100011425 | 3300005719 | Bacteria | 6174 |
| 161 | Ga0068861_100052353 | 3300005719 | Bacteria | 3102 |
| 162 | Ga0068863_100002271 | 3300005841 | Bacteria | 19100 |
| 163 | Ga0068863_100005428 | 3300005841 | Bacteria | 12555 |
| 164 | Ga0068863_100029849 | 3300005841 | Bacteria | 5207 |
| 165 | Ga0068863_100039041 | 3300005841 | Bacteria | 4518 |
| 166 | Ga0068863_100084696 | 3300005841 | Bacteria | 3004 |
| 167 | Ga0068863_100105700 | 3300005841 | Bacteria | 2678 |
| 168 | Ga0068858_100000098 | 3300005842 | Bacteria | 90747 |
| 169 | Ga0068858_100006839 | 3300005842 | Bacteria | 11087 |
| 170 | Ga0068858_100020066 | 3300005842 | Bacteria | 6251 |
| 171 | Ga0068858_100031490 | 3300005842 | Bacteria | 4926 |
| 172 | Ga0068858_100055790 | 3300005842 | Bacteria | 3652 |
| 173 | Ga0068858_100237180 | 3300005842 | Bacteria | 1730 |
| 174 | Ga0068860_100000580 | 3300005843 | Bacteria | 43948 |
| 175 | Ga0068860_100000583 | 3300005843 | Bacteria | 43765 |
| 176 | Ga0068860_100022267 | 3300005843 | Bacteria | 6132 |
| 177 | Ga0068860_100140979 | 3300005843 | Bacteria | 2317 |
| 178 | Ga0068860_100282863 | 3300005843 | Bacteria | 1621 |
| 179 | Ga0068862_100000443 | 3300005844 | Bacteria | 45038 |
| 180 | Ga0068862_100004861 | 3300005844 | Bacteria | 11312 |
| 181 | Ga0068862_100011082 | 3300005844 | Bacteria | 7448 |
| 182 | Ga0068862_100014334 | 3300005844 | Bacteria | 6574 |
| 183 | Ga0068862_100044274 | 3300005844 | Bacteria | 3796 |
| 184 | Ga0068862_100100985 | 3300005844 | Bacteria | 2523 |
| 185 | Ga0068862_100196208 | 3300005844 | Bacteria | 1819 |
| 186 | Ga0081455_10001641 | 3300005937 | Bacteria | 27241 |
| 187 | Ga0081455_10004974 | 3300005937 | Bacteria | 14702 |
| 188 | Ga0081539_10013768 | 3300005985 | Bacteria | 6062 |
| 189 | Ga0081539_10069354 | 3300005985 | Bacteria | 1898 |
| 190 | Ga0075368_10004137 | 3300006042 | Bacteria | 4888 |
| 191 | Ga0075368_10007426 | 3300006042 | Bacteria | 3868 |
| 192 | Ga0075364_10003123 | 3300006051 | Bacteria | 9375 |
| 193 | Ga0070715_10004104 | 3300006163 | Bacteria | 4734 |
| 194 | Ga0070716_100014189 | 3300006173 | Bacteria | 4078 |
| 195 | Ga0070712_100023883 | 3300006175 | Bacteria | 4043 |
| 196 | Ga0070712_100045608 | 3300006175 | Bacteria | 3027 |
| 197 | Ga0075362_10006143 | 3300006177 | Bacteria | 4454 |
| 198 | Ga0075367_10031006 | 3300006178 | Bacteria | 3069 |
| 199 | Ga0075366_10012514 | 3300006195 | Bacteria | 4813 |
| 200 | Ga0097621_100000004 | 3300006237 | Bacteria | 144414 |
| 201 | Ga0097621_100114654 | 3300006237 | Bacteria | 2280 |
| 202 | Ga0097621_100245117 | 3300006237 | Bacteria | 1568 |
| 203 | Ga0068871_100041474 | 3300006358 | Bacteria | 3691 |
| 204 | Ga0068871_100166216 | 3300006358 | Bacteria | 1889 |
| 205 | Ga0075428_100060508 | 3300006844 | Bacteria | 4147 |
| 206 | Ga0075430_100036361 | 3300006846 | Bacteria | 4177 |
| 207 | Ga0075431_100088461 | 3300006847 | Bacteria | 3196 |
| 208 | Ga0075431_100176581 | 3300006847 | Bacteria | 2194 |
| 209 | Ga0075433_10016841 | 3300006852 | Bacteria | 6039 |
| 210 | Ga0075434_100208611 | 3300006871 | Bacteria | 1974 |
| 211 | Ga0068865_100000723 | 3300006881 | Bacteria | 18580 |
| 212 | Ga0068865_100022539 | 3300006881 | Bacteria | 4110 |
| 213 | Ga0075436_100069795 | 3300006914 | Bacteria | 2428 |
| 214 | Ga0097620_100002317 | 3300006931 | Bacteria | 19344 |
| 215 | Ga0097620_100015570 | 3300006931 | Bacteria | 7642 |
| 216 | Ga0097620_100057660 | 3300006931 | Bacteria | 3912 |
| 217 | Ga0105240_10000189 | 3300009093 | Bacteria | 125396 |
| 218 | Ga0105240_10003194 | 3300009093 | Bacteria | 25746 |
| 219 | Ga0105240_10011563 | 3300009093 | Bacteria | 12282 |
| 220 | Ga0105240_10017423 | 3300009093 | Bacteria | 9681 |
| 221 | Ga0105240_10041926 | 3300009093 | Bacteria | 5837 |
| 222 | Ga0105240_10044078 | 3300009093 | Bacteria | 5672 |
| 223 | Ga0105240_10050693 | 3300009093 | Bacteria | 5231 |
| 224 | Ga0105240_10068604 | 3300009093 | Bacteria | 4391 |
| 225 | Ga0105240_10069728 | 3300009093 | Bacteria | 4350 |
| 226 | Ga0105240_10246678 | 3300009093 | Bacteria | 2068 |
| 227 | Ga0111539_10012292 | 3300009094 | Bacteria | 10731 |
| 228 | Ga0111539_10221374 | 3300009094 | Bacteria | 2204 |
| 229 | Ga0105245_10001293 | 3300009098 | Bacteria | 22573 |
| 230 | Ga0105245_10047864 | 3300009098 | Bacteria | 3824 |
| 231 | Ga0105245_10089674 | 3300009098 | Bacteria | 2827 |
| 232 | Ga0105247_10000673 | 3300009101 | Bacteria | 26928 |
| 233 | Ga0105247_10006738 | 3300009101 | Bacteria | 7087 |
| 234 | Ga0105243_10002889 | 3300009148 | Bacteria | 14238 |
| 235 | Ga0105243_10003266 | 3300009148 | Bacteria | 13205 |
| 236 | Ga0105243_10029612 | 3300009148 | Bacteria | 4211 |
| 237 | Ga0105241_10012391 | 3300009174 | Bacteria | 6248 |
| 238 | Ga0105241_10082892 | 3300009174 | Bacteria | 2514 |
| 239 | Ga0105242_10021185 | 3300009176 | Bacteria | 5102 |
| 240 | Ga0105248_10004862 | 3300009177 | Bacteria | 14873 |
| 241 | Ga0105248_10006553 | 3300009177 | Bacteria | 12766 |
| 242 | Ga0105248_10022662 | 3300009177 | Bacteria | 6970 |
| 243 | Ga0105248_10030181 | 3300009177 | Bacteria | 6052 |
| 244 | Ga0105248_10041909 | 3300009177 | Bacteria | 5133 |
| 245 | Ga0105237_10006217 | 3300009545 | Bacteria | 13306 |
| 246 | Ga0105237_10038275 | 3300009545 | Bacteria | 4843 |
| 247 | Ga0105237_10158072 | 3300009545 | Bacteria | 2264 |
| 248 | Ga0105237_10164072 | 3300009545 | Bacteria | 2220 |
| 249 | Ga0105238_10012191 | 3300009551 | Bacteria | 8665 |
| 250 | Ga0105238_10016939 | 3300009551 | Bacteria | 7396 |
| 251 | Ga0105238_10033513 | 3300009551 | Bacteria | 5227 |
| 252 | Ga0105238_10036572 | 3300009551 | Bacteria | 4992 |
| 253 | Ga0105238_10056284 | 3300009551 | Bacteria | 3946 |
| 254 | Ga0105238_10056986 | 3300009551 | Bacteria | 3919 |
| 255 | Ga0105238_10124630 | 3300009551 | Bacteria | 2556 |
| 256 | Ga0105238_10151581 | 3300009551 | Bacteria | 2293 |
| 257 | Ga0105249_10004149 | 3300009553 | Bacteria | 12511 |
| 258 | Ga0105249_10033372 | 3300009553 | Bacteria | 4660 |
| 259 | Ga0105239_10000157 | 3300010375 | Bacteria | 98327 |
| 260 | Ga0105239_10022193 | 3300010375 | Bacteria | 6997 |
| 261 | Ga0105239_10058604 | 3300010375 | Bacteria | 4226 |
| 262 | Ga0105239_10148198 | 3300010375 | Bacteria | 2618 |
| 263 | Ga0105239_10172760 | 3300010375 | Bacteria | 2417 |
| 264 | Ga0105239_10175604 | 3300010375 | Bacteria | 2396 |
| 265 | Ga0105246_10014991 | 3300011119 | Bacteria | 4884 |
| 266 | Ga0105246_10034704 | 3300011119 | Bacteria | 3364 |
| 267 | Ga0157373_10000106 | 3300013100 | Bacteria | 65255 |
| 268 | Ga0157373_10000549 | 3300013100 | Bacteria | 29370 |
| 269 | Ga0157373_10019946 | 3300013100 | Bacteria | 4877 |
| 270 | Ga0157373_10099310 | 3300013100 | Bacteria | 2049 |
| 271 | Ga0157371_10008210 | 3300013102 | Bacteria | 8349 |
| 272 | Ga0157371_10015685 | 3300013102 | Bacteria | 5673 |
| 273 | Ga0157370_10073701 | 3300013104 | Bacteria | 3221 |
| 274 | Ga0157370_10295033 | 3300013104 | Bacteria | 1497 |
| 275 | Ga0157369_10000202 | 3300013105 | Bacteria | 82819 |
| 276 | Ga0157369_10004702 | 3300013105 | Bacteria | 16048 |
| 277 | Ga0157369_10010154 | 3300013105 | Bacteria | 10746 |
| 278 | Ga0157369_10018118 | 3300013105 | Bacteria | 7899 |
| 279 | Ga0157369_10046948 | 3300013105 | Bacteria | 4692 |
| 280 | Ga0157369_10137587 | 3300013105 | Bacteria | 2585 |
| 281 | Ga0171462_1040 | 3300013250 | Bacteria | 73112 |
| 282 | Ga0157374_10001715 | 3300013296 | Bacteria | 18394 |
| 283 | Ga0157378_10007224 | 3300013297 | Bacteria | 9702 |
| 284 | Ga0157378_10014358 | 3300013297 | Bacteria | 6935 |
| 285 | Ga0157378_10025468 | 3300013297 | Bacteria | 5208 |
| 286 | Ga0157378_10155814 | 3300013297 | Bacteria | 2132 |
| 287 | Ga0163162_10052631 | 3300013306 | Bacteria | 4089 |
| 288 | Ga0163162_10098343 | 3300013306 | Bacteria | 3016 |
| 289 | Ga0157372_10015386 | 3300013307 | Bacteria | 8199 |
| 290 | Ga0157372_10020017 | 3300013307 | Bacteria | 7215 |
| 291 | Ga0157372_10028104 | 3300013307 | Bacteria | 6135 |
| 292 | Ga0157372_10294811 | 3300013307 | Bacteria | 1886 |
| 293 | Ga0157375_10002209 | 3300013308 | Bacteria | 16831 |
| 294 | Ga0157375_10054963 | 3300013308 | Bacteria | 3923 |
| 295 | Ga0157375_10151643 | 3300013308 | Bacteria | 2454 |
| 296 | Ga0157375_10169873 | 3300013308 | Bacteria | 2328 |
| 297 | Ga0163163_10031710 | 3300014325 | Bacteria | 5103 |
| 298 | Ga0163163_10032695 | 3300014325 | Bacteria | 5026 |
| 299 | Ga0163163_10153893 | 3300014325 | Bacteria | 2343 |
| 300 | Ga0157380_10002753 | 3300014326 | Bacteria | 11937 |
| 301 | Ga0157380_10006132 | 3300014326 | Bacteria | 8429 |
| 302 | Ga0157380_10029593 | 3300014326 | Bacteria | 4187 |
| 303 | Ga0157380_10067375 | 3300014326 | Bacteria | 2882 |
| 304 | Ga0157379_10017057 | 3300014968 | Bacteria | 6393 |
| 305 | Ga0157379_10017776 | 3300014968 | Bacteria | 6263 |
| 306 | Ga0157379_10026633 | 3300014968 | Bacteria | 5147 |
| 307 | Ga0157379_10067903 | 3300014968 | Bacteria | 3187 |
| 308 | Ga0157379_10071957 | 3300014968 | Bacteria | 3093 |
| 309 | Ga0157376_10016186 | 3300014969 | Bacteria | 5655 |
| 310 | Ga0157376_10124306 | 3300014969 | Bacteria | 2291 |
| 311 | Ga0157376_10161051 | 3300014969 | Bacteria | 2034 |
| 312 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 313 | Ga0163161_10078138 | 3300017792 | Bacteria | 2432 |
| 314 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 315 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 316 | Ga0213876_10000125 | 3300021384 | Bacteria | 83238 |
| 317 | Ga0213876_10001849 | 3300021384 | Bacteria | 12750 |
| 318 | Ga0213876_10021790 | 3300021384 | Bacteria | 3389 |
| 319 | Ga0213875_10001173 | 3300021388 | Bacteria | 17947 |
| 320 | Ga0207427_101301 | 3300025231 | Bacteria | 9417 |
| 321 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 322 | Ga0209233_1001390 | 3300025261 | Bacteria | 9590 |
| 323 | Ga0209130_1000697 | 3300025284 | Bacteria | 30036 |
| 324 | Ga0209675_1000808 | 3300025291 | Bacteria | 20627 |
| 325 | Ga0209675_1001346 | 3300025291 | Bacteria | 14500 |
| 326 | Ga0209675_1007120 | 3300025291 | Bacteria | 4346 |
| 327 | Ga0209676_1000151 | 3300025292 | Bacteria | 167307 |
| 328 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 329 | Ga0209676_1000453 | 3300025292 | Bacteria | 69137 |
| 330 | Ga0209676_1001788 | 3300025292 | Bacteria | 18043 |
| 331 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 332 | Ga0209025_1021699 | 3300025294 | Bacteria | 3445 |
| 333 | Ga0209564_1000105 | 3300025295 | Bacteria | 218124 |
| 334 | Ga0209564_1000150 | 3300025295 | Bacteria | 170318 |
| 335 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 336 | Ga0209758_1000401 | 3300025297 | Bacteria | 74599 |
| 337 | Ga0209050_1000031 | 3300025298 | Bacteria | 458181 |
| 338 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 339 | Ga0209050_1000822 | 3300025298 | Bacteria | 43254 |
| 340 | Ga0209050_1001101 | 3300025298 | Bacteria | 32754 |
| 341 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 342 | Ga0209256_1000128 | 3300025299 | Bacteria | 163833 |
| 343 | Ga0209256_1000743 | 3300025299 | Bacteria | 42721 |
| 344 | Ga0207426_1007192 | 3300025302 | Bacteria | 4696 |
| 345 | Ga0209257_1000073 | 3300025304 | Bacteria | 325833 |
| 346 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 347 | Ga0209257_1000413 | 3300025304 | Bacteria | 82516 |
| 348 | Ga0209257_1000487 | 3300025304 | Bacteria | 71315 |
| 349 | Ga0209257_1000760 | 3300025304 | Bacteria | 48318 |
| 350 | Ga0209257_1002730 | 3300025304 | Bacteria | 16776 |
| 351 | Ga0209257_1003297 | 3300025304 | Bacteria | 14064 |
| 352 | Ga0207697_10000036 | 3300025315 | Bacteria | 49927 |
| 353 | Ga0207697_10000845 | 3300025315 | Bacteria | 17297 |
| 354 | Ga0207697_10021489 | 3300025315 | Bacteria | 2641 |
| 355 | Ga0207682_10000389 | 3300025893 | Bacteria | 20256 |
| 356 | Ga0207710_10001925 | 3300025900 | Bacteria | 9942 |
| 357 | Ga0207710_10025882 | 3300025900 | Bacteria | 2534 |
| 358 | Ga0207680_10000097 | 3300025903 | Bacteria | 40203 |
| 359 | Ga0207647_10004963 | 3300025904 | Bacteria | 9808 |
| 360 | Ga0207645_10031151 | 3300025907 | Bacteria | 3433 |
| 361 | Ga0207645_10032477 | 3300025907 | Bacteria | 3355 |
| 362 | Ga0207705_10000060 | 3300025909 | Bacteria | 152576 |
| 363 | Ga0207705_10005248 | 3300025909 | Bacteria | 9712 |
| 364 | Ga0207705_10012524 | 3300025909 | Bacteria | 6122 |
| 365 | Ga0207705_10020398 | 3300025909 | Bacteria | 4737 |
| 366 | Ga0207705_10024713 | 3300025909 | Bacteria | 4287 |
| 367 | Ga0207705_10051612 | 3300025909 | Bacteria | 2960 |
| 368 | Ga0207705_10079055 | 3300025909 | Bacteria | 2395 |
| 369 | Ga0207654_10042006 | 3300025911 | Bacteria | 2585 |
| 370 | Ga0207654_10055799 | 3300025911 | Bacteria | 2289 |
| 371 | Ga0207654_10058582 | 3300025911 | Bacteria | 2243 |
| 372 | Ga0207707_10009978 | 3300025912 | Bacteria | 8236 |
| 373 | Ga0207707_10021925 | 3300025912 | Bacteria | 5583 |
| 374 | Ga0207707_10040418 | 3300025912 | Bacteria | 4073 |
| 375 | Ga0207707_10108805 | 3300025912 | Bacteria | 2423 |
| 376 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 377 | Ga0207695_10000984 | 3300025913 | Bacteria | 50625 |
| 378 | Ga0207695_10001296 | 3300025913 | Bacteria | 42421 |
| 379 | Ga0207695_10004268 | 3300025913 | Bacteria | 19631 |
| 380 | Ga0207695_10006268 | 3300025913 | Bacteria | 15485 |
| 381 | Ga0207695_10006284 | 3300025913 | Bacteria | 15460 |
| 382 | Ga0207695_10006822 | 3300025913 | Bacteria | 14705 |
| 383 | Ga0207695_10017297 | 3300025913 | Bacteria | 8395 |
| 384 | Ga0207695_10025668 | 3300025913 | Bacteria | 6592 |
| 385 | Ga0207695_10030351 | 3300025913 | Bacteria | 5952 |
| 386 | Ga0207695_10037479 | 3300025913 | Bacteria | 5231 |
| 387 | Ga0207695_10054252 | 3300025913 | Bacteria | 4187 |
| 388 | Ga0207671_10000701 | 3300025914 | Bacteria | 43166 |
| 389 | Ga0207671_10007162 | 3300025914 | Bacteria | 9727 |
| 390 | Ga0207671_10087469 | 3300025914 | Bacteria | 2343 |
| 391 | Ga0207693_10001172 | 3300025915 | Bacteria | 23402 |
| 392 | Ga0207693_10038804 | 3300025915 | Bacteria | 3749 |
| 393 | Ga0207663_10056658 | 3300025916 | Bacteria | 2466 |
| 394 | Ga0207660_10000221 | 3300025917 | Bacteria | 36706 |
| 395 | Ga0207660_10014579 | 3300025917 | Bacteria | 5172 |
| 396 | Ga0207660_10051165 | 3300025917 | Bacteria | 2936 |
| 397 | Ga0207662_10019704 | 3300025918 | Bacteria | 3843 |
| 398 | Ga0207657_10002252 | 3300025919 | Bacteria | 20914 |
| 399 | Ga0207657_10007933 | 3300025919 | Bacteria | 10824 |
| 400 | Ga0207657_10017872 | 3300025919 | Bacteria | 6786 |
| 401 | Ga0207657_10019859 | 3300025919 | Bacteria | 6367 |
| 402 | Ga0207657_10020383 | 3300025919 | Bacteria | 6266 |
| 403 | Ga0207649_10000235 | 3300025920 | Bacteria | 45363 |
| 404 | Ga0207649_10000448 | 3300025920 | Bacteria | 29660 |
| 405 | Ga0207649_10002604 | 3300025920 | Bacteria | 10015 |
| 406 | Ga0207649_10014458 | 3300025920 | Bacteria | 4421 |
| 407 | Ga0207649_10060349 | 3300025920 | Bacteria | 2383 |
| 408 | Ga0207652_10033185 | 3300025921 | Bacteria | 4345 |
| 409 | Ga0207652_10112272 | 3300025921 | Bacteria | 2418 |
| 410 | Ga0207652_10125765 | 3300025921 | Bacteria | 2283 |
| 411 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 412 | Ga0207681_10003001 | 3300025923 | Bacteria | 10603 |
| 413 | Ga0207681_10071587 | 3300025923 | Bacteria | 2419 |
| 414 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 415 | Ga0207694_10016477 | 3300025924 | Bacteria | 5581 |
| 416 | Ga0207694_10039585 | 3300025924 | Bacteria | 3627 |
| 417 | Ga0207694_10129105 | 3300025924 | Bacteria | 2025 |
| 418 | Ga0207694_10185176 | 3300025924 | Bacteria | 1690 |
| 419 | Ga0207694_10201115 | 3300025924 | Bacteria | 1621 |
| 420 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 421 | Ga0207650_10000537 | 3300025925 | Bacteria | 30997 |
| 422 | Ga0207650_10008947 | 3300025925 | Bacteria | 6844 |
| 423 | Ga0207650_10017759 | 3300025925 | Bacteria | 4983 |
| 424 | Ga0207659_10006280 | 3300025926 | Bacteria | 7271 |
| 425 | Ga0207659_10019312 | 3300025926 | Bacteria | 4484 |
| 426 | Ga0207687_10001382 | 3300025927 | Bacteria | 16576 |
| 427 | Ga0207687_10029495 | 3300025927 | Bacteria | 3691 |
| 428 | Ga0207664_10005602 | 3300025929 | Bacteria | 8594 |
| 429 | Ga0207664_10123471 | 3300025929 | Bacteria | 2171 |
| 430 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 431 | Ga0207690_10000066 | 3300025932 | Bacteria | 91772 |
| 432 | Ga0207690_10004547 | 3300025932 | Bacteria | 8193 |
| 433 | Ga0207690_10009334 | 3300025932 | Bacteria | 5829 |
| 434 | Ga0207690_10034528 | 3300025932 | Bacteria | 3259 |
| 435 | Ga0207706_10000415 | 3300025933 | Bacteria | 45662 |
| 436 | Ga0207706_10013108 | 3300025933 | Bacteria | 7541 |
| 437 | Ga0207706_10017152 | 3300025933 | Bacteria | 6530 |
| 438 | Ga0207706_10033035 | 3300025933 | Bacteria | 4606 |
| 439 | Ga0207686_10142682 | 3300025934 | Bacteria | 1658 |
| 440 | Ga0207709_10002218 | 3300025935 | Bacteria | 12386 |
| 441 | Ga0207709_10093380 | 3300025935 | Bacteria | 1972 |
| 442 | Ga0207709_10146240 | 3300025935 | Bacteria | 1631 |
| 443 | Ga0207670_10016263 | 3300025936 | Bacteria | 4466 |
| 444 | Ga0207670_10030117 | 3300025936 | Bacteria | 3465 |
| 445 | Ga0207669_10023944 | 3300025937 | Bacteria | 3272 |
| 446 | Ga0207704_10201169 | 3300025938 | Bacteria | 1458 |
| 447 | Ga0207665_10001649 | 3300025939 | Bacteria | 15020 |
| 448 | Ga0207691_10001641 | 3300025940 | Bacteria | 22196 |
| 449 | Ga0207691_10014720 | 3300025940 | Bacteria | 7456 |
| 450 | Ga0207711_10007924 | 3300025941 | Bacteria | 8886 |
| 451 | Ga0207711_10066920 | 3300025941 | Bacteria | 3108 |
| 452 | Ga0207711_10069337 | 3300025941 | Bacteria | 3056 |
| 453 | Ga0207689_10028111 | 3300025942 | Bacteria | 4703 |
| 454 | Ga0207689_10042506 | 3300025942 | Bacteria | 3759 |
| 455 | Ga0207689_10155032 | 3300025942 | Bacteria | 1888 |
| 456 | Ga0207661_10030751 | 3300025944 | Bacteria | 4139 |
| 457 | Ga0207661_10172414 | 3300025944 | Bacteria | 1884 |
| 458 | Ga0207679_10004181 | 3300025945 | Bacteria | 8967 |
| 459 | Ga0207667_10000093 | 3300025949 | Bacteria | 145814 |
| 460 | Ga0207667_10010340 | 3300025949 | Bacteria | 10911 |
| 461 | Ga0207667_10031541 | 3300025949 | Bacteria | 5720 |
| 462 | Ga0207667_10033965 | 3300025949 | Bacteria | 5480 |
| 463 | Ga0207667_10121329 | 3300025949 | Bacteria | 2693 |
| 464 | Ga0207667_10205203 | 3300025949 | Bacteria | 2021 |
| 465 | Ga0207651_10128225 | 3300025960 | Bacteria | 1937 |
| 466 | Ga0207712_10002299 | 3300025961 | Bacteria | 12407 |
| 467 | Ga0207712_10055505 | 3300025961 | Bacteria | 2787 |
| 468 | Ga0207668_10000046 | 3300025972 | Bacteria | 102051 |
| 469 | Ga0207668_10000996 | 3300025972 | Bacteria | 16977 |
| 470 | Ga0207668_10001421 | 3300025972 | Bacteria | 14084 |
| 471 | Ga0207668_10003452 | 3300025972 | Bacteria | 9277 |
| 472 | Ga0207668_10018563 | 3300025972 | Bacteria | 4380 |
| 473 | Ga0207668_10032130 | 3300025972 | Bacteria | 3465 |
| 474 | Ga0207640_10003091 | 3300025981 | Bacteria | 8958 |
| 475 | Ga0207640_10005800 | 3300025981 | Bacteria | 6734 |
| 476 | Ga0207640_10026267 | 3300025981 | Bacteria | 3533 |
| 477 | Ga0207640_10042562 | 3300025981 | Bacteria | 2897 |
| 478 | Ga0207658_10000264 | 3300025986 | Bacteria | 55170 |
| 479 | Ga0207658_10003580 | 3300025986 | Bacteria | 10968 |
| 480 | Ga0207658_10006846 | 3300025986 | Bacteria | 7767 |
| 481 | Ga0207658_10015549 | 3300025986 | Bacteria | 5220 |
| 482 | Ga0207677_10051800 | 3300026023 | Bacteria | 2785 |
| 483 | Ga0207703_10000086 | 3300026035 | Bacteria | 107307 |
| 484 | Ga0207703_10001492 | 3300026035 | Bacteria | 21341 |
| 485 | Ga0207703_10002958 | 3300026035 | Bacteria | 14408 |
| 486 | Ga0207703_10003329 | 3300026035 | Bacteria | 13494 |
| 487 | Ga0207639_10015498 | 3300026041 | Bacteria | 5380 |
| 488 | Ga0207639_10064483 | 3300026041 | Bacteria | 2840 |
| 489 | Ga0207639_10076993 | 3300026041 | Bacteria | 2628 |
| 490 | Ga0207678_10000698 | 3300026067 | Bacteria | 30592 |
| 491 | Ga0207678_10000804 | 3300026067 | Bacteria | 28814 |
| 492 | Ga0207678_10001001 | 3300026067 | Bacteria | 25726 |
| 493 | Ga0207678_10017512 | 3300026067 | Bacteria | 6292 |
| 494 | Ga0207678_10028782 | 3300026067 | Bacteria | 4850 |
| 495 | Ga0207678_10150185 | 3300026067 | Bacteria | 1989 |
| 496 | Ga0207708_10001156 | 3300026075 | Bacteria | 19859 |
| 497 | Ga0207702_10008523 | 3300026078 | Bacteria | 8644 |
| 498 | Ga0207702_10011107 | 3300026078 | Bacteria | 7517 |
| 499 | Ga0207702_10024721 | 3300026078 | Bacteria | 4983 |
| 500 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 501 | Ga0207641_10001512 | 3300026088 | Bacteria | 22780 |
| 502 | Ga0207641_10011597 | 3300026088 | Bacteria | 7234 |
| 503 | Ga0207641_10040963 | 3300026088 | Bacteria | 3881 |
| 504 | Ga0207641_10087523 | 3300026088 | Bacteria | 2718 |
| 505 | Ga0207648_10019067 | 3300026089 | Bacteria | 6194 |
| 506 | Ga0207676_10000445 | 3300026095 | Bacteria | 35000 |
| 507 | Ga0207676_10000784 | 3300026095 | Bacteria | 24801 |
| 508 | Ga0207676_10012291 | 3300026095 | Bacteria | 6129 |
| 509 | Ga0207676_10022590 | 3300026095 | Bacteria | 4627 |
| 510 | Ga0207676_10124390 | 3300026095 | Bacteria | 2181 |
| 511 | Ga0207676_10154162 | 3300026095 | Bacteria | 1982 |
| 512 | Ga0207674_10004754 | 3300026116 | Bacteria | 16280 |
| 513 | Ga0207674_10050669 | 3300026116 | Bacteria | 4240 |
| 514 | Ga0207674_10078164 | 3300026116 | Bacteria | 3314 |
| 515 | Ga0207675_100000249 | 3300026118 | Bacteria | 51517 |
| 516 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 517 | Ga0207675_100060567 | 3300026118 | Bacteria | 3534 |
| 518 | Ga0207683_10000527 | 3300026121 | Bacteria | 35492 |
| 519 | Ga0207683_10021308 | 3300026121 | Bacteria | 5547 |
| 520 | Ga0207683_10038603 | 3300026121 | Bacteria | 4164 |
| 521 | Ga0207683_10079316 | 3300026121 | Bacteria | 2911 |
| 522 | Ga0207683_10088260 | 3300026121 | Bacteria | 2759 |
| 523 | Ga0207683_10167283 | 3300026121 | Bacteria | 1990 |
| 524 | Ga0207698_10001333 | 3300026142 | Bacteria | 14406 |
| 525 | Ga0207698_10021331 | 3300026142 | Bacteria | 4477 |
| 526 | Ga0207698_10089425 | 3300026142 | Bacteria | 2515 |
| 527 | Ga0207698_10105462 | 3300026142 | Bacteria | 2349 |
| 528 | Ga0209974_10007907 | 3300027876 | Bacteria | 3647 |
| 529 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 530 | Ga0268266_10000474 | 3300028379 | Bacteria | 57849 |
| 531 | Ga0268266_10001455 | 3300028379 | Bacteria | 28167 |
| 532 | Ga0268266_10005907 | 3300028379 | Bacteria | 11323 |
| 533 | Ga0268266_10023201 | 3300028379 | Bacteria | 5284 |
| 534 | Ga0268266_10024329 | 3300028379 | Bacteria | 5152 |
| 535 | Ga0268266_10029304 | 3300028379 | Bacteria | 4680 |
| 536 | Ga0268266_10036647 | 3300028379 | Bacteria | 4176 |
| 537 | Ga0268266_10090362 | 3300028379 | Bacteria | 2684 |
| 538 | Ga0268266_10122735 | 3300028379 | Bacteria | 2313 |
| 539 | Ga0268266_10187165 | 3300028379 | Bacteria | 1888 |
| 540 | Ga0268265_10000339 | 3300028380 | Bacteria | 50894 |
| 541 | Ga0268265_10002810 | 3300028380 | Bacteria | 12814 |
| 542 | Ga0268265_10029731 | 3300028380 | Bacteria | 3927 |
| 543 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 544 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 545 | Ga0268264_10000358 | 3300028381 | Bacteria | 68359 |
| 546 | Ga0265337_1001828 | 3300028556 | Bacteria | 10210 |
| 547 | Ga0265337_1010633 | 3300028556 | Bacteria | 3212 |
| 548 | Ga0307517_10025834 | 3300028786 | Bacteria | 7154 |
| 549 | Ga0265338_10014834 | 3300028800 | Bacteria | 8621 |
| 550 | Ga0265338_10020764 | 3300028800 | Bacteria | 6889 |
| 551 | Ga0265338_10029551 | 3300028800 | Bacteria | 5428 |
| 552 | Ga0307511_10050145 | 3300030521 | Bacteria | 3366 |
| 553 | Ga0265330_10040206 | 3300031235 | Bacteria | 2077 |
| 554 | Ga0265332_10007546 | 3300031238 | Bacteria | 4917 |
| 555 | Ga0265325_10001499 | 3300031241 | Bacteria | 16417 |
| 556 | Ga0265325_10002804 | 3300031241 | Bacteria | 11626 |
| 557 | Ga0265340_10000071 | 3300031247 | Bacteria | 48537 |
| 558 | Ga0265340_10002678 | 3300031247 | Bacteria | 10128 |
| 559 | Ga0265340_10009105 | 3300031247 | Bacteria | 5338 |
| 560 | Ga0265340_10009447 | 3300031247 | Bacteria | 5232 |
| 561 | Ga0265340_10073391 | 3300031247 | Bacteria | 1619 |
| 562 | Ga0265339_10002510 | 3300031249 | Bacteria | 13106 |
| 563 | Ga0265339_10004519 | 3300031249 | Bacteria | 9474 |
| 564 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 565 | Ga0265331_10094110 | 3300031250 | Bacteria | 1383 |
| 566 | Ga0265327_10000074 | 3300031251 | Bacteria | 214435 |
| 567 | Ga0265327_10000381 | 3300031251 | Bacteria | 83617 |
| 568 | Ga0265327_10001725 | 3300031251 | Bacteria | 25910 |
| 569 | Ga0265327_10020337 | 3300031251 | Bacteria | 4049 |
| 570 | Ga0265316_10020337 | 3300031344 | Bacteria | 5652 |
| 571 | Ga0265316_10064684 | 3300031344 | Bacteria | 2833 |
| 572 | Ga0265316_10101941 | 3300031344 | Bacteria | 2180 |
| 573 | Ga0307513_10001008 | 3300031456 | Bacteria | 40757 |
| 574 | Ga0307513_10004817 | 3300031456 | Bacteria | 17920 |
| 575 | Ga0307408_100012825 | 3300031548 | Bacteria | 5558 |
| 576 | Ga0307408_100049854 | 3300031548 | Bacteria | 3008 |
| 577 | Ga0316579_10014412 | 3300031691 | Bacteria | 3416 |
| 578 | Ga0265314_10002986 | 3300031711 | Bacteria | 16750 |
| 579 | Ga0265314_10009963 | 3300031711 | Bacteria | 7968 |
| 580 | Ga0265314_10028054 | 3300031711 | Bacteria | 4203 |
| 581 | Ga0265342_10000100 | 3300031712 | Bacteria | 94554 |
| 582 | Ga0265342_10011993 | 3300031712 | Bacteria | 5888 |
| 583 | Ga0265342_10056439 | 3300031712 | Bacteria | 2327 |
| 584 | Ga0265342_10099770 | 3300031712 | Bacteria | 1655 |
| 585 | Ga0316576_10034936 | 3300031727 | Bacteria | 3585 |
| 586 | Ga0316578_10048851 | 3300031728 | Bacteria | 2471 |
| 587 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 588 | Ga0307516_10024467 | 3300031730 | Bacteria | 6167 |
| 589 | Ga0307516_10041770 | 3300031730 | Bacteria | 4555 |
| 590 | Ga0307405_10004900 | 3300031731 | Bacteria | 6391 |
| 591 | Ga0316577_10026372 | 3300031733 | Bacteria | 3235 |
| 592 | Ga0307413_10027278 | 3300031824 | Bacteria | 3162 |
| 593 | Ga0307410_10004727 | 3300031852 | Bacteria | 7088 |
| 594 | Ga0307410_10014826 | 3300031852 | Bacteria | 4601 |
| 595 | Ga0307410_10015919 | 3300031852 | Bacteria | 4471 |
| 596 | Ga0307410_10038726 | 3300031852 | Bacteria | 3125 |
| 597 | Ga0307410_10069070 | 3300031852 | Bacteria | 2443 |
| 598 | Ga0307410_10076539 | 3300031852 | Bacteria | 2336 |
| 599 | Ga0307406_10004114 | 3300031901 | Bacteria | 7920 |
| 600 | Ga0307406_10042409 | 3300031901 | Bacteria | 2840 |
| 601 | Ga0307406_10156355 | 3300031901 | Bacteria | 1633 |
| 602 | Ga0307412_10004265 | 3300031911 | Bacteria | 7973 |
| 603 | Ga0307412_10115500 | 3300031911 | Bacteria | 1924 |
| 604 | Ga0307409_100009507 | 3300031995 | Bacteria | 5977 |
| 605 | Ga0307409_100042393 | 3300031995 | Bacteria | 3408 |
| 606 | Ga0307409_100091515 | 3300031995 | Bacteria | 2493 |
| 607 | Ga0307416_100018999 | 3300032002 | Bacteria | 4860 |
| 608 | Ga0307414_10008109 | 3300032004 | Bacteria | 5934 |
| 609 | Ga0307414_10048172 | 3300032004 | Bacteria | 2938 |
| 610 | Ga0307414_10057250 | 3300032004 | Bacteria | 2739 |
| 611 | Ga0307414_10112576 | 3300032004 | Bacteria | 2075 |
| 612 | Ga0307414_10130993 | 3300032004 | Bacteria | 1947 |
| 613 | Ga0307414_10154727 | 3300032004 | Bacteria | 1813 |
| 614 | Ga0307414_10241746 | 3300032004 | Bacteria | 1495 |
| 615 | Ga0307411_10010448 | 3300032005 | Bacteria | 4949 |
| 616 | Ga0307411_10089364 | 3300032005 | Bacteria | 2145 |
| 617 | Ga0307411_10100930 | 3300032005 | Bacteria | 2040 |
| 618 | Ga0307411_10154398 | 3300032005 | Bacteria | 1710 |
| 619 | Ga0307415_100003761 | 3300032126 | Bacteria | 7778 |
| 620 | Ga0307415_100009695 | 3300032126 | Bacteria | 5416 |
| 621 | Ga0316583_10020047 | 3300032133 | Bacteria | 2396 |
| 622 | Ga0316585_10021242 | 3300032137 | Bacteria | 1992 |
| 623 | Ga0307510_10007774 | 3300033180 | Bacteria | 12786 |
| 624 | Ga0307510_10132745 | 3300033180 | Bacteria | 2157 |
| 625 | Ga0373939_0011890 | 3300035114 | Bacteria | 2208 |
| 626 | Ga0373927_0001191 | 3300035695 | Bacteria | 19735 |
| 627 | Ga0373927_0079266 | 3300035695 | Bacteria | 2127 |
| 628 | Ga0373933_0058424 | 3300035724 | Bacteria | 2320 |
| 629 | Ga0373947_0003164 | 3300035725 | Bacteria | 9796 |
| 630 | Ga0373937_0257417 | 3300036401 | Bacteria | 1646 |
| 631 | Ga0316582_0032276 | 3300036647 | Bacteria | 3207 |
| 632 | Ga0373925_0000136 | 3300037068 | Bacteria | 77912 |
| 633 | Ga0373925_0033525 | 3300037068 | Bacteria | 3784 |
| 634 | Ga0395899_0000165 | 3300037312 | Bacteria | 102140 |
| 635 | Ga0395899_0000399 | 3300037312 | Bacteria | 51229 |
| 636 | Ga0395899_0014303 | 3300037312 | Bacteria | 6057 |
| 637 | Ga0395899_0016202 | 3300037312 | Bacteria | 5681 |
| 638 | Ga0395899_0067809 | 3300037312 | Bacteria | 2617 |
| 639 | Ga0395899_0159151 | 3300037312 | Bacteria | 1596 |
| 640 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 641 | Ga0395900_0000949 | 3300037418 | Bacteria | 37825 |
| 642 | Ga0395900_0033116 | 3300037418 | Bacteria | 5318 |
| 643 | Ga0395900_0042970 | 3300037418 | Bacteria | 4656 |
| 644 | Ga0395900_0047787 | 3300037418 | Bacteria | 4408 |
| 645 | Ga0395900_0050318 | 3300037418 | Bacteria | 4292 |
| 646 | Ga0395900_0122468 | 3300037418 | Bacteria | 2668 |
| 647 | Ga0395900_0145234 | 3300037418 | Bacteria | 2426 |
| 648 | Ga0395900_0211953 | 3300037418 | Bacteria | 1956 |
| 649 | Ga0395898_0001666 | 3300037466 | Bacteria | 29798 |
| 650 | Ga0395898_0002368 | 3300037466 | Bacteria | 22407 |
| 651 | Ga0395898_0015228 | 3300037466 | Bacteria | 7894 |
| 652 | Ga0395898_0074709 | 3300037466 | Bacteria | 3274 |
| 653 | Ga0395898_0085974 | 3300037466 | Bacteria | 3031 |
| 654 | Ga0395898_0110442 | 3300037466 | Bacteria | 2635 |
| 655 | Ga0395898_0186904 | 3300037466 | Bacteria | 1980 |
| 656 | Ga0395898_0321335 | 3300037466 | Bacteria | 1476 |
| 657 | Ga0395905_0000130 | 3300037471 | Bacteria | 123719 |
| 658 | Ga0395905_0000523 | 3300037471 | Bacteria | 52635 |
| 659 | Ga0395905_0001118 | 3300037471 | Bacteria | 33620 |
| 660 | Ga0395905_0004354 | 3300037471 | Bacteria | 14743 |
| 661 | Ga0395905_0078393 | 3300037471 | Bacteria | 3096 |
| 662 | Ga0395905_0186889 | 3300037471 | Bacteria | 1944 |
| 663 | Ga0395905_0297071 | 3300037471 | Bacteria | 1502 |
| 664 | Ga0436364_0050837 | 3300037853 | Bacteria | 2129 |
| 665 | Ga0436364_1468866 | 3300037853 | Bacteria | 21170 |
| 666 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 667 | Ga0395901_0000064 | 3300038443 | Bacteria | 147477 |
| 668 | Ga0395901_0003263 | 3300038443 | Bacteria | 16327 |
| 669 | Ga0395901_0016805 | 3300038443 | Bacteria | 7456 |
| 670 | Ga0395901_0062898 | 3300038443 | Bacteria | 3862 |
| 671 | Ga0395901_0304594 | 3300038443 | Bacteria | 1651 |
| 672 | Ga0237819_01482 | 3300038705 | Bacteria | 6016 |
| 673 | Ga0400483_221937 | 3300039062 | Bacteria | 7652 |
| 674 | Ga0436365_0749742 | 3300039437 | Bacteria | 107056 |
| 675 | Ga0436365_1215130 | 3300039437 | Bacteria | 80243 |
| 676 | Ga0436365_1242987 | 3300039437 | Bacteria | 27013 |
| 677 | Ga0436361_0135818 | 3300039447 | Bacteria | 1710 |
| 678 | Ga0436363_0800232 | 3300039450 | Bacteria | 3281 |
| 679 | Ga0436363_0882399 | 3300039450 | Bacteria | 1850 |
| 680 | Ga0436362_0094317 | 3300039453 | Bacteria | 79076 |
| 681 | Ga0439445_0001896 | 3300042004 | Bacteria | 4610 |
| 682 | Ga0450889_000351 | 3300042144 | Bacteria | 5152 |
| 683 | Ga0439435_0004642 | 3300042436 | Bacteria | 2972 |
| 684 | Ga0466969_0003245 | 3300044656 | Bacteria | 8649 |
| 685 | Ga0466966_0013163 | 3300044684 | Bacteria | 5478 |
| 686 | Ga0466961_0017719 | 3300044693 | Bacteria | 4576 |
| 687 | Ga0466957_0003095 | 3300044842 | Bacteria | 9054 |
| 688 | Ga0466957_0005423 | 3300044842 | Bacteria | 7161 |
| 689 | Ga0466959_0010147 | 3300045049 | Bacteria | 6720 |
| 690 | Ga0451576_0003258 | 3300045051 | Bacteria | 22524 |
| 691 | Ga0466958_0001266 | 3300045836 | Bacteria | 11847 |
| 692 | Ga0466958_0002358 | 3300045836 | Bacteria | 9451 |
| 693 | Ga0466967_0004158 | 3300045976 | Bacteria | 9684 |
| 694 | Ga0466967_0044107 | 3300045976 | Bacteria | 3865 |
| 695 | Ga0495603_0001675 | 3300046455 | Bacteria | 13009 |
| 696 | Ga0495629_0001791 | 3300046459 | Bacteria | 16823 |
| 697 | Ga0495638_0000800 | 3300046460 | Bacteria | 33205 |
| 698 | Ga0495580_0000080 | 3300046472 | Bacteria | 61309 |
| 699 | Ga0495582_0000988 | 3300046473 | Bacteria | 15917 |
| 700 | Ga0495582_0077552 | 3300046473 | Bacteria | 1843 |
| 701 | Ga0495639_0002279 | 3300046475 | Bacteria | 8409 |
| 702 | Ga0495594_0000223 | 3300046499 | Bacteria | 27605 |
| 703 | Ga0495610_0000336 | 3300046512 | Bacteria | 49714 |
| 704 | Ga0495610_0047880 | 3300046512 | Bacteria | 2101 |
| 705 | Ga0495637_0024359 | 3300046520 | Bacteria | 2739 |
| 706 | Ga0495643_0031941 | 3300046522 | Bacteria | 2926 |
| 707 | Ga0495663_0003127 | 3300046525 | Bacteria | 4836 |
| 708 | Ga0495642_0014466 | 3300046528 | Bacteria | 3058 |
| 709 | Ga0495665_0017316 | 3300046531 | Bacteria | 3876 |
| 710 | Ga0495665_0043953 | 3300046531 | Bacteria | 2375 |
| 711 | Ga0495598_0007163 | 3300046537 | Bacteria | 2547 |
| 712 | Ga0495609_0022864 | 3300046538 | Bacteria | 2879 |
| 713 | Ga0495621_0000635 | 3300046539 | Bacteria | 8827 |
| 714 | Ga0495621_0000933 | 3300046539 | Bacteria | 7438 |
| 715 | Ga0495621_0006571 | 3300046539 | Bacteria | 3402 |
| 716 | Ga0495597_0002439 | 3300046542 | Bacteria | 11798 |
| 717 | Ga0495597_0015124 | 3300046542 | Bacteria | 3657 |
| 718 | Ga0495622_0002022 | 3300046557 | Bacteria | 9909 |
| 719 | Ga0495622_0004437 | 3300046557 | Bacteria | 6513 |
| 720 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 721 | Ga0495668_0009345 | 3300046616 | Bacteria | 6028 |
| 722 | Ga0495634_0002584 | 3300046642 | Bacteria | 14931 |
| 723 | Ga0495611_0007262 | 3300046648 | Bacteria | 4707 |
| 724 | Ga0495625_0000652 | 3300046660 | Bacteria | 49796 |
| 725 | Ga0495625_0003289 | 3300046660 | Bacteria | 16312 |
| 726 | Ga0495625_0007216 | 3300046660 | Bacteria | 9726 |
| 727 | Ga0495625_0066964 | 3300046660 | Bacteria | 2528 |
| 728 | Ga0495659_0028770 | 3300046664 | Bacteria | 1925 |
| 729 | Ga0495588_0001787 | 3300046674 | Bacteria | 9163 |
| 730 | Ga0495658_0001573 | 3300046683 | Bacteria | 11906 |
| 731 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 732 | Ga0495669_0000267 | 3300046684 | Bacteria | 29896 |
| 733 | Ga0495669_0009330 | 3300046684 | Bacteria | 4134 |
| 734 | Ga0495669_0019082 | 3300046684 | Bacteria | 2957 |
| 735 | Ga0495613_0000333 | 3300046689 | Bacteria | 42597 |
| 736 | Ga0495670_0007177 | 3300046691 | Bacteria | 5486 |
| 737 | Ga0495670_0036629 | 3300046691 | Bacteria | 2444 |
| 738 | Ga0495649_0000519 | 3300046694 | Bacteria | 32837 |
| 739 | Ga0495660_0001590 | 3300046810 | Bacteria | 15256 |
| 740 | Ga0495581_0005135 | 3300047315 | Bacteria | 7576 |
| 741 | Ga0495676_0007241 | 3300047321 | Bacteria | 10167 |
| 742 | Ga0495677_0022018 | 3300047445 | Bacteria | 2310 |
| 743 | Ga0495679_008727 | 3300047446 | Bacteria | 4100 |
| 744 | Ga0495686_0000055 | 3300047472 | Bacteria | 255566 |
| 745 | Ga0495593_0000085 | 3300047673 | Bacteria | 41086 |
| 746 | Ga0495614_0011605 | 3300048089 | Bacteria | 3874 |
| 747 | Ga0496100_0044733 | 3300048903 | Bacteria | 2837 |
| 748 | Ga0496101_0006844 | 3300048904 | Bacteria | 7358 |
| 749 | Ga0496101_0045339 | 3300048904 | Bacteria | 3148 |
| 750 | Ga0496102_0000143 | 3300048905 | Bacteria | 96813 |
| 751 | Ga0496102_0036426 | 3300048905 | Bacteria | 4432 |
| 752 | Ga0496102_0045483 | 3300048905 | Bacteria | 3985 |
| 753 | Ga0496102_0291072 | 3300048905 | Bacteria | 1539 |
| 754 | Ga0496103_0000098 | 3300048906 | Bacteria | 96109 |
| 755 | Ga0496103_0049805 | 3300048906 | Bacteria | 2590 |
| 756 | Ga0496104_0001549 | 3300048907 | Bacteria | 19809 |
| 757 | Ga0496105_0004701 | 3300048908 | Bacteria | 10295 |
| 758 | Ga0496105_0005017 | 3300048908 | Bacteria | 10019 |
| 759 | Ga0496106_0157107 | 3300048909 | Bacteria | 1796 |
| 760 | Ga0496107_0008427 | 3300048910 | Bacteria | 7132 |
| 761 | Ga0496108_0047875 | 3300048911 | Bacteria | 3574 |
| 762 | Ga0496108_0100383 | 3300048911 | Bacteria | 2468 |
| 763 | Ga0496109_0083013 | 3300048912 | Bacteria | 2954 |
| 764 | Ga0496109_0205167 | 3300048912 | Bacteria | 1853 |
| 765 | Ga0496112_0034209 | 3300048915 | Bacteria | 4944 |
| 766 | Ga0496113_0076581 | 3300048916 | Bacteria | 2556 |
| 767 | Ga0496114_0015522 | 3300048917 | Bacteria | 6124 |
| 768 | Ga0496115_0000396 | 3300048918 | Bacteria | 35918 |
| 769 | Ga0496115_0000643 | 3300048918 | Bacteria | 26252 |
| 770 | Ga0496115_0006459 | 3300048918 | Bacteria | 8596 |
| 771 | Ga0496115_0061107 | 3300048918 | Bacteria | 3037 |
| 772 | Ga0496115_0082523 | 3300048918 | Bacteria | 2619 |
| 773 | Ga0496116_0000726 | 3300048919 | Bacteria | 42098 |
| 774 | Ga0496117_0000121 | 3300048920 | Bacteria | 171532 |
| 775 | Ga0496117_0037383 | 3300048920 | Bacteria | 3617 |
| 776 | Ga0496117_0088755 | 3300048920 | Bacteria | 1999 |
| 777 | Ga0496118_0000095 | 3300048921 | Bacteria | 164850 |
| 778 | Ga0496118_0000677 | 3300048921 | Bacteria | 55423 |
| 779 | Ga0496118_0014843 | 3300048921 | Bacteria | 7258 |
| 780 | Ga0496118_0017247 | 3300048921 | Bacteria | 6583 |
| 781 | Ga0496118_0048915 | 3300048921 | Bacteria | 3260 |
| 782 | Ga0496119_0023813 | 3300048922 | Bacteria | 4328 |
| 783 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 784 | Ga0496121_0013184 | 3300048924 | Bacteria | 8910 |
| 785 | Ga0496122_0001187 | 3300048925 | Bacteria | 44594 |
| 786 | Ga0496123_0002266 | 3300048926 | Bacteria | 24245 |
| 787 | Ga0496124_0000119 | 3300048927 | Bacteria | 163996 |
| 788 | Ga0496124_0004955 | 3300048927 | Bacteria | 15261 |
| 789 | Ga0496125_0000217 | 3300048928 | Bacteria | 117498 |
| 790 | Ga0496125_0055255 | 3300048928 | Bacteria | 3237 |
| 791 | Ga0496125_0106196 | 3300048928 | Bacteria | 2050 |
| 792 | Ga0496126_0044544 | 3300048929 | Bacteria | 4085 |
| 793 | Ga0495682_0002152 | 3300049460 | Bacteria | 9553 |
| 794 | Ga0501031_0112002 | 3300049568 | Bacteria | 1782 |
| 795 | Ga0501032_0004021 | 3300049569 | Bacteria | 11148 |
| 796 | Ga0501032_0011363 | 3300049569 | Bacteria | 6395 |
| 797 | Ga0501032_0048415 | 3300049569 | Bacteria | 2870 |
| 798 | Ga0501033_0014661 | 3300049570 | Bacteria | 5951 |
| 799 | Ga0501033_0015038 | 3300049570 | Bacteria | 5873 |
| 800 | Ga0501033_0020758 | 3300049570 | Bacteria | 4962 |
| 801 | Ga0501033_0022279 | 3300049570 | Bacteria | 4780 |
| 802 | Ga0501033_0043351 | 3300049570 | Bacteria | 3351 |
| 803 | Ga0501034_0000013 | 3300049571 | Bacteria | 297898 |
| 804 | Ga0501034_0001509 | 3300049571 | Bacteria | 30551 |
| 805 | Ga0501034_0007585 | 3300049571 | Bacteria | 11543 |
| 806 | Ga0501034_0015313 | 3300049571 | Bacteria | 7882 |
| 807 | Ga0501034_0063575 | 3300049571 | Bacteria | 3704 |
| 808 | Ga0501034_0084499 | 3300049571 | Bacteria | 3176 |
| 809 | Ga0501034_0148031 | 3300049571 | Bacteria | 2324 |
| 810 | Ga0501034_0181167 | 3300049571 | Bacteria | 2072 |
| 811 | Ga0501034_0254955 | 3300049571 | Bacteria | 1698 |
| 812 | Ga0501034_0309920 | 3300049571 | Bacteria | 1513 |
| 813 | Ga0501036_0018741 | 3300049572 | Bacteria | 5805 |
| 814 | Ga0501036_0025076 | 3300049572 | Bacteria | 5029 |
| 815 | Ga0501036_0043700 | 3300049572 | Bacteria | 3795 |
| 816 | Ga0501036_0113934 | 3300049572 | Bacteria | 2285 |
| 817 | Ga0501037_0000487 | 3300049573 | Bacteria | 32144 |
| 818 | Ga0501037_0039423 | 3300049573 | Bacteria | 3477 |
| 819 | Ga0501037_0045502 | 3300049573 | Bacteria | 3222 |
| 820 | Ga0501037_0047476 | 3300049573 | Bacteria | 3147 |
| 821 | Ga0501037_0119016 | 3300049573 | Bacteria | 1900 |
| 822 | Ga0501038_0000009 | 3300049574 | Bacteria | 190794 |
| 823 | Ga0501038_0010838 | 3300049574 | Bacteria | 8329 |
| 824 | Ga0501038_0042587 | 3300049574 | Bacteria | 3954 |
| 825 | Ga0501038_0046649 | 3300049574 | Bacteria | 3756 |
| 826 | Ga0501038_0086165 | 3300049574 | Bacteria | 2640 |
| 827 | Ga0501043_0024083 | 3300049579 | Bacteria | 4777 |
| 828 | Ga0501043_0029427 | 3300049579 | Bacteria | 4315 |
| 829 | Ga0501043_0031524 | 3300049579 | Bacteria | 4167 |
| 830 | Ga0501043_0043621 | 3300049579 | Bacteria | 3525 |
| 831 | Ga0501043_0053345 | 3300049579 | Bacteria | 3175 |
| 832 | Ga0501043_0163288 | 3300049579 | Bacteria | 1740 |
| 833 | Ga0501046_0003767 | 3300049580 | Bacteria | 13882 |
| 834 | Ga0501046_0013968 | 3300049580 | Bacteria | 6784 |
| 835 | Ga0501046_0034820 | 3300049580 | Bacteria | 4062 |
| 836 | Ga0501047_0002124 | 3300049581 | Bacteria | 18973 |
| 837 | Ga0501047_0003221 | 3300049581 | Bacteria | 15472 |
| 838 | Ga0501047_0006557 | 3300049581 | Bacteria | 10960 |
| 839 | Ga0501047_0009447 | 3300049581 | Bacteria | 9212 |
| 840 | Ga0501047_0012825 | 3300049581 | Bacteria | 7941 |
| 841 | Ga0501047_0026719 | 3300049581 | Bacteria | 5556 |
| 842 | Ga0501047_0049086 | 3300049581 | Bacteria | 4075 |
| 843 | Ga0501047_0081130 | 3300049581 | Bacteria | 3118 |
| 844 | Ga0501047_0090764 | 3300049581 | Bacteria | 2932 |
| 845 | Ga0501047_0110229 | 3300049581 | Bacteria | 2635 |
| 846 | Ga0501047_0166649 | 3300049581 | Bacteria | 2073 |
| 847 | Ga0501047_0173664 | 3300049581 | Bacteria | 2024 |
| 848 | Ga0501048_0000242 | 3300049582 | Bacteria | 36361 |
| 849 | Ga0501048_0072157 | 3300049582 | Bacteria | 2437 |
| 850 | Ga0501048_0097818 | 3300049582 | Bacteria | 2071 |
| 851 | Ga0501067_0000380 | 3300049583 | Bacteria | 24178 |
| 852 | Ga0501067_0028515 | 3300049583 | Bacteria | 3093 |
| 853 | Ga0501069_0020369 | 3300049585 | Bacteria | 3593 |
| 854 | Ga0501069_0038330 | 3300049585 | Bacteria | 2646 |
| 855 | Ga0501070_0000109 | 3300049586 | Bacteria | 72583 |
| 856 | Ga0501070_0031932 | 3300049586 | Bacteria | 4410 |
| 857 | Ga0501070_0127895 | 3300049586 | Bacteria | 2099 |
| 858 | Ga0501071_0160797 | 3300049587 | Bacteria | 1678 |
| 859 | Ga0501072_0001994 | 3300049588 | Bacteria | 15210 |
| 860 | Ga0501073_0017964 | 3300049589 | Bacteria | 5115 |
| 861 | Ga0501073_0091643 | 3300049589 | Bacteria | 2112 |
| 862 | Ga0501073_0133789 | 3300049589 | Bacteria | 1719 |
| 863 | Ga0501074_0011873 | 3300049590 | Bacteria | 6332 |
| 864 | Ga0501074_0119975 | 3300049590 | Bacteria | 1881 |
| 865 | Ga0501075_0025225 | 3300049591 | Bacteria | 4368 |
| 866 | Ga0501075_0050247 | 3300049591 | Bacteria | 3134 |
| 867 | Ga0501076_0030823 | 3300049592 | Bacteria | 4178 |
| 868 | Ga0501077_0038016 | 3300049593 | Bacteria | 3064 |
| 869 | Ga0501223_000067 | 3300049663 | Bacteria | 31945 |
| 870 | Ga0501223_005421 | 3300049663 | Bacteria | 2680 |
| 871 | Ga0501224_000036 | 3300049664 | Bacteria | 30236 |
| 872 | Ga0501233_005491 | 3300049668 | Bacteria | 2355 |
| 873 | Ga0501257_000014 | 3300049686 | Bacteria | 50280 |
| 874 | Ga0501225_0000018 | 3300049705 | Bacteria | 59791 |
| 875 | Ga0501079_0023950 | 3300049741 | Bacteria | 4683 |
| 876 | Ga0501079_0109946 | 3300049741 | Bacteria | 2141 |
| 877 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 878 | Ga0501080_0011909 | 3300049742 | Bacteria | 7966 |
| 879 | Ga0501080_0013395 | 3300049742 | Bacteria | 7542 |
| 880 | Ga0501080_0036324 | 3300049742 | Bacteria | 4600 |
| 881 | Ga0501080_0055866 | 3300049742 | Bacteria | 3677 |
| 882 | Ga0501080_0068094 | 3300049742 | Bacteria | 3311 |
| 883 | Ga0501080_0075893 | 3300049742 | Bacteria | 3126 |
| 884 | Ga0501081_0104852 | 3300049743 | Bacteria | 2002 |
| 885 | Ga0501081_0190352 | 3300049743 | Bacteria | 1486 |
| 886 | Ga0501083_0058356 | 3300049744 | Bacteria | 2582 |
| 887 | Ga0501083_0128328 | 3300049744 | Bacteria | 1662 |
| 888 | Ga0501273_004451 | 3300049770 | Bacteria | 1540 |
| 889 | Ga0501280_000272 | 3300049776 | Bacteria | 13149 |
| 890 | Ga0501035_0000058 | 3300049822 | Bacteria | 135089 |
| 891 | Ga0501035_0008525 | 3300049822 | Bacteria | 9543 |
| 892 | Ga0501035_0010025 | 3300049822 | Bacteria | 8791 |
| 893 | Ga0501035_0027886 | 3300049822 | Bacteria | 5160 |
| 894 | Ga0501035_0074748 | 3300049822 | Bacteria | 2997 |
| 895 | Ga0501035_0087634 | 3300049822 | Bacteria | 2743 |
| 896 | Ga0501044_0000023 | 3300049823 | Bacteria | 196555 |
| 897 | Ga0501044_0005359 | 3300049823 | Bacteria | 14252 |
| 898 | Ga0501044_0005940 | 3300049823 | Bacteria | 13522 |
| 899 | Ga0501044_0008325 | 3300049823 | Bacteria | 11365 |
| 900 | Ga0501044_0008931 | 3300049823 | Bacteria | 10955 |
| 901 | Ga0501044_0015477 | 3300049823 | Bacteria | 8215 |
| 902 | Ga0501044_0017237 | 3300049823 | Bacteria | 7747 |
| 903 | Ga0501044_0025782 | 3300049823 | Bacteria | 6232 |
| 904 | Ga0501044_0025973 | 3300049823 | Bacteria | 6204 |
| 905 | Ga0501044_0051080 | 3300049823 | Bacteria | 4264 |
| 906 | Ga0501044_0080320 | 3300049823 | Bacteria | 3303 |
| 907 | Ga0501044_0091812 | 3300049823 | Bacteria | 3062 |
| 908 | Ga0501044_0095430 | 3300049823 | Bacteria | 2997 |
| 909 | Ga0501044_0102275 | 3300049823 | Bacteria | 2881 |
| 910 | Ga0501045_0031636 | 3300049824 | Bacteria | 3832 |
| 911 | Ga0501226_000063 | 3300049853 | Bacteria | 35700 |
| 912 | nmdc:mga00v17_2502_c1 | 3300050491 | Bacteria | 9409 |
| 913 | nmdc:mga0k408_42307_c1 | 3300050493 | Bacteria | 2624 |
| 914 | nmdc:mga06z11_28570_c1 | 3300050494 | Bacteria | 2678 |
| 915 | nmdc:mga07m45_2641_c1 | 3300050496 | Bacteria | 8439 |
| 916 | nmdc:mga05p37_102778_c1 | 3300050507 | Bacteria | 3519 |
| 917 | nmdc:mga0qj67_13980_c1 | 3300050509 | Bacteria | 6062 |
| 918 | nmdc:mga06r32_146215_c1 | 3300050510 | Bacteria | 2341 |
| 919 | nmdc:mga08y16_191730_c1 | 3300050511 | Bacteria | 2120 |
| 920 | nmdc:mga08y16_230153_c1 | 3300050511 | Bacteria | 1917 |
| 921 | nmdc:mga08y16_266301_c1 | 3300050511 | Bacteria | 1769 |
| 922 | nmdc:mga0n895_162800_c1 | 3300050512 | Bacteria | 2263 |
| 923 | nmdc:mga0n895_32032_c1 | 3300050512 | Bacteria | 5041 |
| 924 | nmdc:mga0rr50_86467_c1 | 3300050513 | Bacteria | 2432 |
| 925 | nmdc:mga08x19_7707_c1 | 3300050514 | Bacteria | 6393 |
| 926 | nmdc:mga0a205_24271_c2 | 3300050515 | Bacteria | 2660 |
| 927 | nmdc:mga0sz30_23010_c2 | 3300050516 | Bacteria | 2172 |
| 928 | Ga0495601_0053411 | 3300053077 | Bacteria | 2554 |
| 929 | Ga0500635_0000847 | 3300053080 | Bacteria | 7530 |
| 930 | Ga0495595_0036105 | 3300053084 | Bacteria | 2241 |
| 931 | Ga0495619_0042290 | 3300053085 | Bacteria | 2983 |
| 932 | Ga0500643_000407 | 3300053087 | Bacteria | 32885 |
| 933 | Ga0500643_003227 | 3300053087 | Bacteria | 7939 |
| 934 | Ga0500643_011792 | 3300053087 | Bacteria | 3165 |
| 935 | Ga0500643_012437 | 3300053087 | Bacteria | 3048 |
| 936 | Ga0500643_014657 | 3300053087 | Bacteria | 2714 |
| 937 | Ga0500651_0000538 | 3300053093 | Bacteria | 19288 |
| 938 | Ga0500651_0089878 | 3300053093 | Bacteria | 1892 |
| 939 | Ga0500641_0002349 | 3300053096 | Bacteria | 6704 |
| 940 | Ga0500641_0004883 | 3300053096 | Bacteria | 4746 |
| 941 | Ga0500641_0035728 | 3300053096 | Bacteria | 1984 |
| 942 | Ga0500555_015110 | 3300053103 | Bacteria | 2226 |
| 943 | Ga0500556_0000049 | 3300053104 | Bacteria | 122572 |
| 944 | Ga0500556_0000774 | 3300053104 | Bacteria | 18901 |
| 945 | Ga0500562_000163 | 3300053108 | Bacteria | 18798 |
| 946 | Ga0500562_000549 | 3300053108 | Bacteria | 9070 |
| 947 | Ga0500562_001824 | 3300053108 | Bacteria | 5336 |
| 948 | Ga0500592_001393 | 3300053116 | Bacteria | 3909 |
| 949 | Ga0500592_009106 | 3300053116 | Bacteria | 1577 |
| 950 | Ga0500593_000095 | 3300053117 | Bacteria | 33178 |
| 951 | Ga0500594_0000406 | 3300053118 | Bacteria | 9542 |
| 952 | Ga0500595_006788 | 3300053119 | Bacteria | 4820 |
| 953 | Ga0500595_010491 | 3300053119 | Bacteria | 3680 |
| 954 | Ga0500608_072404 | 3300053122 | Bacteria | 1637 |
| 955 | Ga0500614_001488 | 3300053123 | Bacteria | 5584 |
| 956 | Ga0500618_000123 | 3300053125 | Bacteria | 63600 |
| 957 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 958 | Ga0500642_0003276 | 3300053130 | Bacteria | 4872 |
| 959 | Ga0500568_0001107 | 3300053139 | Bacteria | 18110 |
| 960 | Ga0500604_0000695 | 3300053151 | Bacteria | 9220 |
| 961 | Ga0500616_0001288 | 3300053153 | Bacteria | 24938 |
| 962 | Ga0500616_0074146 | 3300053153 | Bacteria | 1726 |
| 963 | Ga0500622_0003465 | 3300053156 | Bacteria | 10508 |
| 964 | Ga0500624_000294 | 3300053157 | Bacteria | 17081 |
| 965 | Ga0500627_0000005 | 3300053158 | Bacteria | 167950 |
| 966 | Ga0500634_0000212 | 3300053161 | Bacteria | 18816 |
| 967 | Ga0500636_0003201 | 3300053177 | Bacteria | 9166 |
| 968 | Ga0500636_0017824 | 3300053177 | Bacteria | 4196 |
| 969 | Ga0500570_000470 | 3300053724 | Bacteria | 15608 |
| 970 | Ga0500645_001493 | 3300053730 | Bacteria | 11730 |
| 971 | Ga0500645_002380 | 3300053730 | Bacteria | 8462 |
| 972 | Ga0501084_0013927 | 3300054114 | Bacteria | 6657 |
| 973 | Ga0501082_0007213 | 3300060353 | Bacteria | 9583 |
| 974 | Ga0501082_0022186 | 3300060353 | Bacteria | 5472 |
| 975 | Ga0466962_0026280 | 3300061719 | Bacteria | 2795 |
| 976 | Ga0530510_0005973 | 3300061734 | Bacteria | 8446 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0190352 | Ga0501081_0190352_24_1187 | 351 |
| 2 | 3300037466 | Ga0395898_0186904 | Ga0395898_0186904_15_1226 | 364 |
| 3 | 3300044656 | Ga0466969_0003245 | Ga0466969_0003245_7477_8622 | 371 |
| 4 | 3300046539 | Ga0495621_0006571 | Ga0495621_0006571_2221_3384 | 371 |
| 5 | 3300048905 | Ga0496102_0291072 | Ga0496102_0291072_18_1178 | 371 |
| 6 | 3300037471 | Ga0395905_0297071 | Ga0395905_0297071_268_1464 | 389 |
| 7 | 3300039447 | Ga0436361_0135818 | Ga0436361_0135818_410_1696 | 395 |
| 8 | 3300046542 | Ga0495597_0015124 | Ga0495597_0015124_2346_3644 | 396 |
| 9 | 3300037466 | Ga0395898_0074709 | Ga0395898_0074709_1928_3235 | 397 |
| 10 | 3300053077 | Ga0495601_0053411 | Ga0495601_0053411_1209_2516 | 397 |
| 11 | 3300053084 | Ga0495595_0036105 | Ga0495595_0036105_904_2211 | 397 |
| 12 | 3300048918 | Ga0496115_0000396 | Ga0496115_0000396_5016_6320 | 401 |
| 13 | 3300036647 | Ga0316582_0032276 | Ga0316582_0032276_108_1430 | 402 |
| 14 | 3300053087 | Ga0500643_012437 | Ga0500643_012437_1777_3030 | 402 |
| 15 | 3300015684 | Ga0183365_10001 | Ga0183365_100011959 | 403 |
| 16 | 3300005347 | Ga0070668_100023079 | Ga0070668_1000230792 | 407 |
| 17 | 3300005436 | Ga0070713_100087488 | Ga0070713_1000874883 | 408 |
| 18 | 3300025916 | Ga0207663_10056658 | Ga0207663_100566582 | 408 |
| 19 | 3300048908 | Ga0496105_0005017 | Ga0496105_0005017_8394_9734 | 409 |
| 20 | 3300049590 | Ga0501074_0119975 | Ga0501074_0119975_287_1690 | 409 |
| 21 | 3300003781 | Ga0055536_1001904 | Ga0055536_10019049 | 410 |
| 22 | 3300025292 | Ga0209676_1001788 | Ga0209676_100178814 | 410 |
| 23 | 3300049571 | Ga0501034_0148031 | Ga0501034_0148031_289_1623 | 412 |
| 24 | 3300049581 | Ga0501047_0110229 | Ga0501047_0110229_506_1840 | 412 |
| 25 | 3300049823 | Ga0501044_0102275 | Ga0501044_0102275_541_1875 | 412 |
| 26 | 3300035724 | Ga0373933_0058424 | Ga0373933_0058424_198_1532 | 415 |
| 27 | 3300025291 | Ga0209675_1007120 | Ga0209675_10071203 | 416 |
| 28 | 3300049742 | Ga0501080_0011909 | Ga0501080_0011909_205_1581 | 416 |
| 29 | 3300060353 | Ga0501082_0007213 | Ga0501082_0007213_6532_7908 | 416 |
| 30 | 3300005327 | Ga0070658_10040543 | Ga0070658_100405434 | 417 |
| 31 | 3300025909 | Ga0207705_10079055 | Ga0207705_100790552 | 417 |
| 32 | 3300025913 | Ga0207695_10006268 | Ga0207695_1000626814 | 417 |
| 33 | 3300046660 | Ga0495625_0003289 | Ga0495625_0003289_1303_2619 | 417 |
| 34 | 3300049581 | Ga0501047_0012825 | Ga0501047_0012825_1038_2351 | 417 |
| 35 | 3300049581 | Ga0501047_0173664 | Ga0501047_0173664_466_1869 | 417 |
| 36 | 3300049583 | Ga0501067_0028515 | Ga0501067_0028515_306_1619 | 417 |
| 37 | 3300049588 | Ga0501072_0001994 | Ga0501072_0001994_3386_4699 | 417 |
| 38 | 3300049742 | Ga0501080_0068094 | Ga0501080_0068094_828_2141 | 417 |
| 39 | 3300049570 | Ga0501033_0022279 | Ga0501033_0022279_681_2051 | 418 |
| 40 | 3300049571 | Ga0501034_0084499 | Ga0501034_0084499_949_2361 | 418 |
| 41 | 3300049582 | Ga0501048_0097818 | Ga0501048_0097818_23_1426 | 418 |
| 42 | 3300049587 | Ga0501071_0160797 | Ga0501071_0160797_66_1469 | 418 |
| 43 | 3300049589 | Ga0501073_0133789 | Ga0501073_0133789_135_1538 | 418 |
| 44 | 3300049591 | Ga0501075_0050247 | Ga0501075_0050247_1342_2745 | 418 |
| 45 | 3300049743 | Ga0501081_0104852 | Ga0501081_0104852_14_1417 | 418 |
| 46 | 3300009545 | Ga0105237_10038275 | Ga0105237_100382755 | 419 |
| 47 | 3300049586 | Ga0501070_0127895 | Ga0501070_0127895_71_1399 | 419 |
| 48 | 3300026116 | Ga0207674_10050669 | Ga0207674_100506694 | 420 |
| 49 | 3300028800 | Ga0265338_10014834 | Ga0265338_100148347 | 420 |
| 50 | 3300035695 | Ga0373927_0001191 | Ga0373927_0001191_1225_2628 | 420 |
| 51 | 3300037068 | Ga0373925_0000136 | Ga0373925_0000136_4065_5468 | 420 |
| 52 | 3300048916 | Ga0496113_0076581 | Ga0496113_0076581_226_1629 | 420 |
| 53 | 3300049579 | Ga0501043_0163288 | Ga0501043_0163288_139_1455 | 421 |
| 54 | 3300049589 | Ga0501073_0091643 | Ga0501073_0091643_466_1782 | 421 |
| 55 | 3300049742 | Ga0501080_0013395 | Ga0501080_0013395_708_2024 | 421 |
| 56 | 3300054114 | Ga0501084_0013927 | Ga0501084_0013927_3739_5055 | 421 |
| 57 | 3300046684 | Ga0495669_0019082 | Ga0495669_0019082_515_1879 | 422 |
| 58 | 3300049582 | Ga0501048_0000242 | Ga0501048_0000242_23791_25224 | 422 |
| 59 | 3300005262 | Ga0065165_1000029 | Ga0065165_1000029176 | 423 |
| 60 | 3300005618 | Ga0068864_100000472 | Ga0068864_10000047225 | 423 |
| 61 | 3300005841 | Ga0068863_100005428 | Ga0068863_1000054289 | 423 |
| 62 | 3300005842 | Ga0068858_100000098 | Ga0068858_10000009865 | 423 |
| 63 | 3300014325 | Ga0163163_10031710 | Ga0163163_100317103 | 423 |
| 64 | 3300026035 | Ga0207703_10000086 | Ga0207703_1000008680 | 423 |
| 65 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001241 | 423 |
| 66 | 3300026095 | Ga0207676_10000445 | Ga0207676_1000044524 | 423 |
| 67 | 3300031235 | Ga0265330_10040206 | Ga0265330_100402062 | 423 |
| 68 | 3300031247 | Ga0265340_10000071 | Ga0265340_1000007111 | 423 |
| 69 | 3300031250 | Ga0265331_10094110 | Ga0265331_100941101 | 423 |
| 70 | 3300031344 | Ga0265316_10020337 | Ga0265316_100203373 | 423 |
| 71 | 3300031344 | Ga0265316_10101941 | Ga0265316_101019411 | 423 |
| 72 | 3300031712 | Ga0265342_10056439 | Ga0265342_100564391 | 423 |
| 73 | 3300048918 | Ga0496115_0082523 | Ga0496115_0082523_1111_2514 | 423 |
| 74 | 3300005347 | Ga0070668_100076218 | Ga0070668_1000762181 | 424 |
| 75 | 3300005844 | Ga0068862_100004861 | Ga0068862_1000048619 | 424 |
| 76 | 3300009551 | Ga0105238_10056986 | Ga0105238_100569863 | 424 |
| 77 | 3300036401 | Ga0373937_0257417 | Ga0373937_0257417_261_1634 | 424 |
| 78 | iso_pu_bacteria | 2928531327 | 2928533013 | 424 |
| 79 | 3300031730 | Ga0307516_10041770 | Ga0307516_100417705 | 425 |
| 80 | 3300048927 | Ga0496124_0004955 | Ga0496124_0004955_1691_3091 | 425 |
| 81 | 3300049572 | Ga0501036_0025076 | Ga0501036_0025076_3666_4982 | 425 |
| 82 | 3300049581 | Ga0501047_0006557 | Ga0501047_0006557_2661_3977 | 425 |
| 83 | 3300049585 | Ga0501069_0020369 | Ga0501069_0020369_25_1341 | 425 |
| 84 | 3300049590 | Ga0501074_0011873 | Ga0501074_0011873_1743_3059 | 425 |
| 85 | 3300049741 | Ga0501079_0023950 | Ga0501079_0023950_1603_2919 | 425 |
| 86 | 3300049822 | Ga0501035_0087634 | Ga0501035_0087634_496_1812 | 425 |
| 87 | 3300049823 | Ga0501044_0015477 | Ga0501044_0015477_5519_6835 | 425 |
| 88 | 3300053130 | Ga0500642_0003276 | Ga0500642_0003276_712_2055 | 425 |
| 89 | iso_pu_bacteria | 2739367756 | 2739793030 | 425 |
| 90 | 3300003781 | Ga0055536_1007868 | Ga0055536_10078684 | 426 |
| 91 | 3300003791 | Ga0055530_10000013 | Ga0055530_10000013111 | 426 |
| 92 | 3300003794 | Ga0055531_10000627 | Ga0055531_1000062718 | 426 |
| 93 | 3300003794 | Ga0055531_10006022 | Ga0055531_100060227 | 426 |
| 94 | 3300006195 | Ga0075366_10012514 | Ga0075366_100125144 | 426 |
| 95 | 3300009094 | Ga0111539_10221374 | Ga0111539_102213742 | 426 |
| 96 | 3300021384 | Ga0213876_10000125 | Ga0213876_1000012546 | 426 |
| 97 | 3300025291 | Ga0209675_1000808 | Ga0209675_100080814 | 426 |
| 98 | 3300025292 | Ga0209676_1000221 | Ga0209676_1000221109 | 426 |
| 99 | 3300025294 | Ga0209025_1021699 | Ga0209025_10216991 | 426 |
| 100 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042278 | 426 |
| 101 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135109 | 426 |
| 102 | 3300025304 | Ga0209257_1000487 | Ga0209257_100048717 | 426 |
| 103 | 3300025909 | Ga0207705_10005248 | Ga0207705_100052489 | 426 |
| 104 | 3300025919 | Ga0207657_10002252 | Ga0207657_1000225222 | 426 |
| 105 | 3300025932 | Ga0207690_10004547 | Ga0207690_100045478 | 426 |
| 106 | 3300028556 | Ga0265337_1010633 | Ga0265337_10106332 | 426 |
| 107 | 3300039437 | Ga0436365_0749742 | Ga0436365_0749742_101243_102691 | 426 |
| 108 | 3300046660 | Ga0495625_0066964 | Ga0495625_0066964_474_1883 | 426 |
| 109 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_761768_763174 | 426 |
| 110 | 3300049686 | Ga0501257_000014 | Ga0501257_000014_31488_32813 | 426 |
| 111 | 3300049741 | Ga0501079_0109946 | Ga0501079_0109946_382_1725 | 426 |
| 112 | 3300049776 | Ga0501280_000272 | Ga0501280_000272_1839_3164 | 426 |
| 113 | 3300050493 | nmdc:mga0k408_42307_c1 | nmdc:mga0k408_42307_c1_1188_2597 | 426 |
| 114 | 3300050511 | nmdc:mga08y16_191730_c1 | nmdc:mga08y16_191730_c1_678_2021 | 426 |
| 115 | 3300053156 | Ga0500622_0003465 | Ga0500622_0003465_7149_8573 | 426 |
| 116 | iso_pu_bacteria | 2582581305 | 2585259781 | 426 |
| 117 | iso_pu_bacteria | 2585428106 | 2587919210 | 426 |
| 118 | iso_pu_bacteria | 2643221591 | 2643963229 | 426 |
| 119 | iso_pu_bacteria | 2643221640 | 2644225040 | 426 |
| 120 | iso_pu_bacteria | 2643221642 | 2644232348 | 426 |
| 121 | iso_pu_bacteria | 2643221733 | 2644729152 | 426 |
| 122 | 3300005331 | Ga0070670_100000050 | Ga0070670_10000005018 | 427 |
| 123 | 3300005456 | Ga0070678_100013030 | Ga0070678_1000130305 | 427 |
| 124 | 3300005937 | Ga0081455_10004974 | Ga0081455_100049744 | 427 |
| 125 | 3300006358 | Ga0068871_100166216 | Ga0068871_1001662162 | 427 |
| 126 | 3300006847 | Ga0075431_100088461 | Ga0075431_1000884612 | 427 |
| 127 | 3300006852 | Ga0075433_10016841 | Ga0075433_1001684110 | 427 |
| 128 | 3300013297 | Ga0157378_10007224 | Ga0157378_100072247 | 427 |
| 129 | 3300013297 | Ga0157378_10025468 | Ga0157378_100254683 | 427 |
| 130 | 3300013306 | Ga0163162_10098343 | Ga0163162_100983433 | 427 |
| 131 | 3300014968 | Ga0157379_10017776 | Ga0157379_100177765 | 427 |
| 132 | 3300014968 | Ga0157379_10026633 | Ga0157379_100266332 | 427 |
| 133 | 3300026121 | Ga0207683_10021308 | Ga0207683_100213084 | 427 |
| 134 | 3300035695 | Ga0373927_0079266 | Ga0373927_0079266_531_1922 | 427 |
| 135 | 3300035725 | Ga0373947_0003164 | Ga0373947_0003164_3448_4839 | 427 |
| 136 | 3300037853 | Ga0436364_0050837 | Ga0436364_0050837_335_1711 | 427 |
| 137 | 3300046455 | Ga0495603_0001675 | Ga0495603_0001675_5931_7322 | 427 |
| 138 | 3300046459 | Ga0495629_0001791 | Ga0495629_0001791_160_1551 | 427 |
| 139 | 3300046472 | Ga0495580_0000080 | Ga0495580_0000080_14246_15637 | 427 |
| 140 | 3300046473 | Ga0495582_0000988 | Ga0495582_0000988_10894_12285 | 427 |
| 141 | 3300046475 | Ga0495639_0002279 | Ga0495639_0002279_3415_4806 | 427 |
| 142 | 3300046499 | Ga0495594_0000223 | Ga0495594_0000223_11070_12461 | 427 |
| 143 | 3300046531 | Ga0495665_0017316 | Ga0495665_0017316_1747_3138 | 427 |
| 144 | 3300046557 | Ga0495622_0002022 | Ga0495622_0002022_42_1433 | 427 |
| 145 | 3300046642 | Ga0495634_0002584 | Ga0495634_0002584_12867_14258 | 427 |
| 146 | 3300046674 | Ga0495588_0001787 | Ga0495588_0001787_2636_4027 | 427 |
| 147 | 3300046683 | Ga0495658_0001573 | Ga0495658_0001573_5632_7023 | 427 |
| 148 | 3300046689 | Ga0495613_0000333 | Ga0495613_0000333_5554_6945 | 427 |
| 149 | 3300046694 | Ga0495649_0000519 | Ga0495649_0000519_10753_12147 | 427 |
| 150 | 3300047315 | Ga0495581_0005135 | Ga0495581_0005135_1632_3023 | 427 |
| 151 | 3300047321 | Ga0495676_0007241 | Ga0495676_0007241_7868_9259 | 427 |
| 152 | 3300047446 | Ga0495679_008727 | Ga0495679_008727_2377_3822 | 427 |
| 153 | 3300047673 | Ga0495593_0000085 | Ga0495593_0000085_3506_4897 | 427 |
| 154 | 3300048089 | Ga0495614_0011605 | Ga0495614_0011605_2423_3814 | 427 |
| 155 | 3300049569 | Ga0501032_0004021 | Ga0501032_0004021_8206_9639 | 427 |
| 156 | 3300049569 | Ga0501032_0048415 | Ga0501032_0048415_418_1776 | 427 |
| 157 | 3300049570 | Ga0501033_0014661 | Ga0501033_0014661_13_1371 | 427 |
| 158 | 3300049571 | Ga0501034_0000013 | Ga0501034_0000013_183349_184782 | 427 |
| 159 | 3300049571 | Ga0501034_0015313 | Ga0501034_0015313_2101_3459 | 427 |
| 160 | 3300049572 | Ga0501036_0043700 | Ga0501036_0043700_1981_3414 | 427 |
| 161 | 3300049572 | Ga0501036_0113934 | Ga0501036_0113934_438_1796 | 427 |
| 162 | 3300049573 | Ga0501037_0000487 | Ga0501037_0000487_21414_22847 | 427 |
| 163 | 3300049574 | Ga0501038_0010838 | Ga0501038_0010838_4972_6405 | 427 |
| 164 | 3300049579 | Ga0501043_0053345 | Ga0501043_0053345_689_2122 | 427 |
| 165 | 3300049580 | Ga0501046_0003767 | Ga0501046_0003767_10806_12239 | 427 |
| 166 | 3300049581 | Ga0501047_0009447 | Ga0501047_0009447_7026_8459 | 427 |
| 167 | 3300049582 | Ga0501048_0072157 | Ga0501048_0072157_56_1489 | 427 |
| 168 | 3300049583 | Ga0501067_0000380 | Ga0501067_0000380_14591_16024 | 427 |
| 169 | 3300049586 | Ga0501070_0031932 | Ga0501070_0031932_2013_3446 | 427 |
| 170 | 3300049589 | Ga0501073_0017964 | Ga0501073_0017964_279_1712 | 427 |
| 171 | 3300049742 | Ga0501080_0000003 | Ga0501080_0000003_175879_177312 | 427 |
| 172 | 3300049742 | Ga0501080_0036324 | Ga0501080_0036324_2819_4177 | 427 |
| 173 | 3300049744 | Ga0501083_0128328 | Ga0501083_0128328_123_1481 | 427 |
| 174 | 3300049822 | Ga0501035_0000058 | Ga0501035_0000058_19202_20635 | 427 |
| 175 | 3300049823 | Ga0501044_0000023 | Ga0501044_0000023_80617_82050 | 427 |
| 176 | 3300049823 | Ga0501044_0080320 | Ga0501044_0080320_303_1661 | 427 |
| 177 | 3300049824 | Ga0501045_0031636 | Ga0501045_0031636_1515_2948 | 427 |
| 178 | 3300050512 | nmdc:mga0n895_162800_c1 | nmdc:mga0n895_162800_c1_642_2045 | 427 |
| 179 | 3300053125 | Ga0500618_000123 | Ga0500618_000123_38741_40186 | 427 |
| 180 | iso_pu_bacteria | 2643221580 | 2643912417 | 427 |
| 181 | iso_pu_bacteria | 2643221674 | 2644410736 | 427 |
| 182 | iso_pu_bacteria | 2643221734 | 2644735514 | 427 |
| 183 | iso_pu_bacteria | 2917699015 | 2917699375 | 427 |
| 184 | iso_pu_bacteria | 2932401849 | 2932403476 | 427 |
| 185 | 3300003791 | Ga0055530_10005482 | Ga0055530_100054822 | 428 |
| 186 | 3300003794 | Ga0055531_10000667 | Ga0055531_1000066710 | 428 |
| 187 | 3300003794 | Ga0055531_10000800 | Ga0055531_1000080024 | 428 |
| 188 | 3300005548 | Ga0070665_100022755 | Ga0070665_1000227557 | 428 |
| 189 | 3300010375 | Ga0105239_10148198 | Ga0105239_101481982 | 428 |
| 190 | 3300013307 | Ga0157372_10028104 | Ga0157372_100281046 | 428 |
| 191 | 3300013308 | Ga0157375_10054963 | Ga0157375_100549635 | 428 |
| 192 | 3300025292 | Ga0209676_1000151 | Ga0209676_100015129 | 428 |
| 193 | 3300025298 | Ga0209050_1001101 | Ga0209050_100110113 | 428 |
| 194 | 3300025304 | Ga0209257_1000413 | Ga0209257_100041345 | 428 |
| 195 | 3300025304 | Ga0209257_1000760 | Ga0209257_100076023 | 428 |
| 196 | 3300026041 | Ga0207639_10076993 | Ga0207639_100769932 | 428 |
| 197 | 3300032004 | Ga0307414_10008109 | Ga0307414_100081092 | 428 |
| 198 | 3300046660 | Ga0495625_0007216 | Ga0495625_0007216_2257_3660 | 428 |
| 199 | 3300046810 | Ga0495660_0001590 | Ga0495660_0001590_5741_7204 | 428 |
| 200 | 3300048921 | Ga0496118_0014843 | Ga0496118_0014843_1373_2779 | 428 |
| 201 | 3300053087 | Ga0500643_011792 | Ga0500643_011792_918_2300 | 428 |
| 202 | 3300053108 | Ga0500562_000549 | Ga0500562_000549_6084_7466 | 428 |
| 203 | 3300053730 | Ga0500645_002380 | Ga0500645_002380_4673_6055 | 428 |
| 204 | iso_pu_bacteria | 2643221598 | 2644002096 | 428 |
| 205 | iso_pu_bacteria | 2643221614 | 2644085507 | 428 |
| 206 | iso_pu_bacteria | 2643221661 | 2644343059 | 428 |
| 207 | iso_pu_bacteria | 2643221666 | 2644366359 | 428 |
| 208 | iso_pu_bacteria | 2818991435 | 2819539327 | 428 |
| 209 | iso_pu_bacteria | 2818991454 | 2819647799 | 428 |
| 210 | 3300005330 | Ga0070690_100047251 | Ga0070690_1000472512 | 429 |
| 211 | 3300005345 | Ga0070692_10008265 | Ga0070692_100082654 | 429 |
| 212 | 3300005364 | Ga0070673_100257186 | Ga0070673_1002571861 | 429 |
| 213 | 3300005365 | Ga0070688_100118190 | Ga0070688_1001181901 | 429 |
| 214 | 3300005435 | Ga0070714_100126231 | Ga0070714_1001262311 | 429 |
| 215 | 3300005440 | Ga0070705_100015454 | Ga0070705_1000154542 | 429 |
| 216 | 3300005530 | Ga0070679_100080501 | Ga0070679_1000805014 | 429 |
| 217 | 3300005536 | Ga0070697_100010332 | Ga0070697_1000103323 | 429 |
| 218 | 3300005547 | Ga0070693_100001672 | Ga0070693_1000016722 | 429 |
| 219 | 3300005548 | Ga0070665_100073128 | Ga0070665_1000731282 | 429 |
| 220 | 3300005548 | Ga0070665_100153619 | Ga0070665_1001536192 | 429 |
| 221 | 3300005563 | Ga0068855_100116015 | Ga0068855_1001160152 | 429 |
| 222 | 3300005564 | Ga0070664_100136620 | Ga0070664_1001366202 | 429 |
| 223 | 3300005578 | Ga0068854_100080460 | Ga0068854_1000804603 | 429 |
| 224 | 3300005842 | Ga0068858_100031490 | Ga0068858_1000314903 | 429 |
| 225 | 3300005843 | Ga0068860_100022267 | Ga0068860_1000222674 | 429 |
| 226 | 3300005844 | Ga0068862_100044274 | Ga0068862_1000442744 | 429 |
| 227 | 3300005844 | Ga0068862_100100985 | Ga0068862_1001009852 | 429 |
| 228 | 3300006163 | Ga0070715_10004104 | Ga0070715_100041042 | 429 |
| 229 | 3300006844 | Ga0075428_100060508 | Ga0075428_1000605083 | 429 |
| 230 | 3300006881 | Ga0068865_100022539 | Ga0068865_1000225393 | 429 |
| 231 | 3300009101 | Ga0105247_10006738 | Ga0105247_100067384 | 429 |
| 232 | 3300009148 | Ga0105243_10002889 | Ga0105243_100028899 | 429 |
| 233 | 3300009148 | Ga0105243_10029612 | Ga0105243_100296123 | 429 |
| 234 | 3300009177 | Ga0105248_10022662 | Ga0105248_1002266211 | 429 |
| 235 | 3300009177 | Ga0105248_10041909 | Ga0105248_100419095 | 429 |
| 236 | 3300009551 | Ga0105238_10056284 | Ga0105238_100562841 | 429 |
| 237 | 3300009553 | Ga0105249_10033372 | Ga0105249_100333724 | 429 |
| 238 | 3300013102 | Ga0157371_10015685 | Ga0157371_100156852 | 429 |
| 239 | 3300013297 | Ga0157378_10014358 | Ga0157378_100143588 | 429 |
| 240 | 3300013308 | Ga0157375_10002209 | Ga0157375_100022092 | 429 |
| 241 | 3300014325 | Ga0163163_10032695 | Ga0163163_100326952 | 429 |
| 242 | 3300014969 | Ga0157376_10124306 | Ga0157376_101243062 | 429 |
| 243 | 3300025904 | Ga0207647_10004963 | Ga0207647_100049637 | 429 |
| 244 | 3300025915 | Ga0207693_10001172 | Ga0207693_100011727 | 429 |
| 245 | 3300025924 | Ga0207694_10129105 | Ga0207694_101291052 | 429 |
| 246 | 3300025932 | Ga0207690_10034528 | Ga0207690_100345282 | 429 |
| 247 | 3300025935 | Ga0207709_10146240 | Ga0207709_101462401 | 429 |
| 248 | 3300025936 | Ga0207670_10016263 | Ga0207670_100162632 | 429 |
| 249 | 3300025940 | Ga0207691_10014720 | Ga0207691_100147204 | 429 |
| 250 | 3300025941 | Ga0207711_10066920 | Ga0207711_100669202 | 429 |
| 251 | 3300025972 | Ga0207668_10003452 | Ga0207668_100034527 | 429 |
| 252 | 3300026067 | Ga0207678_10000698 | Ga0207678_100006982 | 429 |
| 253 | 3300026121 | Ga0207683_10000527 | Ga0207683_1000052729 | 429 |
| 254 | 3300028379 | Ga0268266_10090362 | Ga0268266_100903621 | 429 |
| 255 | 3300028380 | Ga0268265_10029731 | Ga0268265_100297312 | 429 |
| 256 | 3300032004 | Ga0307414_10048172 | Ga0307414_100481723 | 429 |
| 257 | 3300035114 | Ga0373939_0011890 | Ga0373939_0011890_780_2183 | 429 |
| 258 | 3300037312 | Ga0395899_0000399 | Ga0395899_0000399_27862_29319 | 429 |
| 259 | 3300037312 | Ga0395899_0014303 | Ga0395899_0014303_4652_6034 | 429 |
| 260 | 3300037418 | Ga0395900_0000010 | Ga0395900_0000010_287071_288528 | 429 |
| 261 | 3300037418 | Ga0395900_0033116 | Ga0395900_0033116_2483_3865 | 429 |
| 262 | 3300037418 | Ga0395900_0122468 | Ga0395900_0122468_261_1664 | 429 |
| 263 | 3300037466 | Ga0395898_0001666 | Ga0395898_0001666_4598_6055 | 429 |
| 264 | 3300037466 | Ga0395898_0110442 | Ga0395898_0110442_1069_2451 | 429 |
| 265 | 3300037471 | Ga0395905_0000130 | Ga0395905_0000130_24927_26357 | 429 |
| 266 | 3300037471 | Ga0395905_0001118 | Ga0395905_0001118_1003_2406 | 429 |
| 267 | 3300037471 | Ga0395905_0004354 | Ga0395905_0004354_7355_8812 | 429 |
| 268 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_371435_372892 | 429 |
| 269 | 3300038443 | Ga0395901_0062898 | Ga0395901_0062898_182_1585 | 429 |
| 270 | 3300046460 | Ga0495638_0000800 | Ga0495638_0000800_20114_21520 | 429 |
| 271 | 3300046512 | Ga0495610_0000336 | Ga0495610_0000336_20759_22204 | 429 |
| 272 | 3300048903 | Ga0496100_0044733 | Ga0496100_0044733_109_1512 | 429 |
| 273 | 3300048907 | Ga0496104_0001549 | Ga0496104_0001549_7939_9342 | 429 |
| 274 | 3300048908 | Ga0496105_0004701 | Ga0496105_0004701_8375_9778 | 429 |
| 275 | 3300048910 | Ga0496107_0008427 | Ga0496107_0008427_4306_5709 | 429 |
| 276 | 3300048911 | Ga0496108_0100383 | Ga0496108_0100383_970_2373 | 429 |
| 277 | 3300048912 | Ga0496109_0205167 | Ga0496109_0205167_438_1841 | 429 |
| 278 | 3300048917 | Ga0496114_0015522 | Ga0496114_0015522_2049_3452 | 429 |
| 279 | 3300048918 | Ga0496115_0006459 | Ga0496115_0006459_2524_3927 | 429 |
| 280 | 3300048921 | Ga0496118_0000677 | Ga0496118_0000677_20177_21484 | 429 |
| 281 | 3300048928 | Ga0496125_0000217 | Ga0496125_0000217_61827_63209 | 429 |
| 282 | 3300049571 | Ga0501034_0007585 | Ga0501034_0007585_5728_7113 | 429 |
| 283 | 3300049571 | Ga0501034_0309920 | Ga0501034_0309920_99_1484 | 429 |
| 284 | 3300049579 | Ga0501043_0031524 | Ga0501043_0031524_560_1921 | 429 |
| 285 | 3300049591 | Ga0501075_0025225 | Ga0501075_0025225_1562_2950 | 429 |
| 286 | 3300049593 | Ga0501077_0038016 | Ga0501077_0038016_165_1553 | 429 |
| 287 | 3300049823 | Ga0501044_0091812 | Ga0501044_0091812_467_1828 | 429 |
| 288 | 3300050507 | nmdc:mga05p37_102778_c1 | nmdc:mga05p37_102778_c1_433_1836 | 429 |
| 289 | 3300053085 | Ga0495619_0042290 | Ga0495619_0042290_1451_2854 | 429 |
| 290 | 3300053151 | Ga0500604_0000695 | Ga0500604_0000695_5806_7188 | 429 |
| 291 | 3300053161 | Ga0500634_0000212 | Ga0500634_0000212_998_2383 | 429 |
| 292 | iso_pu_bacteria | 2643221563 | 2643835843 | 429 |
| 293 | iso_pu_bacteria | 2643221608 | 2644056769 | 429 |
| 294 | iso_pu_bacteria | 2643221736 | 2644746757 | 429 |
| 295 | iso_pu_bacteria | 2841760612 | 2841762604 | 429 |
| 296 | iso_pu_bacteria | 2841911363 | 2841913526 | 429 |
| 297 | iso_pu_bacteria | 2841917233 | 2841919273 | 429 |
| 298 | iso_pu_bacteria | 2844104063 | 2844110388 | 429 |
| 299 | iso_pu_bacteria | 2851182111 | 2851187046 | 429 |
| 300 | iso_pu_bacteria | 2851246043 | 2851252050 | 429 |
| 301 | iso_pu_bacteria | 2852653556 | 2852655017 | 429 |
| 302 | iso_pu_bacteria | 2852680915 | 2852681522 | 429 |
| 303 | iso_pu_bacteria | 8057529695 | 8057535338 | 429 |
| 304 | 3300003214 | JGI25165J46597_1003861 | JGI25165J46597_10038614 | 430 |
| 305 | 3300005366 | Ga0070659_100001909 | Ga0070659_10000190911 | 430 |
| 306 | 3300005458 | Ga0070681_10009284 | Ga0070681_100092845 | 430 |
| 307 | 3300005530 | Ga0070679_100161731 | Ga0070679_1001617312 | 430 |
| 308 | 3300005539 | Ga0068853_100053469 | Ga0068853_1000534692 | 430 |
| 309 | 3300005563 | Ga0068855_100044198 | Ga0068855_1000441982 | 430 |
| 310 | 3300005618 | Ga0068864_100085254 | Ga0068864_1000852541 | 430 |
| 311 | 3300005843 | Ga0068860_100282863 | Ga0068860_1002828632 | 430 |
| 312 | 3300014325 | Ga0163163_10153893 | Ga0163163_101538932 | 430 |
| 313 | 3300025231 | Ga0207427_101301 | Ga0207427_1013017 | 430 |
| 314 | 3300025261 | Ga0209233_1001390 | Ga0209233_10013905 | 430 |
| 315 | 3300025299 | Ga0209256_1000743 | Ga0209256_100074315 | 430 |
| 316 | 3300025914 | Ga0207671_10000701 | Ga0207671_1000070132 | 430 |
| 317 | 3300025942 | Ga0207689_10155032 | Ga0207689_101550321 | 430 |
| 318 | 3300028379 | Ga0268266_10000474 | Ga0268266_100004749 | 430 |
| 319 | 3300028556 | Ga0265337_1001828 | Ga0265337_10018287 | 430 |
| 320 | 3300028786 | Ga0307517_10025834 | Ga0307517_100258344 | 430 |
| 321 | 3300028800 | Ga0265338_10020764 | Ga0265338_100207643 | 430 |
| 322 | 3300031241 | Ga0265325_10001499 | Ga0265325_100014995 | 430 |
| 323 | 3300031249 | Ga0265339_10004519 | Ga0265339_1000451911 | 430 |
| 324 | 3300031251 | Ga0265327_10020337 | Ga0265327_100203372 | 430 |
| 325 | 3300032004 | Ga0307414_10241746 | Ga0307414_102417461 | 430 |
| 326 | 3300039450 | Ga0436363_0882399 | Ga0436363_0882399_180_1553 | 430 |
| 327 | 3300046473 | Ga0495582_0077552 | Ga0495582_0077552_17_1357 | 430 |
| 328 | 3300046520 | Ga0495637_0024359 | Ga0495637_0024359_180_1502 | 430 |
| 329 | 3300046522 | Ga0495643_0031941 | Ga0495643_0031941_912_2234 | 430 |
| 330 | 3300046531 | Ga0495665_0043953 | Ga0495665_0043953_419_1759 | 430 |
| 331 | 3300053087 | Ga0500643_000407 | Ga0500643_000407_8903_10225 | 430 |
| 332 | 3300053093 | Ga0500651_0000538 | Ga0500651_0000538_6814_8136 | 430 |
| 333 | 3300053096 | Ga0500641_0002349 | Ga0500641_0002349_314_1636 | 430 |
| 334 | 3300053108 | Ga0500562_000163 | Ga0500562_000163_16358_17746 | 430 |
| 335 | 3300053116 | Ga0500592_009106 | Ga0500592_009106_43_1365 | 430 |
| 336 | 3300053123 | Ga0500614_001488 | Ga0500614_001488_3261_4583 | 430 |
| 337 | 3300053724 | Ga0500570_000470 | Ga0500570_000470_4186_5508 | 430 |
| 338 | iso_pu_bacteria | 2643221629 | 2644166842 | 430 |
| 339 | iso_pu_bacteria | 2643221662 | 2644349356 | 430 |
| 340 | 3300003187 | JGI25151J46595_10000038 | JGI25151J46595_10000038119 | 431 |
| 341 | 3300003771 | Ga0055526_1000282 | Ga0055526_100028217 | 431 |
| 342 | 3300003771 | Ga0055526_1001779 | Ga0055526_10017793 | 431 |
| 343 | 3300003775 | Ga0055524_1000091 | Ga0055524_100009157 | 431 |
| 344 | 3300005331 | Ga0070670_100048561 | Ga0070670_1000485613 | 431 |
| 345 | 3300005347 | Ga0070668_100067102 | Ga0070668_1000671023 | 431 |
| 346 | 3300005367 | Ga0070667_100090483 | Ga0070667_1000904833 | 431 |
| 347 | 3300005548 | Ga0070665_100022780 | Ga0070665_1000227804 | 431 |
| 348 | 3300005618 | Ga0068864_100014781 | Ga0068864_1000147813 | 431 |
| 349 | 3300005841 | Ga0068863_100105700 | Ga0068863_1001057003 | 431 |
| 350 | 3300005842 | Ga0068858_100237180 | Ga0068858_1002371801 | 431 |
| 351 | 3300005843 | Ga0068860_100000583 | Ga0068860_10000058323 | 431 |
| 352 | 3300005843 | Ga0068860_100140979 | Ga0068860_1001409792 | 431 |
| 353 | 3300005844 | Ga0068862_100196208 | Ga0068862_1001962082 | 431 |
| 354 | 3300006881 | Ga0068865_100000723 | Ga0068865_1000007235 | 431 |
| 355 | 3300009093 | Ga0105240_10003194 | Ga0105240_100031945 | 431 |
| 356 | 3300009093 | Ga0105240_10050693 | Ga0105240_100506933 | 431 |
| 357 | 3300009177 | Ga0105248_10006553 | Ga0105248_100065539 | 431 |
| 358 | 3300010375 | Ga0105239_10000157 | Ga0105239_1000015722 | 431 |
| 359 | 3300013250 | Ga0171462_1040 | Ga0171462_104052 | 431 |
| 360 | 3300013308 | Ga0157375_10169873 | Ga0157375_101698731 | 431 |
| 361 | 3300025291 | Ga0209675_1001346 | Ga0209675_100134614 | 431 |
| 362 | 3300025294 | Ga0209025_1000014 | Ga0209025_1000014114 | 431 |
| 363 | 3300025295 | Ga0209564_1000105 | Ga0209564_100010588 | 431 |
| 364 | 3300025295 | Ga0209564_1000150 | Ga0209564_100015088 | 431 |
| 365 | 3300025299 | Ga0209256_1000108 | Ga0209256_100010888 | 431 |
| 366 | 3300025299 | Ga0209256_1000128 | Ga0209256_100012823 | 431 |
| 367 | 3300025913 | Ga0207695_10001296 | Ga0207695_1000129620 | 431 |
| 368 | 3300025913 | Ga0207695_10037479 | Ga0207695_100374793 | 431 |
| 369 | 3300025914 | Ga0207671_10007162 | Ga0207671_100071628 | 431 |
| 370 | 3300025925 | Ga0207650_10008947 | Ga0207650_100089473 | 431 |
| 371 | 3300025935 | Ga0207709_10093380 | Ga0207709_100933802 | 431 |
| 372 | 3300025941 | Ga0207711_10007924 | Ga0207711_100079245 | 431 |
| 373 | 3300025972 | Ga0207668_10018563 | Ga0207668_100185633 | 431 |
| 374 | 3300026088 | Ga0207641_10087523 | Ga0207641_100875231 | 431 |
| 375 | 3300026095 | Ga0207676_10012291 | Ga0207676_100122915 | 431 |
| 376 | 3300026095 | Ga0207676_10124390 | Ga0207676_101243902 | 431 |
| 377 | 3300026121 | Ga0207683_10167283 | Ga0207683_101672832 | 431 |
| 378 | 3300028379 | Ga0268266_10036647 | Ga0268266_100366472 | 431 |
| 379 | 3300028381 | Ga0268264_10000046 | Ga0268264_1000004623 | 431 |
| 380 | 3300031456 | Ga0307513_10004817 | Ga0307513_1000481713 | 431 |
| 381 | 3300031548 | Ga0307408_100049854 | Ga0307408_1000498544 | 431 |
| 382 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004201 | 431 |
| 383 | 3300031852 | Ga0307410_10004727 | Ga0307410_100047275 | 431 |
| 384 | 3300032002 | Ga0307416_100018999 | Ga0307416_1000189995 | 431 |
| 385 | 3300032005 | Ga0307411_10010448 | Ga0307411_100104484 | 431 |
| 386 | 3300032126 | Ga0307415_100003761 | Ga0307415_1000037615 | 431 |
| 387 | 3300033180 | Ga0307510_10007774 | Ga0307510_100077742 | 431 |
| 388 | 3300037068 | Ga0373925_0033525 | Ga0373925_0033525_1583_2983 | 431 |
| 389 | 3300046528 | Ga0495642_0014466 | Ga0495642_0014466_948_2348 | 431 |
| 390 | 3300046648 | Ga0495611_0007262 | Ga0495611_0007262_3209_4609 | 431 |
| 391 | 3300047472 | Ga0495686_0000055 | Ga0495686_0000055_5027_6355 | 431 |
| 392 | 3300048905 | Ga0496102_0000143 | Ga0496102_0000143_34296_35612 | 431 |
| 393 | 3300048905 | Ga0496102_0036426 | Ga0496102_0036426_2375_3775 | 431 |
| 394 | 3300048906 | Ga0496103_0000098 | Ga0496103_0000098_34280_35596 | 431 |
| 395 | 3300048915 | Ga0496112_0034209 | Ga0496112_0034209_3226_4626 | 431 |
| 396 | 3300048919 | Ga0496116_0000726 | Ga0496116_0000726_5920_7236 | 431 |
| 397 | 3300048920 | Ga0496117_0000121 | Ga0496117_0000121_68050_69366 | 431 |
| 398 | 3300048920 | Ga0496117_0088755 | Ga0496117_0088755_344_1654 | 431 |
| 399 | 3300048921 | Ga0496118_0000095 | Ga0496118_0000095_102167_103483 | 431 |
| 400 | 3300048921 | Ga0496118_0017247 | Ga0496118_0017247_779_2104 | 431 |
| 401 | 3300048921 | Ga0496118_0048915 | Ga0496118_0048915_1523_2833 | 431 |
| 402 | 3300048922 | Ga0496119_0023813 | Ga0496119_0023813_217_1545 | 431 |
| 403 | 3300048924 | Ga0496121_0013184 | Ga0496121_0013184_7464_8789 | 431 |
| 404 | 3300048927 | Ga0496124_0000119 | Ga0496124_0000119_102167_103483 | 431 |
| 405 | 3300048928 | Ga0496125_0106196 | Ga0496125_0106196_197_1603 | 431 |
| 406 | 3300049581 | Ga0501047_0002124 | Ga0501047_0002124_2797_4200 | 431 |
| 407 | 3300049581 | Ga0501047_0049086 | Ga0501047_0049086_872_2269 | 431 |
| 408 | 3300049663 | Ga0501223_005421 | Ga0501223_005421_783_2159 | 431 |
| 409 | 3300049770 | Ga0501273_004451 | Ga0501273_004451_132_1508 | 431 |
| 410 | 3300050514 | nmdc:mga08x19_7707_c1 | nmdc:mga08x19_7707_c1_163_1569 | 431 |
| 411 | 3300053153 | Ga0500616_0074146 | Ga0500616_0074146_189_1592 | 431 |
| 412 | iso_pu_bacteria | 2884960567 | 2884960873 | 431 |
| 413 | 3300005262 | Ga0065165_1000667 | Ga0065165_100066713 | 432 |
| 414 | 3300005327 | Ga0070658_10069401 | Ga0070658_100694012 | 432 |
| 415 | 3300005344 | Ga0070661_100019658 | Ga0070661_1000196582 | 432 |
| 416 | 3300005366 | Ga0070659_100001844 | Ga0070659_1000018442 | 432 |
| 417 | 3300005530 | Ga0070679_100083661 | Ga0070679_1000836614 | 432 |
| 418 | 3300005530 | Ga0070679_100114822 | Ga0070679_1001148223 | 432 |
| 419 | 3300005548 | Ga0070665_100000248 | Ga0070665_1000002486 | 432 |
| 420 | 3300005563 | Ga0068855_100000010 | Ga0068855_100000010120 | 432 |
| 421 | 3300005578 | Ga0068854_100172581 | Ga0068854_1001725811 | 432 |
| 422 | 3300005578 | Ga0068854_100179449 | Ga0068854_1001794492 | 432 |
| 423 | 3300005616 | Ga0068852_100002080 | Ga0068852_1000020807 | 432 |
| 424 | 3300005616 | Ga0068852_100007208 | Ga0068852_1000072084 | 432 |
| 425 | 3300005937 | Ga0081455_10001641 | Ga0081455_1000164126 | 432 |
| 426 | 3300009093 | Ga0105240_10000189 | Ga0105240_1000018968 | 432 |
| 427 | 3300009551 | Ga0105238_10036572 | Ga0105238_100365725 | 432 |
| 428 | 3300010375 | Ga0105239_10022193 | Ga0105239_100221933 | 432 |
| 429 | 3300013100 | Ga0157373_10000549 | Ga0157373_100005494 | 432 |
| 430 | 3300013105 | Ga0157369_10010154 | Ga0157369_100101547 | 432 |
| 431 | 3300013105 | Ga0157369_10046948 | Ga0157369_100469482 | 432 |
| 432 | 3300013307 | Ga0157372_10020017 | Ga0157372_100200172 | 432 |
| 433 | 3300025284 | Ga0209130_1000697 | Ga0209130_100069713 | 432 |
| 434 | 3300025302 | Ga0207426_1007192 | Ga0207426_10071923 | 432 |
| 435 | 3300025900 | Ga0207710_10025882 | Ga0207710_100258823 | 432 |
| 436 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003495 | 432 |
| 437 | 3300025920 | Ga0207649_10014458 | Ga0207649_100144584 | 432 |
| 438 | 3300025924 | Ga0207694_10000011 | Ga0207694_10000011266 | 432 |
| 439 | 3300025929 | Ga0207664_10005602 | Ga0207664_100056024 | 432 |
| 440 | 3300025929 | Ga0207664_10123471 | Ga0207664_101234712 | 432 |
| 441 | 3300025932 | Ga0207690_10000066 | Ga0207690_1000006639 | 432 |
| 442 | 3300025932 | Ga0207690_10009334 | Ga0207690_100093342 | 432 |
| 443 | 3300025949 | Ga0207667_10000093 | Ga0207667_10000093106 | 432 |
| 444 | 3300025981 | Ga0207640_10042562 | Ga0207640_100425621 | 432 |
| 445 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051200 | 432 |
| 446 | 3300028800 | Ga0265338_10029551 | Ga0265338_100295517 | 432 |
| 447 | 3300030521 | Ga0307511_10050145 | Ga0307511_100501451 | 432 |
| 448 | 3300031247 | Ga0265340_10002678 | Ga0265340_100026785 | 432 |
| 449 | 3300031251 | Ga0265327_10000074 | Ga0265327_10000074146 | 432 |
| 450 | 3300031251 | Ga0265327_10001725 | Ga0265327_1000172516 | 432 |
| 451 | 3300031711 | Ga0265314_10009963 | Ga0265314_100099635 | 432 |
| 452 | 3300031712 | Ga0265342_10011993 | Ga0265342_100119933 | 432 |
| 453 | 3300031712 | Ga0265342_10099770 | Ga0265342_100997701 | 432 |
| 454 | 3300031730 | Ga0307516_10024467 | Ga0307516_100244672 | 432 |
| 455 | 3300033180 | Ga0307510_10132745 | Ga0307510_101327451 | 432 |
| 456 | 3300042436 | Ga0439435_0004642 | Ga0439435_0004642_1309_2715 | 432 |
| 457 | 3300045051 | Ga0451576_0003258 | Ga0451576_0003258_2249_3679 | 432 |
| 458 | 3300046512 | Ga0495610_0047880 | Ga0495610_0047880_608_2020 | 432 |
| 459 | 3300048918 | Ga0496115_0000643 | Ga0496115_0000643_19495_20907 | 432 |
| 460 | 3300048920 | Ga0496117_0037383 | Ga0496117_0037383_1767_3233 | 432 |
| 461 | 3300048928 | Ga0496125_0055255 | Ga0496125_0055255_1543_2949 | 432 |
| 462 | 3300049460 | Ga0495682_0002152 | Ga0495682_0002152_4301_5632 | 432 |
| 463 | 3300049570 | Ga0501033_0015038 | Ga0501033_0015038_1761_3143 | 432 |
| 464 | 3300049571 | Ga0501034_0001509 | Ga0501034_0001509_8837_10228 | 432 |
| 465 | 3300049571 | Ga0501034_0063575 | Ga0501034_0063575_494_1894 | 432 |
| 466 | 3300049573 | Ga0501037_0045502 | Ga0501037_0045502_138_1520 | 432 |
| 467 | 3300049573 | Ga0501037_0047476 | Ga0501037_0047476_299_1633 | 432 |
| 468 | 3300049574 | Ga0501038_0086165 | Ga0501038_0086165_1217_2551 | 432 |
| 469 | 3300049579 | Ga0501043_0029427 | Ga0501043_0029427_773_2107 | 432 |
| 470 | 3300049581 | Ga0501047_0026719 | Ga0501047_0026719_2991_4373 | 432 |
| 471 | 3300049586 | Ga0501070_0000109 | Ga0501070_0000109_2662_3996 | 432 |
| 472 | 3300049742 | Ga0501080_0075893 | Ga0501080_0075893_662_1996 | 432 |
| 473 | 3300049822 | Ga0501035_0008525 | Ga0501035_0008525_3897_5231 | 432 |
| 474 | 3300049822 | Ga0501035_0074748 | Ga0501035_0074748_294_1640 | 432 |
| 475 | 3300049823 | Ga0501044_0008325 | Ga0501044_0008325_3882_5264 | 432 |
| 476 | 3300049823 | Ga0501044_0008931 | Ga0501044_0008931_5838_7172 | 432 |
| 477 | 3300049823 | Ga0501044_0017237 | Ga0501044_0017237_4489_5823 | 432 |
| 478 | 3300049823 | Ga0501044_0025782 | Ga0501044_0025782_3604_4938 | 432 |
| 479 | 3300049823 | Ga0501044_0095430 | Ga0501044_0095430_711_2045 | 432 |
| 480 | 3300050511 | nmdc:mga08y16_266301_c1 | nmdc:mga08y16_266301_c1_222_1628 | 432 |
| 481 | 3300053096 | Ga0500641_0004883 | Ga0500641_0004883_84_1514 | 432 |
| 482 | 3300053096 | Ga0500641_0035728 | Ga0500641_0035728_225_1622 | 432 |
| 483 | 3300053116 | Ga0500592_001393 | Ga0500592_001393_716_2029 | 432 |
| 484 | iso_pu_bacteria | 2643221547 | 2643756489 | 432 |
| 485 | iso_pu_bacteria | 2818991467 | 2819721055 | 432 |
| 486 | 3300003214 | JGI25165J46597_1000425 | JGI25165J46597_100042541 | 433 |
| 487 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006361 | 433 |
| 488 | 3300003791 | Ga0055530_10004835 | Ga0055530_100048354 | 433 |
| 489 | 3300005331 | Ga0070670_100006180 | Ga0070670_10000618010 | 433 |
| 490 | 3300005335 | Ga0070666_10000234 | Ga0070666_1000023427 | 433 |
| 491 | 3300005336 | Ga0070680_100022755 | Ga0070680_1000227555 | 433 |
| 492 | 3300005336 | Ga0070680_100022987 | Ga0070680_1000229873 | 433 |
| 493 | 3300005341 | Ga0070691_10005886 | Ga0070691_100058866 | 433 |
| 494 | 3300005344 | Ga0070661_100000415 | Ga0070661_10000041514 | 433 |
| 495 | 3300005347 | Ga0070668_100001563 | Ga0070668_10000156312 | 433 |
| 496 | 3300005347 | Ga0070668_100001996 | Ga0070668_10000199613 | 433 |
| 497 | 3300005353 | Ga0070669_100000008 | Ga0070669_10000000883 | 433 |
| 498 | 3300005355 | Ga0070671_100000010 | Ga0070671_100000010188 | 433 |
| 499 | 3300005367 | Ga0070667_100000140 | Ga0070667_10000014039 | 433 |
| 500 | 3300005367 | Ga0070667_100014536 | Ga0070667_1000145367 | 433 |
| 501 | 3300005367 | Ga0070667_100214822 | Ga0070667_1002148222 | 433 |
| 502 | 3300005458 | Ga0070681_10009895 | Ga0070681_100098955 | 433 |
| 503 | 3300005530 | Ga0070679_100012066 | Ga0070679_1000120666 | 433 |
| 504 | 3300005548 | Ga0070665_100006854 | Ga0070665_1000068548 | 433 |
| 505 | 3300005548 | Ga0070665_100007821 | Ga0070665_1000078212 | 433 |
| 506 | 3300005548 | Ga0070665_100040780 | Ga0070665_1000407803 | 433 |
| 507 | 3300005563 | Ga0068855_100114040 | Ga0068855_1001140403 | 433 |
| 508 | 3300005563 | Ga0068855_100122502 | Ga0068855_1001225022 | 433 |
| 509 | 3300005617 | Ga0068859_100002317 | Ga0068859_1000023174 | 433 |
| 510 | 3300005618 | Ga0068864_100000533 | Ga0068864_10000053318 | 433 |
| 511 | 3300005618 | Ga0068864_100030976 | Ga0068864_1000309762 | 433 |
| 512 | 3300005719 | Ga0068861_100011425 | Ga0068861_1000114254 | 433 |
| 513 | 3300005841 | Ga0068863_100002271 | Ga0068863_10000227118 | 433 |
| 514 | 3300005841 | Ga0068863_100029849 | Ga0068863_1000298494 | 433 |
| 515 | 3300005842 | Ga0068858_100006839 | Ga0068858_10000683910 | 433 |
| 516 | 3300005842 | Ga0068858_100020066 | Ga0068858_1000200666 | 433 |
| 517 | 3300005843 | Ga0068860_100000580 | Ga0068860_10000058017 | 433 |
| 518 | 3300005844 | Ga0068862_100000443 | Ga0068862_10000044330 | 433 |
| 519 | 3300005844 | Ga0068862_100011082 | Ga0068862_1000110828 | 433 |
| 520 | 3300005985 | Ga0081539_10013768 | Ga0081539_100137681 | 433 |
| 521 | 3300006042 | Ga0075368_10004137 | Ga0075368_100041372 | 433 |
| 522 | 3300006051 | Ga0075364_10003123 | Ga0075364_100031239 | 433 |
| 523 | 3300006178 | Ga0075367_10031006 | Ga0075367_100310062 | 433 |
| 524 | 3300006237 | Ga0097621_100245117 | Ga0097621_1002451172 | 433 |
| 525 | 3300006358 | Ga0068871_100041474 | Ga0068871_1000414743 | 433 |
| 526 | 3300006931 | Ga0097620_100002317 | Ga0097620_10000231714 | 433 |
| 527 | 3300009093 | Ga0105240_10011563 | Ga0105240_1001156311 | 433 |
| 528 | 3300009093 | Ga0105240_10041926 | Ga0105240_100419263 | 433 |
| 529 | 3300009093 | Ga0105240_10044078 | Ga0105240_100440782 | 433 |
| 530 | 3300009098 | Ga0105245_10001293 | Ga0105245_1000129318 | 433 |
| 531 | 3300009101 | Ga0105247_10000673 | Ga0105247_1000067314 | 433 |
| 532 | 3300009177 | Ga0105248_10004862 | Ga0105248_1000486214 | 433 |
| 533 | 3300009551 | Ga0105238_10012191 | Ga0105238_100121918 | 433 |
| 534 | 3300009553 | Ga0105249_10004149 | Ga0105249_1000414910 | 433 |
| 535 | 3300010375 | Ga0105239_10172760 | Ga0105239_101727602 | 433 |
| 536 | 3300010375 | Ga0105239_10175604 | Ga0105239_101756042 | 433 |
| 537 | 3300013297 | Ga0157378_10155814 | Ga0157378_101558141 | 433 |
| 538 | 3300013306 | Ga0163162_10052631 | Ga0163162_100526312 | 433 |
| 539 | 3300013307 | Ga0157372_10015386 | Ga0157372_100153863 | 433 |
| 540 | 3300014968 | Ga0157379_10071957 | Ga0157379_100719573 | 433 |
| 541 | 3300021384 | Ga0213876_10021790 | Ga0213876_100217902 | 433 |
| 542 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013252 | 433 |
| 543 | 3300025292 | Ga0209676_1000453 | Ga0209676_100045329 | 433 |
| 544 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011465 | 433 |
| 545 | 3300025297 | Ga0209758_1000401 | Ga0209758_100040156 | 433 |
| 546 | 3300025298 | Ga0209050_1000031 | Ga0209050_1000031224 | 433 |
| 547 | 3300025298 | Ga0209050_1000822 | Ga0209050_100082220 | 433 |
| 548 | 3300025304 | Ga0209257_1000073 | Ga0209257_1000073156 | 433 |
| 549 | 3300025304 | Ga0209257_1002730 | Ga0209257_100273010 | 433 |
| 550 | 3300025304 | Ga0209257_1003297 | Ga0209257_10032977 | 433 |
| 551 | 3300025315 | Ga0207697_10000036 | Ga0207697_1000003641 | 433 |
| 552 | 3300025315 | Ga0207697_10021489 | Ga0207697_100214892 | 433 |
| 553 | 3300025903 | Ga0207680_10000097 | Ga0207680_1000009713 | 433 |
| 554 | 3300025911 | Ga0207654_10055799 | Ga0207654_100557991 | 433 |
| 555 | 3300025912 | Ga0207707_10009978 | Ga0207707_100099786 | 433 |
| 556 | 3300025912 | Ga0207707_10108805 | Ga0207707_101088052 | 433 |
| 557 | 3300025913 | Ga0207695_10000984 | Ga0207695_1000098429 | 433 |
| 558 | 3300025913 | Ga0207695_10004268 | Ga0207695_100042686 | 433 |
| 559 | 3300025913 | Ga0207695_10006822 | Ga0207695_100068225 | 433 |
| 560 | 3300025913 | Ga0207695_10017297 | Ga0207695_100172975 | 433 |
| 561 | 3300025917 | Ga0207660_10051165 | Ga0207660_100511652 | 433 |
| 562 | 3300025920 | Ga0207649_10000448 | Ga0207649_1000044824 | 433 |
| 563 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002175 | 433 |
| 564 | 3300025924 | Ga0207694_10016477 | Ga0207694_100164775 | 433 |
| 565 | 3300025925 | Ga0207650_10000062 | Ga0207650_10000062130 | 433 |
| 566 | 3300025927 | Ga0207687_10001382 | Ga0207687_1000138219 | 433 |
| 567 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002174 | 433 |
| 568 | 3300025941 | Ga0207711_10069337 | Ga0207711_100693372 | 433 |
| 569 | 3300025949 | Ga0207667_10010340 | Ga0207667_100103406 | 433 |
| 570 | 3300025949 | Ga0207667_10033965 | Ga0207667_100339654 | 433 |
| 571 | 3300025961 | Ga0207712_10002299 | Ga0207712_100022995 | 433 |
| 572 | 3300025972 | Ga0207668_10000046 | Ga0207668_1000004671 | 433 |
| 573 | 3300025972 | Ga0207668_10001421 | Ga0207668_100014212 | 433 |
| 574 | 3300025986 | Ga0207658_10000264 | Ga0207658_1000026439 | 433 |
| 575 | 3300025986 | Ga0207658_10003580 | Ga0207658_100035808 | 433 |
| 576 | 3300025986 | Ga0207658_10006846 | Ga0207658_100068469 | 433 |
| 577 | 3300026035 | Ga0207703_10001492 | Ga0207703_1000149215 | 433 |
| 578 | 3300026035 | Ga0207703_10003329 | Ga0207703_100033293 | 433 |
| 579 | 3300026088 | Ga0207641_10001512 | Ga0207641_1000151223 | 433 |
| 580 | 3300026088 | Ga0207641_10011597 | Ga0207641_100115976 | 433 |
| 581 | 3300026088 | Ga0207641_10040963 | Ga0207641_100409633 | 433 |
| 582 | 3300026095 | Ga0207676_10000784 | Ga0207676_100007844 | 433 |
| 583 | 3300026095 | Ga0207676_10022590 | Ga0207676_100225902 | 433 |
| 584 | 3300026118 | Ga0207675_100000358 | Ga0207675_10000035843 | 433 |
| 585 | 3300026121 | Ga0207683_10079316 | Ga0207683_100793163 | 433 |
| 586 | 3300026142 | Ga0207698_10105462 | Ga0207698_101054621 | 433 |
| 587 | 3300028379 | Ga0268266_10001455 | Ga0268266_100014559 | 433 |
| 588 | 3300028379 | Ga0268266_10029304 | Ga0268266_100293043 | 433 |
| 589 | 3300028380 | Ga0268265_10000339 | Ga0268265_1000033929 | 433 |
| 590 | 3300028380 | Ga0268265_10002810 | Ga0268265_100028109 | 433 |
| 591 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010393 | 433 |
| 592 | 3300028381 | Ga0268264_10000358 | Ga0268264_1000035818 | 433 |
| 593 | 3300031241 | Ga0265325_10002804 | Ga0265325_1000280410 | 433 |
| 594 | 3300031247 | Ga0265340_10073391 | Ga0265340_100733911 | 433 |
| 595 | 3300031250 | Ga0265331_10000006 | Ga0265331_1000000674 | 433 |
| 596 | 3300031251 | Ga0265327_10000381 | Ga0265327_1000038110 | 433 |
| 597 | 3300031344 | Ga0265316_10064684 | Ga0265316_100646843 | 433 |
| 598 | 3300031456 | Ga0307513_10001008 | Ga0307513_1000100824 | 433 |
| 599 | 3300031711 | Ga0265314_10002986 | Ga0265314_100029864 | 433 |
| 600 | 3300031711 | Ga0265314_10028054 | Ga0265314_100280544 | 433 |
| 601 | 3300032137 | Ga0316585_10021242 | Ga0316585_100212421 | 433 |
| 602 | 3300037418 | Ga0395900_0211953 | Ga0395900_0211953_48_1502 | 433 |
| 603 | 3300039450 | Ga0436363_0800232 | Ga0436363_0800232_1297_2637 | 433 |
| 604 | 3300046542 | Ga0495597_0002439 | Ga0495597_0002439_8588_9994 | 433 |
| 605 | 3300046557 | Ga0495622_0004437 | Ga0495622_0004437_3207_4613 | 433 |
| 606 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_861015_862361 | 433 |
| 607 | 3300046616 | Ga0495668_0009345 | Ga0495668_0009345_1516_2922 | 433 |
| 608 | 3300046660 | Ga0495625_0000652 | Ga0495625_0000652_19456_20802 | 433 |
| 609 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_273863_275266 | 433 |
| 610 | 3300046684 | Ga0495669_0000267 | Ga0495669_0000267_20756_22156 | 433 |
| 611 | 3300046684 | Ga0495669_0009330 | Ga0495669_0009330_68_1477 | 433 |
| 612 | 3300049568 | Ga0501031_0112002 | Ga0501031_0112002_131_1468 | 433 |
| 613 | 3300049569 | Ga0501032_0011363 | Ga0501032_0011363_3320_4657 | 433 |
| 614 | 3300049570 | Ga0501033_0020758 | Ga0501033_0020758_315_1652 | 433 |
| 615 | 3300049572 | Ga0501036_0018741 | Ga0501036_0018741_1249_2586 | 433 |
| 616 | 3300049573 | Ga0501037_0039423 | Ga0501037_0039423_354_1691 | 433 |
| 617 | 3300049573 | Ga0501037_0119016 | Ga0501037_0119016_291_1640 | 433 |
| 618 | 3300049574 | Ga0501038_0042587 | Ga0501038_0042587_2130_3467 | 433 |
| 619 | 3300049579 | Ga0501043_0024083 | Ga0501043_0024083_334_1683 | 433 |
| 620 | 3300049580 | Ga0501046_0013968 | Ga0501046_0013968_191_1549 | 433 |
| 621 | 3300049580 | Ga0501046_0034820 | Ga0501046_0034820_1561_2910 | 433 |
| 622 | 3300049581 | Ga0501047_0003221 | Ga0501047_0003221_9588_10937 | 433 |
| 623 | 3300049585 | Ga0501069_0038330 | Ga0501069_0038330_793_2136 | 433 |
| 624 | 3300049744 | Ga0501083_0058356 | Ga0501083_0058356_284_1627 | 433 |
| 625 | 3300049822 | Ga0501035_0010025 | Ga0501035_0010025_3516_4853 | 433 |
| 626 | 3300049823 | Ga0501044_0005359 | Ga0501044_0005359_1348_2697 | 433 |
| 627 | 3300049823 | Ga0501044_0005940 | Ga0501044_0005940_6474_7811 | 433 |
| 628 | 3300050491 | nmdc:mga00v17_2502_c1 | nmdc:mga00v17_2502_c1_1635_3035 | 433 |
| 629 | 3300050496 | nmdc:mga07m45_2641_c1 | nmdc:mga07m45_2641_c1_4037_5437 | 433 |
| 630 | 3300050516 | nmdc:mga0sz30_23010_c2 | nmdc:mga0sz30_23010_c2_543_1943 | 433 |
| 631 | 3300053080 | Ga0500635_0000847 | Ga0500635_0000847_150_1556 | 433 |
| 632 | 3300053087 | Ga0500643_014657 | Ga0500643_014657_889_2238 | 433 |
| 633 | 3300053093 | Ga0500651_0089878 | Ga0500651_0089878_364_1770 | 433 |
| 634 | 3300053103 | Ga0500555_015110 | Ga0500555_015110_89_1492 | 433 |
| 635 | 3300053117 | Ga0500593_000095 | Ga0500593_000095_5767_7176 | 433 |
| 636 | 3300053119 | Ga0500595_006788 | Ga0500595_006788_2476_3882 | 433 |
| 637 | 3300053119 | Ga0500595_010491 | Ga0500595_010491_2173_3588 | 433 |
| 638 | 3300053122 | Ga0500608_072404 | Ga0500608_072404_205_1611 | 433 |
| 639 | 3300053139 | Ga0500568_0001107 | Ga0500568_0001107_747_2093 | 433 |
| 640 | 3300053157 | Ga0500624_000294 | Ga0500624_000294_4561_5910 | 433 |
| 641 | 3300053158 | Ga0500627_0000005 | Ga0500627_0000005_70528_71877 | 433 |
| 642 | 3300053177 | Ga0500636_0003201 | Ga0500636_0003201_3034_4383 | 433 |
| 643 | 3300053177 | Ga0500636_0017824 | Ga0500636_0017824_2652_4058 | 433 |
| 644 | iso_pu_bacteria | 2882806704 | 2882807726 | 433 |
| 645 | iso_pu_bacteria | 643348564 | 643599929 | 433 |
| 646 | 3300001915 | JGI24741J21665_1004204 | JGI24741J21665_10042043 | 434 |
| 647 | 3300001979 | JGI24740J21852_10010082 | JGI24740J21852_100100823 | 434 |
| 648 | 3300002067 | JGI24735J21928_10003799 | JGI24735J21928_100037993 | 434 |
| 649 | 3300005327 | Ga0070658_10071045 | Ga0070658_100710452 | 434 |
| 650 | 3300005328 | Ga0070676_10025735 | Ga0070676_100257354 | 434 |
| 651 | 3300005334 | Ga0068869_100003098 | Ga0068869_1000030989 | 434 |
| 652 | 3300005334 | Ga0068869_100055111 | Ga0068869_1000551111 | 434 |
| 653 | 3300005336 | Ga0070680_100045778 | Ga0070680_1000457784 | 434 |
| 654 | 3300005337 | Ga0070682_100009658 | Ga0070682_1000096585 | 434 |
| 655 | 3300005337 | Ga0070682_100012477 | Ga0070682_1000124772 | 434 |
| 656 | 3300005339 | Ga0070660_100036631 | Ga0070660_1000366312 | 434 |
| 657 | 3300005341 | Ga0070691_10044509 | Ga0070691_100445092 | 434 |
| 658 | 3300005344 | Ga0070661_100096602 | Ga0070661_1000966022 | 434 |
| 659 | 3300005347 | Ga0070668_100135103 | Ga0070668_1001351032 | 434 |
| 660 | 3300005353 | Ga0070669_100045468 | Ga0070669_1000454683 | 434 |
| 661 | 3300005354 | Ga0070675_100027852 | Ga0070675_1000278522 | 434 |
| 662 | 3300005356 | Ga0070674_100029240 | Ga0070674_1000292402 | 434 |
| 663 | 3300005364 | Ga0070673_100061252 | Ga0070673_1000612524 | 434 |
| 664 | 3300005365 | Ga0070688_100010364 | Ga0070688_1000103644 | 434 |
| 665 | 3300005455 | Ga0070663_100003708 | Ga0070663_1000037083 | 434 |
| 666 | 3300005457 | Ga0070662_100127009 | Ga0070662_1001270092 | 434 |
| 667 | 3300005458 | Ga0070681_10060810 | Ga0070681_100608102 | 434 |
| 668 | 3300005466 | Ga0070685_10013224 | Ga0070685_100132245 | 434 |
| 669 | 3300005466 | Ga0070685_10081286 | Ga0070685_100812862 | 434 |
| 670 | 3300005530 | Ga0070679_100153856 | Ga0070679_1001538562 | 434 |
| 671 | 3300005547 | Ga0070693_100061671 | Ga0070693_1000616712 | 434 |
| 672 | 3300005548 | Ga0070665_100010246 | Ga0070665_1000102466 | 434 |
| 673 | 3300005548 | Ga0070665_100012139 | Ga0070665_1000121394 | 434 |
| 674 | 3300005563 | Ga0068855_100039414 | Ga0068855_1000394144 | 434 |
| 675 | 3300005577 | Ga0068857_100037113 | Ga0068857_1000371133 | 434 |
| 676 | 3300005577 | Ga0068857_100070399 | Ga0068857_1000703993 | 434 |
| 677 | 3300005577 | Ga0068857_100075817 | Ga0068857_1000758173 | 434 |
| 678 | 3300005578 | Ga0068854_100027333 | Ga0068854_1000273334 | 434 |
| 679 | 3300005614 | Ga0068856_100026670 | Ga0068856_1000266702 | 434 |
| 680 | 3300005617 | Ga0068859_100057662 | Ga0068859_1000576622 | 434 |
| 681 | 3300005841 | Ga0068863_100039041 | Ga0068863_1000390415 | 434 |
| 682 | 3300005841 | Ga0068863_100084696 | Ga0068863_1000846963 | 434 |
| 683 | 3300005842 | Ga0068858_100055790 | Ga0068858_1000557904 | 434 |
| 684 | 3300006042 | Ga0075368_10007426 | Ga0075368_100074263 | 434 |
| 685 | 3300006173 | Ga0070716_100014189 | Ga0070716_1000141892 | 434 |
| 686 | 3300006175 | Ga0070712_100023883 | Ga0070712_1000238833 | 434 |
| 687 | 3300006175 | Ga0070712_100045608 | Ga0070712_1000456082 | 434 |
| 688 | 3300006177 | Ga0075362_10006143 | Ga0075362_100061435 | 434 |
| 689 | 3300006237 | Ga0097621_100000004 | Ga0097621_10000000430 | 434 |
| 690 | 3300006237 | Ga0097621_100114654 | Ga0097621_1001146541 | 434 |
| 691 | 3300006871 | Ga0075434_100208611 | Ga0075434_1002086112 | 434 |
| 692 | 3300006914 | Ga0075436_100069795 | Ga0075436_1000697952 | 434 |
| 693 | 3300006931 | Ga0097620_100057660 | Ga0097620_1000576602 | 434 |
| 694 | 3300009093 | Ga0105240_10068604 | Ga0105240_100686044 | 434 |
| 695 | 3300009093 | Ga0105240_10069728 | Ga0105240_100697283 | 434 |
| 696 | 3300009093 | Ga0105240_10246678 | Ga0105240_102466782 | 434 |
| 697 | 3300009098 | Ga0105245_10047864 | Ga0105245_100478644 | 434 |
| 698 | 3300009098 | Ga0105245_10089674 | Ga0105245_100896743 | 434 |
| 699 | 3300009148 | Ga0105243_10003266 | Ga0105243_100032664 | 434 |
| 700 | 3300009174 | Ga0105241_10012391 | Ga0105241_100123917 | 434 |
| 701 | 3300009174 | Ga0105241_10082892 | Ga0105241_100828922 | 434 |
| 702 | 3300009176 | Ga0105242_10021185 | Ga0105242_100211855 | 434 |
| 703 | 3300009177 | Ga0105248_10030181 | Ga0105248_100301812 | 434 |
| 704 | 3300009545 | Ga0105237_10006217 | Ga0105237_100062177 | 434 |
| 705 | 3300009545 | Ga0105237_10158072 | Ga0105237_101580721 | 434 |
| 706 | 3300009545 | Ga0105237_10164072 | Ga0105237_101640722 | 434 |
| 707 | 3300009551 | Ga0105238_10033513 | Ga0105238_100335134 | 434 |
| 708 | 3300009551 | Ga0105238_10151581 | Ga0105238_101515811 | 434 |
| 709 | 3300010375 | Ga0105239_10058604 | Ga0105239_100586044 | 434 |
| 710 | 3300011119 | Ga0105246_10014991 | Ga0105246_100149915 | 434 |
| 711 | 3300011119 | Ga0105246_10034704 | Ga0105246_100347041 | 434 |
| 712 | 3300013308 | Ga0157375_10151643 | Ga0157375_101516432 | 434 |
| 713 | 3300014968 | Ga0157379_10017057 | Ga0157379_100170572 | 434 |
| 714 | 3300014968 | Ga0157379_10067903 | Ga0157379_100679033 | 434 |
| 715 | 3300014969 | Ga0157376_10016186 | Ga0157376_100161862 | 434 |
| 716 | 3300014969 | Ga0157376_10161051 | Ga0157376_101610513 | 434 |
| 717 | 3300017792 | Ga0163161_10078138 | Ga0163161_100781381 | 434 |
| 718 | 3300025900 | Ga0207710_10001925 | Ga0207710_100019258 | 434 |
| 719 | 3300025907 | Ga0207645_10032477 | Ga0207645_100324774 | 434 |
| 720 | 3300025911 | Ga0207654_10042006 | Ga0207654_100420062 | 434 |
| 721 | 3300025911 | Ga0207654_10058582 | Ga0207654_100585822 | 434 |
| 722 | 3300025912 | Ga0207707_10040418 | Ga0207707_100404182 | 434 |
| 723 | 3300025913 | Ga0207695_10006284 | Ga0207695_100062843 | 434 |
| 724 | 3300025913 | Ga0207695_10025668 | Ga0207695_100256684 | 434 |
| 725 | 3300025913 | Ga0207695_10054252 | Ga0207695_100542525 | 434 |
| 726 | 3300025914 | Ga0207671_10087469 | Ga0207671_100874692 | 434 |
| 727 | 3300025915 | Ga0207693_10038804 | Ga0207693_100388043 | 434 |
| 728 | 3300025917 | Ga0207660_10014579 | Ga0207660_100145795 | 434 |
| 729 | 3300025918 | Ga0207662_10019704 | Ga0207662_100197042 | 434 |
| 730 | 3300025919 | Ga0207657_10019859 | Ga0207657_100198596 | 434 |
| 731 | 3300025921 | Ga0207652_10125765 | Ga0207652_101257652 | 434 |
| 732 | 3300025924 | Ga0207694_10185176 | Ga0207694_101851762 | 434 |
| 733 | 3300025924 | Ga0207694_10201115 | Ga0207694_102011151 | 434 |
| 734 | 3300025926 | Ga0207659_10019312 | Ga0207659_100193125 | 434 |
| 735 | 3300025927 | Ga0207687_10029495 | Ga0207687_100294952 | 434 |
| 736 | 3300025933 | Ga0207706_10017152 | Ga0207706_100171522 | 434 |
| 737 | 3300025934 | Ga0207686_10142682 | Ga0207686_101426821 | 434 |
| 738 | 3300025935 | Ga0207709_10002218 | Ga0207709_100022185 | 434 |
| 739 | 3300025936 | Ga0207670_10030117 | Ga0207670_100301171 | 434 |
| 740 | 3300025938 | Ga0207704_10201169 | Ga0207704_102011691 | 434 |
| 741 | 3300025939 | Ga0207665_10001649 | Ga0207665_100016493 | 434 |
| 742 | 3300025942 | Ga0207689_10028111 | Ga0207689_100281115 | 434 |
| 743 | 3300025942 | Ga0207689_10042506 | Ga0207689_100425061 | 434 |
| 744 | 3300025944 | Ga0207661_10030751 | Ga0207661_100307514 | 434 |
| 745 | 3300025949 | Ga0207667_10121329 | Ga0207667_101213293 | 434 |
| 746 | 3300025961 | Ga0207712_10055505 | Ga0207712_100555053 | 434 |
| 747 | 3300025981 | Ga0207640_10026267 | Ga0207640_100262673 | 434 |
| 748 | 3300026023 | Ga0207677_10051800 | Ga0207677_100518004 | 434 |
| 749 | 3300026035 | Ga0207703_10002958 | Ga0207703_100029589 | 434 |
| 750 | 3300026041 | Ga0207639_10015498 | Ga0207639_100154984 | 434 |
| 751 | 3300026041 | Ga0207639_10064483 | Ga0207639_100644832 | 434 |
| 752 | 3300026067 | Ga0207678_10017512 | Ga0207678_100175124 | 434 |
| 753 | 3300026075 | Ga0207708_10001156 | Ga0207708_1000115615 | 434 |
| 754 | 3300026089 | Ga0207648_10019067 | Ga0207648_100190673 | 434 |
| 755 | 3300026116 | Ga0207674_10004754 | Ga0207674_1000475422 | 434 |
| 756 | 3300026116 | Ga0207674_10078164 | Ga0207674_100781643 | 434 |
| 757 | 3300026118 | Ga0207675_100000249 | Ga0207675_10000024936 | 434 |
| 758 | 3300026121 | Ga0207683_10038603 | Ga0207683_100386034 | 434 |
| 759 | 3300026121 | Ga0207683_10088260 | Ga0207683_100882602 | 434 |
| 760 | 3300028379 | Ga0268266_10005907 | Ga0268266_100059078 | 434 |
| 761 | 3300028379 | Ga0268266_10023201 | Ga0268266_100232012 | 434 |
| 762 | 3300028379 | Ga0268266_10024329 | Ga0268266_100243292 | 434 |
| 763 | 3300028379 | Ga0268266_10122735 | Ga0268266_101227353 | 434 |
| 764 | 3300028379 | Ga0268266_10187165 | Ga0268266_101871652 | 434 |
| 765 | 3300031238 | Ga0265332_10007546 | Ga0265332_100075463 | 434 |
| 766 | 3300031247 | Ga0265340_10009105 | Ga0265340_100091054 | 434 |
| 767 | 3300031247 | Ga0265340_10009447 | Ga0265340_100094472 | 434 |
| 768 | 3300031249 | Ga0265339_10002510 | Ga0265339_100025105 | 434 |
| 769 | 3300031691 | Ga0316579_10014412 | Ga0316579_100144123 | 434 |
| 770 | 3300031712 | Ga0265342_10000100 | Ga0265342_1000010084 | 434 |
| 771 | 3300031727 | Ga0316576_10034936 | Ga0316576_100349362 | 434 |
| 772 | 3300031728 | Ga0316578_10048851 | Ga0316578_100488512 | 434 |
| 773 | 3300031733 | Ga0316577_10026372 | Ga0316577_100263723 | 434 |
| 774 | 3300032133 | Ga0316583_10020047 | Ga0316583_100200471 | 434 |
| 775 | 3300037418 | Ga0395900_0145234 | Ga0395900_0145234_701_2059 | 434 |
| 776 | 3300046538 | Ga0495609_0022864 | Ga0495609_0022864_447_1799 | 434 |
| 777 | 3300048904 | Ga0496101_0006844 | Ga0496101_0006844_1492_2925 | 434 |
| 778 | 3300048904 | Ga0496101_0045339 | Ga0496101_0045339_781_2184 | 434 |
| 779 | 3300048905 | Ga0496102_0045483 | Ga0496102_0045483_1937_3370 | 434 |
| 780 | 3300048906 | Ga0496103_0049805 | Ga0496103_0049805_1059_2492 | 434 |
| 781 | 3300048909 | Ga0496106_0157107 | Ga0496106_0157107_193_1626 | 434 |
| 782 | 3300048912 | Ga0496109_0083013 | Ga0496109_0083013_142_1545 | 434 |
| 783 | 3300048918 | Ga0496115_0061107 | Ga0496115_0061107_848_2281 | 434 |
| 784 | 3300049570 | Ga0501033_0043351 | Ga0501033_0043351_1531_2889 | 434 |
| 785 | 3300049571 | Ga0501034_0181167 | Ga0501034_0181167_126_1484 | 434 |
| 786 | 3300049571 | Ga0501034_0254955 | Ga0501034_0254955_113_1447 | 434 |
| 787 | 3300049574 | Ga0501038_0000009 | Ga0501038_0000009_91994_93367 | 434 |
| 788 | 3300049574 | Ga0501038_0046649 | Ga0501038_0046649_2200_3615 | 434 |
| 789 | 3300049579 | Ga0501043_0043621 | Ga0501043_0043621_771_2129 | 434 |
| 790 | 3300049581 | Ga0501047_0081130 | Ga0501047_0081130_104_1537 | 434 |
| 791 | 3300049581 | Ga0501047_0166649 | Ga0501047_0166649_174_1589 | 434 |
| 792 | 3300049592 | Ga0501076_0030823 | Ga0501076_0030823_2419_3834 | 434 |
| 793 | 3300049663 | Ga0501223_000067 | Ga0501223_000067_4512_5927 | 434 |
| 794 | 3300049664 | Ga0501224_000036 | Ga0501224_000036_4720_6135 | 434 |
| 795 | 3300049668 | Ga0501233_005491 | Ga0501233_005491_32_1447 | 434 |
| 796 | 3300049705 | Ga0501225_0000018 | Ga0501225_0000018_24074_25489 | 434 |
| 797 | 3300049742 | Ga0501080_0055866 | Ga0501080_0055866_2141_3499 | 434 |
| 798 | 3300049822 | Ga0501035_0027886 | Ga0501035_0027886_1528_2943 | 434 |
| 799 | 3300049823 | Ga0501044_0025973 | Ga0501044_0025973_1336_2751 | 434 |
| 800 | 3300049823 | Ga0501044_0051080 | Ga0501044_0051080_2359_3717 | 434 |
| 801 | 3300049853 | Ga0501226_000063 | Ga0501226_000063_24102_25517 | 434 |
| 802 | 3300050494 | nmdc:mga06z11_28570_c1 | nmdc:mga06z11_28570_c1_217_1629 | 434 |
| 803 | 3300050512 | nmdc:mga0n895_32032_c1 | nmdc:mga0n895_32032_c1_378_1787 | 434 |
| 804 | 3300050513 | nmdc:mga0rr50_86467_c1 | nmdc:mga0rr50_86467_c1_657_2066 | 434 |
| 805 | 3300050515 | nmdc:mga0a205_24271_c2 | nmdc:mga0a205_24271_c2_697_2100 | 434 |
| 806 | 3300053104 | Ga0500556_0000049 | Ga0500556_0000049_6820_8169 | 434 |
| 807 | 3300053104 | Ga0500556_0000774 | Ga0500556_0000774_86_1516 | 434 |
| 808 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_126335_127684 | 434 |
| 809 | 3300053153 | Ga0500616_0001288 | Ga0500616_0001288_20451_21881 | 434 |
| 810 | 3300053730 | Ga0500645_001493 | Ga0500645_001493_1524_2873 | 434 |
| 811 | 3300060353 | Ga0501082_0022186 | Ga0501082_0022186_3909_5324 | 434 |
| 812 | 3300061734 | Ga0530510_0005973 | Ga0530510_0005973_52_1467 | 434 |
| 813 | 3300006846 | Ga0075430_100036361 | Ga0075430_1000363613 | 435 |
| 814 | 3300021384 | Ga0213876_10001849 | Ga0213876_100018496 | 435 |
| 815 | 3300021388 | Ga0213875_10001173 | Ga0213875_100011735 | 435 |
| 816 | 3300037853 | Ga0436364_1468866 | Ga0436364_1468866_5985_7352 | 435 |
| 817 | 3300038705 | Ga0237819_01482 | Ga0237819_01482_4369_5766 | 435 |
| 818 | 3300039062 | Ga0400483_221937 | Ga0400483_221937_4998_6374 | 435 |
| 819 | 3300039437 | Ga0436365_1242987 | Ga0436365_1242987_7503_8855 | 435 |
| 820 | 3300048911 | Ga0496108_0047875 | Ga0496108_0047875_127_1491 | 435 |
| 821 | 3300048925 | Ga0496122_0001187 | Ga0496122_0001187_37537_38910 | 435 |
| 822 | 3300048926 | Ga0496123_0002266 | Ga0496123_0002266_7211_8584 | 435 |
| 823 | 3300048929 | Ga0496126_0044544 | Ga0496126_0044544_1144_2517 | 435 |
| 824 | 3300050509 | nmdc:mga0qj67_13980_c1 | nmdc:mga0qj67_13980_c1_3847_5175 | 435 |
| 825 | 3300053118 | Ga0500594_0000406 | Ga0500594_0000406_4369_5730 | 435 |
| 826 | 3300005293 | Ga0065715_10000489 | Ga0065715_100004893 | 436 |
| 827 | 3300005328 | Ga0070676_10001990 | Ga0070676_1000199015 | 436 |
| 828 | 3300005331 | Ga0070670_100008096 | Ga0070670_1000080965 | 436 |
| 829 | 3300005347 | Ga0070668_100013222 | Ga0070668_1000132225 | 436 |
| 830 | 3300005353 | Ga0070669_100002352 | Ga0070669_10000235215 | 436 |
| 831 | 3300005356 | Ga0070674_100078446 | Ga0070674_1000784462 | 436 |
| 832 | 3300005367 | Ga0070667_100023369 | Ga0070667_1000233694 | 436 |
| 833 | 3300005456 | Ga0070678_100006677 | Ga0070678_1000066774 | 436 |
| 834 | 3300005457 | Ga0070662_100001233 | Ga0070662_1000012335 | 436 |
| 835 | 3300005543 | Ga0070672_100023443 | Ga0070672_1000234434 | 436 |
| 836 | 3300005564 | Ga0070664_100004570 | Ga0070664_1000045707 | 436 |
| 837 | 3300005617 | Ga0068859_100015571 | Ga0068859_1000155712 | 436 |
| 838 | 3300005719 | Ga0068861_100052353 | Ga0068861_1000523534 | 436 |
| 839 | 3300005844 | Ga0068862_100014334 | Ga0068862_1000143344 | 436 |
| 840 | 3300006847 | Ga0075431_100176581 | Ga0075431_1001765813 | 436 |
| 841 | 3300006931 | Ga0097620_100015570 | Ga0097620_1000155708 | 436 |
| 842 | 3300009094 | Ga0111539_10012292 | Ga0111539_100122924 | 436 |
| 843 | 3300014326 | Ga0157380_10006132 | Ga0157380_100061327 | 436 |
| 844 | 3300014326 | Ga0157380_10029593 | Ga0157380_100295932 | 436 |
| 845 | 3300014326 | Ga0157380_10067375 | Ga0157380_100673752 | 436 |
| 846 | 3300025315 | Ga0207697_10000845 | Ga0207697_100008454 | 436 |
| 847 | 3300025893 | Ga0207682_10000389 | Ga0207682_1000038922 | 436 |
| 848 | 3300025907 | Ga0207645_10031151 | Ga0207645_100311514 | 436 |
| 849 | 3300025923 | Ga0207681_10003001 | Ga0207681_100030012 | 436 |
| 850 | 3300025926 | Ga0207659_10006280 | Ga0207659_100062805 | 436 |
| 851 | 3300025933 | Ga0207706_10000415 | Ga0207706_1000041532 | 436 |
| 852 | 3300025937 | Ga0207669_10023944 | Ga0207669_100239444 | 436 |
| 853 | 3300025940 | Ga0207691_10001641 | Ga0207691_100016417 | 436 |
| 854 | 3300025945 | Ga0207679_10004181 | Ga0207679_100041814 | 436 |
| 855 | 3300025960 | Ga0207651_10128225 | Ga0207651_101282252 | 436 |
| 856 | 3300025972 | Ga0207668_10000996 | Ga0207668_100009962 | 436 |
| 857 | 3300025986 | Ga0207658_10015549 | Ga0207658_100155494 | 436 |
| 858 | 3300026067 | Ga0207678_10001001 | Ga0207678_1000100122 | 436 |
| 859 | 3300026067 | Ga0207678_10150185 | Ga0207678_101501852 | 436 |
| 860 | 3300026118 | Ga0207675_100060567 | Ga0207675_1000605672 | 436 |
| 861 | 3300027876 | Ga0209974_10007907 | Ga0209974_100079073 | 436 |
| 862 | 3300031824 | Ga0307413_10027278 | Ga0307413_100272783 | 436 |
| 863 | 3300031852 | Ga0307410_10038726 | Ga0307410_100387264 | 436 |
| 864 | 3300031852 | Ga0307410_10076539 | Ga0307410_100765393 | 436 |
| 865 | 3300031901 | Ga0307406_10156355 | Ga0307406_101563552 | 436 |
| 866 | 3300031911 | Ga0307412_10115500 | Ga0307412_101155002 | 436 |
| 867 | 3300031995 | Ga0307409_100091515 | Ga0307409_1000915152 | 436 |
| 868 | 3300032004 | Ga0307414_10057250 | Ga0307414_100572502 | 436 |
| 869 | 3300032004 | Ga0307414_10154727 | Ga0307414_101547272 | 436 |
| 870 | 3300032005 | Ga0307411_10089364 | Ga0307411_100893642 | 436 |
| 871 | 3300032005 | Ga0307411_10154398 | Ga0307411_101543981 | 436 |
| 872 | 3300037418 | Ga0395900_0000949 | Ga0395900_0000949_27298_28632 | 436 |
| 873 | 3300037466 | Ga0395898_0002368 | Ga0395898_0002368_8195_9532 | 436 |
| 874 | 3300037471 | Ga0395905_0000523 | Ga0395905_0000523_44777_46111 | 436 |
| 875 | 3300038443 | Ga0395901_0003263 | Ga0395901_0003263_12948_14282 | 436 |
| 876 | 3300042004 | Ga0439445_0001896 | Ga0439445_0001896_1051_2385 | 436 |
| 877 | 3300046525 | Ga0495663_0003127 | Ga0495663_0003127_1899_3233 | 436 |
| 878 | 3300046537 | Ga0495598_0007163 | Ga0495598_0007163_188_1522 | 436 |
| 879 | 3300046539 | Ga0495621_0000933 | Ga0495621_0000933_3220_4554 | 436 |
| 880 | 3300050510 | nmdc:mga06r32_146215_c1 | nmdc:mga06r32_146215_c1_740_2074 | 436 |
| 881 | 3300005293 | Ga0065715_10134850 | Ga0065715_101348502 | 437 |
| 882 | 3300005327 | Ga0070658_10023327 | Ga0070658_100233274 | 437 |
| 883 | 3300005327 | Ga0070658_10027486 | Ga0070658_100274865 | 437 |
| 884 | 3300005530 | Ga0070679_100071563 | Ga0070679_1000715635 | 437 |
| 885 | 3300025909 | Ga0207705_10020398 | Ga0207705_100203983 | 437 |
| 886 | 3300025909 | Ga0207705_10024713 | Ga0207705_100247133 | 437 |
| 887 | 3300046539 | Ga0495621_0000635 | Ga0495621_0000635_3265_4614 | 437 |
| 888 | 3300046691 | Ga0495670_0007177 | Ga0495670_0007177_1969_3318 | 437 |
| 889 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006284 | 438 |
| 890 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004790 | 438 |
| 891 | 3300031852 | Ga0307410_10015919 | Ga0307410_100159196 | 438 |
| 892 | 3300039437 | Ga0436365_1215130 | Ga0436365_1215130_59775_61118 | 438 |
| 893 | 3300039453 | Ga0436362_0094317 | Ga0436362_0094317_59775_61118 | 438 |
| 894 | 3300005331 | Ga0070670_100040151 | Ga0070670_1000401511 | 439 |
| 895 | 3300005336 | Ga0070680_100000336 | Ga0070680_10000033627 | 439 |
| 896 | 3300005578 | Ga0068854_100041361 | Ga0068854_1000413614 | 439 |
| 897 | 3300005616 | Ga0068852_100019190 | Ga0068852_1000191906 | 439 |
| 898 | 3300005985 | Ga0081539_10069354 | Ga0081539_100693542 | 439 |
| 899 | 3300009551 | Ga0105238_10124630 | Ga0105238_101246302 | 439 |
| 900 | 3300025909 | Ga0207705_10012524 | Ga0207705_100125244 | 439 |
| 901 | 3300025917 | Ga0207660_10000221 | Ga0207660_1000022129 | 439 |
| 902 | 3300025921 | Ga0207652_10112272 | Ga0207652_101122722 | 439 |
| 903 | 3300025925 | Ga0207650_10017759 | Ga0207650_100177595 | 439 |
| 904 | 3300025949 | Ga0207667_10205203 | Ga0207667_102052032 | 439 |
| 905 | 3300026142 | Ga0207698_10089425 | Ga0207698_100894252 | 439 |
| 906 | 3300031852 | Ga0307410_10069070 | Ga0307410_100690702 | 439 |
| 907 | 3300031901 | Ga0307406_10042409 | Ga0307406_100424093 | 439 |
| 908 | 3300031995 | Ga0307409_100009507 | Ga0307409_1000095076 | 439 |
| 909 | 3300031995 | Ga0307409_100042393 | Ga0307409_1000423932 | 439 |
| 910 | 3300032005 | Ga0307411_10100930 | Ga0307411_101009302 | 439 |
| 911 | 3300037312 | Ga0395899_0067809 | Ga0395899_0067809_876_2222 | 439 |
| 912 | 3300037466 | Ga0395898_0321335 | Ga0395898_0321335_78_1427 | 439 |
| 913 | 3300037471 | Ga0395905_0078393 | Ga0395905_0078393_1500_2846 | 439 |
| 914 | 3300037471 | Ga0395905_0186889 | Ga0395905_0186889_62_1408 | 439 |
| 915 | 3300038443 | Ga0395901_0304594 | Ga0395901_0304594_78_1424 | 439 |
| 916 | 3300044842 | Ga0466957_0003095 | Ga0466957_0003095_5821_7167 | 439 |
| 917 | 3300045836 | Ga0466958_0002358 | Ga0466958_0002358_6152_7498 | 439 |
| 918 | 3300045976 | Ga0466967_0004158 | Ga0466967_0004158_3946_5292 | 439 |
| 919 | 3300005327 | Ga0070658_10033937 | Ga0070658_100339372 | 440 |
| 920 | 3300005331 | Ga0070670_100001146 | Ga0070670_10000114614 | 440 |
| 921 | 3300014326 | Ga0157380_10002753 | Ga0157380_1000275313 | 440 |
| 922 | 3300025919 | Ga0207657_10007933 | Ga0207657_1000793314 | 440 |
| 923 | 3300025919 | Ga0207657_10020383 | Ga0207657_100203833 | 440 |
| 924 | 3300025925 | Ga0207650_10000537 | Ga0207650_100005378 | 440 |
| 925 | 3300026095 | Ga0207676_10154162 | Ga0207676_101541622 | 440 |
| 926 | 3300032004 | Ga0307414_10112576 | Ga0307414_101125762 | 440 |
| 927 | 3300032004 | Ga0307414_10130993 | Ga0307414_101309932 | 440 |
| 928 | 3300037312 | Ga0395899_0000165 | Ga0395899_0000165_67114_68472 | 440 |
| 929 | 3300037466 | Ga0395898_0085974 | Ga0395898_0085974_1611_2969 | 440 |
| 930 | 3300038443 | Ga0395901_0000064 | Ga0395901_0000064_121419_122777 | 440 |
| 931 | 3300005331 | Ga0070670_100028559 | Ga0070670_1000285593 | 441 |
| 932 | 3300005563 | Ga0068855_100184885 | Ga0068855_1001848853 | 441 |
| 933 | 3300005564 | Ga0070664_100110447 | Ga0070664_1001104472 | 441 |
| 934 | 3300025909 | Ga0207705_10051612 | Ga0207705_100516122 | 441 |
| 935 | 3300025912 | Ga0207707_10021925 | Ga0207707_100219253 | 441 |
| 936 | 3300025920 | Ga0207649_10060349 | Ga0207649_100603492 | 441 |
| 937 | 3300025921 | Ga0207652_10033185 | Ga0207652_100331852 | 441 |
| 938 | 3300025972 | Ga0207668_10032130 | Ga0207668_100321302 | 441 |
| 939 | 3300031548 | Ga0307408_100012825 | Ga0307408_1000128254 | 441 |
| 940 | 3300031731 | Ga0307405_10004900 | Ga0307405_100049006 | 441 |
| 941 | 3300031852 | Ga0307410_10014826 | Ga0307410_100148264 | 441 |
| 942 | 3300031901 | Ga0307406_10004114 | Ga0307406_100041145 | 441 |
| 943 | 3300031911 | Ga0307412_10004265 | Ga0307412_100042654 | 441 |
| 944 | 3300032126 | Ga0307415_100009695 | Ga0307415_1000096954 | 441 |
| 945 | 3300042144 | Ga0450889_000351 | Ga0450889_000351_2102_3523 | 441 |
| 946 | 3300045976 | Ga0466967_0044107 | Ga0466967_0044107_1751_3148 | 441 |
| 947 | 3300046664 | Ga0495659_0028770 | Ga0495659_0028770_408_1811 | 441 |
| 948 | 3300046691 | Ga0495670_0036629 | Ga0495670_0036629_31_1434 | 441 |
| 949 | 3300047445 | Ga0495677_0022018 | Ga0495677_0022018_285_1688 | 441 |
| 950 | 3300049581 | Ga0501047_0090764 | Ga0501047_0090764_1480_2892 | 441 |
| 951 | 3300050511 | nmdc:mga08y16_230153_c1 | nmdc:mga08y16_230153_c1_315_1724 | 441 |
| 952 | 3300013100 | Ga0157373_10000106 | Ga0157373_1000010624 | 442 |
| 953 | 3300025920 | Ga0207649_10000235 | Ga0207649_1000023518 | 442 |
| 954 | 3300005367 | Ga0070667_100014955 | Ga0070667_1000149556 | 443 |
| 955 | 3300005457 | Ga0070662_100126397 | Ga0070662_1001263971 | 443 |
| 956 | 3300025933 | Ga0207706_10013108 | Ga0207706_100131086 | 443 |
| 957 | 3300026067 | Ga0207678_10000804 | Ga0207678_1000080419 | 443 |
| 958 | 3300053087 | Ga0500643_003227 | Ga0500643_003227_6415_7806 | 443 |
| 959 | 3300005339 | Ga0070660_100009530 | Ga0070660_1000095306 | 444 |
| 960 | 3300005455 | Ga0070663_100008421 | Ga0070663_1000084214 | 444 |
| 961 | 3300005563 | Ga0068855_100100860 | Ga0068855_1001008603 | 444 |
| 962 | 3300005578 | Ga0068854_100000732 | Ga0068854_1000007325 | 444 |
| 963 | 3300005614 | Ga0068856_100018794 | Ga0068856_1000187946 | 444 |
| 964 | 3300005614 | Ga0068856_100189330 | Ga0068856_1001893302 | 444 |
| 965 | 3300005616 | Ga0068852_100000692 | Ga0068852_10000069210 | 444 |
| 966 | 3300005616 | Ga0068852_100008296 | Ga0068852_1000082967 | 444 |
| 967 | 3300005718 | Ga0068866_10006662 | Ga0068866_100066624 | 444 |
| 968 | 3300009093 | Ga0105240_10017423 | Ga0105240_1001742310 | 444 |
| 969 | 3300009551 | Ga0105238_10016939 | Ga0105238_100169395 | 444 |
| 970 | 3300013100 | Ga0157373_10019946 | Ga0157373_100199462 | 444 |
| 971 | 3300013100 | Ga0157373_10099310 | Ga0157373_100993102 | 444 |
| 972 | 3300013102 | Ga0157371_10008210 | Ga0157371_100082107 | 444 |
| 973 | 3300013104 | Ga0157370_10073701 | Ga0157370_100737011 | 444 |
| 974 | 3300013104 | Ga0157370_10295033 | Ga0157370_102950331 | 444 |
| 975 | 3300013105 | Ga0157369_10000202 | Ga0157369_1000020227 | 444 |
| 976 | 3300013105 | Ga0157369_10004702 | Ga0157369_100047027 | 444 |
| 977 | 3300013105 | Ga0157369_10018118 | Ga0157369_100181184 | 444 |
| 978 | 3300013105 | Ga0157369_10137587 | Ga0157369_101375872 | 444 |
| 979 | 3300013296 | Ga0157374_10001715 | Ga0157374_100017156 | 444 |
| 980 | 3300013307 | Ga0157372_10294811 | Ga0157372_102948111 | 444 |
| 981 | 3300025909 | Ga0207705_10000060 | Ga0207705_10000060102 | 444 |
| 982 | 3300025913 | Ga0207695_10030351 | Ga0207695_100303516 | 444 |
| 983 | 3300025919 | Ga0207657_10017872 | Ga0207657_100178726 | 444 |
| 984 | 3300025920 | Ga0207649_10002604 | Ga0207649_1000260410 | 444 |
| 985 | 3300025923 | Ga0207681_10071587 | Ga0207681_100715872 | 444 |
| 986 | 3300025924 | Ga0207694_10039585 | Ga0207694_100395852 | 444 |
| 987 | 3300025933 | Ga0207706_10033035 | Ga0207706_100330354 | 444 |
| 988 | 3300025944 | Ga0207661_10172414 | Ga0207661_101724142 | 444 |
| 989 | 3300025949 | Ga0207667_10031541 | Ga0207667_100315416 | 444 |
| 990 | 3300025981 | Ga0207640_10003091 | Ga0207640_100030912 | 444 |
| 991 | 3300026067 | Ga0207678_10028782 | Ga0207678_100287823 | 444 |
| 992 | 3300026078 | Ga0207702_10011107 | Ga0207702_100111072 | 444 |
| 993 | 3300026078 | Ga0207702_10024721 | Ga0207702_100247216 | 444 |
| 994 | 3300026142 | Ga0207698_10001333 | Ga0207698_100013332 | 444 |
| 995 | 3300026142 | Ga0207698_10021331 | Ga0207698_100213315 | 444 |
| 996 | 3300037312 | Ga0395899_0016202 | Ga0395899_0016202_896_2272 | 444 |
| 997 | 3300037312 | Ga0395899_0159151 | Ga0395899_0159151_117_1493 | 444 |
| 998 | 3300037418 | Ga0395900_0042970 | Ga0395900_0042970_123_1499 | 444 |
| 999 | 3300037418 | Ga0395900_0047787 | Ga0395900_0047787_2144_3520 | 444 |
| 1000 | 3300037418 | Ga0395900_0050318 | Ga0395900_0050318_495_1871 | 444 |
| 1001 | 3300037466 | Ga0395898_0015228 | Ga0395898_0015228_1231_2607 | 444 |
| 1002 | 3300038443 | Ga0395901_0016805 | Ga0395901_0016805_618_1994 | 444 |
| 1003 | 3300044684 | Ga0466966_0013163 | Ga0466966_0013163_2097_3470 | 444 |
| 1004 | 3300044693 | Ga0466961_0017719 | Ga0466961_0017719_536_1909 | 444 |
| 1005 | 3300044842 | Ga0466957_0005423 | Ga0466957_0005423_4925_6298 | 444 |
| 1006 | 3300045049 | Ga0466959_0010147 | Ga0466959_0010147_4329_5702 | 444 |
| 1007 | 3300045836 | Ga0466958_0001266 | Ga0466958_0001266_6033_7406 | 444 |
| 1008 | 3300061719 | Ga0466962_0026280 | Ga0466962_0026280_74_1447 | 444 |
| 1009 | 3300053108 | Ga0500562_001824 | Ga0500562_001824_3107_4570 | 445 |
| 1010 | 3300001904 | JGI24736J21556_1003493 | JGI24736J21556_10034934 | 452 |
| 1011 | 3300001979 | JGI24740J21852_10026448 | JGI24740J21852_100264482 | 452 |
| 1012 | 3300005578 | Ga0068854_100005086 | Ga0068854_1000050866 | 452 |
| 1013 | 3300025981 | Ga0207640_10005800 | Ga0207640_100058005 | 452 |
| 1014 | 3300026078 | Ga0207702_10008523 | Ga0207702_100085237 | 452 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oqy-assembly1.cif.gz_B | streptomyces sp. gf3546 imine reductase | 0.9815 | 4 | 30 |
| 4oqy-assembly1.cif.gz_A | streptomyces sp. gf3546 imine reductase | 0.9807 | 4 | 30 |
| 4zn0-assembly2.cif.gz_B | structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei | 0.9791 | 3 | 30 |
| 8i4n-assembly1.cif.gz_B | crystal strcuture of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum | 0.9765 | 3 | 31 |
| 8eei-assembly1.cif.gz_B | unbound c. ammoniagenes monoamine oxidase (mao) | 0.9754 | 5 | 30 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN19_146_269_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 1.001 | 5 | 30 | 3.50.50.60 |
| af_P37127_327_452_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9961 | 5 | 31 | 3.50.50.60 |
| 4oqyB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9815 | 4 | 30 | 3.40.50.720 |
| af_Q46811_547_618_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.979 | 6 | 32 | 3.40.50.720 |
| af_Q2FYG1_1_188_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9774 | 5 | 30 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530GM07-F1-model_v4 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase TrmFO | 0.9734 | 163 | 314 |
GO:0002098
GO:0005829 GO:0008168 GO:0030488 GO:0050660 |
| AF-A0A2V9ZTW9-F1-model_v4 | Methylenetetrahydrofolate--tRNA-(Uracil(54)-C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO | 0.9699 | 159 | 314 |
GO:0008168
GO:0032259 |
| AF-A0A0F2R944-F1-model_v4 | Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) | 0.9676 | 5 | 440 |
GO:0002098
GO:0005829 GO:0030488 GO:0047151 GO:0050660 |
| AF-A5G7S3-F1-model_v4 | Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) | 0.967 | 5 | 438 |
GO:0002098
GO:0005829 GO:0030488 GO:0047151 GO:0050660 |
| AF-A0A7V7BZ01-F1-model_v4 | Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (EC 2.1.1.74) (Folate-dependent tRNA (uracil-5-)-methyltransferase) (Folate-dependent tRNA(M-5-U54)-methyltransferase) | 0.967 | 5 | 436 |
GO:0002098
GO:0005829 GO:0030488 GO:0047151 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar