F488035

General Info

Members Datasets Scaffolds Average Seq Length
1007 431 992 311

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10019811|Ga0157369_100198112
Length 340
Sequence LGGHELRYPLIAPRPAPAGVFMPFAFVFPGQGSQSIGMMAKLAASGPVIRETFDEASAVLGYDLWQVVENGPAEKLNSTEVTQPAMLAAGIATWRLWQQRDGARPSVVAGHSLGEFTALVCAEALDFGPAIDLVRFRGKVMQEAAPAGTGAMAAVLGLSEADIELACREAAQGEVVQAVNFNSPGQIVIAGHAGAVQRAIEAAKARGAKRAVLLALSVPSHSSLMQPAAKRLEERLADIELRTPRIRYVSAVDAAAHQAPEDIRALLVRQVASPVRWTDTVTALAGNDISAVIECGPGKVLMGLSRRIVQREGLTYMALEDPDSVTAALAASAPGGAAHA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
8 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
9 2818991436 Collimonas arenae 515 Isolate Unclassified
10 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
11 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
12 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
127 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
192 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
233 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
234 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
248 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
249 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
250 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
251 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
252 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
253 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
257 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
258 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
261 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
283 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
287 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
340 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
352 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
353 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
354 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
386 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
387 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
416 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
417 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
418 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
425 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
430 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
431 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 1.39
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0.1
Rhizoplane 2.78
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004435 3300002705 Bacteria 4274
2 JGI25162J39368_1000036 3300002737 Bacteria 180433
3 JGI25154J39366_1002733 3300002738 Bacteria 4282
4 JGI25150J39212_1005125 3300002774 Bacteria 2829
5 JGI25165J46597_1000022 3300003214 Bacteria 357959
6 rootL2_10014064 3300003322 Bacteria 12412
7 rootL2_10091680 3300003322 Bacteria 3922
8 Ga0007410J51695_1012750 3300003574 Bacteria 9424
9 Ga0007409J51694_1006362 3300003575 Bacteria 11752
10 Ga0007416J51690_1012585 3300003577 Bacteria 9861
11 Ga0032354_1023937 3300003693 Bacteria 8937
12 Ga0055538_1000011 3300003751 Bacteria 357959
13 Ga0055539_1000016 3300003752 Bacteria 358248
14 Ga0055533_1000019 3300003756 Bacteria 357959
15 Ga0055525_1000001 3300003759 Bacteria 1016948
16 Ga0055525_1000042 3300003759 Bacteria 279804
17 Ga0055542_1010239 3300003762 Bacteria 1723
18 Ga0055541_1000017 3300003841 Bacteria 286811
19 Ga0065707_10082492 3300005295 Bacteria 14544
20 Ga0070676_10102203 3300005328 Bacteria 1773
21 Ga0070683_100016811 3300005329 Bacteria 6455
22 Ga0070670_100000001 3300005331 Bacteria 728788
23 Ga0070670_100025491 3300005331 Bacteria 5086
24 Ga0070670_100127161 3300005331 Bacteria 2200
25 Ga0068869_100040075 3300005334 Bacteria 3347
26 Ga0068869_100087511 3300005334 Bacteria 2337
27 Ga0068869_100182469 3300005334 Bacteria 1646
28 Ga0068869_100450708 3300005334 Bacteria 1066
29 Ga0070666_10015694 3300005335 Bacteria 4834
30 Ga0070666_10036180 3300005335 Bacteria 3275
31 Ga0070666_10049131 3300005335 Bacteria 2834
32 Ga0070680_100026542 3300005336 Bacteria 4632
33 Ga0070680_100085042 3300005336 Bacteria 2613
34 Ga0070682_100003924 3300005337 Bacteria 8253
35 Ga0070660_100014318 3300005339 Bacteria 5713
36 Ga0070660_100041122 3300005339 Bacteria 3522
37 Ga0070689_100008006 3300005340 Bacteria 7417
38 Ga0070689_100016914 3300005340 Bacteria 5345
39 Ga0070687_100160380 3300005343 Bacteria 1329
40 Ga0070661_100000813 3300005344 Bacteria 22437
41 Ga0070661_100036959 3300005344 Bacteria 3551
42 Ga0070661_100175855 3300005344 Bacteria 1627
43 Ga0070668_100023143 3300005347 Bacteria 4696
44 Ga0070669_100046626 3300005353 Bacteria 3161
45 Ga0070669_100164633 3300005353 Bacteria 1725
46 Ga0070675_100024523 3300005354 Bacteria 4830
47 Ga0070675_100031692 3300005354 Bacteria 4276
48 Ga0070675_100057275 3300005354 Bacteria 3212
49 Ga0070675_100177229 3300005354 Bacteria 1841
50 Ga0070671_100000018 3300005355 Bacteria 147427
51 Ga0070671_100010483 3300005355 Bacteria 7437
52 Ga0070674_100003565 3300005356 Bacteria 8749
53 Ga0070674_100013910 3300005356 Bacteria 4989
54 Ga0070673_100060284 3300005364 Bacteria 3006
55 Ga0070688_100004521 3300005365 Bacteria 7253
56 Ga0070688_100099691 3300005365 Bacteria 1913
57 Ga0070659_100053692 3300005366 Bacteria 3172
58 Ga0070659_100070043 3300005366 Bacteria 2785
59 Ga0070667_100000026 3300005367 Bacteria 183244
60 Ga0070667_100020275 3300005367 Bacteria 5519
61 Ga0070667_100049400 3300005367 Bacteria 3543
62 Ga0070667_100247902 3300005367 Bacteria 1592
63 Ga0070713_100212468 3300005436 Bacteria 1752
64 Ga0070713_100230531 3300005436 Bacteria 1683
65 Ga0070701_10052915 3300005438 Bacteria 2111
66 Ga0070701_10058065 3300005438 Bacteria 2030
67 Ga0070705_100009205 3300005440 Bacteria 4905
68 Ga0070663_100079890 3300005455 Bacteria 2401
69 Ga0070663_100240090 3300005455 Bacteria 1430
70 Ga0070678_100025418 3300005456 Bacteria 3983
71 Ga0070662_100014371 3300005457 Bacteria 5287
72 Ga0070662_100038172 3300005457 Bacteria 3410
73 Ga0070681_10005499 3300005458 Bacteria 12241
74 Ga0070681_10229940 3300005458 Bacteria 1769
75 Ga0068867_100005237 3300005459 Bacteria 9153
76 Ga0068867_100032317 3300005459 Bacteria 3784
77 Ga0068867_100034852 3300005459 Bacteria 3649
78 Ga0068867_100113656 3300005459 Bacteria 2084
79 Ga0070685_10000007 3300005466 Bacteria 180539
80 Ga0070685_10159859 3300005466 Bacteria 1435
81 Ga0070706_100140325 3300005467 Bacteria 2256
82 Ga0070679_100008554 3300005530 Bacteria 9641
83 Ga0070679_100046729 3300005530 Bacteria 4316
84 Ga0070679_100422533 3300005530 Bacteria 1278
85 Ga0070684_100005117 3300005535 Bacteria 10018
86 Ga0068853_100099084 3300005539 Bacteria 2574
87 Ga0070672_100019627 3300005543 Bacteria 4910
88 Ga0070672_100034611 3300005543 Bacteria 3835
89 Ga0070672_100118028 3300005543 Bacteria 2169
90 Ga0070672_100308130 3300005543 Bacteria 1343
91 Ga0070686_100009512 3300005544 Bacteria 5465
92 Ga0070686_100027798 3300005544 Bacteria 3425
93 Ga0070696_100031637 3300005546 Bacteria 3627
94 Ga0070696_100087225 3300005546 Bacteria 2217
95 Ga0070665_100044195 3300005548 Bacteria 4474
96 Ga0070665_100068997 3300005548 Bacteria 3543
97 Ga0070665_100567097 3300005548 Bacteria 1148
98 Ga0070704_100032448 3300005549 Bacteria 3523
99 Ga0070704_100135283 3300005549 Bacteria 1916
100 Ga0070704_100321259 3300005549 Bacteria 1297
101 Ga0068855_100008719 3300005563 Bacteria 12260
102 Ga0068855_100031837 3300005563 Bacteria 6296
103 Ga0068855_100220292 3300005563 Bacteria 2128
104 Ga0070664_100012001 3300005564 Bacteria 7036
105 Ga0070664_100014812 3300005564 Bacteria 6365
106 Ga0070664_100065531 3300005564 Bacteria 3099
107 Ga0070664_100216824 3300005564 Bacteria 1711
108 Ga0068857_100006850 3300005577 Bacteria 9807
109 Ga0068857_100140938 3300005577 Bacteria 2179
110 Ga0068857_100396467 3300005577 Bacteria 1284
111 Ga0068857_100463351 3300005577 Bacteria 1186
112 Ga0068854_100005152 3300005578 Bacteria 8239
113 Ga0068856_100016323 3300005614 Bacteria 7186
114 Ga0068856_100092120 3300005614 Bacteria 3015
115 Ga0070702_100017140 3300005615 Bacteria 3730
116 Ga0068852_100001206 3300005616 Bacteria 17155
117 Ga0068852_100095514 3300005616 Bacteria 2669
118 Ga0068859_100001745 3300005617 Bacteria 22159
119 Ga0068859_100007685 3300005617 Bacteria 10950
120 Ga0068859_100080974 3300005617 Bacteria 3289
121 Ga0068859_100115963 3300005617 Bacteria 2743
122 Ga0068859_100150062 3300005617 Bacteria 2406
123 Ga0068859_100223012 3300005617 Bacteria 1973
124 Ga0068864_100000012 3300005618 Bacteria 335070
125 Ga0068864_100037858 3300005618 Bacteria 4118
126 Ga0068866_10150941 3300005718 Bacteria 1345
127 Ga0068861_100000962 3300005719 Bacteria 17544
128 Ga0068861_100074083 3300005719 Bacteria 2647
129 Ga0068861_100101784 3300005719 Bacteria 2286
130 Ga0068861_100208178 3300005719 Bacteria 1646
131 Ga0068861_100335508 3300005719 Bacteria 1322
132 Ga0068863_100008065 3300005841 Bacteria 10283
133 Ga0068863_100017541 3300005841 Bacteria 6862
134 Ga0068858_100001018 3300005842 Bacteria 28907
135 Ga0068858_100016226 3300005842 Bacteria 6997
136 Ga0068858_100017352 3300005842 Bacteria 6752
137 Ga0068858_100428549 3300005842 Bacteria 1272
138 Ga0068860_100004168 3300005843 Bacteria 14825
139 Ga0068860_100007832 3300005843 Bacteria 10665
140 Ga0068862_100001146 3300005844 Bacteria 25101
141 Ga0068862_100033113 3300005844 Bacteria 4366
142 Ga0068862_100036344 3300005844 Bacteria 4176
143 Ga0068862_100209238 3300005844 Bacteria 1762
144 Ga0075363_100002122 3300006048 Bacteria 7961
145 Ga0075367_10013597 3300006178 Bacteria 4381
146 Ga0075369_10064583 3300006186 Bacteria 1603
147 Ga0075366_10123535 3300006195 Bacteria 1560
148 Ga0097621_100068678 3300006237 Bacteria 2924
149 Ga0068871_100100355 3300006358 Bacteria 2424
150 Ga0075430_100011821 3300006846 Bacteria 7428
151 Ga0075431_100035076 3300006847 Bacteria 5167
152 Ga0075431_100104471 3300006847 Bacteria 2923
153 Ga0068865_100008565 3300006881 Bacteria 6322
154 Ga0068865_100023560 3300006881 Bacteria 4032
155 Ga0068865_100278869 3300006881 Bacteria 1330
156 Ga0097620_100001745 3300006931 Bacteria 22159
157 Ga0097620_100007685 3300006931 Bacteria 10950
158 Ga0097620_100080966 3300006931 Bacteria 3289
159 Ga0097620_100115964 3300006931 Bacteria 2743
160 Ga0097620_100150062 3300006931 Bacteria 2406
161 Ga0097620_100223007 3300006931 Bacteria 1973
162 Ga0099795_10000014 3300007788 Bacteria 67566
163 Ga0105240_10019812 3300009093 Bacteria 8986
164 Ga0105240_10038598 3300009093 Bacteria 6124
165 Ga0105240_10059153 3300009093 Bacteria 4783
166 Ga0105240_10328511 3300009093 Bacteria 1741
167 Ga0111539_10012880 3300009094 Bacteria 10466
168 Ga0111539_10429433 3300009094 Bacteria 1538
169 Ga0105247_10001941 3300009101 Bacteria 14376
170 Ga0105247_10018455 3300009101 Bacteria 4184
171 Ga0105247_10202911 3300009101 Bacteria 1333
172 Ga0105243_10216785 3300009148 Bacteria 1689
173 Ga0105241_10044133 3300009174 Bacteria 3377
174 Ga0105241_10082865 3300009174 Bacteria 2515
175 Ga0105242_10030398 3300009176 Bacteria 4313
176 Ga0105242_10045340 3300009176 Bacteria 3563
177 Ga0105242_10054998 3300009176 Bacteria 3255
178 Ga0105248_10123619 3300009177 Bacteria 2919
179 Ga0105248_10263891 3300009177 Bacteria 1939
180 Ga0105237_10023342 3300009545 Bacteria 6339
181 Ga0105237_10310823 3300009545 Bacteria 1579
182 Ga0105238_10003217 3300009551 Bacteria 16314
183 Ga0105238_10049013 3300009551 Bacteria 4255
184 Ga0105238_10371117 3300009551 Bacteria 1421
185 Ga0105249_10070890 3300009553 Bacteria 3218
186 Ga0105249_10086586 3300009553 Bacteria 2922
187 Ga0105249_10103644 3300009553 Bacteria 2680
188 Ga0105249_10263908 3300009553 Bacteria 1712
189 Ga0099796_10000054 3300010159 Bacteria 20546
190 Ga0157373_10006638 3300013100 Bacteria 8623
191 Ga0157371_10000078 3300013102 Bacteria 154095
192 Ga0157370_10031830 3300013104 Bacteria 5156
193 Ga0157369_10001598 3300013105 Bacteria 27722
194 Ga0157369_10004689 3300013105 Bacteria 16077
195 Ga0157369_10019811 3300013105 Bacteria 7529
196 Ga0157374_10265654 3300013296 Bacteria 1691
197 Ga0157378_10012175 3300013297 Bacteria 7532
198 Ga0163162_10002139 3300013306 Bacteria 18531
199 Ga0163162_10012636 3300013306 Bacteria 8244
200 Ga0163162_10021561 3300013306 Bacteria 6346
201 Ga0163162_10033867 3300013306 Bacteria 5079
202 Ga0157372_10020911 3300013307 Bacteria 7064
203 Ga0157372_10124114 3300013307 Bacteria 2968
204 Ga0157372_10651454 3300013307 Bacteria 1226
205 Ga0157375_10088560 3300013308 Bacteria 3151
206 Ga0157375_10160315 3300013308 Bacteria 2391
207 Ga0157375_10171726 3300013308 Bacteria 2316
208 Ga0157375_10310817 3300013308 Bacteria 1740
209 Ga0163163_10000051 3300014325 Bacteria 128275
210 Ga0163163_10089960 3300014325 Bacteria 3083
211 Ga0163163_10144606 3300014325 Bacteria 2421
212 Ga0157380_10020523 3300014326 Bacteria 4939
213 Ga0157380_10080085 3300014326 Bacteria 2669
214 Ga0157380_10189332 3300014326 Bacteria 1815
215 Ga0182008_10103316 3300014497 Bacteria 1409
216 Ga0182008_10117790 3300014497 Bacteria 1318
217 Ga0157379_10006122 3300014968 Bacteria 10357
218 Ga0157379_10034926 3300014968 Bacteria 4482
219 Ga0157379_10247486 3300014968 Bacteria 1618
220 Ga0157379_10704311 3300014968 Bacteria 948
221 Ga0157376_10222159 3300014969 Bacteria 1750
222 Ga0157376_10396632 3300014969 Bacteria 1333
223 Ga0182006_1010763 3300015261 Bacteria 4051
224 Ga0182007_10021648 3300015262 Bacteria 2279
225 Ga0182005_1000307 3300015265 Bacteria 29530
226 Ga0163161_10012670 3300017792 Bacteria 5856
227 Ga0163161_10165647 3300017792 Bacteria 1687
228 Ga0213872_10000263 3300021361 Bacteria 45483
229 Ga0213872_10001047 3300021361 Bacteria 19247
230 Ga0213872_10011598 3300021361 Bacteria 4166
231 Ga0213872_10012586 3300021361 Bacteria 3979
232 Ga0213874_10066299 3300021377 Unclassified 1142
233 Ga0213876_10107712 3300021384 Bacteria 1479
234 Ga0209435_100716 3300025206 Bacteria 5582
235 Ga0209784_100019 3300025224 Bacteria 453558
236 Ga0209566_100017 3300025225 Bacteria 453558
237 Ga0209674_100031 3300025226 Bacteria 453558
238 Ga0209672_106450 3300025228 Bacteria 1903
239 Ga0209563_100007 3300025230 Bacteria 1579402
240 Ga0209563_100035 3300025230 Bacteria 453558
241 Ga0207427_100255 3300025231 Bacteria 41856
242 Ga0209437_100038 3300025233 Bacteria 453558
243 Ga0207425_1001639 3300025245 Bacteria 9024
244 Ga0209646_1000872 3300025246 Bacteria 10050
245 Ga0209026_1003950 3300025250 Bacteria 4633
246 Ga0209677_100020 3300025253 Bacteria 453558
247 Ga0209148_1000992 3300025254 Bacteria 18267
248 Ga0209759_1000359 3300025256 Bacteria 58766
249 Ga0209233_1000049 3300025261 Bacteria 453558
250 Ga0209025_1016263 3300025294 Bacteria 4408
251 Ga0209758_1002044 3300025297 Bacteria 21637
252 Ga0207682_10000363 3300025893 Bacteria 20824
253 Ga0207682_10000537 3300025893 Bacteria 17474
254 Ga0207682_10004847 3300025893 Bacteria 5566
255 Ga0207642_10030040 3300025899 Bacteria 2258
256 Ga0207642_10081710 3300025899 Bacteria 1571
257 Ga0207710_10000230 3300025900 Bacteria 48621
258 Ga0207710_10070795 3300025900 Bacteria 1599
259 Ga0207680_10004217 3300025903 Bacteria 6806
260 Ga0207680_10041684 3300025903 Bacteria 2681
261 Ga0207645_10000178 3300025907 Bacteria 50810
262 Ga0207645_10008955 3300025907 Bacteria 6949
263 Ga0207645_10144605 3300025907 Bacteria 1550
264 Ga0207643_10020654 3300025908 Bacteria 3615
265 Ga0207643_10035424 3300025908 Bacteria 2799
266 Ga0207643_10174565 3300025908 Bacteria 1298
267 Ga0207705_10023618 3300025909 Bacteria 4386
268 Ga0207654_10280643 3300025911 Bacteria 1127
269 Ga0207707_10024558 3300025912 Bacteria 5275
270 Ga0207707_10045689 3300025912 Bacteria 3816
271 Ga0207695_10018572 3300025913 Bacteria 8033
272 Ga0207695_10032578 3300025913 Bacteria 5700
273 Ga0207695_10073110 3300025913 Bacteria 3495
274 Ga0207695_10109895 3300025913 Bacteria 2738
275 Ga0207695_10235923 3300025913 Bacteria 1732
276 Ga0207671_10182076 3300025914 Bacteria 1635
277 Ga0207660_10027094 3300025917 Bacteria 3907
278 Ga0207660_10094123 3300025917 Bacteria 2227
279 Ga0207662_10015635 3300025918 Bacteria 4272
280 Ga0207662_10109919 3300025918 Bacteria 1718
281 Ga0207657_10019066 3300025919 Bacteria 6527
282 Ga0207657_10037258 3300025919 Bacteria 4344
283 Ga0207649_10000924 3300025920 Bacteria 18501
284 Ga0207649_10035200 3300025920 Bacteria 3008
285 Ga0207652_10375354 3300025921 Bacteria 1284
286 Ga0207694_10003088 3300025924 Bacteria 13330
287 Ga0207694_10015470 3300025924 Bacteria 5754
288 Ga0207694_10040729 3300025924 Bacteria 3578
289 Ga0207694_10260318 3300025924 Bacteria 1421
290 Ga0207650_10000002 3300025925 Bacteria 1439222
291 Ga0207650_10123907 3300025925 Bacteria 2015
292 Ga0207659_10036008 3300025926 Bacteria 3425
293 Ga0207659_10413336 3300025926 Bacteria 1130
294 Ga0207700_10135931 3300025928 Bacteria 2014
295 Ga0207700_10247189 3300025928 Bacteria 1522
296 Ga0207664_10015733 3300025929 Bacteria 5501
297 Ga0207644_10000026 3300025931 Bacteria 147255
298 Ga0207644_10001003 3300025931 Bacteria 18047
299 Ga0207644_10036298 3300025931 Bacteria 3459
300 Ga0207644_10150659 3300025931 Bacteria 1799
301 Ga0207706_10000721 3300025933 Bacteria 34533
302 Ga0207706_10007741 3300025933 Bacteria 9917
303 Ga0207706_10023309 3300025933 Bacteria 5560
304 Ga0207706_10070140 3300025933 Bacteria 3082
305 Ga0207686_10049440 3300025934 Bacteria 2610
306 Ga0207686_10076906 3300025934 Bacteria 2166
307 Ga0207709_10040362 3300025935 Bacteria 2794
308 Ga0207669_10100246 3300025937 Bacteria 1912
309 Ga0207704_10020566 3300025938 Bacteria 3495
310 Ga0207691_10003757 3300025940 Bacteria 14732
311 Ga0207691_10007249 3300025940 Bacteria 10697
312 Ga0207691_10032022 3300025940 Bacteria 4905
313 Ga0207691_10058407 3300025940 Bacteria 3509
314 Ga0207691_10092587 3300025940 Bacteria 2707
315 Ga0207691_10191110 3300025940 Bacteria 1785
316 Ga0207711_10000279 3300025941 Bacteria 55112
317 Ga0207689_10012093 3300025942 Bacteria 7391
318 Ga0207689_10043003 3300025942 Bacteria 3735
319 Ga0207689_10100862 3300025942 Bacteria 2371
320 Ga0207689_10185344 3300025942 Bacteria 1716
321 Ga0207679_10004443 3300025945 Bacteria 8736
322 Ga0207679_10066044 3300025945 Bacteria 2709
323 Ga0207679_10069762 3300025945 Bacteria 2646
324 Ga0207679_10159090 3300025945 Bacteria 1847
325 Ga0207679_10167752 3300025945 Bacteria 1804
326 Ga0207667_10013878 3300025949 Bacteria 9203
327 Ga0207667_10019236 3300025949 Bacteria 7634
328 Ga0207651_10543326 3300025960 Bacteria 1009
329 Ga0207668_10220837 3300025972 Bacteria 1522
330 Ga0207640_10207290 3300025981 Bacteria 1490
331 Ga0207658_10000001 3300025986 Bacteria 1439333
332 Ga0207658_10021308 3300025986 Bacteria 4497
333 Ga0207658_10048303 3300025986 Bacteria 3120
334 Ga0207703_10000931 3300026035 Bacteria 28414
335 Ga0207703_10001837 3300026035 Bacteria 18926
336 Ga0207703_10026533 3300026035 Bacteria 4560
337 Ga0207678_10028049 3300026067 Bacteria 4917
338 Ga0207678_10046744 3300026067 Bacteria 3743
339 Ga0207678_10155218 3300026067 Bacteria 1954
340 Ga0207708_10003301 3300026075 Bacteria 11873
341 Ga0207708_10106735 3300026075 Bacteria 2172
342 Ga0207702_10003782 3300026078 Bacteria 13659
343 Ga0207641_10002241 3300026088 Bacteria 18054
344 Ga0207641_10416560 3300026088 Bacteria 1292
345 Ga0207641_10416561 3300026088 Bacteria 1292
346 Ga0207648_10001407 3300026089 Bacteria 26493
347 Ga0207648_10036960 3300026089 Bacteria 4302
348 Ga0207648_10307240 3300026089 Bacteria 1423
349 Ga0207676_10000001 3300026095 Bacteria 1439222
350 Ga0207676_10005269 3300026095 Bacteria 9154
351 Ga0207676_10008269 3300026095 Bacteria 7399
352 Ga0207674_10000536 3300026116 Bacteria 49766
353 Ga0207674_10083098 3300026116 Bacteria 3202
354 Ga0207674_10260873 3300026116 Bacteria 1680
355 Ga0207674_10281293 3300026116 Bacteria 1612
356 Ga0207675_100000345 3300026118 Bacteria 44273
357 Ga0207675_100001625 3300026118 Bacteria 22527
358 Ga0207675_100009265 3300026118 Bacteria 9232
359 Ga0207675_100010996 3300026118 Bacteria 8479
360 Ga0207675_100012530 3300026118 Bacteria 7920
361 Ga0207675_100105310 3300026118 Bacteria 2658
362 Ga0207675_100276354 3300026118 Bacteria 1631
363 Ga0207675_100287270 3300026118 Bacteria 1599
364 Ga0207683_10034525 3300026121 Bacteria 4395
365 Ga0207683_10047615 3300026121 Bacteria 3754
366 Ga0207683_10064063 3300026121 Bacteria 3239
367 Ga0207698_10012426 3300026142 Bacteria 5571
368 Ga0207698_10057160 3300026142 Bacteria 3016
369 Ga0209179_1000013 3300027512 Bacteria 62144
370 Ga0265354_1000774 3300028016 Bacteria 5204
371 Ga0265356_1002312 3300028017 Bacteria 2570
372 Ga0268266_10001083 3300028379 Bacteria 34130
373 Ga0268266_10004153 3300028379 Bacteria 13973
374 Ga0268266_10047347 3300028379 Bacteria 3683
375 Ga0268266_10409662 3300028379 Bacteria 1283
376 Ga0268265_10001823 3300028380 Bacteria 17029
377 Ga0268265_10025833 3300028380 Bacteria 4174
378 Ga0268265_10284555 3300028380 Bacteria 1481
379 Ga0268264_10000061 3300028381 Bacteria 303123
380 Ga0268264_10000179 3300028381 Bacteria 134401
381 Ga0268264_10027283 3300028381 Bacteria 4664
382 Ga0265319_1020051 3300028563 Bacteria 2486
383 Ga0265334_10000127 3300028573 Bacteria 48527
384 Ga0265318_10000024 3300028577 Bacteria 159801
385 Ga0307515_10299892 3300028794 Bacteria 1293
386 Ga0265338_10010433 3300028800 Bacteria 10893
387 Ga0265338_10028206 3300028800 Bacteria 5605
388 Ga0307511_10000040 3300030521 Bacteria 102640
389 Ga0265770_1000354 3300030878 Bacteria 6250
390 Ga0265330_10003907 3300031235 Bacteria 7664
391 Ga0265328_10010066 3300031239 Bacteria 3822
392 Ga0265320_10005045 3300031240 Bacteria 8549
393 Ga0265325_10005133 3300031241 Bacteria 8144
394 Ga0265340_10045334 3300031247 Bacteria 2148
395 Ga0265339_10023115 3300031249 Bacteria 3596
396 Ga0265331_10005948 3300031250 Bacteria 7282
397 Ga0265327_10000014 3300031251 Bacteria 506288
398 Ga0265316_10024185 3300031344 Bacteria 5096
399 Ga0307513_10040878 3300031456 Bacteria 5123
400 Ga0307513_10063236 3300031456 Bacteria 3906
401 Ga0307513_10175972 3300031456 Bacteria 2010
402 Ga0307509_10001628 3300031507 Bacteria 37634
403 Ga0307509_10170332 3300031507 Bacteria 2058
404 Ga0307509_10176859 3300031507 Bacteria 2005
405 Ga0307509_10199032 3300031507 Bacteria 1843
406 Ga0307408_100001210 3300031548 Bacteria 19453
407 Ga0265313_10004752 3300031595 Bacteria 10242
408 Ga0307508_10074771 3300031616 Bacteria 2965
409 Ga0307514_10091103 3300031649 Bacteria 2222
410 Ga0316575_10018347 3300031665 Bacteria 2666
411 Ga0265314_10001695 3300031711 Bacteria 23953
412 Ga0265342_10068460 3300031712 Bacteria 2074
413 Ga0316576_10022743 3300031727 Bacteria 4357
414 Ga0316578_10003631 3300031728 Bacteria 7109
415 Ga0316578_10024545 3300031728 Bacteria 3382
416 Ga0316577_10001334 3300031733 Bacteria 11567
417 Ga0316577_10009802 3300031733 Bacteria 5162
418 Ga0307413_10001755 3300031824 Bacteria 8486
419 Ga0307410_10003357 3300031852 Bacteria 8019
420 Ga0307410_10004428 3300031852 Bacteria 7260
421 Ga0307407_10004906 3300031903 Bacteria 5743
422 Ga0307407_10005254 3300031903 Bacteria 5596
423 Ga0307409_100002705 3300031995 Bacteria 9350
424 Ga0307409_100007342 3300031995 Bacteria 6585
425 Ga0307416_100070648 3300032002 Bacteria 2896
426 Ga0307411_10010509 3300032005 Bacteria 4939
427 Ga0307415_100090684 3300032126 Bacteria 2212
428 Ga0307415_100139537 3300032126 Bacteria 1849
429 Ga0316583_10028218 3300032133 Bacteria 2002
430 Ga0316585_10000956 3300032137 Bacteria 7410
431 Ga0316580_10022804 3300032139 Bacteria 1932
432 Ga0316593_10000472 3300032168 Bacteria 7413
433 Ga0316593_10003014 3300032168 Bacteria 4104
434 Ga0316593_10031252 3300032168 Bacteria 1734
435 Ga0307510_10000013 3300033180 Bacteria 274569
436 Ga0307510_10010455 3300033180 Bacteria 11024
437 Ga0316592_1000192 3300033524 Bacteria 7310
438 Ga0316596_1000369 3300033541 Bacteria 7411
439 Ga0316596_1002070 3300033541 Bacteria 4227
440 Ga0373936_0015718 3300035113 Bacteria 2902
441 Ga0316574_0007763 3300035398 Bacteria 5905
442 Ga0316574_0021798 3300035398 Bacteria 3807
443 Ga0316574_0023127 3300035398 Bacteria 3708
444 Ga0316582_0017047 3300036647 Bacteria 4191
445 Ga0316582_0033533 3300036647 Bacteria 3155
446 Ga0316584_0005374 3300036712 Bacteria 8593
447 Ga0316584_0029740 3300036712 Bacteria 4033
448 Ga0395899_0000128 3300037312 Bacteria 119014
449 Ga0395899_0000904 3300037312 Bacteria 27911
450 Ga0395899_0002101 3300037312 Bacteria 16364
451 Ga0395899_0036149 3300037312 Bacteria 3706
452 Ga0395900_0000874 3300037418 Bacteria 39520
453 Ga0395900_0036284 3300037418 Bacteria 5082
454 Ga0395900_0050571 3300037418 Bacteria 4280
455 Ga0395900_0062747 3300037418 Bacteria 3819
456 Ga0395900_0163739 3300037418 Bacteria 2267
457 Ga0395900_0322603 3300037418 Bacteria 1524
458 Ga0395898_0003704 3300037466 Bacteria 16960
459 Ga0395898_0039391 3300037466 Bacteria 4677
460 Ga0395898_0154334 3300037466 Bacteria 2196
461 Ga0395898_0157087 3300037466 Bacteria 2175
462 Ga0395898_0160048 3300037466 Bacteria 2153
463 Ga0395898_0207310 3300037466 Bacteria 1870
464 Ga0395905_0009571 3300037471 Bacteria 9461
465 Ga0395905_0010272 3300037471 Bacteria 9114
466 Ga0395905_0075118 3300037471 Bacteria 3167
467 Ga0395905_0242584 3300037471 Bacteria 1684
468 Ga0395905_0295595 3300037471 Bacteria 1506
469 Ga0395901_0000054 3300038443 Bacteria 160505
470 Ga0395901_0003565 3300038443 Bacteria 15697
471 Ga0395901_0127852 3300038443 Bacteria 2671
472 Ga0395901_0155312 3300038443 Bacteria 2403
473 Ga0395901_0426283 3300038443 Bacteria 1359
474 Ga0400484_03261 3300038725 Bacteria 37196
475 Ga0400484_07350 3300038725 Bacteria 7933
476 Ga0400490_20091 3300038726 Bacteria 9857
477 Ga0400490_21770 3300038726 Bacteria 5517
478 Ga0400490_45662 3300038726 Bacteria 38225
479 Ga0400490_51771 3300038726 Bacteria 2053
480 Ga0400491_10244 3300038727 Bacteria 3893
481 Ga0400491_16906 3300038727 Bacteria 2081
482 Ga0400488_04816 3300038741 Bacteria 1117
483 Ga0400488_18372 3300038741 Bacteria 11596
484 Ga0400488_23615 3300038741 Bacteria 4654
485 Ga0400488_31619 3300038741 Bacteria 1531
486 Ga0400488_40478 3300038741 Bacteria 1121
487 Ga0400486_10786 3300038742 Bacteria 2942
488 Ga0400483_044439 3300039062 Bacteria 12231
489 Ga0400483_048826 3300039062 Bacteria 15631
490 Ga0400483_163381 3300039062 Bacteria 10819
491 Ga0400487_26214 3300039110 Bacteria 1642
492 Ga0400487_41427 3300039110 Bacteria 4185
493 Ga0400487_47735 3300039110 Bacteria 59107
494 Ga0400487_51105 3300039110 Bacteria 2410
495 Ga0400487_51635 3300039110 Bacteria 1751
496 Ga0436361_0080172 3300039447 Bacteria 39325
497 Ga0436361_0119299 3300039447 Bacteria 18398
498 Ga0436361_0837724 3300039447 Bacteria 3222
499 Ga0436361_0944997 3300039447 Bacteria 6398
500 Ga0436363_0672559 3300039450 Bacteria 12181
501 Ga0436363_1199362 3300039450 Bacteria 5411
502 Ga0436362_0176928 3300039453 Bacteria 3764
503 Ga0451787_573112 3300041441 Bacteria 2089
504 Ga0451789_1220021 3300041443 Bacteria 1111
505 Ga0451793_0865321 3300041452 Bacteria 1749
506 Ga0451795_0279517 3300041456 Bacteria 1210
507 Ga0451807_1281246 3300041486 Bacteria 2974
508 Ga0451853_3198134 3300041512 Bacteria 1950
509 Ga0439448_0003707 3300042005 Bacteria 4256
510 Ga0439448_0045297 3300042005 Bacteria 1431
511 Ga0439450_024169 3300042008 Bacteria 1323
512 Ga0439450_039179 3300042008 Bacteria 1094
513 Ga0450904_001557 3300042139 Bacteria 3131
514 Ga0439458_0001531 3300042157 Bacteria 5778
515 Ga0451577_0097310 3300042876 Bacteria 2628
516 Ga0451577_0104243 3300042876 Bacteria 2535
517 Ga0466969_0015826 3300044656 Bacteria 3953
518 Ga0466972_0002881 3300044658 Bacteria 8512
519 Ga0453683_0068607 3300044673 Bacteria 2217
520 Ga0466965_0014133 3300044683 Bacteria 3776
521 Ga0466965_0016917 3300044683 Bacteria 3478
522 Ga0466965_0043666 3300044683 Bacteria 2213
523 Ga0466966_0005305 3300044684 Bacteria 8476
524 Ga0466966_0033545 3300044684 Bacteria 3324
525 Ga0466966_0221696 3300044684 Bacteria 1141
526 Ga0466966_0239292 3300044684 Bacteria 1094
527 Ga0466961_0124576 3300044693 Bacteria 1617
528 Ga0466964_0001227 3300044706 Bacteria 8693
529 Ga0466964_0001931 3300044706 Bacteria 7257
530 Ga0466971_0010136 3300044719 Bacteria 4115
531 Ga0466971_0132277 3300044719 Bacteria 1158
532 Ga0466968_0001801 3300044735 Bacteria 7739
533 Ga0466968_0099409 3300044735 Bacteria 1297
534 Ga0466957_0046829 3300044842 Bacteria 2626
535 Ga0466957_0159888 3300044842 Bacteria 1462
536 Ga0466960_0126220 3300044901 Bacteria 1345
537 Ga0466959_0045778 3300045049 Bacteria 3221
538 Ga0466959_0080319 3300045049 Bacteria 2351
539 Ga0466959_0145988 3300045049 Bacteria 1669
540 Ga0451576_0000250 3300045051 Bacteria 132101
541 Ga0466958_0075060 3300045836 Bacteria 2073
542 Ga0495617_000057 3300046452 Bacteria 100673
543 Ga0495617_000303 3300046452 Bacteria 27779
544 Ga0495617_046083 3300046452 Bacteria 1453
545 Ga0495627_001817 3300046453 Bacteria 11358
546 Ga0495627_006174 3300046453 Bacteria 4721
547 Ga0495592_0046495 3300046454 Bacteria 3235
548 Ga0495603_0086608 3300046455 Bacteria 1833
549 Ga0495590_0000018 3300046457 Bacteria 216375
550 Ga0495590_0002149 3300046457 Bacteria 8279
551 Ga0495590_0002928 3300046457 Bacteria 7024
552 Ga0495590_0058050 3300046457 Bacteria 1353
553 Ga0495591_012498 3300046458 Bacteria 3159
554 Ga0495591_019841 3300046458 Bacteria 2238
555 Ga0495629_0132375 3300046459 Bacteria 1737
556 Ga0495638_0010108 3300046460 Bacteria 6574
557 Ga0495638_0027791 3300046460 Bacteria 3659
558 Ga0495638_0048144 3300046460 Bacteria 2669
559 Ga0495638_0112870 3300046460 Bacteria 1613
560 Ga0495651_0028201 3300046462 Bacteria 4375
561 Ga0495651_0100413 3300046462 Bacteria 2155
562 Ga0495653_0028643 3300046463 Bacteria 4452
563 Ga0495653_0078585 3300046463 Bacteria 2446
564 Ga0495650_0000108 3300046471 Bacteria 200369
565 Ga0495650_0000140 3300046471 Bacteria 169317
566 Ga0495650_0032139 3300046471 Bacteria 2351
567 Ga0495605_0000416 3300046474 Bacteria 38811
568 Ga0495605_0000438 3300046474 Bacteria 37563
569 Ga0495605_0003370 3300046474 Bacteria 9538
570 Ga0495605_0011441 3300046474 Bacteria 4944
571 Ga0495605_0027851 3300046474 Bacteria 2923
572 Ga0495605_0029379 3300046474 Bacteria 2829
573 Ga0495605_0041158 3300046474 Bacteria 2302
574 Ga0495605_0045539 3300046474 Bacteria 2161
575 Ga0495605_0124866 3300046474 Bacteria 1164
576 Ga0495584_0000006 3300046491 Bacteria 301775
577 Ga0495584_0000281 3300046491 Bacteria 35857
578 Ga0495584_0009627 3300046491 Bacteria 4976
579 Ga0495584_0013652 3300046491 Bacteria 4143
580 Ga0495584_0033622 3300046491 Bacteria 2594
581 Ga0495584_0036504 3300046491 Bacteria 2483
582 Ga0495584_0043266 3300046491 Bacteria 2273
583 Ga0495584_0171850 3300046491 Bacteria 1101
584 Ga0495585_0000193 3300046492 Bacteria 63937
585 Ga0495585_0000515 3300046492 Bacteria 36553
586 Ga0495585_0002529 3300046492 Bacteria 12997
587 Ga0495585_0003683 3300046492 Bacteria 10243
588 Ga0495585_0005187 3300046492 Bacteria 8261
589 Ga0495585_0007454 3300046492 Bacteria 6694
590 Ga0495585_0014980 3300046492 Bacteria 4508
591 Ga0495585_0038339 3300046492 Bacteria 2697
592 Ga0495585_0064979 3300046492 Bacteria 1999
593 Ga0495585_0065111 3300046492 Bacteria 1997
594 Ga0495585_0065981 3300046492 Bacteria 1982
595 Ga0495585_0115949 3300046492 Bacteria 1420
596 Ga0495594_0039206 3300046499 Bacteria 2589
597 Ga0495594_0206510 3300046499 Bacteria 1119
598 Ga0495596_0001089 3300046500 Bacteria 16084
599 Ga0495596_0001435 3300046500 Bacteria 13653
600 Ga0495596_0001794 3300046500 Bacteria 11945
601 Ga0495596_0007906 3300046500 Bacteria 4763
602 Ga0495596_0011978 3300046500 Bacteria 3722
603 Ga0495596_0012711 3300046500 Bacteria 3594
604 Ga0495596_0020949 3300046500 Bacteria 2672
605 Ga0495596_0023469 3300046500 Bacteria 2502
606 Ga0495596_0023665 3300046500 Bacteria 2491
607 Ga0495596_0052210 3300046500 Bacteria 1600
608 Ga0495596_0053292 3300046500 Bacteria 1583
609 Ga0495596_0057895 3300046500 Bacteria 1511
610 Ga0495607_0003330 3300046501 Bacteria 12335
611 Ga0495607_0011000 3300046501 Bacteria 6048
612 Ga0495607_0019846 3300046501 Bacteria 4261
613 Ga0495607_0025658 3300046501 Bacteria 3663
614 Ga0495607_0031999 3300046501 Bacteria 3216
615 Ga0495607_0050509 3300046501 Bacteria 2420
616 Ga0495607_0069694 3300046501 Bacteria 1967
617 Ga0495583_0003816 3300046506 Bacteria 11182
618 Ga0495583_0012109 3300046506 Bacteria 4905
619 Ga0495583_0014101 3300046506 Bacteria 4422
620 Ga0495583_0020486 3300046506 Bacteria 3425
621 Ga0495583_0029563 3300046506 Bacteria 2679
622 Ga0495583_0032217 3300046506 Bacteria 2531
623 Ga0495583_0032488 3300046506 Bacteria 2519
624 Ga0495583_0037057 3300046506 Bacteria 2314
625 Ga0495583_0059784 3300046506 Bacteria 1706
626 Ga0495583_0164587 3300046506 Bacteria 913
627 Ga0495606_0006986 3300046507 Bacteria 10256
628 Ga0495606_0011967 3300046507 Bacteria 7010
629 Ga0495606_0027851 3300046507 Bacteria 3997
630 Ga0495606_0086107 3300046507 Bacteria 1942
631 Ga0495606_0113794 3300046507 Bacteria 1628
632 Ga0495608_0041553 3300046511 Bacteria 3076
633 Ga0495610_0002329 3300046512 Bacteria 16055
634 Ga0495616_0000662 3300046513 Bacteria 25597
635 Ga0495616_0002246 3300046513 Bacteria 12914
636 Ga0495616_0002684 3300046513 Bacteria 11663
637 Ga0495616_0003012 3300046513 Bacteria 10933
638 Ga0495616_0004448 3300046513 Bacteria 8829
639 Ga0495616_0013824 3300046513 Bacteria 4538
640 Ga0495616_0018343 3300046513 Bacteria 3842
641 Ga0495616_0026851 3300046513 Bacteria 3058
642 Ga0495616_0033272 3300046513 Bacteria 2687
643 Ga0495616_0034518 3300046513 Bacteria 2627
644 Ga0495616_0057056 3300046513 Bacteria 1926
645 Ga0495616_0068379 3300046513 Bacteria 1724
646 Ga0495616_0111702 3300046513 Bacteria 1269
647 Ga0495620_0004669 3300046515 Bacteria 7698
648 Ga0495628_0004565 3300046516 Bacteria 12256
649 Ga0495630_0084205 3300046517 Bacteria 2401
650 Ga0495631_0000632 3300046518 Bacteria 23007
651 Ga0495631_0001483 3300046518 Bacteria 14222
652 Ga0495631_0002977 3300046518 Bacteria 9377
653 Ga0495631_0007116 3300046518 Bacteria 5717
654 Ga0495631_0011740 3300046518 Bacteria 4297
655 Ga0495631_0016053 3300046518 Bacteria 3577
656 Ga0495631_0018121 3300046518 Bacteria 3318
657 Ga0495631_0041077 3300046518 Bacteria 2047
658 Ga0495631_0042382 3300046518 Bacteria 2011
659 Ga0495631_0052764 3300046518 Bacteria 1775
660 Ga0495632_0000214 3300046519 Bacteria 58439
661 Ga0495632_0000364 3300046519 Bacteria 43040
662 Ga0495632_0003852 3300046519 Bacteria 10434
663 Ga0495632_0009850 3300046519 Bacteria 5716
664 Ga0495632_0011405 3300046519 Bacteria 5187
665 Ga0495632_0014316 3300046519 Bacteria 4490
666 Ga0495632_0015456 3300046519 Bacteria 4278
667 Ga0495632_0026674 3300046519 Bacteria 3038
668 Ga0495632_0027244 3300046519 Bacteria 2995
669 Ga0495632_0052634 3300046519 Bacteria 2001
670 Ga0495632_0056759 3300046519 Bacteria 1913
671 Ga0495632_0056879 3300046519 Bacteria 1911
672 Ga0495632_0087379 3300046519 Bacteria 1482
673 Ga0495637_0000612 3300046520 Bacteria 25396
674 Ga0495643_0000141 3300046522 Bacteria 115660
675 Ga0495643_0004483 3300046522 Bacteria 9748
676 Ga0495643_0019252 3300046522 Bacteria 3952
677 Ga0495643_0021003 3300046522 Bacteria 3753
678 Ga0495643_0032721 3300046522 Bacteria 2883
679 Ga0495643_0043697 3300046522 Bacteria 2437
680 Ga0495643_0061065 3300046522 Bacteria 1999
681 Ga0495643_0120803 3300046522 Bacteria 1324
682 Ga0495644_0002371 3300046523 Bacteria 7511
683 Ga0495644_0005317 3300046523 Bacteria 5028
684 Ga0495644_0007533 3300046523 Bacteria 4196
685 Ga0495644_0025164 3300046523 Bacteria 2260
686 Ga0495644_0030060 3300046523 Bacteria 2051
687 Ga0495648_0000109 3300046524 Bacteria 101519
688 Ga0495648_0004137 3300046524 Bacteria 12482
689 Ga0495648_0019039 3300046524 Bacteria 4841
690 Ga0495666_0012627 3300046526 Bacteria 4210
691 Ga0495642_0000741 3300046528 Bacteria 16179
692 Ga0495642_0001464 3300046528 Bacteria 10572
693 Ga0495642_0007631 3300046528 Bacteria 4147
694 Ga0495642_0013970 3300046528 Bacteria 3110
695 Ga0495642_0037500 3300046528 Bacteria 1961
696 Ga0495642_0054460 3300046528 Bacteria 1649
697 Ga0495642_0065860 3300046528 Bacteria 1509
698 Ga0495652_0012068 3300046529 Bacteria 7808
699 Ga0495652_0040085 3300046529 Bacteria 4048
700 Ga0495654_0047746 3300046530 Bacteria 2103
701 Ga0495654_0048172 3300046530 Bacteria 2092
702 Ga0495654_0059366 3300046530 Bacteria 1842
703 Ga0495654_0094487 3300046530 Bacteria 1383
704 Ga0495665_0019053 3300046531 Bacteria 3688
705 Ga0495665_0026571 3300046531 Bacteria 3109
706 Ga0495665_0030666 3300046531 Bacteria 2878
707 Ga0495586_0142085 3300046535 Bacteria 1347
708 Ga0495598_0022846 3300046537 Bacteria 1677
709 Ga0495609_0000009 3300046538 Bacteria 354860
710 Ga0495609_0001562 3300046538 Bacteria 14985
711 Ga0495609_0006657 3300046538 Bacteria 5864
712 Ga0495609_0018010 3300046538 Bacteria 3276
713 Ga0495609_0020796 3300046538 Bacteria 3029
714 Ga0495609_0037586 3300046538 Bacteria 2183
715 Ga0495609_0049452 3300046538 Bacteria 1876
716 Ga0495609_0049544 3300046538 Bacteria 1874
717 Ga0495609_0114655 3300046538 Bacteria 1161
718 Ga0495597_0002044 3300046542 Bacteria 13485
719 Ga0495597_0003097 3300046542 Bacteria 10004
720 Ga0495597_0014117 3300046542 Bacteria 3808
721 Ga0495597_0042966 3300046542 Bacteria 2013
722 Ga0495645_0027376 3300046543 Bacteria 4142
723 Ga0495622_0038097 3300046557 Bacteria 2238
724 Ga0495622_0049436 3300046557 Bacteria 1952
725 Ga0495633_0006086 3300046558 Bacteria 7228
726 Ga0495633_0007030 3300046558 Bacteria 6559
727 Ga0495633_0007058 3300046558 Bacteria 6539
728 Ga0495633_0026986 3300046558 Bacteria 2811
729 Ga0495633_0088992 3300046558 Bacteria 1435
730 Ga0495656_0022919 3300046615 Bacteria 2451
731 Ga0495656_0053279 3300046615 Bacteria 1738
732 Ga0495668_0003200 3300046616 Bacteria 12527
733 Ga0495668_0003639 3300046616 Bacteria 11407
734 Ga0495668_0015431 3300046616 Bacteria 4461
735 Ga0495668_0016287 3300046616 Bacteria 4320
736 Ga0495668_0020369 3300046616 Bacteria 3815
737 Ga0495668_0051043 3300046616 Bacteria 2290
738 Ga0495668_0114115 3300046616 Bacteria 1477
739 Ga0495634_0201412 3300046642 Bacteria 1236
740 Ga0495611_0000499 3300046648 Bacteria 23354
741 Ga0495611_0002457 3300046648 Bacteria 8460
742 Ga0495611_0019231 3300046648 Bacteria 2933
743 Ga0495611_0019315 3300046648 Bacteria 2926
744 Ga0495611_0024956 3300046648 Bacteria 2602
745 Ga0495611_0026413 3300046648 Bacteria 2533
746 Ga0495611_0031348 3300046648 Bacteria 2339
747 Ga0495625_0032776 3300046660 Bacteria 3848
748 Ga0495625_0063609 3300046660 Bacteria 2605
749 Ga0495625_0066343 3300046660 Bacteria 2542
750 Ga0495625_0124604 3300046660 Bacteria 1750
751 Ga0495625_0178631 3300046660 Bacteria 1413
752 Ga0495635_0002454 3300046663 Bacteria 12659
753 Ga0495661_0001929 3300046665 Bacteria 16505
754 Ga0495661_0007429 3300046665 Bacteria 7642
755 Ga0495661_0012238 3300046665 Bacteria 5795
756 Ga0495661_0013191 3300046665 Bacteria 5556
757 Ga0495661_0027110 3300046665 Bacteria 3680
758 Ga0495661_0035807 3300046665 Bacteria 3112
759 Ga0495661_0064902 3300046665 Bacteria 2152
760 Ga0495661_0065409 3300046665 Bacteria 2142
761 Ga0495661_0071191 3300046665 Bacteria 2032
762 Ga0495661_0075659 3300046665 Bacteria 1956
763 Ga0495661_0153789 3300046665 Bacteria 1240
764 Ga0495661_0171609 3300046665 Bacteria 1156
765 Ga0495588_0000077 3300046674 Bacteria 215338
766 Ga0495588_0010399 3300046674 Bacteria 4328
767 Ga0495588_0012275 3300046674 Bacteria 4043
768 Ga0495588_0027405 3300046674 Bacteria 2847
769 Ga0495588_0031167 3300046674 Bacteria 2682
770 Ga0495588_0055912 3300046674 Bacteria 2037
771 Ga0495588_0067940 3300046674 Bacteria 1850
772 Ga0495657_0073728 3300046675 Bacteria 2222
773 Ga0495599_0004944 3300046678 Bacteria 7925
774 Ga0495623_0011364 3300046679 Bacteria 5760
775 Ga0495646_0012052 3300046680 Bacteria 5499
776 Ga0495669_0000116 3300046684 Bacteria 51756
777 Ga0495669_0007431 3300046684 Bacteria 4595
778 Ga0495669_0011905 3300046684 Bacteria 3699
779 Ga0495669_0030253 3300046684 Bacteria 2377
780 Ga0495624_0300210 3300046690 Bacteria 968
781 Ga0495670_0001273 3300046691 Bacteria 12311
782 Ga0495670_0005019 3300046691 Bacteria 6507
783 Ga0495670_0007909 3300046691 Bacteria 5227
784 Ga0495670_0016363 3300046691 Bacteria 3644
785 Ga0495670_0041425 3300046691 Bacteria 2298
786 Ga0495670_0049421 3300046691 Bacteria 2104
787 Ga0495670_0072508 3300046691 Bacteria 1744
788 Ga0495671_0002689 3300046692 Bacteria 11143
789 Ga0495671_0016637 3300046692 Bacteria 3924
790 Ga0495649_0003311 3300046694 Bacteria 10948
791 Ga0495649_0003561 3300046694 Bacteria 10460
792 Ga0495649_0011717 3300046694 Bacteria 5131
793 Ga0495649_0057116 3300046694 Bacteria 2105
794 Ga0495649_0082868 3300046694 Bacteria 1713
795 Ga0495589_0001060 3300046794 Bacteria 16526
796 Ga0495589_0007613 3300046794 Bacteria 5673
797 Ga0495589_0013208 3300046794 Bacteria 4261
798 Ga0495589_0017044 3300046794 Bacteria 3730
799 Ga0495589_0019655 3300046794 Bacteria 3458
800 Ga0495660_0000178 3300046810 Bacteria 68956
801 Ga0495660_0010952 3300046810 Bacteria 5271
802 Ga0495660_0020825 3300046810 Bacteria 3759
803 Ga0495660_0070404 3300046810 Bacteria 1856
804 Ga0495660_0070610 3300046810 Bacteria 1853
805 Ga0495660_0108124 3300046810 Bacteria 1422
806 Ga0495660_0117839 3300046810 Bacteria 1347
807 Ga0495604_0027131 3300047317 Bacteria 4556
808 Ga0495672_0000033 3300047320 Bacteria 291992
809 Ga0495672_0000437 3300047320 Bacteria 49739
810 Ga0495672_0001623 3300047320 Bacteria 21897
811 Ga0495672_0009440 3300047320 Bacteria 7068
812 Ga0495672_0010123 3300047320 Bacteria 6744
813 Ga0495672_0072525 3300047320 Bacteria 1944
814 Ga0495676_0000121 3300047321 Bacteria 59949
815 Ga0495676_0049524 3300047321 Bacteria 3377
816 Ga0495680_0007548 3300047322 Bacteria 9946
817 Ga0495683_0000182 3300047323 Bacteria 61818
818 Ga0495683_0001151 3300047323 Bacteria 18144
819 Ga0495683_0011839 3300047323 Bacteria 4586
820 Ga0495683_0018583 3300047323 Bacteria 3591
821 Ga0495683_0020136 3300047323 Bacteria 3443
822 Ga0495683_0020827 3300047323 Bacteria 3380
823 Ga0495687_000002 3300047443 Bacteria 1085770
824 Ga0495687_000017 3300047443 Bacteria 350429
825 Ga0495687_000024 3300047443 Bacteria 316676
826 Ga0495687_000458 3300047443 Bacteria 49855
827 Ga0495687_013931 3300047443 Bacteria 4166
828 Ga0495687_014022 3300047443 Bacteria 4147
829 Ga0495675_0016790 3300047444 Bacteria 4629
830 Ga0495677_0000117 3300047445 Bacteria 38586
831 Ga0495677_0003340 3300047445 Bacteria 6242
832 Ga0495677_0004846 3300047445 Bacteria 5132
833 Ga0495677_0005027 3300047445 Bacteria 5043
834 Ga0495677_0005223 3300047445 Bacteria 4938
835 Ga0495677_0008846 3300047445 Bacteria 3729
836 Ga0495677_0010361 3300047445 Bacteria 3425
837 Ga0495677_0017662 3300047445 Bacteria 2585
838 Ga0495677_0026283 3300047445 Bacteria 2111
839 Ga0495677_0027824 3300047445 Bacteria 2052
840 Ga0495677_0028764 3300047445 Bacteria 2020
841 Ga0495677_0029631 3300047445 Bacteria 1990
842 Ga0495679_003474 3300047446 Bacteria 7557
843 Ga0495679_004009 3300047446 Bacteria 6926
844 Ga0495679_013040 3300047446 Bacteria 3136
845 Ga0495685_004997 3300047447 Bacteria 4313
846 Ga0495681_0000994 3300047470 Bacteria 21702
847 Ga0495681_0012084 3300047470 Bacteria 5090
848 Ga0495681_0014560 3300047470 Bacteria 4497
849 Ga0495681_0023578 3300047470 Bacteria 3265
850 Ga0495681_0031695 3300047470 Bacteria 2671
851 Ga0495681_0058051 3300047470 Bacteria 1795
852 Ga0495686_0000591 3300047472 Bacteria 50934
853 Ga0495686_0001614 3300047472 Bacteria 23675
854 Ga0495686_0082989 3300047472 Bacteria 1955
855 Ga0495593_0088157 3300047673 Bacteria 1599
856 Ga0495593_0117865 3300047673 Bacteria 1352
857 Ga0495602_0077771 3300048088 Bacteria 2805
858 Ga0495614_0004132 3300048089 Bacteria 6536
859 Ga0495626_0000004 3300048091 Bacteria 356599
860 Ga0495626_0000016 3300048091 Bacteria 232214
861 Ga0495626_0000693 3300048091 Bacteria 32187
862 Ga0495626_0006971 3300048091 Bacteria 6359
863 Ga0495626_0012875 3300048091 Bacteria 4366
864 Ga0495626_0015332 3300048091 Bacteria 3927
865 Ga0495626_0030305 3300048091 Bacteria 2609
866 Ga0495626_0035415 3300048091 Bacteria 2382
867 Ga0495626_0042550 3300048091 Bacteria 2133
868 Ga0495626_0042772 3300048091 Bacteria 2127
869 Ga0495626_0079806 3300048091 Bacteria 1455
870 Ga0496101_0100541 3300048904 Bacteria 2163
871 Ga0496102_0000340 3300048905 Bacteria 57233
872 Ga0496102_0031296 3300048905 Bacteria 4772
873 Ga0496102_0039013 3300048905 Bacteria 4289
874 Ga0496102_0073083 3300048905 Bacteria 3152
875 Ga0496102_0189580 3300048905 Bacteria 1937
876 Ga0496102_0285842 3300048905 Bacteria 1554
877 Ga0496103_0013246 3300048906 Bacteria 4888
878 Ga0496103_0097970 3300048906 Unclassified 1854
879 Ga0496103_0201425 3300048906 Bacteria 1280
880 Ga0496106_0239107 3300048909 Bacteria 1451
881 Ga0496107_0007412 3300048910 Bacteria 7562
882 Ga0496108_0019844 3300048911 Bacteria 5522
883 Ga0496109_0005210 3300048912 Bacteria 10861
884 Ga0496109_0102982 3300048912 Bacteria 2649
885 Ga0496110_0004929 3300048913 Bacteria 10425
886 Ga0496111_0152130 3300048914 Bacteria 1716
887 Ga0496112_0020372 3300048915 Bacteria 6287
888 Ga0496112_0321442 3300048915 Bacteria 1492
889 Ga0496113_0023519 3300048916 Bacteria 4369
890 Ga0496113_0176820 3300048916 Bacteria 1691
891 Ga0496113_0347407 3300048916 Bacteria 1190
892 Ga0496115_0143915 3300048918 Bacteria 1967
893 Ga0496116_0046354 3300048919 Bacteria 2934
894 Ga0496117_0000057 3300048920 Bacteria 268246
895 Ga0496118_0000028 3300048921 Bacteria 366490
896 Ga0496119_0005745 3300048922 Bacteria 11760
897 Ga0496119_0009417 3300048922 Bacteria 8387
898 Ga0496120_0007468 3300048923 Bacteria 8123
899 Ga0496120_0014995 3300048923 Bacteria 5132
900 Ga0496120_0056979 3300048923 Bacteria 2202
901 Ga0496121_0001295 3300048924 Bacteria 43040
902 Ga0496121_0029970 3300048924 Bacteria 5010
903 Ga0496121_0046034 3300048924 Bacteria 3739
904 Ga0496121_0095309 3300048924 Bacteria 2313
905 Ga0496121_0204670 3300048924 Bacteria 1403
906 Ga0496122_0009237 3300048925 Bacteria 10432
907 Ga0496122_0009551 3300048925 Bacteria 10188
908 Ga0496122_0090290 3300048925 Bacteria 2091
909 Ga0496123_0026217 3300048926 Bacteria 4373
910 Ga0496123_0042315 3300048926 Bacteria 3145
911 Ga0496123_0093738 3300048926 Bacteria 1772
912 Ga0496124_0002724 3300048927 Bacteria 22533
913 Ga0496124_0003292 3300048927 Bacteria 19912
914 Ga0496124_0012916 3300048927 Bacteria 8193
915 Ga0496124_0035599 3300048927 Bacteria 4354
916 Ga0496124_0056406 3300048927 Bacteria 3313
917 Ga0496124_0091173 3300048927 Bacteria 2484
918 Ga0496125_0011721 3300048928 Bacteria 8738
919 Ga0496125_0013698 3300048928 Bacteria 7956
920 Ga0496125_0059832 3300048928 Bacteria 3066
921 Ga0496125_0103905 3300048928 Bacteria 2083
922 Ga0496125_0203493 3300048928 Bacteria 1293
923 Ga0496126_0038970 3300048929 Bacteria 4416
924 Ga0496126_0068887 3300048929 Bacteria 3157
925 Ga0496126_0097557 3300048929 Bacteria 2575
926 Ga0501308_000102 3300049128 Bacteria 3985
927 Ga0501304_000184 3300049160 Bacteria 2688
928 Ga0495678_000275 3300049459 Bacteria 56673
929 Ga0495678_000746 3300049459 Bacteria 29508
930 Ga0495678_001983 3300049459 Bacteria 14748
931 Ga0495678_002319 3300049459 Bacteria 13113
932 Ga0495678_004447 3300049459 Bacteria 8101
933 Ga0495678_014319 3300049459 Bacteria 3691
934 Ga0495682_0002099 3300049460 Bacteria 9711
935 Ga0495682_0017114 3300049460 Bacteria 2740
936 Ga0495682_0019757 3300049460 Bacteria 2531
937 Ga0495682_0027473 3300049460 Bacteria 2110
938 Ga0495682_0074150 3300049460 Bacteria 1224
939 Ga0501033_0361474 3300049570 Bacteria 1016
940 Ga0501037_0008788 3300049573 Bacteria 7408
941 Ga0501037_0013697 3300049573 Bacteria 5975
942 Ga0501039_0030179 3300049575 Bacteria 4179
943 Ga0501040_0049070 3300049576 Bacteria 2886
944 Ga0501046_0012173 3300049580 Bacteria 7334
945 Ga0501047_0098639 3300049581 Bacteria 2800
946 Ga0501048_0286988 3300049582 Bacteria 1170
947 Ga0501067_0003287 3300049583 Bacteria 8901
948 Ga0501068_0000097 3300049584 Bacteria 37675
949 Ga0501069_0020201 3300049585 Bacteria 3607
950 Ga0501070_0003050 3300049586 Bacteria 14588
951 Ga0501070_0008303 3300049586 Bacteria 8776
952 Ga0501070_0015322 3300049586 Bacteria 6450
953 Ga0501070_0134521 3300049586 Bacteria 2041
954 Ga0501071_0068445 3300049587 Bacteria 2583
955 Ga0501072_0028213 3300049588 Bacteria 4382
956 Ga0501073_0000086 3300049589 Bacteria 59101
957 Ga0501074_0028123 3300049590 Bacteria 4074
958 Ga0501074_0057987 3300049590 Bacteria 2789
959 Ga0501075_0319129 3300049591 Bacteria 1184
960 Ga0501076_0061458 3300049592 Bacteria 2989
961 Ga0501077_0001839 3300049593 Bacteria 12841
962 Ga0501079_0000201 3300049741 Bacteria 34664
963 Ga0501080_0001101 3300049742 Bacteria 22270
964 Ga0501080_0003269 3300049742 Bacteria 14304
965 Ga0501081_0244740 3300049743 Bacteria 1308
966 Ga0501083_0001294 3300049744 Bacteria 16922
967 Ga0501035_0004380 3300049822 Bacteria 13405
968 Ga0501044_0001746 3300049823 Bacteria 25368
969 nmdc:mga03683_150182_c1 3300050489 Bacteria 1051
970 nmdc:mga07m45_124896_c1 3300050496 Bacteria 1488
971 nmdc:mga0qj67_232795_c1 3300050509 Bacteria 1495
972 nmdc:mga0qj67_7557_c1 3300050509 Bacteria 8031
973 nmdc:mga06r32_166393_c1 3300050510 Bacteria 2188
974 nmdc:mga06r32_34635_c1 3300050510 Bacteria 4763
975 Ga0500646_0031268 3300053090 Bacteria 1465
976 Ga0500583_0001580 3300053092 Bacteria 6603
977 Ga0500583_0015022 3300053092 Bacteria 3052
978 Ga0500583_0020890 3300053092 Bacteria 2712
979 Ga0500640_090446 3300053095 Bacteria 1283
980 Ga0500650_0000034 3300053098 Bacteria 52582
981 Ga0500556_0000374 3300053104 Bacteria 32602
982 Ga0500642_0195462 3300053130 Bacteria 943
983 Ga0500658_0104505 3300053134 Bacteria 1240
984 Ga0500568_0004577 3300053139 Bacteria 7367
985 Ga0500616_0000016 3300053153 Bacteria 627087
986 Ga0500633_0115889 3300053160 Bacteria 995
987 Ga0500637_0003857 3300053178 Bacteria 6988
988 Ga0500637_0040698 3300053178 Bacteria 2626
989 Ga0501084_0001279 3300054114 Bacteria 19817
990 Ga0501084_0182396 3300054114 Bacteria 1772
991 Ga0587067_002624 3300059640 Bacteria 2157
992 Ga0466962_0108370 3300061719 Bacteria 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100046626 Ga0070669_1000466264 259
2 3300036647 Ga0316582_0033533 Ga0316582_0033533_1745_2635 272
3 3300036712 Ga0316584_0029740 Ga0316584_0029740_1202_2092 272
4 3300053178 Ga0500637_0040698 Ga0500637_0040698_1060_2004 274
5 3300048914 Ga0496111_0152130 Ga0496111_0152130_42_944 275
6 3300028017 Ga0265356_1002312 Ga0265356_10023124 276
7 3300046810 Ga0495660_0010952 Ga0495660_0010952_4416_5261 279
8 3300005577 Ga0068857_100463351 Ga0068857_1004633511 281
9 3300048924 Ga0496121_0095309 Ga0496121_0095309_938_1792 283
10 3300005543 Ga0070672_100118028 Ga0070672_1001180282 284
11 3300025893 Ga0207682_10004847 Ga0207682_100048474 284
12 3300025908 Ga0207643_10035424 Ga0207643_100354242 284
13 3300025940 Ga0207691_10003757 Ga0207691_1000375713 284
14 3300003322 rootL2_10091680 rootL2_100916803 285
15 3300032168 Ga0316593_10000472 Ga0316593_100004725 287
16 3300005719 Ga0068861_100074083 Ga0068861_1000740832 288
17 3300025918 Ga0207662_10109919 Ga0207662_101099192 288
18 3300026118 Ga0207675_100287270 Ga0207675_1002872702 288
19 3300049573 Ga0501037_0013697 Ga0501037_0013697_2765_3703 288
20 3300049586 Ga0501070_0015322 Ga0501070_0015322_4452_5390 288
21 3300049590 Ga0501074_0028123 Ga0501074_0028123_558_1496 288
22 3300049742 Ga0501080_0001101 Ga0501080_0001101_2725_3663 288
23 3300005543 Ga0070672_100034611 Ga0070672_1000346112 289
24 3300005564 Ga0070664_100012001 Ga0070664_1000120014 289
25 3300014325 Ga0163163_10089960 Ga0163163_100899602 289
26 3300025940 Ga0207691_10058407 Ga0207691_100584072 289
27 3300025945 Ga0207679_10159090 Ga0207679_101590902 289
28 iso_pu_bacteria 2839094727 2839096106 289
29 3300005467 Ga0070706_100140325 Ga0070706_1001403252 290
30 3300047443 Ga0495687_013931 Ga0495687_013931_941_1846 290
31 3300009177 Ga0105248_10263891 Ga0105248_102638912 291
32 3300031824 Ga0307413_10001755 Ga0307413_100017555 291
33 3300031852 Ga0307410_10003357 Ga0307410_100033575 291
34 3300031903 Ga0307407_10004906 Ga0307407_100049065 291
35 3300031995 Ga0307409_100007342 Ga0307409_1000073427 291
36 3300032002 Ga0307416_100070648 Ga0307416_1000706484 291
37 3300032005 Ga0307411_10010509 Ga0307411_100105096 291
38 3300032126 Ga0307415_100090684 Ga0307415_1000906842 291
39 3300048910 Ga0496107_0007412 Ga0496107_0007412_2400_3350 291
40 3300048911 Ga0496108_0019844 Ga0496108_0019844_1077_2027 291
41 3300048912 Ga0496109_0102982 Ga0496109_0102982_1511_2461 291
42 3300048915 Ga0496112_0020372 Ga0496112_0020372_420_1370 291
43 3300049586 Ga0501070_0134521 Ga0501070_0134521_40_927 292
44 3300005334 Ga0068869_100450708 Ga0068869_1004507081 293
45 3300005354 Ga0070675_100057275 Ga0070675_1000572754 293
46 3300005455 Ga0070663_100079890 Ga0070663_1000798902 293
47 3300005543 Ga0070672_100019627 Ga0070672_1000196274 293
48 3300005543 Ga0070672_100308130 Ga0070672_1003081302 293
49 3300009093 Ga0105240_10019812 Ga0105240_100198122 293
50 3300009101 Ga0105247_10001941 Ga0105247_100019417 293
51 3300009553 Ga0105249_10103644 Ga0105249_101036442 293
52 3300013306 Ga0163162_10033867 Ga0163162_100338673 293
53 3300014968 Ga0157379_10006122 Ga0157379_1000612211 293
54 3300014968 Ga0157379_10704311 Ga0157379_107043111 293
55 3300025245 Ga0207425_1001639 Ga0207425_10016399 293
56 3300025294 Ga0209025_1016263 Ga0209025_10162632 293
57 3300025297 Ga0209758_1002044 Ga0209758_100204426 293
58 3300025899 Ga0207642_10081710 Ga0207642_100817102 293
59 3300025925 Ga0207650_10123907 Ga0207650_101239072 293
60 3300025926 Ga0207659_10036008 Ga0207659_100360082 293
61 3300025926 Ga0207659_10413336 Ga0207659_104133362 293
62 3300025931 Ga0207644_10150659 Ga0207644_101506592 293
63 3300025940 Ga0207691_10032022 Ga0207691_100320225 293
64 3300025942 Ga0207689_10185344 Ga0207689_101853442 293
65 3300025960 Ga0207651_10543326 Ga0207651_105433261 293
66 3300026095 Ga0207676_10008269 Ga0207676_100082697 293
67 3300031456 Ga0307513_10040878 Ga0307513_100408787 293
68 3300031456 Ga0307513_10175972 Ga0307513_101759723 293
69 3300038741 Ga0400488_23615 Ga0400488_23615_2788_3672 293
70 3300038741 Ga0400488_40478 Ga0400488_40478_91_975 293
71 3300039062 Ga0400483_044439 Ga0400483_044439_8556_9440 293
72 3300039110 Ga0400487_26214 Ga0400487_26214_581_1465 293
73 3300039110 Ga0400487_51635 Ga0400487_51635_338_1222 293
74 3300039450 Ga0436363_1199362 Ga0436363_1199362_4461_5366 293
75 3300041456 Ga0451795_0279517 Ga0451795_0279517_108_998 293
76 3300041512 Ga0451853_3198134 Ga0451853_3198134_57_953 293
77 3300046455 Ga0495603_0086608 Ga0495603_0086608_906_1799 293
78 3300046506 Ga0495583_0164587 Ga0495583_0164587_11_898 293
79 3300046513 Ga0495616_0002246 Ga0495616_0002246_701_1606 293
80 3300046518 Ga0495631_0002977 Ga0495631_0002977_8464_9351 293
81 3300046519 Ga0495632_0052634 Ga0495632_0052634_839_1744 293
82 3300046519 Ga0495632_0087379 Ga0495632_0087379_338_1231 293
83 3300046522 Ga0495643_0120803 Ga0495643_0120803_249_1166 293
84 3300046535 Ga0495586_0142085 Ga0495586_0142085_431_1315 293
85 3300046660 Ga0495625_0063609 Ga0495625_0063609_44_940 293
86 3300046660 Ga0495625_0178631 Ga0495625_0178631_20_913 293
87 3300046690 Ga0495624_0300210 Ga0495624_0300210_24_905 293
88 3300046691 Ga0495670_0007909 Ga0495670_0007909_27_911 293
89 3300047673 Ga0495593_0117865 Ga0495593_0117865_426_1316 293
90 3300048905 Ga0496102_0031296 Ga0496102_0031296_609_1526 293
91 3300048906 Ga0496103_0097970 Ga0496103_0097970_359_1276 293
92 3300048924 Ga0496121_0001295 Ga0496121_0001295_39514_40431 293
93 3300048924 Ga0496121_0204670 Ga0496121_0204670_459_1355 293
94 3300048928 Ga0496125_0059832 Ga0496125_0059832_796_1713 293
95 3300048929 Ga0496126_0097557 Ga0496126_0097557_752_1648 293
96 3300049570 Ga0501033_0361474 Ga0501033_0361474_79_984 293
97 3300050489 nmdc:mga03683_150182_c1 nmdc:mga03683_150182_c1_40_921 293
98 3300053092 Ga0500583_0015022 Ga0500583_0015022_2009_2908 293
99 3300053130 Ga0500642_0195462 Ga0500642_0195462_29_925 293
100 3300053134 Ga0500658_0104505 Ga0500658_0104505_310_1215 293
101 3300053153 Ga0500616_0000016 Ga0500616_0000016_191915_192814 293
102 3300053178 Ga0500637_0003857 Ga0500637_0003857_5892_6809 293
103 3300054114 Ga0501084_0182396 Ga0501084_0182396_871_1758 293
104 3300005458 Ga0070681_10229940 Ga0070681_102299401 294
105 3300005530 Ga0070679_100046729 Ga0070679_1000467294 294
106 3300009093 Ga0105240_10328511 Ga0105240_103285112 294
107 3300025913 Ga0207695_10235923 Ga0207695_102359232 294
108 3300026067 Ga0207678_10046744 Ga0207678_100467442 294
109 3300013307 Ga0157372_10124114 Ga0157372_101241142 296
110 3300053104 Ga0500556_0000374 Ga0500556_0000374_25186_26136 296
111 3300049591 Ga0501075_0319129 Ga0501075_0319129_109_1029 299
112 iso_pu_bacteria 8054357960 8054360169 301
113 3300031616 Ga0307508_10074771 Ga0307508_100747712 303
114 3300053092 Ga0500583_0020890 Ga0500583_0020890_1255_2199 304
115 3300005343 Ga0070687_100160380 Ga0070687_1001603801 305
116 3300005365 Ga0070688_100099691 Ga0070688_1000996912 305
117 3300005549 Ga0070704_100321259 Ga0070704_1003212592 305
118 3300005617 Ga0068859_100115963 Ga0068859_1001159632 305
119 3300005617 Ga0068859_100223012 Ga0068859_1002230122 305
120 3300006931 Ga0097620_100115964 Ga0097620_1001159642 305
121 3300006931 Ga0097620_100223007 Ga0097620_1002230072 305
122 3300025934 Ga0207686_10076906 Ga0207686_100769062 305
123 3300028563 Ga0265319_1020051 Ga0265319_10200513 305
124 3300028573 Ga0265334_10000127 Ga0265334_1000012735 305
125 3300028577 Ga0265318_10000024 Ga0265318_1000002465 305
126 3300028800 Ga0265338_10010433 Ga0265338_1001043311 305
127 3300031235 Ga0265330_10003907 Ga0265330_100039072 305
128 3300031239 Ga0265328_10010066 Ga0265328_100100662 305
129 3300031240 Ga0265320_10005045 Ga0265320_1000504511 305
130 3300031241 Ga0265325_10005133 Ga0265325_100051338 305
131 3300031249 Ga0265339_10023115 Ga0265339_100231153 305
132 3300031250 Ga0265331_10005948 Ga0265331_100059486 305
133 3300031344 Ga0265316_10024185 Ga0265316_100241855 305
134 3300031595 Ga0265313_10004752 Ga0265313_100047527 305
135 3300031711 Ga0265314_10001695 Ga0265314_1000169510 305
136 3300031712 Ga0265342_10068460 Ga0265342_100684602 305
137 iso_pu_bacteria 2547132103 2547373081 305
138 iso_pu_bacteria 2843690924 2843691967 305
139 iso_pu_bacteria 2846037992 2846040439 305
140 3300005331 Ga0070670_100025491 Ga0070670_1000254914 306
141 3300005344 Ga0070661_100175855 Ga0070661_1001758552 306
142 iso_pu_bacteria 2511231003 2511250642 306
143 iso_pu_bacteria 2511231026 2511384950 306
144 iso_pu_bacteria 2643221556 2643802366 306
145 iso_pu_bacteria 2643221603 2644030670 306
146 iso_pu_bacteria 2643221684 2644475879 306
147 iso_pu_bacteria 2765235838 2765569009 306
148 iso_pu_bacteria 2808606418 2809145418 306
149 iso_pu_bacteria 2818991436 2819542543 306
150 iso_pu_bacteria 8047673197 8047673771 306
151 3300031727 Ga0316576_10022743 Ga0316576_100227432 307
152 3300031728 Ga0316578_10003631 Ga0316578_100036313 307
153 3300031728 Ga0316578_10024545 Ga0316578_100245454 307
154 3300031733 Ga0316577_10001334 Ga0316577_100013346 307
155 3300032133 Ga0316583_10028218 Ga0316583_100282181 307
156 3300032137 Ga0316585_10000956 Ga0316585_100009564 307
157 3300032139 Ga0316580_10022804 Ga0316580_100228042 307
158 3300032168 Ga0316593_10003014 Ga0316593_100030142 307
159 3300033541 Ga0316596_1002070 Ga0316596_10020705 307
160 3300035398 Ga0316574_0007763 Ga0316574_0007763_1362_2291 307
161 3300036647 Ga0316582_0017047 Ga0316582_0017047_2798_3727 307
162 3300036712 Ga0316584_0005374 Ga0316584_0005374_758_1687 307
163 3300003322 rootL2_10014064 rootL2_100140644 308
164 3300005295 Ga0065707_10082492 Ga0065707_1008249214 308
165 3300005331 Ga0070670_100000001 Ga0070670_100000001541 308
166 3300005335 Ga0070666_10015694 Ga0070666_100156942 308
167 3300005355 Ga0070671_100000018 Ga0070671_10000001894 308
168 3300005365 Ga0070688_100004521 Ga0070688_1000045219 308
169 3300005367 Ga0070667_100000026 Ga0070667_10000002673 308
170 3300005436 Ga0070713_100230531 Ga0070713_1002305311 308
171 3300005466 Ga0070685_10000007 Ga0070685_10000007153 308
172 3300005548 Ga0070665_100068997 Ga0070665_1000689972 308
173 3300005563 Ga0068855_100031837 Ga0068855_1000318375 308
174 3300005617 Ga0068859_100007685 Ga0068859_10000768510 308
175 3300005618 Ga0068864_100000012 Ga0068864_100000012183 308
176 3300005842 Ga0068858_100016226 Ga0068858_1000162264 308
177 3300005843 Ga0068860_100007832 Ga0068860_1000078327 308
178 3300005844 Ga0068862_100001146 Ga0068862_10000114611 308
179 3300006931 Ga0097620_100007685 Ga0097620_10000768510 308
180 3300007788 Ga0099795_10000014 Ga0099795_1000001454 308
181 3300009101 Ga0105247_10202911 Ga0105247_102029112 308
182 3300009553 Ga0105249_10086586 Ga0105249_100865863 308
183 3300010159 Ga0099796_10000054 Ga0099796_1000005422 308
184 3300013105 Ga0157369_10001598 Ga0157369_1000159814 308
185 3300014325 Ga0163163_10000051 Ga0163163_1000005156 308
186 3300021377 Ga0213874_10066299 Ga0213874_100662992 308
187 3300025903 Ga0207680_10004217 Ga0207680_100042176 308
188 3300025913 Ga0207695_10109895 Ga0207695_101098953 308
189 3300025925 Ga0207650_10000002 Ga0207650_100000021217 308
190 3300025928 Ga0207700_10135931 Ga0207700_101359313 308
191 3300025928 Ga0207700_10247189 Ga0207700_102471891 308
192 3300025931 Ga0207644_10000026 Ga0207644_1000002684 308
193 3300025941 Ga0207711_10000279 Ga0207711_1000027935 308
194 3300025949 Ga0207667_10013878 Ga0207667_100138789 308
195 3300025986 Ga0207658_10000001 Ga0207658_10000001138 308
196 3300026035 Ga0207703_10026533 Ga0207703_100265334 308
197 3300026088 Ga0207641_10416560 Ga0207641_104165602 308
198 3300026088 Ga0207641_10416561 Ga0207641_104165612 308
199 3300026095 Ga0207676_10000001 Ga0207676_100000011217 308
200 3300027512 Ga0209179_1000013 Ga0209179_100001361 308
201 3300028379 Ga0268266_10004153 Ga0268266_100041539 308
202 3300028380 Ga0268265_10001823 Ga0268265_1000182310 308
203 3300028381 Ga0268264_10000061 Ga0268264_10000061135 308
204 3300028800 Ga0265338_10028206 Ga0265338_100282062 308
205 3300031247 Ga0265340_10045334 Ga0265340_100453342 308
206 3300031665 Ga0316575_10018347 Ga0316575_100183472 308
207 3300039450 Ga0436363_0672559 Ga0436363_0672559_5109_6059 308
208 3300046492 Ga0495585_0065111 Ga0495585_0065111_576_1502 308
209 3300046506 Ga0495583_0059784 Ga0495583_0059784_474_1400 308
210 3300046542 Ga0495597_0014117 Ga0495597_0014117_1779_2705 308
211 3300047443 Ga0495687_000002 Ga0495687_000002_878415_879341 308
212 3300049582 Ga0501048_0286988 Ga0501048_0286988_169_1104 308
213 3300049823 Ga0501044_0001746 Ga0501044_0001746_11290_12225 308
214 3300053098 Ga0500650_0000034 Ga0500650_0000034_22598_23536 308
215 3300005329 Ga0070683_100016811 Ga0070683_1000168116 309
216 3300005335 Ga0070666_10036180 Ga0070666_100361804 309
217 3300005335 Ga0070666_10049131 Ga0070666_100491313 309
218 3300005336 Ga0070680_100026542 Ga0070680_1000265424 309
219 3300005336 Ga0070680_100085042 Ga0070680_1000850422 309
220 3300005339 Ga0070660_100014318 Ga0070660_1000143183 309
221 3300005340 Ga0070689_100008006 Ga0070689_1000080062 309
222 3300005344 Ga0070661_100000813 Ga0070661_10000081317 309
223 3300005347 Ga0070668_100023143 Ga0070668_1000231435 309
224 3300005354 Ga0070675_100177229 Ga0070675_1001772292 309
225 3300005355 Ga0070671_100010483 Ga0070671_1000104837 309
226 3300005356 Ga0070674_100003565 Ga0070674_1000035659 309
227 3300005367 Ga0070667_100020275 Ga0070667_1000202752 309
228 3300005367 Ga0070667_100049400 Ga0070667_1000494003 309
229 3300005436 Ga0070713_100212468 Ga0070713_1002124682 309
230 3300005438 Ga0070701_10058065 Ga0070701_100580652 309
231 3300005455 Ga0070663_100240090 Ga0070663_1002400902 309
232 3300005457 Ga0070662_100014371 Ga0070662_1000143715 309
233 3300005457 Ga0070662_100038172 Ga0070662_1000381724 309
234 3300005458 Ga0070681_10005499 Ga0070681_1000549914 309
235 3300005459 Ga0068867_100032317 Ga0068867_1000323171 309
236 3300005530 Ga0070679_100008554 Ga0070679_10000855411 309
237 3300005530 Ga0070679_100422533 Ga0070679_1004225332 309
238 3300005535 Ga0070684_100005117 Ga0070684_1000051177 309
239 3300005539 Ga0068853_100099084 Ga0068853_1000990841 309
240 3300005544 Ga0070686_100009512 Ga0070686_1000095122 309
241 3300005546 Ga0070696_100087225 Ga0070696_1000872252 309
242 3300005548 Ga0070665_100044195 Ga0070665_1000441955 309
243 3300005548 Ga0070665_100567097 Ga0070665_1005670972 309
244 3300005549 Ga0070704_100135283 Ga0070704_1001352832 309
245 3300005563 Ga0068855_100008719 Ga0068855_10000871912 309
246 3300005564 Ga0070664_100014812 Ga0070664_1000148125 309
247 3300005577 Ga0068857_100006850 Ga0068857_10000685011 309
248 3300005577 Ga0068857_100140938 Ga0068857_1001409382 309
249 3300005578 Ga0068854_100005152 Ga0068854_1000051528 309
250 3300005614 Ga0068856_100016323 Ga0068856_1000163233 309
251 3300005614 Ga0068856_100092120 Ga0068856_1000921205 309
252 3300005616 Ga0068852_100001206 Ga0068852_1000012069 309
253 3300005616 Ga0068852_100095514 Ga0068852_1000955141 309
254 3300005617 Ga0068859_100001745 Ga0068859_10000174513 309
255 3300005617 Ga0068859_100080974 Ga0068859_1000809744 309
256 3300005718 Ga0068866_10150941 Ga0068866_101509412 309
257 3300005719 Ga0068861_100208178 Ga0068861_1002081782 309
258 3300005719 Ga0068861_100335508 Ga0068861_1003355082 309
259 3300005841 Ga0068863_100008065 Ga0068863_1000080656 309
260 3300005841 Ga0068863_100017541 Ga0068863_1000175415 309
261 3300005842 Ga0068858_100001018 Ga0068858_10000101818 309
262 3300005842 Ga0068858_100017352 Ga0068858_1000173527 309
263 3300005842 Ga0068858_100428549 Ga0068858_1004285492 309
264 3300005843 Ga0068860_100004168 Ga0068860_1000041683 309
265 3300005844 Ga0068862_100036344 Ga0068862_1000363444 309
266 3300006048 Ga0075363_100002122 Ga0075363_1000021221 309
267 3300006178 Ga0075367_10013597 Ga0075367_100135972 309
268 3300006186 Ga0075369_10064583 Ga0075369_100645832 309
269 3300006195 Ga0075366_10123535 Ga0075366_101235352 309
270 3300006846 Ga0075430_100011821 Ga0075430_10001182110 309
271 3300006847 Ga0075431_100035076 Ga0075431_1000350763 309
272 3300006847 Ga0075431_100104471 Ga0075431_1001044713 309
273 3300006881 Ga0068865_100008565 Ga0068865_1000085655 309
274 3300006931 Ga0097620_100001745 Ga0097620_10000174513 309
275 3300006931 Ga0097620_100080966 Ga0097620_1000809662 309
276 3300009093 Ga0105240_10059153 Ga0105240_100591532 309
277 3300009094 Ga0111539_10012880 Ga0111539_1001288011 309
278 3300009094 Ga0111539_10429433 Ga0111539_104294331 309
279 3300009101 Ga0105247_10018455 Ga0105247_100184555 309
280 3300009174 Ga0105241_10044133 Ga0105241_100441332 309
281 3300009174 Ga0105241_10082865 Ga0105241_100828651 309
282 3300009176 Ga0105242_10054998 Ga0105242_100549984 309
283 3300009177 Ga0105248_10123619 Ga0105248_101236193 309
284 3300009545 Ga0105237_10023342 Ga0105237_100233424 309
285 3300009545 Ga0105237_10310823 Ga0105237_103108232 309
286 3300009551 Ga0105238_10003217 Ga0105238_100032175 309
287 3300009551 Ga0105238_10049013 Ga0105238_100490135 309
288 3300009551 Ga0105238_10371117 Ga0105238_103711172 309
289 3300009553 Ga0105249_10070890 Ga0105249_100708902 309
290 3300009553 Ga0105249_10263908 Ga0105249_102639082 309
291 3300013100 Ga0157373_10006638 Ga0157373_100066385 309
292 3300013104 Ga0157370_10031830 Ga0157370_100318303 309
293 3300013105 Ga0157369_10004689 Ga0157369_1000468915 309
294 3300013105 Ga0157369_10019811 Ga0157369_100198112 309
295 3300013296 Ga0157374_10265654 Ga0157374_102656542 309
296 3300013297 Ga0157378_10012175 Ga0157378_100121753 309
297 3300013306 Ga0163162_10002139 Ga0163162_100021395 309
298 3300013306 Ga0163162_10021561 Ga0163162_100215612 309
299 3300013307 Ga0157372_10020911 Ga0157372_100209115 309
300 3300013308 Ga0157375_10171726 Ga0157375_101717262 309
301 3300014325 Ga0163163_10144606 Ga0163163_101446062 309
302 3300014497 Ga0182008_10103316 Ga0182008_101033162 309
303 3300014968 Ga0157379_10034926 Ga0157379_100349262 309
304 3300014968 Ga0157379_10247486 Ga0157379_102474862 309
305 3300014969 Ga0157376_10396632 Ga0157376_103966322 309
306 3300017792 Ga0163161_10165647 Ga0163161_101656472 309
307 3300021361 Ga0213872_10001047 Ga0213872_1000104713 309
308 3300021361 Ga0213872_10011598 Ga0213872_100115983 309
309 3300021384 Ga0213876_10107712 Ga0213876_101077122 309
310 3300025893 Ga0207682_10000363 Ga0207682_1000036311 309
311 3300025899 Ga0207642_10030040 Ga0207642_100300403 309
312 3300025900 Ga0207710_10000230 Ga0207710_1000023017 309
313 3300025900 Ga0207710_10070795 Ga0207710_100707951 309
314 3300025903 Ga0207680_10041684 Ga0207680_100416844 309
315 3300025907 Ga0207645_10000178 Ga0207645_1000017814 309
316 3300025907 Ga0207645_10008955 Ga0207645_100089558 309
317 3300025908 Ga0207643_10020654 Ga0207643_100206544 309
318 3300025908 Ga0207643_10174565 Ga0207643_101745651 309
319 3300025911 Ga0207654_10280643 Ga0207654_102806432 309
320 3300025912 Ga0207707_10024558 Ga0207707_100245586 309
321 3300025912 Ga0207707_10045689 Ga0207707_100456894 309
322 3300025913 Ga0207695_10018572 Ga0207695_100185727 309
323 3300025913 Ga0207695_10073110 Ga0207695_100731102 309
324 3300025914 Ga0207671_10182076 Ga0207671_101820762 309
325 3300025917 Ga0207660_10027094 Ga0207660_100270945 309
326 3300025918 Ga0207662_10015635 Ga0207662_100156355 309
327 3300025919 Ga0207657_10019066 Ga0207657_100190665 309
328 3300025920 Ga0207649_10000924 Ga0207649_100009246 309
329 3300025921 Ga0207652_10375354 Ga0207652_103753542 309
330 3300025924 Ga0207694_10003088 Ga0207694_100030887 309
331 3300025924 Ga0207694_10015470 Ga0207694_100154704 309
332 3300025924 Ga0207694_10040729 Ga0207694_100407293 309
333 3300025924 Ga0207694_10260318 Ga0207694_102603182 309
334 3300025929 Ga0207664_10015733 Ga0207664_100157334 309
335 3300025931 Ga0207644_10001003 Ga0207644_100010037 309
336 3300025931 Ga0207644_10036298 Ga0207644_100362984 309
337 3300025933 Ga0207706_10000721 Ga0207706_100007216 309
338 3300025933 Ga0207706_10007741 Ga0207706_1000774112 309
339 3300025935 Ga0207709_10040362 Ga0207709_100403623 309
340 3300025940 Ga0207691_10191110 Ga0207691_101911102 309
341 3300025942 Ga0207689_10043003 Ga0207689_100430032 309
342 3300025945 Ga0207679_10066044 Ga0207679_100660442 309
343 3300025945 Ga0207679_10069762 Ga0207679_100697622 309
344 3300025949 Ga0207667_10019236 Ga0207667_100192366 309
345 3300025981 Ga0207640_10207290 Ga0207640_102072902 309
346 3300025986 Ga0207658_10021308 Ga0207658_100213083 309
347 3300025986 Ga0207658_10048303 Ga0207658_100483032 309
348 3300026035 Ga0207703_10000931 Ga0207703_1000093112 309
349 3300026035 Ga0207703_10001837 Ga0207703_100018372 309
350 3300026067 Ga0207678_10028049 Ga0207678_100280495 309
351 3300026075 Ga0207708_10003301 Ga0207708_1000330113 309
352 3300026078 Ga0207702_10003782 Ga0207702_1000378212 309
353 3300026088 Ga0207641_10002241 Ga0207641_1000224114 309
354 3300026089 Ga0207648_10001407 Ga0207648_1000140718 309
355 3300026116 Ga0207674_10000536 Ga0207674_100005367 309
356 3300026116 Ga0207674_10260873 Ga0207674_102608732 309
357 3300026116 Ga0207674_10281293 Ga0207674_102812932 309
358 3300026118 Ga0207675_100000345 Ga0207675_10000034522 309
359 3300026118 Ga0207675_100009265 Ga0207675_1000092656 309
360 3300026118 Ga0207675_100010996 Ga0207675_1000109962 309
361 3300026121 Ga0207683_10047615 Ga0207683_100476151 309
362 3300026142 Ga0207698_10012426 Ga0207698_100124266 309
363 3300028016 Ga0265354_1000774 Ga0265354_10007747 309
364 3300028379 Ga0268266_10001083 Ga0268266_1000108310 309
365 3300028379 Ga0268266_10047347 Ga0268266_100473472 309
366 3300028379 Ga0268266_10409662 Ga0268266_104096621 309
367 3300028381 Ga0268264_10000179 Ga0268264_1000017970 309
368 3300028794 Ga0307515_10299892 Ga0307515_102998922 309
369 3300030521 Ga0307511_10000040 Ga0307511_1000004070 309
370 3300030878 Ga0265770_1000354 Ga0265770_10003545 309
371 3300031251 Ga0265327_10000014 Ga0265327_1000001488 309
372 3300031507 Ga0307509_10001628 Ga0307509_1000162828 309
373 3300031733 Ga0316577_10009802 Ga0316577_100098027 309
374 3300032126 Ga0307415_100139537 Ga0307415_1001395372 309
375 3300033180 Ga0307510_10000013 Ga0307510_10000013128 309
376 3300033180 Ga0307510_10010455 Ga0307510_1001045511 309
377 3300035113 Ga0373936_0015718 Ga0373936_0015718_295_1260 309
378 3300035398 Ga0316574_0021798 Ga0316574_0021798_1706_2641 309
379 3300035398 Ga0316574_0023127 Ga0316574_0023127_2208_3167 309
380 3300037466 Ga0395898_0003704 Ga0395898_0003704_15125_16069 309
381 3300037471 Ga0395905_0242584 Ga0395905_0242584_152_1087 309
382 3300039447 Ga0436361_0119299 Ga0436361_0119299_16562_17494 309
383 3300039447 Ga0436361_0837724 Ga0436361_0837724_1087_2019 309
384 3300039453 Ga0436362_0176928 Ga0436362_0176928_1648_2601 309
385 3300041486 Ga0451807_1281246 Ga0451807_1281246_324_1271 309
386 3300042876 Ga0451577_0097310 Ga0451577_0097310_1344_2279 309
387 3300042876 Ga0451577_0104243 Ga0451577_0104243_354_1289 309
388 3300044673 Ga0453683_0068607 Ga0453683_0068607_1028_1963 309
389 3300044901 Ga0466960_0126220 Ga0466960_0126220_264_1208 309
390 3300045049 Ga0466959_0045778 Ga0466959_0045778_946_1875 309
391 3300045049 Ga0466959_0080319 Ga0466959_0080319_74_1018 309
392 3300045051 Ga0451576_0000250 Ga0451576_0000250_126531_127466 309
393 3300046459 Ga0495629_0132375 Ga0495629_0132375_478_1410 309
394 3300046460 Ga0495638_0048144 Ga0495638_0048144_749_1681 309
395 3300046474 Ga0495605_0003370 Ga0495605_0003370_308_1240 309
396 3300046522 Ga0495643_0019252 Ga0495643_0019252_560_1489 309
397 3300046531 Ga0495665_0030666 Ga0495665_0030666_1436_2368 309
398 3300046537 Ga0495598_0022846 Ga0495598_0022846_44_988 309
399 3300046674 Ga0495588_0067940 Ga0495588_0067940_288_1217 309
400 3300048905 Ga0496102_0039013 Ga0496102_0039013_1725_2669 309
401 3300048905 Ga0496102_0073083 Ga0496102_0073083_657_1589 309
402 3300048916 Ga0496113_0347407 Ga0496113_0347407_228_1163 309
403 3300048919 Ga0496116_0046354 Ga0496116_0046354_1794_2738 309
404 3300048920 Ga0496117_0000057 Ga0496117_0000057_173123_174067 309
405 3300048921 Ga0496118_0000028 Ga0496118_0000028_126953_127897 309
406 3300048922 Ga0496119_0005745 Ga0496119_0005745_1148_2104 309
407 3300048922 Ga0496119_0009417 Ga0496119_0009417_6193_7137 309
408 3300048923 Ga0496120_0007468 Ga0496120_0007468_1147_2103 309
409 3300048923 Ga0496120_0014995 Ga0496120_0014995_2739_3683 309
410 3300048923 Ga0496120_0056979 Ga0496120_0056979_406_1350 309
411 3300048924 Ga0496121_0029970 Ga0496121_0029970_928_1872 309
412 3300048927 Ga0496124_0012916 Ga0496124_0012916_6907_7851 309
413 3300048928 Ga0496125_0011721 Ga0496125_0011721_7676_8617 309
414 3300048928 Ga0496125_0013698 Ga0496125_0013698_6147_7091 309
415 3300048929 Ga0496126_0038970 Ga0496126_0038970_30_971 309
416 3300048929 Ga0496126_0068887 Ga0496126_0068887_1286_2230 309
417 3300049573 Ga0501037_0008788 Ga0501037_0008788_4927_5871 309
418 3300049575 Ga0501039_0030179 Ga0501039_0030179_2967_3911 309
419 3300049576 Ga0501040_0049070 Ga0501040_0049070_1188_2141 309
420 3300049580 Ga0501046_0012173 Ga0501046_0012173_318_1262 309
421 3300049581 Ga0501047_0098639 Ga0501047_0098639_1075_2013 309
422 3300049585 Ga0501069_0020201 Ga0501069_0020201_1104_2048 309
423 3300049586 Ga0501070_0008303 Ga0501070_0008303_4829_5773 309
424 3300049743 Ga0501081_0244740 Ga0501081_0244740_284_1237 309
425 3300050496 nmdc:mga07m45_124896_c1 nmdc:mga07m45_124896_c1_532_1461 309
426 3300050509 nmdc:mga0qj67_232795_c1 nmdc:mga0qj67_232795_c1_224_1177 309
427 3300050509 nmdc:mga0qj67_7557_c1 nmdc:mga0qj67_7557_c1_1594_2532 309
428 3300050510 nmdc:mga06r32_166393_c1 nmdc:mga06r32_166393_c1_587_1525 309
429 3300050510 nmdc:mga06r32_34635_c1 nmdc:mga06r32_34635_c1_2846_3799 309
430 3300053090 Ga0500646_0031268 Ga0500646_0031268_96_1049 309
431 3300053092 Ga0500583_0001580 Ga0500583_0001580_5156_6109 309
432 3300053095 Ga0500640_090446 Ga0500640_090446_251_1207 309
433 3300053139 Ga0500568_0004577 Ga0500568_0004577_2037_2975 309
434 3300053160 Ga0500633_0115889 Ga0500633_0115889_17_970 309
435 iso_pu_bacteria 8001522603 8001526377 309
436 3300002705 JGI25156J39149_1004435 JGI25156J39149_10044353 310
437 3300002737 JGI25162J39368_1000036 JGI25162J39368_100003693 310
438 3300002738 JGI25154J39366_1002733 JGI25154J39366_10027333 310
439 3300002774 JGI25150J39212_1005125 JGI25150J39212_10051252 310
440 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022265 310
441 3300003574 Ga0007410J51695_1012750 Ga0007410J51695_10127505 310
442 3300003575 Ga0007409J51694_1006362 Ga0007409J51694_10063625 310
443 3300003577 Ga0007416J51690_1012585 Ga0007416J51690_10125853 310
444 3300003693 Ga0032354_1023937 Ga0032354_10239371 310
445 3300003751 Ga0055538_1000011 Ga0055538_100001192 310
446 3300003752 Ga0055539_1000016 Ga0055539_1000016265 310
447 3300003756 Ga0055533_1000019 Ga0055533_1000019265 310
448 3300003759 Ga0055525_1000001 Ga0055525_1000001555 310
449 3300003759 Ga0055525_1000042 Ga0055525_100004293 310
450 3300003762 Ga0055542_1010239 Ga0055542_10102392 310
451 3300003841 Ga0055541_1000017 Ga0055541_1000017200 310
452 3300005328 Ga0070676_10102203 Ga0070676_101022032 310
453 3300005331 Ga0070670_100127161 Ga0070670_1001271613 310
454 3300005334 Ga0068869_100040075 Ga0068869_1000400755 310
455 3300005334 Ga0068869_100087511 Ga0068869_1000875112 310
456 3300005334 Ga0068869_100182469 Ga0068869_1001824692 310
457 3300005337 Ga0070682_100003924 Ga0070682_1000039242 310
458 3300005339 Ga0070660_100041122 Ga0070660_1000411222 310
459 3300005340 Ga0070689_100016914 Ga0070689_1000169147 310
460 3300005344 Ga0070661_100036959 Ga0070661_1000369592 310
461 3300005353 Ga0070669_100164633 Ga0070669_1001646331 310
462 3300005354 Ga0070675_100024523 Ga0070675_1000245232 310
463 3300005354 Ga0070675_100031692 Ga0070675_1000316926 310
464 3300005356 Ga0070674_100013910 Ga0070674_1000139102 310
465 3300005364 Ga0070673_100060284 Ga0070673_1000602842 310
466 3300005366 Ga0070659_100053692 Ga0070659_1000536922 310
467 3300005366 Ga0070659_100070043 Ga0070659_1000700433 310
468 3300005367 Ga0070667_100247902 Ga0070667_1002479022 310
469 3300005438 Ga0070701_10052915 Ga0070701_100529151 310
470 3300005440 Ga0070705_100009205 Ga0070705_1000092054 310
471 3300005456 Ga0070678_100025418 Ga0070678_1000254182 310
472 3300005459 Ga0068867_100005237 Ga0068867_1000052374 310
473 3300005459 Ga0068867_100034852 Ga0068867_1000348524 310
474 3300005459 Ga0068867_100113656 Ga0068867_1001136562 310
475 3300005466 Ga0070685_10159859 Ga0070685_101598592 310
476 3300005544 Ga0070686_100027798 Ga0070686_1000277984 310
477 3300005546 Ga0070696_100031637 Ga0070696_1000316376 310
478 3300005549 Ga0070704_100032448 Ga0070704_1000324485 310
479 3300005563 Ga0068855_100220292 Ga0068855_1002202922 310
480 3300005564 Ga0070664_100065531 Ga0070664_1000655313 310
481 3300005564 Ga0070664_100216824 Ga0070664_1002168242 310
482 3300005577 Ga0068857_100396467 Ga0068857_1003964671 310
483 3300005615 Ga0070702_100017140 Ga0070702_1000171404 310
484 3300005617 Ga0068859_100150062 Ga0068859_1001500623 310
485 3300005618 Ga0068864_100037858 Ga0068864_1000378582 310
486 3300005719 Ga0068861_100000962 Ga0068861_1000009624 310
487 3300005719 Ga0068861_100101784 Ga0068861_1001017842 310
488 3300005844 Ga0068862_100033113 Ga0068862_1000331136 310
489 3300005844 Ga0068862_100209238 Ga0068862_1002092382 310
490 3300006237 Ga0097621_100068678 Ga0097621_1000686784 310
491 3300006358 Ga0068871_100100355 Ga0068871_1001003552 310
492 3300006881 Ga0068865_100023560 Ga0068865_1000235603 310
493 3300006881 Ga0068865_100278869 Ga0068865_1002788692 310
494 3300006931 Ga0097620_100150062 Ga0097620_1001500623 310
495 3300009093 Ga0105240_10038598 Ga0105240_100385983 310
496 3300009148 Ga0105243_10216785 Ga0105243_102167852 310
497 3300009176 Ga0105242_10030398 Ga0105242_100303982 310
498 3300009176 Ga0105242_10045340 Ga0105242_100453402 310
499 3300013102 Ga0157371_10000078 Ga0157371_1000007873 310
500 3300013306 Ga0163162_10012636 Ga0163162_100126367 310
501 3300013307 Ga0157372_10651454 Ga0157372_106514541 310
502 3300013308 Ga0157375_10088560 Ga0157375_100885602 310
503 3300013308 Ga0157375_10160315 Ga0157375_101603153 310
504 3300013308 Ga0157375_10310817 Ga0157375_103108172 310
505 3300014326 Ga0157380_10020523 Ga0157380_100205232 310
506 3300014326 Ga0157380_10080085 Ga0157380_100800852 310
507 3300014326 Ga0157380_10189332 Ga0157380_101893322 310
508 3300014497 Ga0182008_10117790 Ga0182008_101177902 310
509 3300014969 Ga0157376_10222159 Ga0157376_102221592 310
510 3300015261 Ga0182006_1010763 Ga0182006_10107634 310
511 3300015262 Ga0182007_10021648 Ga0182007_100216482 310
512 3300015265 Ga0182005_1000307 Ga0182005_100030727 310
513 3300017792 Ga0163161_10012670 Ga0163161_100126702 310
514 3300021361 Ga0213872_10000263 Ga0213872_1000026338 310
515 3300021361 Ga0213872_10012586 Ga0213872_100125863 310
516 3300025206 Ga0209435_100716 Ga0209435_1007164 310
517 3300025224 Ga0209784_100019 Ga0209784_100019342 310
518 3300025225 Ga0209566_100017 Ga0209566_100017342 310
519 3300025226 Ga0209674_100031 Ga0209674_100031342 310
520 3300025228 Ga0209672_106450 Ga0209672_1064501 310
521 3300025230 Ga0209563_100007 Ga0209563_100007541 310
522 3300025230 Ga0209563_100035 Ga0209563_100035342 310
523 3300025231 Ga0207427_100255 Ga0207427_10025520 310
524 3300025233 Ga0209437_100038 Ga0209437_100038342 310
525 3300025246 Ga0209646_1000872 Ga0209646_10008723 310
526 3300025250 Ga0209026_1003950 Ga0209026_10039504 310
527 3300025253 Ga0209677_100020 Ga0209677_100020342 310
528 3300025254 Ga0209148_1000992 Ga0209148_10009929 310
529 3300025256 Ga0209759_1000359 Ga0209759_10003593 310
530 3300025261 Ga0209233_1000049 Ga0209233_1000049342 310
531 3300025893 Ga0207682_10000537 Ga0207682_1000053714 310
532 3300025907 Ga0207645_10144605 Ga0207645_101446051 310
533 3300025909 Ga0207705_10023618 Ga0207705_100236184 310
534 3300025913 Ga0207695_10032578 Ga0207695_100325787 310
535 3300025917 Ga0207660_10094123 Ga0207660_100941232 310
536 3300025919 Ga0207657_10037258 Ga0207657_100372584 310
537 3300025920 Ga0207649_10035200 Ga0207649_100352003 310
538 3300025933 Ga0207706_10023309 Ga0207706_100233092 310
539 3300025933 Ga0207706_10070140 Ga0207706_100701404 310
540 3300025934 Ga0207686_10049440 Ga0207686_100494402 310
541 3300025937 Ga0207669_10100246 Ga0207669_101002462 310
542 3300025938 Ga0207704_10020566 Ga0207704_100205665 310
543 3300025940 Ga0207691_10007249 Ga0207691_100072493 310
544 3300025940 Ga0207691_10092587 Ga0207691_100925872 310
545 3300025942 Ga0207689_10012093 Ga0207689_100120936 310
546 3300025942 Ga0207689_10100862 Ga0207689_101008622 310
547 3300025945 Ga0207679_10004443 Ga0207679_100044433 310
548 3300025945 Ga0207679_10167752 Ga0207679_101677522 310
549 3300025972 Ga0207668_10220837 Ga0207668_102208372 310
550 3300026067 Ga0207678_10155218 Ga0207678_101552183 310
551 3300026075 Ga0207708_10106735 Ga0207708_101067353 310
552 3300026089 Ga0207648_10036960 Ga0207648_100369602 310
553 3300026089 Ga0207648_10307240 Ga0207648_103072402 310
554 3300026095 Ga0207676_10005269 Ga0207676_1000526910 310
555 3300026116 Ga0207674_10083098 Ga0207674_100830984 310
556 3300026118 Ga0207675_100001625 Ga0207675_10000162511 310
557 3300026118 Ga0207675_100012530 Ga0207675_1000125304 310
558 3300026118 Ga0207675_100105310 Ga0207675_1001053103 310
559 3300026118 Ga0207675_100276354 Ga0207675_1002763542 310
560 3300026121 Ga0207683_10034525 Ga0207683_100345256 310
561 3300026121 Ga0207683_10064063 Ga0207683_100640634 310
562 3300026142 Ga0207698_10057160 Ga0207698_100571604 310
563 3300028380 Ga0268265_10025833 Ga0268265_100258334 310
564 3300028380 Ga0268265_10284555 Ga0268265_102845552 310
565 3300028381 Ga0268264_10027283 Ga0268264_100272833 310
566 3300031456 Ga0307513_10063236 Ga0307513_100632362 310
567 3300031507 Ga0307509_10170332 Ga0307509_101703322 310
568 3300031507 Ga0307509_10176859 Ga0307509_101768592 310
569 3300031507 Ga0307509_10199032 Ga0307509_101990322 310
570 3300031548 Ga0307408_100001210 Ga0307408_1000012104 310
571 3300031649 Ga0307514_10091103 Ga0307514_100911032 310
572 3300031852 Ga0307410_10004428 Ga0307410_100044286 310
573 3300031903 Ga0307407_10005254 Ga0307407_100052544 310
574 3300031995 Ga0307409_100002705 Ga0307409_1000027056 310
575 3300032168 Ga0316593_10031252 Ga0316593_100312522 310
576 3300033524 Ga0316592_1000192 Ga0316592_10001925 310
577 3300033541 Ga0316596_1000369 Ga0316596_10003695 310
578 3300037312 Ga0395899_0000128 Ga0395899_0000128_21033_21986 310
579 3300037312 Ga0395899_0000904 Ga0395899_0000904_18314_19246 310
580 3300037312 Ga0395899_0002101 Ga0395899_0002101_13096_14028 310
581 3300037312 Ga0395899_0036149 Ga0395899_0036149_1292_2227 310
582 3300037418 Ga0395900_0000874 Ga0395900_0000874_35372_36307 310
583 3300037418 Ga0395900_0036284 Ga0395900_0036284_3273_4205 310
584 3300037418 Ga0395900_0050571 Ga0395900_0050571_2409_3347 310
585 3300037418 Ga0395900_0062747 Ga0395900_0062747_949_1881 310
586 3300037418 Ga0395900_0163739 Ga0395900_0163739_1107_2039 310
587 3300037418 Ga0395900_0322603 Ga0395900_0322603_515_1453 310
588 3300037466 Ga0395898_0039391 Ga0395898_0039391_3411_4343 310
589 3300037466 Ga0395898_0154334 Ga0395898_0154334_1140_2078 310
590 3300037466 Ga0395898_0157087 Ga0395898_0157087_71_1006 310
591 3300037466 Ga0395898_0160048 Ga0395898_0160048_240_1175 310
592 3300037466 Ga0395898_0207310 Ga0395898_0207310_351_1286 310
593 3300037471 Ga0395905_0009571 Ga0395905_0009571_4645_5577 310
594 3300037471 Ga0395905_0010272 Ga0395905_0010272_8008_8940 310
595 3300037471 Ga0395905_0075118 Ga0395905_0075118_1274_2209 310
596 3300037471 Ga0395905_0295595 Ga0395905_0295595_404_1354 310
597 3300038443 Ga0395901_0000054 Ga0395901_0000054_10546_11481 310
598 3300038443 Ga0395901_0003565 Ga0395901_0003565_1939_2871 310
599 3300038443 Ga0395901_0127852 Ga0395901_0127852_485_1420 310
600 3300038443 Ga0395901_0155312 Ga0395901_0155312_575_1507 310
601 3300038443 Ga0395901_0426283 Ga0395901_0426283_280_1218 310
602 3300038725 Ga0400484_03261 Ga0400484_03261_17493_18434 310
603 3300038725 Ga0400484_07350 Ga0400484_07350_6008_6949 310
604 3300038726 Ga0400490_20091 Ga0400490_20091_6691_7632 310
605 3300038726 Ga0400490_21770 Ga0400490_21770_913_1854 310
606 3300038726 Ga0400490_45662 Ga0400490_45662_11927_12868 310
607 3300038726 Ga0400490_51771 Ga0400490_51771_920_1861 310
608 3300038727 Ga0400491_10244 Ga0400491_10244_932_1873 310
609 3300038727 Ga0400491_16906 Ga0400491_16906_205_1146 310
610 3300038741 Ga0400488_04816 Ga0400488_04816_32_973 310
611 3300038741 Ga0400488_18372 Ga0400488_18372_978_1925 310
612 3300038741 Ga0400488_31619 Ga0400488_31619_361_1302 310
613 3300038742 Ga0400486_10786 Ga0400486_10786_869_1810 310
614 3300039062 Ga0400483_048826 Ga0400483_048826_7489_8430 310
615 3300039062 Ga0400483_163381 Ga0400483_163381_1882_2823 310
616 3300039110 Ga0400487_41427 Ga0400487_41427_167_1108 310
617 3300039110 Ga0400487_47735 Ga0400487_47735_31266_32207 310
618 3300039110 Ga0400487_51105 Ga0400487_51105_464_1405 310
619 3300039447 Ga0436361_0080172 Ga0436361_0080172_37386_38318 310
620 3300039447 Ga0436361_0944997 Ga0436361_0944997_2070_3002 310
621 3300041441 Ga0451787_573112 Ga0451787_573112_1007_1972 310
622 3300041443 Ga0451789_1220021 Ga0451789_1220021_74_1039 310
623 3300041452 Ga0451793_0865321 Ga0451793_0865321_337_1287 310
624 3300042005 Ga0439448_0003707 Ga0439448_0003707_2349_3284 310
625 3300042005 Ga0439448_0045297 Ga0439448_0045297_352_1287 310
626 3300042008 Ga0439450_024169 Ga0439450_024169_212_1147 310
627 3300042008 Ga0439450_039179 Ga0439450_039179_11_946 310
628 3300042139 Ga0450904_001557 Ga0450904_001557_1370_2308 310
629 3300042157 Ga0439458_0001531 Ga0439458_0001531_3235_4170 310
630 3300044656 Ga0466969_0015826 Ga0466969_0015826_2385_3320 310
631 3300044658 Ga0466972_0002881 Ga0466972_0002881_748_1683 310
632 3300044683 Ga0466965_0014133 Ga0466965_0014133_2395_3330 310
633 3300044683 Ga0466965_0016917 Ga0466965_0016917_472_1407 310
634 3300044683 Ga0466965_0043666 Ga0466965_0043666_774_1721 310
635 3300044684 Ga0466966_0005305 Ga0466966_0005305_874_1806 310
636 3300044684 Ga0466966_0033545 Ga0466966_0033545_2295_3233 310
637 3300044684 Ga0466966_0221696 Ga0466966_0221696_121_1068 310
638 3300044684 Ga0466966_0239292 Ga0466966_0239292_59_994 310
639 3300044693 Ga0466961_0124576 Ga0466961_0124576_271_1206 310
640 3300044706 Ga0466964_0001227 Ga0466964_0001227_5396_6331 310
641 3300044706 Ga0466964_0001931 Ga0466964_0001931_1234_2169 310
642 3300044719 Ga0466971_0010136 Ga0466971_0010136_1229_2161 310
643 3300044719 Ga0466971_0132277 Ga0466971_0132277_108_1043 310
644 3300044735 Ga0466968_0001801 Ga0466968_0001801_4998_5933 310
645 3300044735 Ga0466968_0099409 Ga0466968_0099409_261_1196 310
646 3300044842 Ga0466957_0046829 Ga0466957_0046829_775_1722 310
647 3300044842 Ga0466957_0159888 Ga0466957_0159888_423_1358 310
648 3300045049 Ga0466959_0145988 Ga0466959_0145988_70_1017 310
649 3300045836 Ga0466958_0075060 Ga0466958_0075060_382_1317 310
650 3300046452 Ga0495617_000057 Ga0495617_000057_23968_24909 310
651 3300046452 Ga0495617_000303 Ga0495617_000303_16297_17235 310
652 3300046452 Ga0495617_046083 Ga0495617_046083_109_1047 310
653 3300046453 Ga0495627_001817 Ga0495627_001817_7800_8741 310
654 3300046453 Ga0495627_006174 Ga0495627_006174_1992_2927 310
655 3300046454 Ga0495592_0046495 Ga0495592_0046495_57_989 310
656 3300046457 Ga0495590_0000018 Ga0495590_0000018_207954_208892 310
657 3300046457 Ga0495590_0002149 Ga0495590_0002149_5654_6604 310
658 3300046457 Ga0495590_0002928 Ga0495590_0002928_1451_2404 310
659 3300046457 Ga0495590_0058050 Ga0495590_0058050_163_1101 310
660 3300046458 Ga0495591_012498 Ga0495591_012498_1788_2726 310
661 3300046458 Ga0495591_019841 Ga0495591_019841_389_1321 310
662 3300046460 Ga0495638_0010108 Ga0495638_0010108_2954_3892 310
663 3300046460 Ga0495638_0027791 Ga0495638_0027791_1935_2897 310
664 3300046460 Ga0495638_0112870 Ga0495638_0112870_362_1315 310
665 3300046462 Ga0495651_0028201 Ga0495651_0028201_2532_3464 310
666 3300046462 Ga0495651_0100413 Ga0495651_0100413_217_1149 310
667 3300046463 Ga0495653_0028643 Ga0495653_0028643_2189_3133 310
668 3300046463 Ga0495653_0078585 Ga0495653_0078585_408_1343 310
669 3300046471 Ga0495650_0000108 Ga0495650_0000108_61230_62168 310
670 3300046471 Ga0495650_0000140 Ga0495650_0000140_66272_67207 310
671 3300046471 Ga0495650_0032139 Ga0495650_0032139_657_1601 310
672 3300046474 Ga0495605_0000416 Ga0495605_0000416_13903_14844 310
673 3300046474 Ga0495605_0000438 Ga0495605_0000438_35663_36598 310
674 3300046474 Ga0495605_0011441 Ga0495605_0011441_1110_2048 310
675 3300046474 Ga0495605_0027851 Ga0495605_0027851_1521_2456 310
676 3300046474 Ga0495605_0029379 Ga0495605_0029379_310_1248 310
677 3300046474 Ga0495605_0041158 Ga0495605_0041158_409_1347 310
678 3300046474 Ga0495605_0045539 Ga0495605_0045539_892_1833 310
679 3300046474 Ga0495605_0124866 Ga0495605_0124866_23_958 310
680 3300046491 Ga0495584_0000006 Ga0495584_0000006_207139_208077 310
681 3300046491 Ga0495584_0000281 Ga0495584_0000281_434_1372 310
682 3300046491 Ga0495584_0009627 Ga0495584_0009627_3420_4358 310
683 3300046491 Ga0495584_0013652 Ga0495584_0013652_994_1926 310
684 3300046491 Ga0495584_0033622 Ga0495584_0033622_1325_2266 310
685 3300046491 Ga0495584_0036504 Ga0495584_0036504_426_1364 310
686 3300046491 Ga0495584_0043266 Ga0495584_0043266_267_1211 310
687 3300046491 Ga0495584_0171850 Ga0495584_0171850_29_976 310
688 3300046492 Ga0495585_0000193 Ga0495585_0000193_8149_9087 310
689 3300046492 Ga0495585_0000515 Ga0495585_0000515_17981_18919 310
690 3300046492 Ga0495585_0002529 Ga0495585_0002529_6591_7529 310
691 3300046492 Ga0495585_0003683 Ga0495585_0003683_6662_7600 310
692 3300046492 Ga0495585_0005187 Ga0495585_0005187_2377_3312 310
693 3300046492 Ga0495585_0007454 Ga0495585_0007454_4873_5805 310
694 3300046492 Ga0495585_0014980 Ga0495585_0014980_1207_2145 310
695 3300046492 Ga0495585_0038339 Ga0495585_0038339_1587_2522 310
696 3300046492 Ga0495585_0064979 Ga0495585_0064979_822_1760 310
697 3300046492 Ga0495585_0065981 Ga0495585_0065981_57_992 310
698 3300046492 Ga0495585_0115949 Ga0495585_0115949_470_1408 310
699 3300046499 Ga0495594_0039206 Ga0495594_0039206_604_1542 310
700 3300046499 Ga0495594_0206510 Ga0495594_0206510_142_1086 310
701 3300046500 Ga0495596_0001089 Ga0495596_0001089_8548_9486 310
702 3300046500 Ga0495596_0001435 Ga0495596_0001435_9253_10191 310
703 3300046500 Ga0495596_0001794 Ga0495596_0001794_7207_8145 310
704 3300046500 Ga0495596_0007906 Ga0495596_0007906_2562_3500 310
705 3300046500 Ga0495596_0011978 Ga0495596_0011978_170_1111 310
706 3300046500 Ga0495596_0012711 Ga0495596_0012711_2365_3309 310
707 3300046500 Ga0495596_0020949 Ga0495596_0020949_1403_2344 310
708 3300046500 Ga0495596_0023469 Ga0495596_0023469_1019_1957 310
709 3300046500 Ga0495596_0023665 Ga0495596_0023665_1115_2047 310
710 3300046500 Ga0495596_0052210 Ga0495596_0052210_652_1590 310
711 3300046500 Ga0495596_0053292 Ga0495596_0053292_168_1106 310
712 3300046500 Ga0495596_0057895 Ga0495596_0057895_329_1270 310
713 3300046501 Ga0495607_0003330 Ga0495607_0003330_525_1460 310
714 3300046501 Ga0495607_0011000 Ga0495607_0011000_925_1863 310
715 3300046501 Ga0495607_0019846 Ga0495607_0019846_955_1890 310
716 3300046501 Ga0495607_0025658 Ga0495607_0025658_999_1934 310
717 3300046501 Ga0495607_0031999 Ga0495607_0031999_2153_3085 310
718 3300046501 Ga0495607_0050509 Ga0495607_0050509_623_1564 310
719 3300046501 Ga0495607_0069694 Ga0495607_0069694_258_1196 310
720 3300046506 Ga0495583_0003816 Ga0495583_0003816_2467_3414 310
721 3300046506 Ga0495583_0012109 Ga0495583_0012109_2538_3476 310
722 3300046506 Ga0495583_0014101 Ga0495583_0014101_2446_3384 310
723 3300046506 Ga0495583_0020486 Ga0495583_0020486_2278_3210 310
724 3300046506 Ga0495583_0029563 Ga0495583_0029563_778_1713 310
725 3300046506 Ga0495583_0032217 Ga0495583_0032217_582_1547 310
726 3300046506 Ga0495583_0032488 Ga0495583_0032488_1369_2313 310
727 3300046506 Ga0495583_0037057 Ga0495583_0037057_757_1692 310
728 3300046507 Ga0495606_0006986 Ga0495606_0006986_8646_9578 310
729 3300046507 Ga0495606_0011967 Ga0495606_0011967_3224_4162 310
730 3300046507 Ga0495606_0027851 Ga0495606_0027851_2336_3268 310
731 3300046507 Ga0495606_0086107 Ga0495606_0086107_845_1780 310
732 3300046507 Ga0495606_0113794 Ga0495606_0113794_196_1248 310
733 3300046511 Ga0495608_0041553 Ga0495608_0041553_2002_2934 310
734 3300046512 Ga0495610_0002329 Ga0495610_0002329_8026_8964 310
735 3300046513 Ga0495616_0000662 Ga0495616_0000662_694_1629 310
736 3300046513 Ga0495616_0002684 Ga0495616_0002684_8639_9586 310
737 3300046513 Ga0495616_0003012 Ga0495616_0003012_1037_1975 310
738 3300046513 Ga0495616_0004448 Ga0495616_0004448_2644_3582 310
739 3300046513 Ga0495616_0013824 Ga0495616_0013824_2702_3646 310
740 3300046513 Ga0495616_0018343 Ga0495616_0018343_2333_3298 310
741 3300046513 Ga0495616_0026851 Ga0495616_0026851_914_1846 310
742 3300046513 Ga0495616_0033272 Ga0495616_0033272_541_1476 310
743 3300046513 Ga0495616_0034518 Ga0495616_0034518_761_1699 310
744 3300046513 Ga0495616_0057056 Ga0495616_0057056_712_1647 310
745 3300046513 Ga0495616_0068379 Ga0495616_0068379_324_1265 310
746 3300046513 Ga0495616_0111702 Ga0495616_0111702_126_1076 310
747 3300046515 Ga0495620_0004669 Ga0495620_0004669_6742_7680 310
748 3300046516 Ga0495628_0004565 Ga0495628_0004565_10394_11326 310
749 3300046517 Ga0495630_0084205 Ga0495630_0084205_28_963 310
750 3300046518 Ga0495631_0000632 Ga0495631_0000632_7422_8357 310
751 3300046518 Ga0495631_0001483 Ga0495631_0001483_5918_6856 310
752 3300046518 Ga0495631_0007116 Ga0495631_0007116_348_1286 310
753 3300046518 Ga0495631_0011740 Ga0495631_0011740_932_1870 310
754 3300046518 Ga0495631_0016053 Ga0495631_0016053_1102_2043 310
755 3300046518 Ga0495631_0018121 Ga0495631_0018121_52_984 310
756 3300046518 Ga0495631_0041077 Ga0495631_0041077_440_1381 310
757 3300046518 Ga0495631_0042382 Ga0495631_0042382_555_1490 310
758 3300046518 Ga0495631_0052764 Ga0495631_0052764_276_1241 310
759 3300046519 Ga0495632_0000214 Ga0495632_0000214_42473_43438 310
760 3300046519 Ga0495632_0000364 Ga0495632_0000364_40336_41280 310
761 3300046519 Ga0495632_0003852 Ga0495632_0003852_1007_1951 310
762 3300046519 Ga0495632_0009850 Ga0495632_0009850_1805_2743 310
763 3300046519 Ga0495632_0011405 Ga0495632_0011405_3309_4256 310
764 3300046519 Ga0495632_0014316 Ga0495632_0014316_392_1330 310
765 3300046519 Ga0495632_0015456 Ga0495632_0015456_2431_3366 310
766 3300046519 Ga0495632_0026674 Ga0495632_0026674_1053_2006 310
767 3300046519 Ga0495632_0027244 Ga0495632_0027244_530_1462 310
768 3300046519 Ga0495632_0056759 Ga0495632_0056759_559_1494 310
769 3300046519 Ga0495632_0056879 Ga0495632_0056879_712_1647 310
770 3300046520 Ga0495637_0000612 Ga0495637_0000612_12729_13667 310
771 3300046522 Ga0495643_0000141 Ga0495643_0000141_101159_102097 310
772 3300046522 Ga0495643_0004483 Ga0495643_0004483_7880_8815 310
773 3300046522 Ga0495643_0021003 Ga0495643_0021003_1679_2614 310
774 3300046522 Ga0495643_0032721 Ga0495643_0032721_1775_2713 310
775 3300046522 Ga0495643_0043697 Ga0495643_0043697_1120_2055 310
776 3300046522 Ga0495643_0061065 Ga0495643_0061065_149_1087 310
777 3300046523 Ga0495644_0002371 Ga0495644_0002371_6522_7469 310
778 3300046523 Ga0495644_0005317 Ga0495644_0005317_1812_2750 310
779 3300046523 Ga0495644_0007533 Ga0495644_0007533_2356_3288 310
780 3300046523 Ga0495644_0025164 Ga0495644_0025164_930_1868 310
781 3300046523 Ga0495644_0030060 Ga0495644_0030060_601_1539 310
782 3300046524 Ga0495648_0000109 Ga0495648_0000109_77540_78478 310
783 3300046524 Ga0495648_0004137 Ga0495648_0004137_2575_3513 310
784 3300046524 Ga0495648_0019039 Ga0495648_0019039_656_1591 310
785 3300046526 Ga0495666_0012627 Ga0495666_0012627_2743_3678 310
786 3300046528 Ga0495642_0000741 Ga0495642_0000741_7294_8241 310
787 3300046528 Ga0495642_0001464 Ga0495642_0001464_8551_9492 310
788 3300046528 Ga0495642_0007631 Ga0495642_0007631_2318_3262 310
789 3300046528 Ga0495642_0013970 Ga0495642_0013970_1624_2556 310
790 3300046528 Ga0495642_0037500 Ga0495642_0037500_676_1617 310
791 3300046528 Ga0495642_0054460 Ga0495642_0054460_545_1510 310
792 3300046528 Ga0495642_0065860 Ga0495642_0065860_454_1392 310
793 3300046529 Ga0495652_0012068 Ga0495652_0012068_5145_6080 310
794 3300046529 Ga0495652_0040085 Ga0495652_0040085_644_1576 310
795 3300046530 Ga0495654_0047746 Ga0495654_0047746_319_1263 310
796 3300046530 Ga0495654_0048172 Ga0495654_0048172_843_1778 310
797 3300046530 Ga0495654_0059366 Ga0495654_0059366_289_1224 310
798 3300046530 Ga0495654_0094487 Ga0495654_0094487_343_1284 310
799 3300046531 Ga0495665_0019053 Ga0495665_0019053_2649_3584 310
800 3300046531 Ga0495665_0026571 Ga0495665_0026571_895_1833 310
801 3300046538 Ga0495609_0000009 Ga0495609_0000009_167541_168476 310
802 3300046538 Ga0495609_0001562 Ga0495609_0001562_1923_2861 310
803 3300046538 Ga0495609_0006657 Ga0495609_0006657_3437_4375 310
804 3300046538 Ga0495609_0018010 Ga0495609_0018010_617_1561 310
805 3300046538 Ga0495609_0020796 Ga0495609_0020796_297_1238 310
806 3300046538 Ga0495609_0037586 Ga0495609_0037586_962_1897 310
807 3300046538 Ga0495609_0049452 Ga0495609_0049452_449_1387 310
808 3300046538 Ga0495609_0049544 Ga0495609_0049544_919_1851 310
809 3300046538 Ga0495609_0114655 Ga0495609_0114655_81_1025 310
810 3300046542 Ga0495597_0002044 Ga0495597_0002044_848_1780 310
811 3300046542 Ga0495597_0003097 Ga0495597_0003097_1048_1983 310
812 3300046542 Ga0495597_0042966 Ga0495597_0042966_60_998 310
813 3300046543 Ga0495645_0027376 Ga0495645_0027376_2170_3102 310
814 3300046557 Ga0495622_0038097 Ga0495622_0038097_133_1074 310
815 3300046557 Ga0495622_0049436 Ga0495622_0049436_370_1302 310
816 3300046558 Ga0495633_0006086 Ga0495633_0006086_4175_5119 310
817 3300046558 Ga0495633_0007030 Ga0495633_0007030_807_1745 310
818 3300046558 Ga0495633_0007058 Ga0495633_0007058_4543_5481 310
819 3300046558 Ga0495633_0026986 Ga0495633_0026986_561_1499 310
820 3300046558 Ga0495633_0088992 Ga0495633_0088992_228_1166 310
821 3300046615 Ga0495656_0022919 Ga0495656_0022919_962_1897 310
822 3300046615 Ga0495656_0053279 Ga0495656_0053279_370_1308 310
823 3300046616 Ga0495668_0003200 Ga0495668_0003200_3384_4322 310
824 3300046616 Ga0495668_0003639 Ga0495668_0003639_8103_9038 310
825 3300046616 Ga0495668_0015431 Ga0495668_0015431_2591_3532 310
826 3300046616 Ga0495668_0016287 Ga0495668_0016287_1007_1942 310
827 3300046616 Ga0495668_0020369 Ga0495668_0020369_2839_3786 310
828 3300046616 Ga0495668_0051043 Ga0495668_0051043_795_1733 310
829 3300046616 Ga0495668_0114115 Ga0495668_0114115_282_1223 310
830 3300046642 Ga0495634_0201412 Ga0495634_0201412_267_1202 310
831 3300046648 Ga0495611_0000499 Ga0495611_0000499_12735_13673 310
832 3300046648 Ga0495611_0002457 Ga0495611_0002457_2497_3444 310
833 3300046648 Ga0495611_0019231 Ga0495611_0019231_743_1681 310
834 3300046648 Ga0495611_0019315 Ga0495611_0019315_869_1804 310
835 3300046648 Ga0495611_0024956 Ga0495611_0024956_1126_2064 310
836 3300046648 Ga0495611_0026413 Ga0495611_0026413_389_1321 310
837 3300046648 Ga0495611_0031348 Ga0495611_0031348_1024_1962 310
838 3300046660 Ga0495625_0032776 Ga0495625_0032776_2377_3312 310
839 3300046660 Ga0495625_0066343 Ga0495625_0066343_1280_2227 310
840 3300046660 Ga0495625_0124604 Ga0495625_0124604_506_1444 310
841 3300046663 Ga0495635_0002454 Ga0495635_0002454_7599_8543 310
842 3300046665 Ga0495661_0001929 Ga0495661_0001929_2383_3318 310
843 3300046665 Ga0495661_0007429 Ga0495661_0007429_832_1767 310
844 3300046665 Ga0495661_0012238 Ga0495661_0012238_2365_3309 310
845 3300046665 Ga0495661_0013191 Ga0495661_0013191_2285_3220 310
846 3300046665 Ga0495661_0027110 Ga0495661_0027110_1673_2638 310
847 3300046665 Ga0495661_0035807 Ga0495661_0035807_919_1851 310
848 3300046665 Ga0495661_0064902 Ga0495661_0064902_1045_1983 310
849 3300046665 Ga0495661_0065409 Ga0495661_0065409_189_1127 310
850 3300046665 Ga0495661_0071191 Ga0495661_0071191_934_1869 310
851 3300046665 Ga0495661_0075659 Ga0495661_0075659_955_1890 310
852 3300046665 Ga0495661_0153789 Ga0495661_0153789_30_977 310
853 3300046665 Ga0495661_0171609 Ga0495661_0171609_134_1069 310
854 3300046674 Ga0495588_0000077 Ga0495588_0000077_168759_169694 310
855 3300046674 Ga0495588_0010399 Ga0495588_0010399_2484_3428 310
856 3300046674 Ga0495588_0012275 Ga0495588_0012275_2646_3584 310
857 3300046674 Ga0495588_0027405 Ga0495588_0027405_955_1899 310
858 3300046674 Ga0495588_0031167 Ga0495588_0031167_519_1460 310
859 3300046674 Ga0495588_0055912 Ga0495588_0055912_493_1425 310
860 3300046675 Ga0495657_0073728 Ga0495657_0073728_153_1085 310
861 3300046678 Ga0495599_0004944 Ga0495599_0004944_184_1116 310
862 3300046679 Ga0495623_0011364 Ga0495623_0011364_918_1853 310
863 3300046680 Ga0495646_0012052 Ga0495646_0012052_1538_2470 310
864 3300046684 Ga0495669_0000116 Ga0495669_0000116_9450_10391 310
865 3300046684 Ga0495669_0007431 Ga0495669_0007431_2623_3567 310
866 3300046684 Ga0495669_0011905 Ga0495669_0011905_631_1569 310
867 3300046684 Ga0495669_0030253 Ga0495669_0030253_819_1757 310
868 3300046691 Ga0495670_0001273 Ga0495670_0001273_6169_7107 310
869 3300046691 Ga0495670_0005019 Ga0495670_0005019_2481_3425 310
870 3300046691 Ga0495670_0016363 Ga0495670_0016363_2669_3607 310
871 3300046691 Ga0495670_0041425 Ga0495670_0041425_903_1835 310
872 3300046691 Ga0495670_0049421 Ga0495670_0049421_301_1239 310
873 3300046691 Ga0495670_0072508 Ga0495670_0072508_326_1261 310
874 3300046692 Ga0495671_0002689 Ga0495671_0002689_3133_4074 310
875 3300046692 Ga0495671_0016637 Ga0495671_0016637_838_1773 310
876 3300046694 Ga0495649_0003311 Ga0495649_0003311_8179_9114 310
877 3300046694 Ga0495649_0003561 Ga0495649_0003561_4569_5525 310
878 3300046694 Ga0495649_0011717 Ga0495649_0011717_1009_1947 310
879 3300046694 Ga0495649_0057116 Ga0495649_0057116_216_1163 310
880 3300046694 Ga0495649_0082868 Ga0495649_0082868_626_1561 310
881 3300046794 Ga0495589_0001060 Ga0495589_0001060_13199_14134 310
882 3300046794 Ga0495589_0007613 Ga0495589_0007613_998_1936 310
883 3300046794 Ga0495589_0013208 Ga0495589_0013208_2372_3307 310
884 3300046794 Ga0495589_0017044 Ga0495589_0017044_876_1817 310
885 3300046794 Ga0495589_0019655 Ga0495589_0019655_1575_2507 310
886 3300046810 Ga0495660_0000178 Ga0495660_0000178_56009_56944 310
887 3300046810 Ga0495660_0020825 Ga0495660_0020825_2610_3557 310
888 3300046810 Ga0495660_0070404 Ga0495660_0070404_433_1371 310
889 3300046810 Ga0495660_0070610 Ga0495660_0070610_675_1640 310
890 3300046810 Ga0495660_0108124 Ga0495660_0108124_460_1404 310
891 3300046810 Ga0495660_0117839 Ga0495660_0117839_130_1068 310
892 3300047317 Ga0495604_0027131 Ga0495604_0027131_2471_3406 310
893 3300047320 Ga0495672_0000033 Ga0495672_0000033_279686_280624 310
894 3300047320 Ga0495672_0000437 Ga0495672_0000437_7472_8416 310
895 3300047320 Ga0495672_0001623 Ga0495672_0001623_12071_13009 310
896 3300047320 Ga0495672_0009440 Ga0495672_0009440_1022_1957 310
897 3300047320 Ga0495672_0010123 Ga0495672_0010123_503_1447 310
898 3300047320 Ga0495672_0072525 Ga0495672_0072525_388_1326 310
899 3300047321 Ga0495676_0000121 Ga0495676_0000121_42321_43262 310
900 3300047321 Ga0495676_0049524 Ga0495676_0049524_1471_2457 310
901 3300047322 Ga0495680_0007548 Ga0495680_0007548_8957_9889 310
902 3300047323 Ga0495683_0000182 Ga0495683_0000182_8671_9609 310
903 3300047323 Ga0495683_0001151 Ga0495683_0001151_12729_13667 310
904 3300047323 Ga0495683_0011839 Ga0495683_0011839_3407_4354 310
905 3300047323 Ga0495683_0018583 Ga0495683_0018583_583_1521 310
906 3300047323 Ga0495683_0020136 Ga0495683_0020136_1908_2843 310
907 3300047323 Ga0495683_0020827 Ga0495683_0020827_1162_2094 310
908 3300047443 Ga0495687_000017 Ga0495687_000017_174582_175526 310
909 3300047443 Ga0495687_000024 Ga0495687_000024_254592_255527 310
910 3300047443 Ga0495687_000458 Ga0495687_000458_36064_37011 310
911 3300047443 Ga0495687_014022 Ga0495687_014022_2258_3193 310
912 3300047444 Ga0495675_0016790 Ga0495675_0016790_2772_3716 310
913 3300047445 Ga0495677_0000117 Ga0495677_0000117_982_1917 310
914 3300047445 Ga0495677_0003340 Ga0495677_0003340_3203_4147 310
915 3300047445 Ga0495677_0004846 Ga0495677_0004846_1032_1970 310
916 3300047445 Ga0495677_0005027 Ga0495677_0005027_118_1056 310
917 3300047445 Ga0495677_0005223 Ga0495677_0005223_1141_2079 310
918 3300047445 Ga0495677_0008846 Ga0495677_0008846_2386_3321 310
919 3300047445 Ga0495677_0010361 Ga0495677_0010361_1513_2454 310
920 3300047445 Ga0495677_0017662 Ga0495677_0017662_906_1841 310
921 3300047445 Ga0495677_0026283 Ga0495677_0026283_209_1156 310
922 3300047445 Ga0495677_0027824 Ga0495677_0027824_132_1064 310
923 3300047445 Ga0495677_0028764 Ga0495677_0028764_331_1269 310
924 3300047445 Ga0495677_0029631 Ga0495677_0029631_380_1315 310
925 3300047446 Ga0495679_003474 Ga0495679_003474_573_1511 310
926 3300047446 Ga0495679_004009 Ga0495679_004009_146_1093 310
927 3300047446 Ga0495679_013040 Ga0495679_013040_1217_2152 310
928 3300047447 Ga0495685_004997 Ga0495685_004997_2427_3359 310
929 3300047470 Ga0495681_0000994 Ga0495681_0000994_15912_16859 310
930 3300047470 Ga0495681_0012084 Ga0495681_0012084_1826_2770 310
931 3300047470 Ga0495681_0014560 Ga0495681_0014560_962_1897 310
932 3300047470 Ga0495681_0023578 Ga0495681_0023578_128_1063 310
933 3300047470 Ga0495681_0031695 Ga0495681_0031695_140_1075 310
934 3300047470 Ga0495681_0058051 Ga0495681_0058051_40_978 310
935 3300047472 Ga0495686_0000591 Ga0495686_0000591_3223_4161 310
936 3300047472 Ga0495686_0001614 Ga0495686_0001614_12261_13205 310
937 3300047472 Ga0495686_0082989 Ga0495686_0082989_168_1106 310
938 3300047673 Ga0495593_0088157 Ga0495593_0088157_302_1246 310
939 3300048088 Ga0495602_0077771 Ga0495602_0077771_1567_2505 310
940 3300048089 Ga0495614_0004132 Ga0495614_0004132_3123_4067 310
941 3300048091 Ga0495626_0000004 Ga0495626_0000004_289512_290447 310
942 3300048091 Ga0495626_0000016 Ga0495626_0000016_26903_27838 310
943 3300048091 Ga0495626_0000693 Ga0495626_0000693_802_1737 310
944 3300048091 Ga0495626_0006971 Ga0495626_0006971_985_1923 310
945 3300048091 Ga0495626_0012875 Ga0495626_0012875_2797_3732 310
946 3300048091 Ga0495626_0015332 Ga0495626_0015332_12_950 310
947 3300048091 Ga0495626_0030305 Ga0495626_0030305_1535_2473 310
948 3300048091 Ga0495626_0035415 Ga0495626_0035415_1321_2253 310
949 3300048091 Ga0495626_0042550 Ga0495626_0042550_195_1133 310
950 3300048091 Ga0495626_0042772 Ga0495626_0042772_728_1666 310
951 3300048091 Ga0495626_0079806 Ga0495626_0079806_284_1231 310
952 3300048904 Ga0496101_0100541 Ga0496101_0100541_1051_1986 310
953 3300048905 Ga0496102_0000340 Ga0496102_0000340_53153_54088 310
954 3300048905 Ga0496102_0189580 Ga0496102_0189580_373_1308 310
955 3300048905 Ga0496102_0285842 Ga0496102_0285842_512_1447 310
956 3300048906 Ga0496103_0013246 Ga0496103_0013246_83_1018 310
957 3300048906 Ga0496103_0201425 Ga0496103_0201425_178_1113 310
958 3300048909 Ga0496106_0239107 Ga0496106_0239107_113_1048 310
959 3300048912 Ga0496109_0005210 Ga0496109_0005210_8891_9826 310
960 3300048913 Ga0496110_0004929 Ga0496110_0004929_1207_2142 310
961 3300048915 Ga0496112_0321442 Ga0496112_0321442_274_1209 310
962 3300048916 Ga0496113_0023519 Ga0496113_0023519_2419_3354 310
963 3300048916 Ga0496113_0176820 Ga0496113_0176820_489_1424 310
964 3300048918 Ga0496115_0143915 Ga0496115_0143915_405_1340 310
965 3300048924 Ga0496121_0046034 Ga0496121_0046034_2277_3209 310
966 3300048925 Ga0496122_0009237 Ga0496122_0009237_1051_1986 310
967 3300048925 Ga0496122_0009551 Ga0496122_0009551_450_1385 310
968 3300048925 Ga0496122_0090290 Ga0496122_0090290_161_1096 310
969 3300048926 Ga0496123_0026217 Ga0496123_0026217_2388_3323 310
970 3300048926 Ga0496123_0042315 Ga0496123_0042315_149_1084 310
971 3300048926 Ga0496123_0093738 Ga0496123_0093738_511_1446 310
972 3300048927 Ga0496124_0002724 Ga0496124_0002724_10873_11811 310
973 3300048927 Ga0496124_0003292 Ga0496124_0003292_8404_9348 310
974 3300048927 Ga0496124_0035599 Ga0496124_0035599_1132_2067 310
975 3300048927 Ga0496124_0056406 Ga0496124_0056406_1017_1952 310
976 3300048927 Ga0496124_0091173 Ga0496124_0091173_1050_2018 310
977 3300048928 Ga0496125_0103905 Ga0496125_0103905_776_1711 310
978 3300048928 Ga0496125_0203493 Ga0496125_0203493_146_1081 310
979 3300049128 Ga0501308_000102 Ga0501308_000102_945_1880 310
980 3300049160 Ga0501304_000184 Ga0501304_000184_949_1884 310
981 3300049459 Ga0495678_000275 Ga0495678_000275_10685_11623 310
982 3300049459 Ga0495678_000746 Ga0495678_000746_27501_28466 310
983 3300049459 Ga0495678_001983 Ga0495678_001983_7676_8623 310
984 3300049459 Ga0495678_002319 Ga0495678_002319_2370_3305 310
985 3300049459 Ga0495678_004447 Ga0495678_004447_943_1878 310
986 3300049459 Ga0495678_014319 Ga0495678_014319_2175_3140 310
987 3300049460 Ga0495682_0002099 Ga0495682_0002099_2401_3366 310
988 3300049460 Ga0495682_0017114 Ga0495682_0017114_812_1750 310
989 3300049460 Ga0495682_0019757 Ga0495682_0019757_1497_2435 310
990 3300049460 Ga0495682_0027473 Ga0495682_0027473_54_992 310
991 3300049460 Ga0495682_0074150 Ga0495682_0074150_47_982 310
992 3300049583 Ga0501067_0003287 Ga0501067_0003287_7452_8405 310
993 3300049584 Ga0501068_0000097 Ga0501068_0000097_16768_17721 310
994 3300049586 Ga0501070_0003050 Ga0501070_0003050_11389_12342 310
995 3300049587 Ga0501071_0068445 Ga0501071_0068445_1576_2529 310
996 3300049588 Ga0501072_0028213 Ga0501072_0028213_3379_4332 310
997 3300049589 Ga0501073_0000086 Ga0501073_0000086_18245_19198 310
998 3300049590 Ga0501074_0057987 Ga0501074_0057987_820_1773 310
999 3300049592 Ga0501076_0061458 Ga0501076_0061458_1142_2095 310
1000 3300049593 Ga0501077_0001839 Ga0501077_0001839_10050_11003 310
1001 3300049741 Ga0501079_0000201 Ga0501079_0000201_17216_18169 310
1002 3300049742 Ga0501080_0003269 Ga0501080_0003269_10634_11587 310
1003 3300049744 Ga0501083_0001294 Ga0501083_0001294_15851_16804 310
1004 3300049822 Ga0501035_0004380 Ga0501035_0004380_2127_3062 310
1005 3300054114 Ga0501084_0001279 Ga0501084_0001279_18746_19699 310
1006 3300059640 Ga0587067_002624 Ga0587067_002624_945_1880 310
1007 3300061719 Ga0466962_0108370 Ga0466962_0108370_16_963 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

25

327

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.987 2 308
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9869 2 306
6u0j-assembly1.cif.gz_A crosslinked crystal structure of malonyl-coa acyl carrier protein transacylase, fabd, and acyl carrier protein, acpp 0.985 1 306
3tqe-assembly1.cif.gz_A structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii 0.9831 2 307
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9809 3 306
ID Description Score Start End Superfamily
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9851 6 285 3.20.10.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9782 6 285 3.20.10.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.978 3 307 3.40.366.10
3tqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9744 124 196 3.30.70.250
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.971 4 308 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A2T8QRA5-F1-model_v4 deleted 0.9933 198 307
AF-V5U0C8-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9919 23 307 GO:0004314
GO:0005829
GO:0006633
AF-A0A378CU40-F1-model_v4 deleted 0.9914 183 307
AF-A0A7W9TU84-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9903 2 309 GO:0004314
GO:0005829
GO:0006633
AF-A0A1H7MJD1-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9903 2 310 GO:0004314
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
96.84 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map