F488035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 431 | 992 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10019811|Ga0157369_100198112 |
| Length | 340 |
| Sequence | LGGHELRYPLIAPRPAPAGVFMPFAFVFPGQGSQSIGMMAKLAASGPVIRETFDEASAVLGYDLWQVVENGPAEKLNSTEVTQPAMLAAGIATWRLWQQRDGARPSVVAGHSLGEFTALVCAEALDFGPAIDLVRFRGKVMQEAAPAGTGAMAAVLGLSEADIELACREAAQGEVVQAVNFNSPGQIVIAGHAGAVQRAIEAAKARGAKRAVLLALSVPSHSSLMQPAAKRLEERLADIELRTPRIRYVSAVDAAAHQAPEDIRALLVRQVASPVRWTDTVTALAGNDISAVIECGPGKVLMGLSRRIVQREGLTYMALEDPDSVTAALAASAPGGAAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 5 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 8 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 9 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 10 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 11 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 12 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 13 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 192 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 202 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 233 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 234 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 248 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 249 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 250 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 251 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 252 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 253 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 265 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 272 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 412 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 416 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 417 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 425 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 426 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 430 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 431 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 1.39 |
| Isolates | 1.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.37 |
| Nodule | 0.1 |
| Rhizoplane | 2.78 |
| Rhizosphere | 84.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1004435 | 3300002705 | Bacteria | 4274 |
| 2 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 3 | JGI25154J39366_1002733 | 3300002738 | Bacteria | 4282 |
| 4 | JGI25150J39212_1005125 | 3300002774 | Bacteria | 2829 |
| 5 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 6 | rootL2_10014064 | 3300003322 | Bacteria | 12412 |
| 7 | rootL2_10091680 | 3300003322 | Bacteria | 3922 |
| 8 | Ga0007410J51695_1012750 | 3300003574 | Bacteria | 9424 |
| 9 | Ga0007409J51694_1006362 | 3300003575 | Bacteria | 11752 |
| 10 | Ga0007416J51690_1012585 | 3300003577 | Bacteria | 9861 |
| 11 | Ga0032354_1023937 | 3300003693 | Bacteria | 8937 |
| 12 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 13 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 14 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 15 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 16 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 17 | Ga0055542_1010239 | 3300003762 | Bacteria | 1723 |
| 18 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 19 | Ga0065707_10082492 | 3300005295 | Bacteria | 14544 |
| 20 | Ga0070676_10102203 | 3300005328 | Bacteria | 1773 |
| 21 | Ga0070683_100016811 | 3300005329 | Bacteria | 6455 |
| 22 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 23 | Ga0070670_100025491 | 3300005331 | Bacteria | 5086 |
| 24 | Ga0070670_100127161 | 3300005331 | Bacteria | 2200 |
| 25 | Ga0068869_100040075 | 3300005334 | Bacteria | 3347 |
| 26 | Ga0068869_100087511 | 3300005334 | Bacteria | 2337 |
| 27 | Ga0068869_100182469 | 3300005334 | Bacteria | 1646 |
| 28 | Ga0068869_100450708 | 3300005334 | Bacteria | 1066 |
| 29 | Ga0070666_10015694 | 3300005335 | Bacteria | 4834 |
| 30 | Ga0070666_10036180 | 3300005335 | Bacteria | 3275 |
| 31 | Ga0070666_10049131 | 3300005335 | Bacteria | 2834 |
| 32 | Ga0070680_100026542 | 3300005336 | Bacteria | 4632 |
| 33 | Ga0070680_100085042 | 3300005336 | Bacteria | 2613 |
| 34 | Ga0070682_100003924 | 3300005337 | Bacteria | 8253 |
| 35 | Ga0070660_100014318 | 3300005339 | Bacteria | 5713 |
| 36 | Ga0070660_100041122 | 3300005339 | Bacteria | 3522 |
| 37 | Ga0070689_100008006 | 3300005340 | Bacteria | 7417 |
| 38 | Ga0070689_100016914 | 3300005340 | Bacteria | 5345 |
| 39 | Ga0070687_100160380 | 3300005343 | Bacteria | 1329 |
| 40 | Ga0070661_100000813 | 3300005344 | Bacteria | 22437 |
| 41 | Ga0070661_100036959 | 3300005344 | Bacteria | 3551 |
| 42 | Ga0070661_100175855 | 3300005344 | Bacteria | 1627 |
| 43 | Ga0070668_100023143 | 3300005347 | Bacteria | 4696 |
| 44 | Ga0070669_100046626 | 3300005353 | Bacteria | 3161 |
| 45 | Ga0070669_100164633 | 3300005353 | Bacteria | 1725 |
| 46 | Ga0070675_100024523 | 3300005354 | Bacteria | 4830 |
| 47 | Ga0070675_100031692 | 3300005354 | Bacteria | 4276 |
| 48 | Ga0070675_100057275 | 3300005354 | Bacteria | 3212 |
| 49 | Ga0070675_100177229 | 3300005354 | Bacteria | 1841 |
| 50 | Ga0070671_100000018 | 3300005355 | Bacteria | 147427 |
| 51 | Ga0070671_100010483 | 3300005355 | Bacteria | 7437 |
| 52 | Ga0070674_100003565 | 3300005356 | Bacteria | 8749 |
| 53 | Ga0070674_100013910 | 3300005356 | Bacteria | 4989 |
| 54 | Ga0070673_100060284 | 3300005364 | Bacteria | 3006 |
| 55 | Ga0070688_100004521 | 3300005365 | Bacteria | 7253 |
| 56 | Ga0070688_100099691 | 3300005365 | Bacteria | 1913 |
| 57 | Ga0070659_100053692 | 3300005366 | Bacteria | 3172 |
| 58 | Ga0070659_100070043 | 3300005366 | Bacteria | 2785 |
| 59 | Ga0070667_100000026 | 3300005367 | Bacteria | 183244 |
| 60 | Ga0070667_100020275 | 3300005367 | Bacteria | 5519 |
| 61 | Ga0070667_100049400 | 3300005367 | Bacteria | 3543 |
| 62 | Ga0070667_100247902 | 3300005367 | Bacteria | 1592 |
| 63 | Ga0070713_100212468 | 3300005436 | Bacteria | 1752 |
| 64 | Ga0070713_100230531 | 3300005436 | Bacteria | 1683 |
| 65 | Ga0070701_10052915 | 3300005438 | Bacteria | 2111 |
| 66 | Ga0070701_10058065 | 3300005438 | Bacteria | 2030 |
| 67 | Ga0070705_100009205 | 3300005440 | Bacteria | 4905 |
| 68 | Ga0070663_100079890 | 3300005455 | Bacteria | 2401 |
| 69 | Ga0070663_100240090 | 3300005455 | Bacteria | 1430 |
| 70 | Ga0070678_100025418 | 3300005456 | Bacteria | 3983 |
| 71 | Ga0070662_100014371 | 3300005457 | Bacteria | 5287 |
| 72 | Ga0070662_100038172 | 3300005457 | Bacteria | 3410 |
| 73 | Ga0070681_10005499 | 3300005458 | Bacteria | 12241 |
| 74 | Ga0070681_10229940 | 3300005458 | Bacteria | 1769 |
| 75 | Ga0068867_100005237 | 3300005459 | Bacteria | 9153 |
| 76 | Ga0068867_100032317 | 3300005459 | Bacteria | 3784 |
| 77 | Ga0068867_100034852 | 3300005459 | Bacteria | 3649 |
| 78 | Ga0068867_100113656 | 3300005459 | Bacteria | 2084 |
| 79 | Ga0070685_10000007 | 3300005466 | Bacteria | 180539 |
| 80 | Ga0070685_10159859 | 3300005466 | Bacteria | 1435 |
| 81 | Ga0070706_100140325 | 3300005467 | Bacteria | 2256 |
| 82 | Ga0070679_100008554 | 3300005530 | Bacteria | 9641 |
| 83 | Ga0070679_100046729 | 3300005530 | Bacteria | 4316 |
| 84 | Ga0070679_100422533 | 3300005530 | Bacteria | 1278 |
| 85 | Ga0070684_100005117 | 3300005535 | Bacteria | 10018 |
| 86 | Ga0068853_100099084 | 3300005539 | Bacteria | 2574 |
| 87 | Ga0070672_100019627 | 3300005543 | Bacteria | 4910 |
| 88 | Ga0070672_100034611 | 3300005543 | Bacteria | 3835 |
| 89 | Ga0070672_100118028 | 3300005543 | Bacteria | 2169 |
| 90 | Ga0070672_100308130 | 3300005543 | Bacteria | 1343 |
| 91 | Ga0070686_100009512 | 3300005544 | Bacteria | 5465 |
| 92 | Ga0070686_100027798 | 3300005544 | Bacteria | 3425 |
| 93 | Ga0070696_100031637 | 3300005546 | Bacteria | 3627 |
| 94 | Ga0070696_100087225 | 3300005546 | Bacteria | 2217 |
| 95 | Ga0070665_100044195 | 3300005548 | Bacteria | 4474 |
| 96 | Ga0070665_100068997 | 3300005548 | Bacteria | 3543 |
| 97 | Ga0070665_100567097 | 3300005548 | Bacteria | 1148 |
| 98 | Ga0070704_100032448 | 3300005549 | Bacteria | 3523 |
| 99 | Ga0070704_100135283 | 3300005549 | Bacteria | 1916 |
| 100 | Ga0070704_100321259 | 3300005549 | Bacteria | 1297 |
| 101 | Ga0068855_100008719 | 3300005563 | Bacteria | 12260 |
| 102 | Ga0068855_100031837 | 3300005563 | Bacteria | 6296 |
| 103 | Ga0068855_100220292 | 3300005563 | Bacteria | 2128 |
| 104 | Ga0070664_100012001 | 3300005564 | Bacteria | 7036 |
| 105 | Ga0070664_100014812 | 3300005564 | Bacteria | 6365 |
| 106 | Ga0070664_100065531 | 3300005564 | Bacteria | 3099 |
| 107 | Ga0070664_100216824 | 3300005564 | Bacteria | 1711 |
| 108 | Ga0068857_100006850 | 3300005577 | Bacteria | 9807 |
| 109 | Ga0068857_100140938 | 3300005577 | Bacteria | 2179 |
| 110 | Ga0068857_100396467 | 3300005577 | Bacteria | 1284 |
| 111 | Ga0068857_100463351 | 3300005577 | Bacteria | 1186 |
| 112 | Ga0068854_100005152 | 3300005578 | Bacteria | 8239 |
| 113 | Ga0068856_100016323 | 3300005614 | Bacteria | 7186 |
| 114 | Ga0068856_100092120 | 3300005614 | Bacteria | 3015 |
| 115 | Ga0070702_100017140 | 3300005615 | Bacteria | 3730 |
| 116 | Ga0068852_100001206 | 3300005616 | Bacteria | 17155 |
| 117 | Ga0068852_100095514 | 3300005616 | Bacteria | 2669 |
| 118 | Ga0068859_100001745 | 3300005617 | Bacteria | 22159 |
| 119 | Ga0068859_100007685 | 3300005617 | Bacteria | 10950 |
| 120 | Ga0068859_100080974 | 3300005617 | Bacteria | 3289 |
| 121 | Ga0068859_100115963 | 3300005617 | Bacteria | 2743 |
| 122 | Ga0068859_100150062 | 3300005617 | Bacteria | 2406 |
| 123 | Ga0068859_100223012 | 3300005617 | Bacteria | 1973 |
| 124 | Ga0068864_100000012 | 3300005618 | Bacteria | 335070 |
| 125 | Ga0068864_100037858 | 3300005618 | Bacteria | 4118 |
| 126 | Ga0068866_10150941 | 3300005718 | Bacteria | 1345 |
| 127 | Ga0068861_100000962 | 3300005719 | Bacteria | 17544 |
| 128 | Ga0068861_100074083 | 3300005719 | Bacteria | 2647 |
| 129 | Ga0068861_100101784 | 3300005719 | Bacteria | 2286 |
| 130 | Ga0068861_100208178 | 3300005719 | Bacteria | 1646 |
| 131 | Ga0068861_100335508 | 3300005719 | Bacteria | 1322 |
| 132 | Ga0068863_100008065 | 3300005841 | Bacteria | 10283 |
| 133 | Ga0068863_100017541 | 3300005841 | Bacteria | 6862 |
| 134 | Ga0068858_100001018 | 3300005842 | Bacteria | 28907 |
| 135 | Ga0068858_100016226 | 3300005842 | Bacteria | 6997 |
| 136 | Ga0068858_100017352 | 3300005842 | Bacteria | 6752 |
| 137 | Ga0068858_100428549 | 3300005842 | Bacteria | 1272 |
| 138 | Ga0068860_100004168 | 3300005843 | Bacteria | 14825 |
| 139 | Ga0068860_100007832 | 3300005843 | Bacteria | 10665 |
| 140 | Ga0068862_100001146 | 3300005844 | Bacteria | 25101 |
| 141 | Ga0068862_100033113 | 3300005844 | Bacteria | 4366 |
| 142 | Ga0068862_100036344 | 3300005844 | Bacteria | 4176 |
| 143 | Ga0068862_100209238 | 3300005844 | Bacteria | 1762 |
| 144 | Ga0075363_100002122 | 3300006048 | Bacteria | 7961 |
| 145 | Ga0075367_10013597 | 3300006178 | Bacteria | 4381 |
| 146 | Ga0075369_10064583 | 3300006186 | Bacteria | 1603 |
| 147 | Ga0075366_10123535 | 3300006195 | Bacteria | 1560 |
| 148 | Ga0097621_100068678 | 3300006237 | Bacteria | 2924 |
| 149 | Ga0068871_100100355 | 3300006358 | Bacteria | 2424 |
| 150 | Ga0075430_100011821 | 3300006846 | Bacteria | 7428 |
| 151 | Ga0075431_100035076 | 3300006847 | Bacteria | 5167 |
| 152 | Ga0075431_100104471 | 3300006847 | Bacteria | 2923 |
| 153 | Ga0068865_100008565 | 3300006881 | Bacteria | 6322 |
| 154 | Ga0068865_100023560 | 3300006881 | Bacteria | 4032 |
| 155 | Ga0068865_100278869 | 3300006881 | Bacteria | 1330 |
| 156 | Ga0097620_100001745 | 3300006931 | Bacteria | 22159 |
| 157 | Ga0097620_100007685 | 3300006931 | Bacteria | 10950 |
| 158 | Ga0097620_100080966 | 3300006931 | Bacteria | 3289 |
| 159 | Ga0097620_100115964 | 3300006931 | Bacteria | 2743 |
| 160 | Ga0097620_100150062 | 3300006931 | Bacteria | 2406 |
| 161 | Ga0097620_100223007 | 3300006931 | Bacteria | 1973 |
| 162 | Ga0099795_10000014 | 3300007788 | Bacteria | 67566 |
| 163 | Ga0105240_10019812 | 3300009093 | Bacteria | 8986 |
| 164 | Ga0105240_10038598 | 3300009093 | Bacteria | 6124 |
| 165 | Ga0105240_10059153 | 3300009093 | Bacteria | 4783 |
| 166 | Ga0105240_10328511 | 3300009093 | Bacteria | 1741 |
| 167 | Ga0111539_10012880 | 3300009094 | Bacteria | 10466 |
| 168 | Ga0111539_10429433 | 3300009094 | Bacteria | 1538 |
| 169 | Ga0105247_10001941 | 3300009101 | Bacteria | 14376 |
| 170 | Ga0105247_10018455 | 3300009101 | Bacteria | 4184 |
| 171 | Ga0105247_10202911 | 3300009101 | Bacteria | 1333 |
| 172 | Ga0105243_10216785 | 3300009148 | Bacteria | 1689 |
| 173 | Ga0105241_10044133 | 3300009174 | Bacteria | 3377 |
| 174 | Ga0105241_10082865 | 3300009174 | Bacteria | 2515 |
| 175 | Ga0105242_10030398 | 3300009176 | Bacteria | 4313 |
| 176 | Ga0105242_10045340 | 3300009176 | Bacteria | 3563 |
| 177 | Ga0105242_10054998 | 3300009176 | Bacteria | 3255 |
| 178 | Ga0105248_10123619 | 3300009177 | Bacteria | 2919 |
| 179 | Ga0105248_10263891 | 3300009177 | Bacteria | 1939 |
| 180 | Ga0105237_10023342 | 3300009545 | Bacteria | 6339 |
| 181 | Ga0105237_10310823 | 3300009545 | Bacteria | 1579 |
| 182 | Ga0105238_10003217 | 3300009551 | Bacteria | 16314 |
| 183 | Ga0105238_10049013 | 3300009551 | Bacteria | 4255 |
| 184 | Ga0105238_10371117 | 3300009551 | Bacteria | 1421 |
| 185 | Ga0105249_10070890 | 3300009553 | Bacteria | 3218 |
| 186 | Ga0105249_10086586 | 3300009553 | Bacteria | 2922 |
| 187 | Ga0105249_10103644 | 3300009553 | Bacteria | 2680 |
| 188 | Ga0105249_10263908 | 3300009553 | Bacteria | 1712 |
| 189 | Ga0099796_10000054 | 3300010159 | Bacteria | 20546 |
| 190 | Ga0157373_10006638 | 3300013100 | Bacteria | 8623 |
| 191 | Ga0157371_10000078 | 3300013102 | Bacteria | 154095 |
| 192 | Ga0157370_10031830 | 3300013104 | Bacteria | 5156 |
| 193 | Ga0157369_10001598 | 3300013105 | Bacteria | 27722 |
| 194 | Ga0157369_10004689 | 3300013105 | Bacteria | 16077 |
| 195 | Ga0157369_10019811 | 3300013105 | Bacteria | 7529 |
| 196 | Ga0157374_10265654 | 3300013296 | Bacteria | 1691 |
| 197 | Ga0157378_10012175 | 3300013297 | Bacteria | 7532 |
| 198 | Ga0163162_10002139 | 3300013306 | Bacteria | 18531 |
| 199 | Ga0163162_10012636 | 3300013306 | Bacteria | 8244 |
| 200 | Ga0163162_10021561 | 3300013306 | Bacteria | 6346 |
| 201 | Ga0163162_10033867 | 3300013306 | Bacteria | 5079 |
| 202 | Ga0157372_10020911 | 3300013307 | Bacteria | 7064 |
| 203 | Ga0157372_10124114 | 3300013307 | Bacteria | 2968 |
| 204 | Ga0157372_10651454 | 3300013307 | Bacteria | 1226 |
| 205 | Ga0157375_10088560 | 3300013308 | Bacteria | 3151 |
| 206 | Ga0157375_10160315 | 3300013308 | Bacteria | 2391 |
| 207 | Ga0157375_10171726 | 3300013308 | Bacteria | 2316 |
| 208 | Ga0157375_10310817 | 3300013308 | Bacteria | 1740 |
| 209 | Ga0163163_10000051 | 3300014325 | Bacteria | 128275 |
| 210 | Ga0163163_10089960 | 3300014325 | Bacteria | 3083 |
| 211 | Ga0163163_10144606 | 3300014325 | Bacteria | 2421 |
| 212 | Ga0157380_10020523 | 3300014326 | Bacteria | 4939 |
| 213 | Ga0157380_10080085 | 3300014326 | Bacteria | 2669 |
| 214 | Ga0157380_10189332 | 3300014326 | Bacteria | 1815 |
| 215 | Ga0182008_10103316 | 3300014497 | Bacteria | 1409 |
| 216 | Ga0182008_10117790 | 3300014497 | Bacteria | 1318 |
| 217 | Ga0157379_10006122 | 3300014968 | Bacteria | 10357 |
| 218 | Ga0157379_10034926 | 3300014968 | Bacteria | 4482 |
| 219 | Ga0157379_10247486 | 3300014968 | Bacteria | 1618 |
| 220 | Ga0157379_10704311 | 3300014968 | Bacteria | 948 |
| 221 | Ga0157376_10222159 | 3300014969 | Bacteria | 1750 |
| 222 | Ga0157376_10396632 | 3300014969 | Bacteria | 1333 |
| 223 | Ga0182006_1010763 | 3300015261 | Bacteria | 4051 |
| 224 | Ga0182007_10021648 | 3300015262 | Bacteria | 2279 |
| 225 | Ga0182005_1000307 | 3300015265 | Bacteria | 29530 |
| 226 | Ga0163161_10012670 | 3300017792 | Bacteria | 5856 |
| 227 | Ga0163161_10165647 | 3300017792 | Bacteria | 1687 |
| 228 | Ga0213872_10000263 | 3300021361 | Bacteria | 45483 |
| 229 | Ga0213872_10001047 | 3300021361 | Bacteria | 19247 |
| 230 | Ga0213872_10011598 | 3300021361 | Bacteria | 4166 |
| 231 | Ga0213872_10012586 | 3300021361 | Bacteria | 3979 |
| 232 | Ga0213874_10066299 | 3300021377 | Unclassified | 1142 |
| 233 | Ga0213876_10107712 | 3300021384 | Bacteria | 1479 |
| 234 | Ga0209435_100716 | 3300025206 | Bacteria | 5582 |
| 235 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 236 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 237 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 238 | Ga0209672_106450 | 3300025228 | Bacteria | 1903 |
| 239 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 240 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 241 | Ga0207427_100255 | 3300025231 | Bacteria | 41856 |
| 242 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 243 | Ga0207425_1001639 | 3300025245 | Bacteria | 9024 |
| 244 | Ga0209646_1000872 | 3300025246 | Bacteria | 10050 |
| 245 | Ga0209026_1003950 | 3300025250 | Bacteria | 4633 |
| 246 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 247 | Ga0209148_1000992 | 3300025254 | Bacteria | 18267 |
| 248 | Ga0209759_1000359 | 3300025256 | Bacteria | 58766 |
| 249 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 250 | Ga0209025_1016263 | 3300025294 | Bacteria | 4408 |
| 251 | Ga0209758_1002044 | 3300025297 | Bacteria | 21637 |
| 252 | Ga0207682_10000363 | 3300025893 | Bacteria | 20824 |
| 253 | Ga0207682_10000537 | 3300025893 | Bacteria | 17474 |
| 254 | Ga0207682_10004847 | 3300025893 | Bacteria | 5566 |
| 255 | Ga0207642_10030040 | 3300025899 | Bacteria | 2258 |
| 256 | Ga0207642_10081710 | 3300025899 | Bacteria | 1571 |
| 257 | Ga0207710_10000230 | 3300025900 | Bacteria | 48621 |
| 258 | Ga0207710_10070795 | 3300025900 | Bacteria | 1599 |
| 259 | Ga0207680_10004217 | 3300025903 | Bacteria | 6806 |
| 260 | Ga0207680_10041684 | 3300025903 | Bacteria | 2681 |
| 261 | Ga0207645_10000178 | 3300025907 | Bacteria | 50810 |
| 262 | Ga0207645_10008955 | 3300025907 | Bacteria | 6949 |
| 263 | Ga0207645_10144605 | 3300025907 | Bacteria | 1550 |
| 264 | Ga0207643_10020654 | 3300025908 | Bacteria | 3615 |
| 265 | Ga0207643_10035424 | 3300025908 | Bacteria | 2799 |
| 266 | Ga0207643_10174565 | 3300025908 | Bacteria | 1298 |
| 267 | Ga0207705_10023618 | 3300025909 | Bacteria | 4386 |
| 268 | Ga0207654_10280643 | 3300025911 | Bacteria | 1127 |
| 269 | Ga0207707_10024558 | 3300025912 | Bacteria | 5275 |
| 270 | Ga0207707_10045689 | 3300025912 | Bacteria | 3816 |
| 271 | Ga0207695_10018572 | 3300025913 | Bacteria | 8033 |
| 272 | Ga0207695_10032578 | 3300025913 | Bacteria | 5700 |
| 273 | Ga0207695_10073110 | 3300025913 | Bacteria | 3495 |
| 274 | Ga0207695_10109895 | 3300025913 | Bacteria | 2738 |
| 275 | Ga0207695_10235923 | 3300025913 | Bacteria | 1732 |
| 276 | Ga0207671_10182076 | 3300025914 | Bacteria | 1635 |
| 277 | Ga0207660_10027094 | 3300025917 | Bacteria | 3907 |
| 278 | Ga0207660_10094123 | 3300025917 | Bacteria | 2227 |
| 279 | Ga0207662_10015635 | 3300025918 | Bacteria | 4272 |
| 280 | Ga0207662_10109919 | 3300025918 | Bacteria | 1718 |
| 281 | Ga0207657_10019066 | 3300025919 | Bacteria | 6527 |
| 282 | Ga0207657_10037258 | 3300025919 | Bacteria | 4344 |
| 283 | Ga0207649_10000924 | 3300025920 | Bacteria | 18501 |
| 284 | Ga0207649_10035200 | 3300025920 | Bacteria | 3008 |
| 285 | Ga0207652_10375354 | 3300025921 | Bacteria | 1284 |
| 286 | Ga0207694_10003088 | 3300025924 | Bacteria | 13330 |
| 287 | Ga0207694_10015470 | 3300025924 | Bacteria | 5754 |
| 288 | Ga0207694_10040729 | 3300025924 | Bacteria | 3578 |
| 289 | Ga0207694_10260318 | 3300025924 | Bacteria | 1421 |
| 290 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 291 | Ga0207650_10123907 | 3300025925 | Bacteria | 2015 |
| 292 | Ga0207659_10036008 | 3300025926 | Bacteria | 3425 |
| 293 | Ga0207659_10413336 | 3300025926 | Bacteria | 1130 |
| 294 | Ga0207700_10135931 | 3300025928 | Bacteria | 2014 |
| 295 | Ga0207700_10247189 | 3300025928 | Bacteria | 1522 |
| 296 | Ga0207664_10015733 | 3300025929 | Bacteria | 5501 |
| 297 | Ga0207644_10000026 | 3300025931 | Bacteria | 147255 |
| 298 | Ga0207644_10001003 | 3300025931 | Bacteria | 18047 |
| 299 | Ga0207644_10036298 | 3300025931 | Bacteria | 3459 |
| 300 | Ga0207644_10150659 | 3300025931 | Bacteria | 1799 |
| 301 | Ga0207706_10000721 | 3300025933 | Bacteria | 34533 |
| 302 | Ga0207706_10007741 | 3300025933 | Bacteria | 9917 |
| 303 | Ga0207706_10023309 | 3300025933 | Bacteria | 5560 |
| 304 | Ga0207706_10070140 | 3300025933 | Bacteria | 3082 |
| 305 | Ga0207686_10049440 | 3300025934 | Bacteria | 2610 |
| 306 | Ga0207686_10076906 | 3300025934 | Bacteria | 2166 |
| 307 | Ga0207709_10040362 | 3300025935 | Bacteria | 2794 |
| 308 | Ga0207669_10100246 | 3300025937 | Bacteria | 1912 |
| 309 | Ga0207704_10020566 | 3300025938 | Bacteria | 3495 |
| 310 | Ga0207691_10003757 | 3300025940 | Bacteria | 14732 |
| 311 | Ga0207691_10007249 | 3300025940 | Bacteria | 10697 |
| 312 | Ga0207691_10032022 | 3300025940 | Bacteria | 4905 |
| 313 | Ga0207691_10058407 | 3300025940 | Bacteria | 3509 |
| 314 | Ga0207691_10092587 | 3300025940 | Bacteria | 2707 |
| 315 | Ga0207691_10191110 | 3300025940 | Bacteria | 1785 |
| 316 | Ga0207711_10000279 | 3300025941 | Bacteria | 55112 |
| 317 | Ga0207689_10012093 | 3300025942 | Bacteria | 7391 |
| 318 | Ga0207689_10043003 | 3300025942 | Bacteria | 3735 |
| 319 | Ga0207689_10100862 | 3300025942 | Bacteria | 2371 |
| 320 | Ga0207689_10185344 | 3300025942 | Bacteria | 1716 |
| 321 | Ga0207679_10004443 | 3300025945 | Bacteria | 8736 |
| 322 | Ga0207679_10066044 | 3300025945 | Bacteria | 2709 |
| 323 | Ga0207679_10069762 | 3300025945 | Bacteria | 2646 |
| 324 | Ga0207679_10159090 | 3300025945 | Bacteria | 1847 |
| 325 | Ga0207679_10167752 | 3300025945 | Bacteria | 1804 |
| 326 | Ga0207667_10013878 | 3300025949 | Bacteria | 9203 |
| 327 | Ga0207667_10019236 | 3300025949 | Bacteria | 7634 |
| 328 | Ga0207651_10543326 | 3300025960 | Bacteria | 1009 |
| 329 | Ga0207668_10220837 | 3300025972 | Bacteria | 1522 |
| 330 | Ga0207640_10207290 | 3300025981 | Bacteria | 1490 |
| 331 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 332 | Ga0207658_10021308 | 3300025986 | Bacteria | 4497 |
| 333 | Ga0207658_10048303 | 3300025986 | Bacteria | 3120 |
| 334 | Ga0207703_10000931 | 3300026035 | Bacteria | 28414 |
| 335 | Ga0207703_10001837 | 3300026035 | Bacteria | 18926 |
| 336 | Ga0207703_10026533 | 3300026035 | Bacteria | 4560 |
| 337 | Ga0207678_10028049 | 3300026067 | Bacteria | 4917 |
| 338 | Ga0207678_10046744 | 3300026067 | Bacteria | 3743 |
| 339 | Ga0207678_10155218 | 3300026067 | Bacteria | 1954 |
| 340 | Ga0207708_10003301 | 3300026075 | Bacteria | 11873 |
| 341 | Ga0207708_10106735 | 3300026075 | Bacteria | 2172 |
| 342 | Ga0207702_10003782 | 3300026078 | Bacteria | 13659 |
| 343 | Ga0207641_10002241 | 3300026088 | Bacteria | 18054 |
| 344 | Ga0207641_10416560 | 3300026088 | Bacteria | 1292 |
| 345 | Ga0207641_10416561 | 3300026088 | Bacteria | 1292 |
| 346 | Ga0207648_10001407 | 3300026089 | Bacteria | 26493 |
| 347 | Ga0207648_10036960 | 3300026089 | Bacteria | 4302 |
| 348 | Ga0207648_10307240 | 3300026089 | Bacteria | 1423 |
| 349 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 350 | Ga0207676_10005269 | 3300026095 | Bacteria | 9154 |
| 351 | Ga0207676_10008269 | 3300026095 | Bacteria | 7399 |
| 352 | Ga0207674_10000536 | 3300026116 | Bacteria | 49766 |
| 353 | Ga0207674_10083098 | 3300026116 | Bacteria | 3202 |
| 354 | Ga0207674_10260873 | 3300026116 | Bacteria | 1680 |
| 355 | Ga0207674_10281293 | 3300026116 | Bacteria | 1612 |
| 356 | Ga0207675_100000345 | 3300026118 | Bacteria | 44273 |
| 357 | Ga0207675_100001625 | 3300026118 | Bacteria | 22527 |
| 358 | Ga0207675_100009265 | 3300026118 | Bacteria | 9232 |
| 359 | Ga0207675_100010996 | 3300026118 | Bacteria | 8479 |
| 360 | Ga0207675_100012530 | 3300026118 | Bacteria | 7920 |
| 361 | Ga0207675_100105310 | 3300026118 | Bacteria | 2658 |
| 362 | Ga0207675_100276354 | 3300026118 | Bacteria | 1631 |
| 363 | Ga0207675_100287270 | 3300026118 | Bacteria | 1599 |
| 364 | Ga0207683_10034525 | 3300026121 | Bacteria | 4395 |
| 365 | Ga0207683_10047615 | 3300026121 | Bacteria | 3754 |
| 366 | Ga0207683_10064063 | 3300026121 | Bacteria | 3239 |
| 367 | Ga0207698_10012426 | 3300026142 | Bacteria | 5571 |
| 368 | Ga0207698_10057160 | 3300026142 | Bacteria | 3016 |
| 369 | Ga0209179_1000013 | 3300027512 | Bacteria | 62144 |
| 370 | Ga0265354_1000774 | 3300028016 | Bacteria | 5204 |
| 371 | Ga0265356_1002312 | 3300028017 | Bacteria | 2570 |
| 372 | Ga0268266_10001083 | 3300028379 | Bacteria | 34130 |
| 373 | Ga0268266_10004153 | 3300028379 | Bacteria | 13973 |
| 374 | Ga0268266_10047347 | 3300028379 | Bacteria | 3683 |
| 375 | Ga0268266_10409662 | 3300028379 | Bacteria | 1283 |
| 376 | Ga0268265_10001823 | 3300028380 | Bacteria | 17029 |
| 377 | Ga0268265_10025833 | 3300028380 | Bacteria | 4174 |
| 378 | Ga0268265_10284555 | 3300028380 | Bacteria | 1481 |
| 379 | Ga0268264_10000061 | 3300028381 | Bacteria | 303123 |
| 380 | Ga0268264_10000179 | 3300028381 | Bacteria | 134401 |
| 381 | Ga0268264_10027283 | 3300028381 | Bacteria | 4664 |
| 382 | Ga0265319_1020051 | 3300028563 | Bacteria | 2486 |
| 383 | Ga0265334_10000127 | 3300028573 | Bacteria | 48527 |
| 384 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 385 | Ga0307515_10299892 | 3300028794 | Bacteria | 1293 |
| 386 | Ga0265338_10010433 | 3300028800 | Bacteria | 10893 |
| 387 | Ga0265338_10028206 | 3300028800 | Bacteria | 5605 |
| 388 | Ga0307511_10000040 | 3300030521 | Bacteria | 102640 |
| 389 | Ga0265770_1000354 | 3300030878 | Bacteria | 6250 |
| 390 | Ga0265330_10003907 | 3300031235 | Bacteria | 7664 |
| 391 | Ga0265328_10010066 | 3300031239 | Bacteria | 3822 |
| 392 | Ga0265320_10005045 | 3300031240 | Bacteria | 8549 |
| 393 | Ga0265325_10005133 | 3300031241 | Bacteria | 8144 |
| 394 | Ga0265340_10045334 | 3300031247 | Bacteria | 2148 |
| 395 | Ga0265339_10023115 | 3300031249 | Bacteria | 3596 |
| 396 | Ga0265331_10005948 | 3300031250 | Bacteria | 7282 |
| 397 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 398 | Ga0265316_10024185 | 3300031344 | Bacteria | 5096 |
| 399 | Ga0307513_10040878 | 3300031456 | Bacteria | 5123 |
| 400 | Ga0307513_10063236 | 3300031456 | Bacteria | 3906 |
| 401 | Ga0307513_10175972 | 3300031456 | Bacteria | 2010 |
| 402 | Ga0307509_10001628 | 3300031507 | Bacteria | 37634 |
| 403 | Ga0307509_10170332 | 3300031507 | Bacteria | 2058 |
| 404 | Ga0307509_10176859 | 3300031507 | Bacteria | 2005 |
| 405 | Ga0307509_10199032 | 3300031507 | Bacteria | 1843 |
| 406 | Ga0307408_100001210 | 3300031548 | Bacteria | 19453 |
| 407 | Ga0265313_10004752 | 3300031595 | Bacteria | 10242 |
| 408 | Ga0307508_10074771 | 3300031616 | Bacteria | 2965 |
| 409 | Ga0307514_10091103 | 3300031649 | Bacteria | 2222 |
| 410 | Ga0316575_10018347 | 3300031665 | Bacteria | 2666 |
| 411 | Ga0265314_10001695 | 3300031711 | Bacteria | 23953 |
| 412 | Ga0265342_10068460 | 3300031712 | Bacteria | 2074 |
| 413 | Ga0316576_10022743 | 3300031727 | Bacteria | 4357 |
| 414 | Ga0316578_10003631 | 3300031728 | Bacteria | 7109 |
| 415 | Ga0316578_10024545 | 3300031728 | Bacteria | 3382 |
| 416 | Ga0316577_10001334 | 3300031733 | Bacteria | 11567 |
| 417 | Ga0316577_10009802 | 3300031733 | Bacteria | 5162 |
| 418 | Ga0307413_10001755 | 3300031824 | Bacteria | 8486 |
| 419 | Ga0307410_10003357 | 3300031852 | Bacteria | 8019 |
| 420 | Ga0307410_10004428 | 3300031852 | Bacteria | 7260 |
| 421 | Ga0307407_10004906 | 3300031903 | Bacteria | 5743 |
| 422 | Ga0307407_10005254 | 3300031903 | Bacteria | 5596 |
| 423 | Ga0307409_100002705 | 3300031995 | Bacteria | 9350 |
| 424 | Ga0307409_100007342 | 3300031995 | Bacteria | 6585 |
| 425 | Ga0307416_100070648 | 3300032002 | Bacteria | 2896 |
| 426 | Ga0307411_10010509 | 3300032005 | Bacteria | 4939 |
| 427 | Ga0307415_100090684 | 3300032126 | Bacteria | 2212 |
| 428 | Ga0307415_100139537 | 3300032126 | Bacteria | 1849 |
| 429 | Ga0316583_10028218 | 3300032133 | Bacteria | 2002 |
| 430 | Ga0316585_10000956 | 3300032137 | Bacteria | 7410 |
| 431 | Ga0316580_10022804 | 3300032139 | Bacteria | 1932 |
| 432 | Ga0316593_10000472 | 3300032168 | Bacteria | 7413 |
| 433 | Ga0316593_10003014 | 3300032168 | Bacteria | 4104 |
| 434 | Ga0316593_10031252 | 3300032168 | Bacteria | 1734 |
| 435 | Ga0307510_10000013 | 3300033180 | Bacteria | 274569 |
| 436 | Ga0307510_10010455 | 3300033180 | Bacteria | 11024 |
| 437 | Ga0316592_1000192 | 3300033524 | Bacteria | 7310 |
| 438 | Ga0316596_1000369 | 3300033541 | Bacteria | 7411 |
| 439 | Ga0316596_1002070 | 3300033541 | Bacteria | 4227 |
| 440 | Ga0373936_0015718 | 3300035113 | Bacteria | 2902 |
| 441 | Ga0316574_0007763 | 3300035398 | Bacteria | 5905 |
| 442 | Ga0316574_0021798 | 3300035398 | Bacteria | 3807 |
| 443 | Ga0316574_0023127 | 3300035398 | Bacteria | 3708 |
| 444 | Ga0316582_0017047 | 3300036647 | Bacteria | 4191 |
| 445 | Ga0316582_0033533 | 3300036647 | Bacteria | 3155 |
| 446 | Ga0316584_0005374 | 3300036712 | Bacteria | 8593 |
| 447 | Ga0316584_0029740 | 3300036712 | Bacteria | 4033 |
| 448 | Ga0395899_0000128 | 3300037312 | Bacteria | 119014 |
| 449 | Ga0395899_0000904 | 3300037312 | Bacteria | 27911 |
| 450 | Ga0395899_0002101 | 3300037312 | Bacteria | 16364 |
| 451 | Ga0395899_0036149 | 3300037312 | Bacteria | 3706 |
| 452 | Ga0395900_0000874 | 3300037418 | Bacteria | 39520 |
| 453 | Ga0395900_0036284 | 3300037418 | Bacteria | 5082 |
| 454 | Ga0395900_0050571 | 3300037418 | Bacteria | 4280 |
| 455 | Ga0395900_0062747 | 3300037418 | Bacteria | 3819 |
| 456 | Ga0395900_0163739 | 3300037418 | Bacteria | 2267 |
| 457 | Ga0395900_0322603 | 3300037418 | Bacteria | 1524 |
| 458 | Ga0395898_0003704 | 3300037466 | Bacteria | 16960 |
| 459 | Ga0395898_0039391 | 3300037466 | Bacteria | 4677 |
| 460 | Ga0395898_0154334 | 3300037466 | Bacteria | 2196 |
| 461 | Ga0395898_0157087 | 3300037466 | Bacteria | 2175 |
| 462 | Ga0395898_0160048 | 3300037466 | Bacteria | 2153 |
| 463 | Ga0395898_0207310 | 3300037466 | Bacteria | 1870 |
| 464 | Ga0395905_0009571 | 3300037471 | Bacteria | 9461 |
| 465 | Ga0395905_0010272 | 3300037471 | Bacteria | 9114 |
| 466 | Ga0395905_0075118 | 3300037471 | Bacteria | 3167 |
| 467 | Ga0395905_0242584 | 3300037471 | Bacteria | 1684 |
| 468 | Ga0395905_0295595 | 3300037471 | Bacteria | 1506 |
| 469 | Ga0395901_0000054 | 3300038443 | Bacteria | 160505 |
| 470 | Ga0395901_0003565 | 3300038443 | Bacteria | 15697 |
| 471 | Ga0395901_0127852 | 3300038443 | Bacteria | 2671 |
| 472 | Ga0395901_0155312 | 3300038443 | Bacteria | 2403 |
| 473 | Ga0395901_0426283 | 3300038443 | Bacteria | 1359 |
| 474 | Ga0400484_03261 | 3300038725 | Bacteria | 37196 |
| 475 | Ga0400484_07350 | 3300038725 | Bacteria | 7933 |
| 476 | Ga0400490_20091 | 3300038726 | Bacteria | 9857 |
| 477 | Ga0400490_21770 | 3300038726 | Bacteria | 5517 |
| 478 | Ga0400490_45662 | 3300038726 | Bacteria | 38225 |
| 479 | Ga0400490_51771 | 3300038726 | Bacteria | 2053 |
| 480 | Ga0400491_10244 | 3300038727 | Bacteria | 3893 |
| 481 | Ga0400491_16906 | 3300038727 | Bacteria | 2081 |
| 482 | Ga0400488_04816 | 3300038741 | Bacteria | 1117 |
| 483 | Ga0400488_18372 | 3300038741 | Bacteria | 11596 |
| 484 | Ga0400488_23615 | 3300038741 | Bacteria | 4654 |
| 485 | Ga0400488_31619 | 3300038741 | Bacteria | 1531 |
| 486 | Ga0400488_40478 | 3300038741 | Bacteria | 1121 |
| 487 | Ga0400486_10786 | 3300038742 | Bacteria | 2942 |
| 488 | Ga0400483_044439 | 3300039062 | Bacteria | 12231 |
| 489 | Ga0400483_048826 | 3300039062 | Bacteria | 15631 |
| 490 | Ga0400483_163381 | 3300039062 | Bacteria | 10819 |
| 491 | Ga0400487_26214 | 3300039110 | Bacteria | 1642 |
| 492 | Ga0400487_41427 | 3300039110 | Bacteria | 4185 |
| 493 | Ga0400487_47735 | 3300039110 | Bacteria | 59107 |
| 494 | Ga0400487_51105 | 3300039110 | Bacteria | 2410 |
| 495 | Ga0400487_51635 | 3300039110 | Bacteria | 1751 |
| 496 | Ga0436361_0080172 | 3300039447 | Bacteria | 39325 |
| 497 | Ga0436361_0119299 | 3300039447 | Bacteria | 18398 |
| 498 | Ga0436361_0837724 | 3300039447 | Bacteria | 3222 |
| 499 | Ga0436361_0944997 | 3300039447 | Bacteria | 6398 |
| 500 | Ga0436363_0672559 | 3300039450 | Bacteria | 12181 |
| 501 | Ga0436363_1199362 | 3300039450 | Bacteria | 5411 |
| 502 | Ga0436362_0176928 | 3300039453 | Bacteria | 3764 |
| 503 | Ga0451787_573112 | 3300041441 | Bacteria | 2089 |
| 504 | Ga0451789_1220021 | 3300041443 | Bacteria | 1111 |
| 505 | Ga0451793_0865321 | 3300041452 | Bacteria | 1749 |
| 506 | Ga0451795_0279517 | 3300041456 | Bacteria | 1210 |
| 507 | Ga0451807_1281246 | 3300041486 | Bacteria | 2974 |
| 508 | Ga0451853_3198134 | 3300041512 | Bacteria | 1950 |
| 509 | Ga0439448_0003707 | 3300042005 | Bacteria | 4256 |
| 510 | Ga0439448_0045297 | 3300042005 | Bacteria | 1431 |
| 511 | Ga0439450_024169 | 3300042008 | Bacteria | 1323 |
| 512 | Ga0439450_039179 | 3300042008 | Bacteria | 1094 |
| 513 | Ga0450904_001557 | 3300042139 | Bacteria | 3131 |
| 514 | Ga0439458_0001531 | 3300042157 | Bacteria | 5778 |
| 515 | Ga0451577_0097310 | 3300042876 | Bacteria | 2628 |
| 516 | Ga0451577_0104243 | 3300042876 | Bacteria | 2535 |
| 517 | Ga0466969_0015826 | 3300044656 | Bacteria | 3953 |
| 518 | Ga0466972_0002881 | 3300044658 | Bacteria | 8512 |
| 519 | Ga0453683_0068607 | 3300044673 | Bacteria | 2217 |
| 520 | Ga0466965_0014133 | 3300044683 | Bacteria | 3776 |
| 521 | Ga0466965_0016917 | 3300044683 | Bacteria | 3478 |
| 522 | Ga0466965_0043666 | 3300044683 | Bacteria | 2213 |
| 523 | Ga0466966_0005305 | 3300044684 | Bacteria | 8476 |
| 524 | Ga0466966_0033545 | 3300044684 | Bacteria | 3324 |
| 525 | Ga0466966_0221696 | 3300044684 | Bacteria | 1141 |
| 526 | Ga0466966_0239292 | 3300044684 | Bacteria | 1094 |
| 527 | Ga0466961_0124576 | 3300044693 | Bacteria | 1617 |
| 528 | Ga0466964_0001227 | 3300044706 | Bacteria | 8693 |
| 529 | Ga0466964_0001931 | 3300044706 | Bacteria | 7257 |
| 530 | Ga0466971_0010136 | 3300044719 | Bacteria | 4115 |
| 531 | Ga0466971_0132277 | 3300044719 | Bacteria | 1158 |
| 532 | Ga0466968_0001801 | 3300044735 | Bacteria | 7739 |
| 533 | Ga0466968_0099409 | 3300044735 | Bacteria | 1297 |
| 534 | Ga0466957_0046829 | 3300044842 | Bacteria | 2626 |
| 535 | Ga0466957_0159888 | 3300044842 | Bacteria | 1462 |
| 536 | Ga0466960_0126220 | 3300044901 | Bacteria | 1345 |
| 537 | Ga0466959_0045778 | 3300045049 | Bacteria | 3221 |
| 538 | Ga0466959_0080319 | 3300045049 | Bacteria | 2351 |
| 539 | Ga0466959_0145988 | 3300045049 | Bacteria | 1669 |
| 540 | Ga0451576_0000250 | 3300045051 | Bacteria | 132101 |
| 541 | Ga0466958_0075060 | 3300045836 | Bacteria | 2073 |
| 542 | Ga0495617_000057 | 3300046452 | Bacteria | 100673 |
| 543 | Ga0495617_000303 | 3300046452 | Bacteria | 27779 |
| 544 | Ga0495617_046083 | 3300046452 | Bacteria | 1453 |
| 545 | Ga0495627_001817 | 3300046453 | Bacteria | 11358 |
| 546 | Ga0495627_006174 | 3300046453 | Bacteria | 4721 |
| 547 | Ga0495592_0046495 | 3300046454 | Bacteria | 3235 |
| 548 | Ga0495603_0086608 | 3300046455 | Bacteria | 1833 |
| 549 | Ga0495590_0000018 | 3300046457 | Bacteria | 216375 |
| 550 | Ga0495590_0002149 | 3300046457 | Bacteria | 8279 |
| 551 | Ga0495590_0002928 | 3300046457 | Bacteria | 7024 |
| 552 | Ga0495590_0058050 | 3300046457 | Bacteria | 1353 |
| 553 | Ga0495591_012498 | 3300046458 | Bacteria | 3159 |
| 554 | Ga0495591_019841 | 3300046458 | Bacteria | 2238 |
| 555 | Ga0495629_0132375 | 3300046459 | Bacteria | 1737 |
| 556 | Ga0495638_0010108 | 3300046460 | Bacteria | 6574 |
| 557 | Ga0495638_0027791 | 3300046460 | Bacteria | 3659 |
| 558 | Ga0495638_0048144 | 3300046460 | Bacteria | 2669 |
| 559 | Ga0495638_0112870 | 3300046460 | Bacteria | 1613 |
| 560 | Ga0495651_0028201 | 3300046462 | Bacteria | 4375 |
| 561 | Ga0495651_0100413 | 3300046462 | Bacteria | 2155 |
| 562 | Ga0495653_0028643 | 3300046463 | Bacteria | 4452 |
| 563 | Ga0495653_0078585 | 3300046463 | Bacteria | 2446 |
| 564 | Ga0495650_0000108 | 3300046471 | Bacteria | 200369 |
| 565 | Ga0495650_0000140 | 3300046471 | Bacteria | 169317 |
| 566 | Ga0495650_0032139 | 3300046471 | Bacteria | 2351 |
| 567 | Ga0495605_0000416 | 3300046474 | Bacteria | 38811 |
| 568 | Ga0495605_0000438 | 3300046474 | Bacteria | 37563 |
| 569 | Ga0495605_0003370 | 3300046474 | Bacteria | 9538 |
| 570 | Ga0495605_0011441 | 3300046474 | Bacteria | 4944 |
| 571 | Ga0495605_0027851 | 3300046474 | Bacteria | 2923 |
| 572 | Ga0495605_0029379 | 3300046474 | Bacteria | 2829 |
| 573 | Ga0495605_0041158 | 3300046474 | Bacteria | 2302 |
| 574 | Ga0495605_0045539 | 3300046474 | Bacteria | 2161 |
| 575 | Ga0495605_0124866 | 3300046474 | Bacteria | 1164 |
| 576 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 577 | Ga0495584_0000281 | 3300046491 | Bacteria | 35857 |
| 578 | Ga0495584_0009627 | 3300046491 | Bacteria | 4976 |
| 579 | Ga0495584_0013652 | 3300046491 | Bacteria | 4143 |
| 580 | Ga0495584_0033622 | 3300046491 | Bacteria | 2594 |
| 581 | Ga0495584_0036504 | 3300046491 | Bacteria | 2483 |
| 582 | Ga0495584_0043266 | 3300046491 | Bacteria | 2273 |
| 583 | Ga0495584_0171850 | 3300046491 | Bacteria | 1101 |
| 584 | Ga0495585_0000193 | 3300046492 | Bacteria | 63937 |
| 585 | Ga0495585_0000515 | 3300046492 | Bacteria | 36553 |
| 586 | Ga0495585_0002529 | 3300046492 | Bacteria | 12997 |
| 587 | Ga0495585_0003683 | 3300046492 | Bacteria | 10243 |
| 588 | Ga0495585_0005187 | 3300046492 | Bacteria | 8261 |
| 589 | Ga0495585_0007454 | 3300046492 | Bacteria | 6694 |
| 590 | Ga0495585_0014980 | 3300046492 | Bacteria | 4508 |
| 591 | Ga0495585_0038339 | 3300046492 | Bacteria | 2697 |
| 592 | Ga0495585_0064979 | 3300046492 | Bacteria | 1999 |
| 593 | Ga0495585_0065111 | 3300046492 | Bacteria | 1997 |
| 594 | Ga0495585_0065981 | 3300046492 | Bacteria | 1982 |
| 595 | Ga0495585_0115949 | 3300046492 | Bacteria | 1420 |
| 596 | Ga0495594_0039206 | 3300046499 | Bacteria | 2589 |
| 597 | Ga0495594_0206510 | 3300046499 | Bacteria | 1119 |
| 598 | Ga0495596_0001089 | 3300046500 | Bacteria | 16084 |
| 599 | Ga0495596_0001435 | 3300046500 | Bacteria | 13653 |
| 600 | Ga0495596_0001794 | 3300046500 | Bacteria | 11945 |
| 601 | Ga0495596_0007906 | 3300046500 | Bacteria | 4763 |
| 602 | Ga0495596_0011978 | 3300046500 | Bacteria | 3722 |
| 603 | Ga0495596_0012711 | 3300046500 | Bacteria | 3594 |
| 604 | Ga0495596_0020949 | 3300046500 | Bacteria | 2672 |
| 605 | Ga0495596_0023469 | 3300046500 | Bacteria | 2502 |
| 606 | Ga0495596_0023665 | 3300046500 | Bacteria | 2491 |
| 607 | Ga0495596_0052210 | 3300046500 | Bacteria | 1600 |
| 608 | Ga0495596_0053292 | 3300046500 | Bacteria | 1583 |
| 609 | Ga0495596_0057895 | 3300046500 | Bacteria | 1511 |
| 610 | Ga0495607_0003330 | 3300046501 | Bacteria | 12335 |
| 611 | Ga0495607_0011000 | 3300046501 | Bacteria | 6048 |
| 612 | Ga0495607_0019846 | 3300046501 | Bacteria | 4261 |
| 613 | Ga0495607_0025658 | 3300046501 | Bacteria | 3663 |
| 614 | Ga0495607_0031999 | 3300046501 | Bacteria | 3216 |
| 615 | Ga0495607_0050509 | 3300046501 | Bacteria | 2420 |
| 616 | Ga0495607_0069694 | 3300046501 | Bacteria | 1967 |
| 617 | Ga0495583_0003816 | 3300046506 | Bacteria | 11182 |
| 618 | Ga0495583_0012109 | 3300046506 | Bacteria | 4905 |
| 619 | Ga0495583_0014101 | 3300046506 | Bacteria | 4422 |
| 620 | Ga0495583_0020486 | 3300046506 | Bacteria | 3425 |
| 621 | Ga0495583_0029563 | 3300046506 | Bacteria | 2679 |
| 622 | Ga0495583_0032217 | 3300046506 | Bacteria | 2531 |
| 623 | Ga0495583_0032488 | 3300046506 | Bacteria | 2519 |
| 624 | Ga0495583_0037057 | 3300046506 | Bacteria | 2314 |
| 625 | Ga0495583_0059784 | 3300046506 | Bacteria | 1706 |
| 626 | Ga0495583_0164587 | 3300046506 | Bacteria | 913 |
| 627 | Ga0495606_0006986 | 3300046507 | Bacteria | 10256 |
| 628 | Ga0495606_0011967 | 3300046507 | Bacteria | 7010 |
| 629 | Ga0495606_0027851 | 3300046507 | Bacteria | 3997 |
| 630 | Ga0495606_0086107 | 3300046507 | Bacteria | 1942 |
| 631 | Ga0495606_0113794 | 3300046507 | Bacteria | 1628 |
| 632 | Ga0495608_0041553 | 3300046511 | Bacteria | 3076 |
| 633 | Ga0495610_0002329 | 3300046512 | Bacteria | 16055 |
| 634 | Ga0495616_0000662 | 3300046513 | Bacteria | 25597 |
| 635 | Ga0495616_0002246 | 3300046513 | Bacteria | 12914 |
| 636 | Ga0495616_0002684 | 3300046513 | Bacteria | 11663 |
| 637 | Ga0495616_0003012 | 3300046513 | Bacteria | 10933 |
| 638 | Ga0495616_0004448 | 3300046513 | Bacteria | 8829 |
| 639 | Ga0495616_0013824 | 3300046513 | Bacteria | 4538 |
| 640 | Ga0495616_0018343 | 3300046513 | Bacteria | 3842 |
| 641 | Ga0495616_0026851 | 3300046513 | Bacteria | 3058 |
| 642 | Ga0495616_0033272 | 3300046513 | Bacteria | 2687 |
| 643 | Ga0495616_0034518 | 3300046513 | Bacteria | 2627 |
| 644 | Ga0495616_0057056 | 3300046513 | Bacteria | 1926 |
| 645 | Ga0495616_0068379 | 3300046513 | Bacteria | 1724 |
| 646 | Ga0495616_0111702 | 3300046513 | Bacteria | 1269 |
| 647 | Ga0495620_0004669 | 3300046515 | Bacteria | 7698 |
| 648 | Ga0495628_0004565 | 3300046516 | Bacteria | 12256 |
| 649 | Ga0495630_0084205 | 3300046517 | Bacteria | 2401 |
| 650 | Ga0495631_0000632 | 3300046518 | Bacteria | 23007 |
| 651 | Ga0495631_0001483 | 3300046518 | Bacteria | 14222 |
| 652 | Ga0495631_0002977 | 3300046518 | Bacteria | 9377 |
| 653 | Ga0495631_0007116 | 3300046518 | Bacteria | 5717 |
| 654 | Ga0495631_0011740 | 3300046518 | Bacteria | 4297 |
| 655 | Ga0495631_0016053 | 3300046518 | Bacteria | 3577 |
| 656 | Ga0495631_0018121 | 3300046518 | Bacteria | 3318 |
| 657 | Ga0495631_0041077 | 3300046518 | Bacteria | 2047 |
| 658 | Ga0495631_0042382 | 3300046518 | Bacteria | 2011 |
| 659 | Ga0495631_0052764 | 3300046518 | Bacteria | 1775 |
| 660 | Ga0495632_0000214 | 3300046519 | Bacteria | 58439 |
| 661 | Ga0495632_0000364 | 3300046519 | Bacteria | 43040 |
| 662 | Ga0495632_0003852 | 3300046519 | Bacteria | 10434 |
| 663 | Ga0495632_0009850 | 3300046519 | Bacteria | 5716 |
| 664 | Ga0495632_0011405 | 3300046519 | Bacteria | 5187 |
| 665 | Ga0495632_0014316 | 3300046519 | Bacteria | 4490 |
| 666 | Ga0495632_0015456 | 3300046519 | Bacteria | 4278 |
| 667 | Ga0495632_0026674 | 3300046519 | Bacteria | 3038 |
| 668 | Ga0495632_0027244 | 3300046519 | Bacteria | 2995 |
| 669 | Ga0495632_0052634 | 3300046519 | Bacteria | 2001 |
| 670 | Ga0495632_0056759 | 3300046519 | Bacteria | 1913 |
| 671 | Ga0495632_0056879 | 3300046519 | Bacteria | 1911 |
| 672 | Ga0495632_0087379 | 3300046519 | Bacteria | 1482 |
| 673 | Ga0495637_0000612 | 3300046520 | Bacteria | 25396 |
| 674 | Ga0495643_0000141 | 3300046522 | Bacteria | 115660 |
| 675 | Ga0495643_0004483 | 3300046522 | Bacteria | 9748 |
| 676 | Ga0495643_0019252 | 3300046522 | Bacteria | 3952 |
| 677 | Ga0495643_0021003 | 3300046522 | Bacteria | 3753 |
| 678 | Ga0495643_0032721 | 3300046522 | Bacteria | 2883 |
| 679 | Ga0495643_0043697 | 3300046522 | Bacteria | 2437 |
| 680 | Ga0495643_0061065 | 3300046522 | Bacteria | 1999 |
| 681 | Ga0495643_0120803 | 3300046522 | Bacteria | 1324 |
| 682 | Ga0495644_0002371 | 3300046523 | Bacteria | 7511 |
| 683 | Ga0495644_0005317 | 3300046523 | Bacteria | 5028 |
| 684 | Ga0495644_0007533 | 3300046523 | Bacteria | 4196 |
| 685 | Ga0495644_0025164 | 3300046523 | Bacteria | 2260 |
| 686 | Ga0495644_0030060 | 3300046523 | Bacteria | 2051 |
| 687 | Ga0495648_0000109 | 3300046524 | Bacteria | 101519 |
| 688 | Ga0495648_0004137 | 3300046524 | Bacteria | 12482 |
| 689 | Ga0495648_0019039 | 3300046524 | Bacteria | 4841 |
| 690 | Ga0495666_0012627 | 3300046526 | Bacteria | 4210 |
| 691 | Ga0495642_0000741 | 3300046528 | Bacteria | 16179 |
| 692 | Ga0495642_0001464 | 3300046528 | Bacteria | 10572 |
| 693 | Ga0495642_0007631 | 3300046528 | Bacteria | 4147 |
| 694 | Ga0495642_0013970 | 3300046528 | Bacteria | 3110 |
| 695 | Ga0495642_0037500 | 3300046528 | Bacteria | 1961 |
| 696 | Ga0495642_0054460 | 3300046528 | Bacteria | 1649 |
| 697 | Ga0495642_0065860 | 3300046528 | Bacteria | 1509 |
| 698 | Ga0495652_0012068 | 3300046529 | Bacteria | 7808 |
| 699 | Ga0495652_0040085 | 3300046529 | Bacteria | 4048 |
| 700 | Ga0495654_0047746 | 3300046530 | Bacteria | 2103 |
| 701 | Ga0495654_0048172 | 3300046530 | Bacteria | 2092 |
| 702 | Ga0495654_0059366 | 3300046530 | Bacteria | 1842 |
| 703 | Ga0495654_0094487 | 3300046530 | Bacteria | 1383 |
| 704 | Ga0495665_0019053 | 3300046531 | Bacteria | 3688 |
| 705 | Ga0495665_0026571 | 3300046531 | Bacteria | 3109 |
| 706 | Ga0495665_0030666 | 3300046531 | Bacteria | 2878 |
| 707 | Ga0495586_0142085 | 3300046535 | Bacteria | 1347 |
| 708 | Ga0495598_0022846 | 3300046537 | Bacteria | 1677 |
| 709 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 710 | Ga0495609_0001562 | 3300046538 | Bacteria | 14985 |
| 711 | Ga0495609_0006657 | 3300046538 | Bacteria | 5864 |
| 712 | Ga0495609_0018010 | 3300046538 | Bacteria | 3276 |
| 713 | Ga0495609_0020796 | 3300046538 | Bacteria | 3029 |
| 714 | Ga0495609_0037586 | 3300046538 | Bacteria | 2183 |
| 715 | Ga0495609_0049452 | 3300046538 | Bacteria | 1876 |
| 716 | Ga0495609_0049544 | 3300046538 | Bacteria | 1874 |
| 717 | Ga0495609_0114655 | 3300046538 | Bacteria | 1161 |
| 718 | Ga0495597_0002044 | 3300046542 | Bacteria | 13485 |
| 719 | Ga0495597_0003097 | 3300046542 | Bacteria | 10004 |
| 720 | Ga0495597_0014117 | 3300046542 | Bacteria | 3808 |
| 721 | Ga0495597_0042966 | 3300046542 | Bacteria | 2013 |
| 722 | Ga0495645_0027376 | 3300046543 | Bacteria | 4142 |
| 723 | Ga0495622_0038097 | 3300046557 | Bacteria | 2238 |
| 724 | Ga0495622_0049436 | 3300046557 | Bacteria | 1952 |
| 725 | Ga0495633_0006086 | 3300046558 | Bacteria | 7228 |
| 726 | Ga0495633_0007030 | 3300046558 | Bacteria | 6559 |
| 727 | Ga0495633_0007058 | 3300046558 | Bacteria | 6539 |
| 728 | Ga0495633_0026986 | 3300046558 | Bacteria | 2811 |
| 729 | Ga0495633_0088992 | 3300046558 | Bacteria | 1435 |
| 730 | Ga0495656_0022919 | 3300046615 | Bacteria | 2451 |
| 731 | Ga0495656_0053279 | 3300046615 | Bacteria | 1738 |
| 732 | Ga0495668_0003200 | 3300046616 | Bacteria | 12527 |
| 733 | Ga0495668_0003639 | 3300046616 | Bacteria | 11407 |
| 734 | Ga0495668_0015431 | 3300046616 | Bacteria | 4461 |
| 735 | Ga0495668_0016287 | 3300046616 | Bacteria | 4320 |
| 736 | Ga0495668_0020369 | 3300046616 | Bacteria | 3815 |
| 737 | Ga0495668_0051043 | 3300046616 | Bacteria | 2290 |
| 738 | Ga0495668_0114115 | 3300046616 | Bacteria | 1477 |
| 739 | Ga0495634_0201412 | 3300046642 | Bacteria | 1236 |
| 740 | Ga0495611_0000499 | 3300046648 | Bacteria | 23354 |
| 741 | Ga0495611_0002457 | 3300046648 | Bacteria | 8460 |
| 742 | Ga0495611_0019231 | 3300046648 | Bacteria | 2933 |
| 743 | Ga0495611_0019315 | 3300046648 | Bacteria | 2926 |
| 744 | Ga0495611_0024956 | 3300046648 | Bacteria | 2602 |
| 745 | Ga0495611_0026413 | 3300046648 | Bacteria | 2533 |
| 746 | Ga0495611_0031348 | 3300046648 | Bacteria | 2339 |
| 747 | Ga0495625_0032776 | 3300046660 | Bacteria | 3848 |
| 748 | Ga0495625_0063609 | 3300046660 | Bacteria | 2605 |
| 749 | Ga0495625_0066343 | 3300046660 | Bacteria | 2542 |
| 750 | Ga0495625_0124604 | 3300046660 | Bacteria | 1750 |
| 751 | Ga0495625_0178631 | 3300046660 | Bacteria | 1413 |
| 752 | Ga0495635_0002454 | 3300046663 | Bacteria | 12659 |
| 753 | Ga0495661_0001929 | 3300046665 | Bacteria | 16505 |
| 754 | Ga0495661_0007429 | 3300046665 | Bacteria | 7642 |
| 755 | Ga0495661_0012238 | 3300046665 | Bacteria | 5795 |
| 756 | Ga0495661_0013191 | 3300046665 | Bacteria | 5556 |
| 757 | Ga0495661_0027110 | 3300046665 | Bacteria | 3680 |
| 758 | Ga0495661_0035807 | 3300046665 | Bacteria | 3112 |
| 759 | Ga0495661_0064902 | 3300046665 | Bacteria | 2152 |
| 760 | Ga0495661_0065409 | 3300046665 | Bacteria | 2142 |
| 761 | Ga0495661_0071191 | 3300046665 | Bacteria | 2032 |
| 762 | Ga0495661_0075659 | 3300046665 | Bacteria | 1956 |
| 763 | Ga0495661_0153789 | 3300046665 | Bacteria | 1240 |
| 764 | Ga0495661_0171609 | 3300046665 | Bacteria | 1156 |
| 765 | Ga0495588_0000077 | 3300046674 | Bacteria | 215338 |
| 766 | Ga0495588_0010399 | 3300046674 | Bacteria | 4328 |
| 767 | Ga0495588_0012275 | 3300046674 | Bacteria | 4043 |
| 768 | Ga0495588_0027405 | 3300046674 | Bacteria | 2847 |
| 769 | Ga0495588_0031167 | 3300046674 | Bacteria | 2682 |
| 770 | Ga0495588_0055912 | 3300046674 | Bacteria | 2037 |
| 771 | Ga0495588_0067940 | 3300046674 | Bacteria | 1850 |
| 772 | Ga0495657_0073728 | 3300046675 | Bacteria | 2222 |
| 773 | Ga0495599_0004944 | 3300046678 | Bacteria | 7925 |
| 774 | Ga0495623_0011364 | 3300046679 | Bacteria | 5760 |
| 775 | Ga0495646_0012052 | 3300046680 | Bacteria | 5499 |
| 776 | Ga0495669_0000116 | 3300046684 | Bacteria | 51756 |
| 777 | Ga0495669_0007431 | 3300046684 | Bacteria | 4595 |
| 778 | Ga0495669_0011905 | 3300046684 | Bacteria | 3699 |
| 779 | Ga0495669_0030253 | 3300046684 | Bacteria | 2377 |
| 780 | Ga0495624_0300210 | 3300046690 | Bacteria | 968 |
| 781 | Ga0495670_0001273 | 3300046691 | Bacteria | 12311 |
| 782 | Ga0495670_0005019 | 3300046691 | Bacteria | 6507 |
| 783 | Ga0495670_0007909 | 3300046691 | Bacteria | 5227 |
| 784 | Ga0495670_0016363 | 3300046691 | Bacteria | 3644 |
| 785 | Ga0495670_0041425 | 3300046691 | Bacteria | 2298 |
| 786 | Ga0495670_0049421 | 3300046691 | Bacteria | 2104 |
| 787 | Ga0495670_0072508 | 3300046691 | Bacteria | 1744 |
| 788 | Ga0495671_0002689 | 3300046692 | Bacteria | 11143 |
| 789 | Ga0495671_0016637 | 3300046692 | Bacteria | 3924 |
| 790 | Ga0495649_0003311 | 3300046694 | Bacteria | 10948 |
| 791 | Ga0495649_0003561 | 3300046694 | Bacteria | 10460 |
| 792 | Ga0495649_0011717 | 3300046694 | Bacteria | 5131 |
| 793 | Ga0495649_0057116 | 3300046694 | Bacteria | 2105 |
| 794 | Ga0495649_0082868 | 3300046694 | Bacteria | 1713 |
| 795 | Ga0495589_0001060 | 3300046794 | Bacteria | 16526 |
| 796 | Ga0495589_0007613 | 3300046794 | Bacteria | 5673 |
| 797 | Ga0495589_0013208 | 3300046794 | Bacteria | 4261 |
| 798 | Ga0495589_0017044 | 3300046794 | Bacteria | 3730 |
| 799 | Ga0495589_0019655 | 3300046794 | Bacteria | 3458 |
| 800 | Ga0495660_0000178 | 3300046810 | Bacteria | 68956 |
| 801 | Ga0495660_0010952 | 3300046810 | Bacteria | 5271 |
| 802 | Ga0495660_0020825 | 3300046810 | Bacteria | 3759 |
| 803 | Ga0495660_0070404 | 3300046810 | Bacteria | 1856 |
| 804 | Ga0495660_0070610 | 3300046810 | Bacteria | 1853 |
| 805 | Ga0495660_0108124 | 3300046810 | Bacteria | 1422 |
| 806 | Ga0495660_0117839 | 3300046810 | Bacteria | 1347 |
| 807 | Ga0495604_0027131 | 3300047317 | Bacteria | 4556 |
| 808 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 809 | Ga0495672_0000437 | 3300047320 | Bacteria | 49739 |
| 810 | Ga0495672_0001623 | 3300047320 | Bacteria | 21897 |
| 811 | Ga0495672_0009440 | 3300047320 | Bacteria | 7068 |
| 812 | Ga0495672_0010123 | 3300047320 | Bacteria | 6744 |
| 813 | Ga0495672_0072525 | 3300047320 | Bacteria | 1944 |
| 814 | Ga0495676_0000121 | 3300047321 | Bacteria | 59949 |
| 815 | Ga0495676_0049524 | 3300047321 | Bacteria | 3377 |
| 816 | Ga0495680_0007548 | 3300047322 | Bacteria | 9946 |
| 817 | Ga0495683_0000182 | 3300047323 | Bacteria | 61818 |
| 818 | Ga0495683_0001151 | 3300047323 | Bacteria | 18144 |
| 819 | Ga0495683_0011839 | 3300047323 | Bacteria | 4586 |
| 820 | Ga0495683_0018583 | 3300047323 | Bacteria | 3591 |
| 821 | Ga0495683_0020136 | 3300047323 | Bacteria | 3443 |
| 822 | Ga0495683_0020827 | 3300047323 | Bacteria | 3380 |
| 823 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 824 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 825 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 826 | Ga0495687_000458 | 3300047443 | Bacteria | 49855 |
| 827 | Ga0495687_013931 | 3300047443 | Bacteria | 4166 |
| 828 | Ga0495687_014022 | 3300047443 | Bacteria | 4147 |
| 829 | Ga0495675_0016790 | 3300047444 | Bacteria | 4629 |
| 830 | Ga0495677_0000117 | 3300047445 | Bacteria | 38586 |
| 831 | Ga0495677_0003340 | 3300047445 | Bacteria | 6242 |
| 832 | Ga0495677_0004846 | 3300047445 | Bacteria | 5132 |
| 833 | Ga0495677_0005027 | 3300047445 | Bacteria | 5043 |
| 834 | Ga0495677_0005223 | 3300047445 | Bacteria | 4938 |
| 835 | Ga0495677_0008846 | 3300047445 | Bacteria | 3729 |
| 836 | Ga0495677_0010361 | 3300047445 | Bacteria | 3425 |
| 837 | Ga0495677_0017662 | 3300047445 | Bacteria | 2585 |
| 838 | Ga0495677_0026283 | 3300047445 | Bacteria | 2111 |
| 839 | Ga0495677_0027824 | 3300047445 | Bacteria | 2052 |
| 840 | Ga0495677_0028764 | 3300047445 | Bacteria | 2020 |
| 841 | Ga0495677_0029631 | 3300047445 | Bacteria | 1990 |
| 842 | Ga0495679_003474 | 3300047446 | Bacteria | 7557 |
| 843 | Ga0495679_004009 | 3300047446 | Bacteria | 6926 |
| 844 | Ga0495679_013040 | 3300047446 | Bacteria | 3136 |
| 845 | Ga0495685_004997 | 3300047447 | Bacteria | 4313 |
| 846 | Ga0495681_0000994 | 3300047470 | Bacteria | 21702 |
| 847 | Ga0495681_0012084 | 3300047470 | Bacteria | 5090 |
| 848 | Ga0495681_0014560 | 3300047470 | Bacteria | 4497 |
| 849 | Ga0495681_0023578 | 3300047470 | Bacteria | 3265 |
| 850 | Ga0495681_0031695 | 3300047470 | Bacteria | 2671 |
| 851 | Ga0495681_0058051 | 3300047470 | Bacteria | 1795 |
| 852 | Ga0495686_0000591 | 3300047472 | Bacteria | 50934 |
| 853 | Ga0495686_0001614 | 3300047472 | Bacteria | 23675 |
| 854 | Ga0495686_0082989 | 3300047472 | Bacteria | 1955 |
| 855 | Ga0495593_0088157 | 3300047673 | Bacteria | 1599 |
| 856 | Ga0495593_0117865 | 3300047673 | Bacteria | 1352 |
| 857 | Ga0495602_0077771 | 3300048088 | Bacteria | 2805 |
| 858 | Ga0495614_0004132 | 3300048089 | Bacteria | 6536 |
| 859 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 860 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 861 | Ga0495626_0000693 | 3300048091 | Bacteria | 32187 |
| 862 | Ga0495626_0006971 | 3300048091 | Bacteria | 6359 |
| 863 | Ga0495626_0012875 | 3300048091 | Bacteria | 4366 |
| 864 | Ga0495626_0015332 | 3300048091 | Bacteria | 3927 |
| 865 | Ga0495626_0030305 | 3300048091 | Bacteria | 2609 |
| 866 | Ga0495626_0035415 | 3300048091 | Bacteria | 2382 |
| 867 | Ga0495626_0042550 | 3300048091 | Bacteria | 2133 |
| 868 | Ga0495626_0042772 | 3300048091 | Bacteria | 2127 |
| 869 | Ga0495626_0079806 | 3300048091 | Bacteria | 1455 |
| 870 | Ga0496101_0100541 | 3300048904 | Bacteria | 2163 |
| 871 | Ga0496102_0000340 | 3300048905 | Bacteria | 57233 |
| 872 | Ga0496102_0031296 | 3300048905 | Bacteria | 4772 |
| 873 | Ga0496102_0039013 | 3300048905 | Bacteria | 4289 |
| 874 | Ga0496102_0073083 | 3300048905 | Bacteria | 3152 |
| 875 | Ga0496102_0189580 | 3300048905 | Bacteria | 1937 |
| 876 | Ga0496102_0285842 | 3300048905 | Bacteria | 1554 |
| 877 | Ga0496103_0013246 | 3300048906 | Bacteria | 4888 |
| 878 | Ga0496103_0097970 | 3300048906 | Unclassified | 1854 |
| 879 | Ga0496103_0201425 | 3300048906 | Bacteria | 1280 |
| 880 | Ga0496106_0239107 | 3300048909 | Bacteria | 1451 |
| 881 | Ga0496107_0007412 | 3300048910 | Bacteria | 7562 |
| 882 | Ga0496108_0019844 | 3300048911 | Bacteria | 5522 |
| 883 | Ga0496109_0005210 | 3300048912 | Bacteria | 10861 |
| 884 | Ga0496109_0102982 | 3300048912 | Bacteria | 2649 |
| 885 | Ga0496110_0004929 | 3300048913 | Bacteria | 10425 |
| 886 | Ga0496111_0152130 | 3300048914 | Bacteria | 1716 |
| 887 | Ga0496112_0020372 | 3300048915 | Bacteria | 6287 |
| 888 | Ga0496112_0321442 | 3300048915 | Bacteria | 1492 |
| 889 | Ga0496113_0023519 | 3300048916 | Bacteria | 4369 |
| 890 | Ga0496113_0176820 | 3300048916 | Bacteria | 1691 |
| 891 | Ga0496113_0347407 | 3300048916 | Bacteria | 1190 |
| 892 | Ga0496115_0143915 | 3300048918 | Bacteria | 1967 |
| 893 | Ga0496116_0046354 | 3300048919 | Bacteria | 2934 |
| 894 | Ga0496117_0000057 | 3300048920 | Bacteria | 268246 |
| 895 | Ga0496118_0000028 | 3300048921 | Bacteria | 366490 |
| 896 | Ga0496119_0005745 | 3300048922 | Bacteria | 11760 |
| 897 | Ga0496119_0009417 | 3300048922 | Bacteria | 8387 |
| 898 | Ga0496120_0007468 | 3300048923 | Bacteria | 8123 |
| 899 | Ga0496120_0014995 | 3300048923 | Bacteria | 5132 |
| 900 | Ga0496120_0056979 | 3300048923 | Bacteria | 2202 |
| 901 | Ga0496121_0001295 | 3300048924 | Bacteria | 43040 |
| 902 | Ga0496121_0029970 | 3300048924 | Bacteria | 5010 |
| 903 | Ga0496121_0046034 | 3300048924 | Bacteria | 3739 |
| 904 | Ga0496121_0095309 | 3300048924 | Bacteria | 2313 |
| 905 | Ga0496121_0204670 | 3300048924 | Bacteria | 1403 |
| 906 | Ga0496122_0009237 | 3300048925 | Bacteria | 10432 |
| 907 | Ga0496122_0009551 | 3300048925 | Bacteria | 10188 |
| 908 | Ga0496122_0090290 | 3300048925 | Bacteria | 2091 |
| 909 | Ga0496123_0026217 | 3300048926 | Bacteria | 4373 |
| 910 | Ga0496123_0042315 | 3300048926 | Bacteria | 3145 |
| 911 | Ga0496123_0093738 | 3300048926 | Bacteria | 1772 |
| 912 | Ga0496124_0002724 | 3300048927 | Bacteria | 22533 |
| 913 | Ga0496124_0003292 | 3300048927 | Bacteria | 19912 |
| 914 | Ga0496124_0012916 | 3300048927 | Bacteria | 8193 |
| 915 | Ga0496124_0035599 | 3300048927 | Bacteria | 4354 |
| 916 | Ga0496124_0056406 | 3300048927 | Bacteria | 3313 |
| 917 | Ga0496124_0091173 | 3300048927 | Bacteria | 2484 |
| 918 | Ga0496125_0011721 | 3300048928 | Bacteria | 8738 |
| 919 | Ga0496125_0013698 | 3300048928 | Bacteria | 7956 |
| 920 | Ga0496125_0059832 | 3300048928 | Bacteria | 3066 |
| 921 | Ga0496125_0103905 | 3300048928 | Bacteria | 2083 |
| 922 | Ga0496125_0203493 | 3300048928 | Bacteria | 1293 |
| 923 | Ga0496126_0038970 | 3300048929 | Bacteria | 4416 |
| 924 | Ga0496126_0068887 | 3300048929 | Bacteria | 3157 |
| 925 | Ga0496126_0097557 | 3300048929 | Bacteria | 2575 |
| 926 | Ga0501308_000102 | 3300049128 | Bacteria | 3985 |
| 927 | Ga0501304_000184 | 3300049160 | Bacteria | 2688 |
| 928 | Ga0495678_000275 | 3300049459 | Bacteria | 56673 |
| 929 | Ga0495678_000746 | 3300049459 | Bacteria | 29508 |
| 930 | Ga0495678_001983 | 3300049459 | Bacteria | 14748 |
| 931 | Ga0495678_002319 | 3300049459 | Bacteria | 13113 |
| 932 | Ga0495678_004447 | 3300049459 | Bacteria | 8101 |
| 933 | Ga0495678_014319 | 3300049459 | Bacteria | 3691 |
| 934 | Ga0495682_0002099 | 3300049460 | Bacteria | 9711 |
| 935 | Ga0495682_0017114 | 3300049460 | Bacteria | 2740 |
| 936 | Ga0495682_0019757 | 3300049460 | Bacteria | 2531 |
| 937 | Ga0495682_0027473 | 3300049460 | Bacteria | 2110 |
| 938 | Ga0495682_0074150 | 3300049460 | Bacteria | 1224 |
| 939 | Ga0501033_0361474 | 3300049570 | Bacteria | 1016 |
| 940 | Ga0501037_0008788 | 3300049573 | Bacteria | 7408 |
| 941 | Ga0501037_0013697 | 3300049573 | Bacteria | 5975 |
| 942 | Ga0501039_0030179 | 3300049575 | Bacteria | 4179 |
| 943 | Ga0501040_0049070 | 3300049576 | Bacteria | 2886 |
| 944 | Ga0501046_0012173 | 3300049580 | Bacteria | 7334 |
| 945 | Ga0501047_0098639 | 3300049581 | Bacteria | 2800 |
| 946 | Ga0501048_0286988 | 3300049582 | Bacteria | 1170 |
| 947 | Ga0501067_0003287 | 3300049583 | Bacteria | 8901 |
| 948 | Ga0501068_0000097 | 3300049584 | Bacteria | 37675 |
| 949 | Ga0501069_0020201 | 3300049585 | Bacteria | 3607 |
| 950 | Ga0501070_0003050 | 3300049586 | Bacteria | 14588 |
| 951 | Ga0501070_0008303 | 3300049586 | Bacteria | 8776 |
| 952 | Ga0501070_0015322 | 3300049586 | Bacteria | 6450 |
| 953 | Ga0501070_0134521 | 3300049586 | Bacteria | 2041 |
| 954 | Ga0501071_0068445 | 3300049587 | Bacteria | 2583 |
| 955 | Ga0501072_0028213 | 3300049588 | Bacteria | 4382 |
| 956 | Ga0501073_0000086 | 3300049589 | Bacteria | 59101 |
| 957 | Ga0501074_0028123 | 3300049590 | Bacteria | 4074 |
| 958 | Ga0501074_0057987 | 3300049590 | Bacteria | 2789 |
| 959 | Ga0501075_0319129 | 3300049591 | Bacteria | 1184 |
| 960 | Ga0501076_0061458 | 3300049592 | Bacteria | 2989 |
| 961 | Ga0501077_0001839 | 3300049593 | Bacteria | 12841 |
| 962 | Ga0501079_0000201 | 3300049741 | Bacteria | 34664 |
| 963 | Ga0501080_0001101 | 3300049742 | Bacteria | 22270 |
| 964 | Ga0501080_0003269 | 3300049742 | Bacteria | 14304 |
| 965 | Ga0501081_0244740 | 3300049743 | Bacteria | 1308 |
| 966 | Ga0501083_0001294 | 3300049744 | Bacteria | 16922 |
| 967 | Ga0501035_0004380 | 3300049822 | Bacteria | 13405 |
| 968 | Ga0501044_0001746 | 3300049823 | Bacteria | 25368 |
| 969 | nmdc:mga03683_150182_c1 | 3300050489 | Bacteria | 1051 |
| 970 | nmdc:mga07m45_124896_c1 | 3300050496 | Bacteria | 1488 |
| 971 | nmdc:mga0qj67_232795_c1 | 3300050509 | Bacteria | 1495 |
| 972 | nmdc:mga0qj67_7557_c1 | 3300050509 | Bacteria | 8031 |
| 973 | nmdc:mga06r32_166393_c1 | 3300050510 | Bacteria | 2188 |
| 974 | nmdc:mga06r32_34635_c1 | 3300050510 | Bacteria | 4763 |
| 975 | Ga0500646_0031268 | 3300053090 | Bacteria | 1465 |
| 976 | Ga0500583_0001580 | 3300053092 | Bacteria | 6603 |
| 977 | Ga0500583_0015022 | 3300053092 | Bacteria | 3052 |
| 978 | Ga0500583_0020890 | 3300053092 | Bacteria | 2712 |
| 979 | Ga0500640_090446 | 3300053095 | Bacteria | 1283 |
| 980 | Ga0500650_0000034 | 3300053098 | Bacteria | 52582 |
| 981 | Ga0500556_0000374 | 3300053104 | Bacteria | 32602 |
| 982 | Ga0500642_0195462 | 3300053130 | Bacteria | 943 |
| 983 | Ga0500658_0104505 | 3300053134 | Bacteria | 1240 |
| 984 | Ga0500568_0004577 | 3300053139 | Bacteria | 7367 |
| 985 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 986 | Ga0500633_0115889 | 3300053160 | Bacteria | 995 |
| 987 | Ga0500637_0003857 | 3300053178 | Bacteria | 6988 |
| 988 | Ga0500637_0040698 | 3300053178 | Bacteria | 2626 |
| 989 | Ga0501084_0001279 | 3300054114 | Bacteria | 19817 |
| 990 | Ga0501084_0182396 | 3300054114 | Bacteria | 1772 |
| 991 | Ga0587067_002624 | 3300059640 | Bacteria | 2157 |
| 992 | Ga0466962_0108370 | 3300061719 | Bacteria | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100046626 | Ga0070669_1000466264 | 259 |
| 2 | 3300036647 | Ga0316582_0033533 | Ga0316582_0033533_1745_2635 | 272 |
| 3 | 3300036712 | Ga0316584_0029740 | Ga0316584_0029740_1202_2092 | 272 |
| 4 | 3300053178 | Ga0500637_0040698 | Ga0500637_0040698_1060_2004 | 274 |
| 5 | 3300048914 | Ga0496111_0152130 | Ga0496111_0152130_42_944 | 275 |
| 6 | 3300028017 | Ga0265356_1002312 | Ga0265356_10023124 | 276 |
| 7 | 3300046810 | Ga0495660_0010952 | Ga0495660_0010952_4416_5261 | 279 |
| 8 | 3300005577 | Ga0068857_100463351 | Ga0068857_1004633511 | 281 |
| 9 | 3300048924 | Ga0496121_0095309 | Ga0496121_0095309_938_1792 | 283 |
| 10 | 3300005543 | Ga0070672_100118028 | Ga0070672_1001180282 | 284 |
| 11 | 3300025893 | Ga0207682_10004847 | Ga0207682_100048474 | 284 |
| 12 | 3300025908 | Ga0207643_10035424 | Ga0207643_100354242 | 284 |
| 13 | 3300025940 | Ga0207691_10003757 | Ga0207691_1000375713 | 284 |
| 14 | 3300003322 | rootL2_10091680 | rootL2_100916803 | 285 |
| 15 | 3300032168 | Ga0316593_10000472 | Ga0316593_100004725 | 287 |
| 16 | 3300005719 | Ga0068861_100074083 | Ga0068861_1000740832 | 288 |
| 17 | 3300025918 | Ga0207662_10109919 | Ga0207662_101099192 | 288 |
| 18 | 3300026118 | Ga0207675_100287270 | Ga0207675_1002872702 | 288 |
| 19 | 3300049573 | Ga0501037_0013697 | Ga0501037_0013697_2765_3703 | 288 |
| 20 | 3300049586 | Ga0501070_0015322 | Ga0501070_0015322_4452_5390 | 288 |
| 21 | 3300049590 | Ga0501074_0028123 | Ga0501074_0028123_558_1496 | 288 |
| 22 | 3300049742 | Ga0501080_0001101 | Ga0501080_0001101_2725_3663 | 288 |
| 23 | 3300005543 | Ga0070672_100034611 | Ga0070672_1000346112 | 289 |
| 24 | 3300005564 | Ga0070664_100012001 | Ga0070664_1000120014 | 289 |
| 25 | 3300014325 | Ga0163163_10089960 | Ga0163163_100899602 | 289 |
| 26 | 3300025940 | Ga0207691_10058407 | Ga0207691_100584072 | 289 |
| 27 | 3300025945 | Ga0207679_10159090 | Ga0207679_101590902 | 289 |
| 28 | iso_pu_bacteria | 2839094727 | 2839096106 | 289 |
| 29 | 3300005467 | Ga0070706_100140325 | Ga0070706_1001403252 | 290 |
| 30 | 3300047443 | Ga0495687_013931 | Ga0495687_013931_941_1846 | 290 |
| 31 | 3300009177 | Ga0105248_10263891 | Ga0105248_102638912 | 291 |
| 32 | 3300031824 | Ga0307413_10001755 | Ga0307413_100017555 | 291 |
| 33 | 3300031852 | Ga0307410_10003357 | Ga0307410_100033575 | 291 |
| 34 | 3300031903 | Ga0307407_10004906 | Ga0307407_100049065 | 291 |
| 35 | 3300031995 | Ga0307409_100007342 | Ga0307409_1000073427 | 291 |
| 36 | 3300032002 | Ga0307416_100070648 | Ga0307416_1000706484 | 291 |
| 37 | 3300032005 | Ga0307411_10010509 | Ga0307411_100105096 | 291 |
| 38 | 3300032126 | Ga0307415_100090684 | Ga0307415_1000906842 | 291 |
| 39 | 3300048910 | Ga0496107_0007412 | Ga0496107_0007412_2400_3350 | 291 |
| 40 | 3300048911 | Ga0496108_0019844 | Ga0496108_0019844_1077_2027 | 291 |
| 41 | 3300048912 | Ga0496109_0102982 | Ga0496109_0102982_1511_2461 | 291 |
| 42 | 3300048915 | Ga0496112_0020372 | Ga0496112_0020372_420_1370 | 291 |
| 43 | 3300049586 | Ga0501070_0134521 | Ga0501070_0134521_40_927 | 292 |
| 44 | 3300005334 | Ga0068869_100450708 | Ga0068869_1004507081 | 293 |
| 45 | 3300005354 | Ga0070675_100057275 | Ga0070675_1000572754 | 293 |
| 46 | 3300005455 | Ga0070663_100079890 | Ga0070663_1000798902 | 293 |
| 47 | 3300005543 | Ga0070672_100019627 | Ga0070672_1000196274 | 293 |
| 48 | 3300005543 | Ga0070672_100308130 | Ga0070672_1003081302 | 293 |
| 49 | 3300009093 | Ga0105240_10019812 | Ga0105240_100198122 | 293 |
| 50 | 3300009101 | Ga0105247_10001941 | Ga0105247_100019417 | 293 |
| 51 | 3300009553 | Ga0105249_10103644 | Ga0105249_101036442 | 293 |
| 52 | 3300013306 | Ga0163162_10033867 | Ga0163162_100338673 | 293 |
| 53 | 3300014968 | Ga0157379_10006122 | Ga0157379_1000612211 | 293 |
| 54 | 3300014968 | Ga0157379_10704311 | Ga0157379_107043111 | 293 |
| 55 | 3300025245 | Ga0207425_1001639 | Ga0207425_10016399 | 293 |
| 56 | 3300025294 | Ga0209025_1016263 | Ga0209025_10162632 | 293 |
| 57 | 3300025297 | Ga0209758_1002044 | Ga0209758_100204426 | 293 |
| 58 | 3300025899 | Ga0207642_10081710 | Ga0207642_100817102 | 293 |
| 59 | 3300025925 | Ga0207650_10123907 | Ga0207650_101239072 | 293 |
| 60 | 3300025926 | Ga0207659_10036008 | Ga0207659_100360082 | 293 |
| 61 | 3300025926 | Ga0207659_10413336 | Ga0207659_104133362 | 293 |
| 62 | 3300025931 | Ga0207644_10150659 | Ga0207644_101506592 | 293 |
| 63 | 3300025940 | Ga0207691_10032022 | Ga0207691_100320225 | 293 |
| 64 | 3300025942 | Ga0207689_10185344 | Ga0207689_101853442 | 293 |
| 65 | 3300025960 | Ga0207651_10543326 | Ga0207651_105433261 | 293 |
| 66 | 3300026095 | Ga0207676_10008269 | Ga0207676_100082697 | 293 |
| 67 | 3300031456 | Ga0307513_10040878 | Ga0307513_100408787 | 293 |
| 68 | 3300031456 | Ga0307513_10175972 | Ga0307513_101759723 | 293 |
| 69 | 3300038741 | Ga0400488_23615 | Ga0400488_23615_2788_3672 | 293 |
| 70 | 3300038741 | Ga0400488_40478 | Ga0400488_40478_91_975 | 293 |
| 71 | 3300039062 | Ga0400483_044439 | Ga0400483_044439_8556_9440 | 293 |
| 72 | 3300039110 | Ga0400487_26214 | Ga0400487_26214_581_1465 | 293 |
| 73 | 3300039110 | Ga0400487_51635 | Ga0400487_51635_338_1222 | 293 |
| 74 | 3300039450 | Ga0436363_1199362 | Ga0436363_1199362_4461_5366 | 293 |
| 75 | 3300041456 | Ga0451795_0279517 | Ga0451795_0279517_108_998 | 293 |
| 76 | 3300041512 | Ga0451853_3198134 | Ga0451853_3198134_57_953 | 293 |
| 77 | 3300046455 | Ga0495603_0086608 | Ga0495603_0086608_906_1799 | 293 |
| 78 | 3300046506 | Ga0495583_0164587 | Ga0495583_0164587_11_898 | 293 |
| 79 | 3300046513 | Ga0495616_0002246 | Ga0495616_0002246_701_1606 | 293 |
| 80 | 3300046518 | Ga0495631_0002977 | Ga0495631_0002977_8464_9351 | 293 |
| 81 | 3300046519 | Ga0495632_0052634 | Ga0495632_0052634_839_1744 | 293 |
| 82 | 3300046519 | Ga0495632_0087379 | Ga0495632_0087379_338_1231 | 293 |
| 83 | 3300046522 | Ga0495643_0120803 | Ga0495643_0120803_249_1166 | 293 |
| 84 | 3300046535 | Ga0495586_0142085 | Ga0495586_0142085_431_1315 | 293 |
| 85 | 3300046660 | Ga0495625_0063609 | Ga0495625_0063609_44_940 | 293 |
| 86 | 3300046660 | Ga0495625_0178631 | Ga0495625_0178631_20_913 | 293 |
| 87 | 3300046690 | Ga0495624_0300210 | Ga0495624_0300210_24_905 | 293 |
| 88 | 3300046691 | Ga0495670_0007909 | Ga0495670_0007909_27_911 | 293 |
| 89 | 3300047673 | Ga0495593_0117865 | Ga0495593_0117865_426_1316 | 293 |
| 90 | 3300048905 | Ga0496102_0031296 | Ga0496102_0031296_609_1526 | 293 |
| 91 | 3300048906 | Ga0496103_0097970 | Ga0496103_0097970_359_1276 | 293 |
| 92 | 3300048924 | Ga0496121_0001295 | Ga0496121_0001295_39514_40431 | 293 |
| 93 | 3300048924 | Ga0496121_0204670 | Ga0496121_0204670_459_1355 | 293 |
| 94 | 3300048928 | Ga0496125_0059832 | Ga0496125_0059832_796_1713 | 293 |
| 95 | 3300048929 | Ga0496126_0097557 | Ga0496126_0097557_752_1648 | 293 |
| 96 | 3300049570 | Ga0501033_0361474 | Ga0501033_0361474_79_984 | 293 |
| 97 | 3300050489 | nmdc:mga03683_150182_c1 | nmdc:mga03683_150182_c1_40_921 | 293 |
| 98 | 3300053092 | Ga0500583_0015022 | Ga0500583_0015022_2009_2908 | 293 |
| 99 | 3300053130 | Ga0500642_0195462 | Ga0500642_0195462_29_925 | 293 |
| 100 | 3300053134 | Ga0500658_0104505 | Ga0500658_0104505_310_1215 | 293 |
| 101 | 3300053153 | Ga0500616_0000016 | Ga0500616_0000016_191915_192814 | 293 |
| 102 | 3300053178 | Ga0500637_0003857 | Ga0500637_0003857_5892_6809 | 293 |
| 103 | 3300054114 | Ga0501084_0182396 | Ga0501084_0182396_871_1758 | 293 |
| 104 | 3300005458 | Ga0070681_10229940 | Ga0070681_102299401 | 294 |
| 105 | 3300005530 | Ga0070679_100046729 | Ga0070679_1000467294 | 294 |
| 106 | 3300009093 | Ga0105240_10328511 | Ga0105240_103285112 | 294 |
| 107 | 3300025913 | Ga0207695_10235923 | Ga0207695_102359232 | 294 |
| 108 | 3300026067 | Ga0207678_10046744 | Ga0207678_100467442 | 294 |
| 109 | 3300013307 | Ga0157372_10124114 | Ga0157372_101241142 | 296 |
| 110 | 3300053104 | Ga0500556_0000374 | Ga0500556_0000374_25186_26136 | 296 |
| 111 | 3300049591 | Ga0501075_0319129 | Ga0501075_0319129_109_1029 | 299 |
| 112 | iso_pu_bacteria | 8054357960 | 8054360169 | 301 |
| 113 | 3300031616 | Ga0307508_10074771 | Ga0307508_100747712 | 303 |
| 114 | 3300053092 | Ga0500583_0020890 | Ga0500583_0020890_1255_2199 | 304 |
| 115 | 3300005343 | Ga0070687_100160380 | Ga0070687_1001603801 | 305 |
| 116 | 3300005365 | Ga0070688_100099691 | Ga0070688_1000996912 | 305 |
| 117 | 3300005549 | Ga0070704_100321259 | Ga0070704_1003212592 | 305 |
| 118 | 3300005617 | Ga0068859_100115963 | Ga0068859_1001159632 | 305 |
| 119 | 3300005617 | Ga0068859_100223012 | Ga0068859_1002230122 | 305 |
| 120 | 3300006931 | Ga0097620_100115964 | Ga0097620_1001159642 | 305 |
| 121 | 3300006931 | Ga0097620_100223007 | Ga0097620_1002230072 | 305 |
| 122 | 3300025934 | Ga0207686_10076906 | Ga0207686_100769062 | 305 |
| 123 | 3300028563 | Ga0265319_1020051 | Ga0265319_10200513 | 305 |
| 124 | 3300028573 | Ga0265334_10000127 | Ga0265334_1000012735 | 305 |
| 125 | 3300028577 | Ga0265318_10000024 | Ga0265318_1000002465 | 305 |
| 126 | 3300028800 | Ga0265338_10010433 | Ga0265338_1001043311 | 305 |
| 127 | 3300031235 | Ga0265330_10003907 | Ga0265330_100039072 | 305 |
| 128 | 3300031239 | Ga0265328_10010066 | Ga0265328_100100662 | 305 |
| 129 | 3300031240 | Ga0265320_10005045 | Ga0265320_1000504511 | 305 |
| 130 | 3300031241 | Ga0265325_10005133 | Ga0265325_100051338 | 305 |
| 131 | 3300031249 | Ga0265339_10023115 | Ga0265339_100231153 | 305 |
| 132 | 3300031250 | Ga0265331_10005948 | Ga0265331_100059486 | 305 |
| 133 | 3300031344 | Ga0265316_10024185 | Ga0265316_100241855 | 305 |
| 134 | 3300031595 | Ga0265313_10004752 | Ga0265313_100047527 | 305 |
| 135 | 3300031711 | Ga0265314_10001695 | Ga0265314_1000169510 | 305 |
| 136 | 3300031712 | Ga0265342_10068460 | Ga0265342_100684602 | 305 |
| 137 | iso_pu_bacteria | 2547132103 | 2547373081 | 305 |
| 138 | iso_pu_bacteria | 2843690924 | 2843691967 | 305 |
| 139 | iso_pu_bacteria | 2846037992 | 2846040439 | 305 |
| 140 | 3300005331 | Ga0070670_100025491 | Ga0070670_1000254914 | 306 |
| 141 | 3300005344 | Ga0070661_100175855 | Ga0070661_1001758552 | 306 |
| 142 | iso_pu_bacteria | 2511231003 | 2511250642 | 306 |
| 143 | iso_pu_bacteria | 2511231026 | 2511384950 | 306 |
| 144 | iso_pu_bacteria | 2643221556 | 2643802366 | 306 |
| 145 | iso_pu_bacteria | 2643221603 | 2644030670 | 306 |
| 146 | iso_pu_bacteria | 2643221684 | 2644475879 | 306 |
| 147 | iso_pu_bacteria | 2765235838 | 2765569009 | 306 |
| 148 | iso_pu_bacteria | 2808606418 | 2809145418 | 306 |
| 149 | iso_pu_bacteria | 2818991436 | 2819542543 | 306 |
| 150 | iso_pu_bacteria | 8047673197 | 8047673771 | 306 |
| 151 | 3300031727 | Ga0316576_10022743 | Ga0316576_100227432 | 307 |
| 152 | 3300031728 | Ga0316578_10003631 | Ga0316578_100036313 | 307 |
| 153 | 3300031728 | Ga0316578_10024545 | Ga0316578_100245454 | 307 |
| 154 | 3300031733 | Ga0316577_10001334 | Ga0316577_100013346 | 307 |
| 155 | 3300032133 | Ga0316583_10028218 | Ga0316583_100282181 | 307 |
| 156 | 3300032137 | Ga0316585_10000956 | Ga0316585_100009564 | 307 |
| 157 | 3300032139 | Ga0316580_10022804 | Ga0316580_100228042 | 307 |
| 158 | 3300032168 | Ga0316593_10003014 | Ga0316593_100030142 | 307 |
| 159 | 3300033541 | Ga0316596_1002070 | Ga0316596_10020705 | 307 |
| 160 | 3300035398 | Ga0316574_0007763 | Ga0316574_0007763_1362_2291 | 307 |
| 161 | 3300036647 | Ga0316582_0017047 | Ga0316582_0017047_2798_3727 | 307 |
| 162 | 3300036712 | Ga0316584_0005374 | Ga0316584_0005374_758_1687 | 307 |
| 163 | 3300003322 | rootL2_10014064 | rootL2_100140644 | 308 |
| 164 | 3300005295 | Ga0065707_10082492 | Ga0065707_1008249214 | 308 |
| 165 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001541 | 308 |
| 166 | 3300005335 | Ga0070666_10015694 | Ga0070666_100156942 | 308 |
| 167 | 3300005355 | Ga0070671_100000018 | Ga0070671_10000001894 | 308 |
| 168 | 3300005365 | Ga0070688_100004521 | Ga0070688_1000045219 | 308 |
| 169 | 3300005367 | Ga0070667_100000026 | Ga0070667_10000002673 | 308 |
| 170 | 3300005436 | Ga0070713_100230531 | Ga0070713_1002305311 | 308 |
| 171 | 3300005466 | Ga0070685_10000007 | Ga0070685_10000007153 | 308 |
| 172 | 3300005548 | Ga0070665_100068997 | Ga0070665_1000689972 | 308 |
| 173 | 3300005563 | Ga0068855_100031837 | Ga0068855_1000318375 | 308 |
| 174 | 3300005617 | Ga0068859_100007685 | Ga0068859_10000768510 | 308 |
| 175 | 3300005618 | Ga0068864_100000012 | Ga0068864_100000012183 | 308 |
| 176 | 3300005842 | Ga0068858_100016226 | Ga0068858_1000162264 | 308 |
| 177 | 3300005843 | Ga0068860_100007832 | Ga0068860_1000078327 | 308 |
| 178 | 3300005844 | Ga0068862_100001146 | Ga0068862_10000114611 | 308 |
| 179 | 3300006931 | Ga0097620_100007685 | Ga0097620_10000768510 | 308 |
| 180 | 3300007788 | Ga0099795_10000014 | Ga0099795_1000001454 | 308 |
| 181 | 3300009101 | Ga0105247_10202911 | Ga0105247_102029112 | 308 |
| 182 | 3300009553 | Ga0105249_10086586 | Ga0105249_100865863 | 308 |
| 183 | 3300010159 | Ga0099796_10000054 | Ga0099796_1000005422 | 308 |
| 184 | 3300013105 | Ga0157369_10001598 | Ga0157369_1000159814 | 308 |
| 185 | 3300014325 | Ga0163163_10000051 | Ga0163163_1000005156 | 308 |
| 186 | 3300021377 | Ga0213874_10066299 | Ga0213874_100662992 | 308 |
| 187 | 3300025903 | Ga0207680_10004217 | Ga0207680_100042176 | 308 |
| 188 | 3300025913 | Ga0207695_10109895 | Ga0207695_101098953 | 308 |
| 189 | 3300025925 | Ga0207650_10000002 | Ga0207650_100000021217 | 308 |
| 190 | 3300025928 | Ga0207700_10135931 | Ga0207700_101359313 | 308 |
| 191 | 3300025928 | Ga0207700_10247189 | Ga0207700_102471891 | 308 |
| 192 | 3300025931 | Ga0207644_10000026 | Ga0207644_1000002684 | 308 |
| 193 | 3300025941 | Ga0207711_10000279 | Ga0207711_1000027935 | 308 |
| 194 | 3300025949 | Ga0207667_10013878 | Ga0207667_100138789 | 308 |
| 195 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001138 | 308 |
| 196 | 3300026035 | Ga0207703_10026533 | Ga0207703_100265334 | 308 |
| 197 | 3300026088 | Ga0207641_10416560 | Ga0207641_104165602 | 308 |
| 198 | 3300026088 | Ga0207641_10416561 | Ga0207641_104165612 | 308 |
| 199 | 3300026095 | Ga0207676_10000001 | Ga0207676_100000011217 | 308 |
| 200 | 3300027512 | Ga0209179_1000013 | Ga0209179_100001361 | 308 |
| 201 | 3300028379 | Ga0268266_10004153 | Ga0268266_100041539 | 308 |
| 202 | 3300028380 | Ga0268265_10001823 | Ga0268265_1000182310 | 308 |
| 203 | 3300028381 | Ga0268264_10000061 | Ga0268264_10000061135 | 308 |
| 204 | 3300028800 | Ga0265338_10028206 | Ga0265338_100282062 | 308 |
| 205 | 3300031247 | Ga0265340_10045334 | Ga0265340_100453342 | 308 |
| 206 | 3300031665 | Ga0316575_10018347 | Ga0316575_100183472 | 308 |
| 207 | 3300039450 | Ga0436363_0672559 | Ga0436363_0672559_5109_6059 | 308 |
| 208 | 3300046492 | Ga0495585_0065111 | Ga0495585_0065111_576_1502 | 308 |
| 209 | 3300046506 | Ga0495583_0059784 | Ga0495583_0059784_474_1400 | 308 |
| 210 | 3300046542 | Ga0495597_0014117 | Ga0495597_0014117_1779_2705 | 308 |
| 211 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_878415_879341 | 308 |
| 212 | 3300049582 | Ga0501048_0286988 | Ga0501048_0286988_169_1104 | 308 |
| 213 | 3300049823 | Ga0501044_0001746 | Ga0501044_0001746_11290_12225 | 308 |
| 214 | 3300053098 | Ga0500650_0000034 | Ga0500650_0000034_22598_23536 | 308 |
| 215 | 3300005329 | Ga0070683_100016811 | Ga0070683_1000168116 | 309 |
| 216 | 3300005335 | Ga0070666_10036180 | Ga0070666_100361804 | 309 |
| 217 | 3300005335 | Ga0070666_10049131 | Ga0070666_100491313 | 309 |
| 218 | 3300005336 | Ga0070680_100026542 | Ga0070680_1000265424 | 309 |
| 219 | 3300005336 | Ga0070680_100085042 | Ga0070680_1000850422 | 309 |
| 220 | 3300005339 | Ga0070660_100014318 | Ga0070660_1000143183 | 309 |
| 221 | 3300005340 | Ga0070689_100008006 | Ga0070689_1000080062 | 309 |
| 222 | 3300005344 | Ga0070661_100000813 | Ga0070661_10000081317 | 309 |
| 223 | 3300005347 | Ga0070668_100023143 | Ga0070668_1000231435 | 309 |
| 224 | 3300005354 | Ga0070675_100177229 | Ga0070675_1001772292 | 309 |
| 225 | 3300005355 | Ga0070671_100010483 | Ga0070671_1000104837 | 309 |
| 226 | 3300005356 | Ga0070674_100003565 | Ga0070674_1000035659 | 309 |
| 227 | 3300005367 | Ga0070667_100020275 | Ga0070667_1000202752 | 309 |
| 228 | 3300005367 | Ga0070667_100049400 | Ga0070667_1000494003 | 309 |
| 229 | 3300005436 | Ga0070713_100212468 | Ga0070713_1002124682 | 309 |
| 230 | 3300005438 | Ga0070701_10058065 | Ga0070701_100580652 | 309 |
| 231 | 3300005455 | Ga0070663_100240090 | Ga0070663_1002400902 | 309 |
| 232 | 3300005457 | Ga0070662_100014371 | Ga0070662_1000143715 | 309 |
| 233 | 3300005457 | Ga0070662_100038172 | Ga0070662_1000381724 | 309 |
| 234 | 3300005458 | Ga0070681_10005499 | Ga0070681_1000549914 | 309 |
| 235 | 3300005459 | Ga0068867_100032317 | Ga0068867_1000323171 | 309 |
| 236 | 3300005530 | Ga0070679_100008554 | Ga0070679_10000855411 | 309 |
| 237 | 3300005530 | Ga0070679_100422533 | Ga0070679_1004225332 | 309 |
| 238 | 3300005535 | Ga0070684_100005117 | Ga0070684_1000051177 | 309 |
| 239 | 3300005539 | Ga0068853_100099084 | Ga0068853_1000990841 | 309 |
| 240 | 3300005544 | Ga0070686_100009512 | Ga0070686_1000095122 | 309 |
| 241 | 3300005546 | Ga0070696_100087225 | Ga0070696_1000872252 | 309 |
| 242 | 3300005548 | Ga0070665_100044195 | Ga0070665_1000441955 | 309 |
| 243 | 3300005548 | Ga0070665_100567097 | Ga0070665_1005670972 | 309 |
| 244 | 3300005549 | Ga0070704_100135283 | Ga0070704_1001352832 | 309 |
| 245 | 3300005563 | Ga0068855_100008719 | Ga0068855_10000871912 | 309 |
| 246 | 3300005564 | Ga0070664_100014812 | Ga0070664_1000148125 | 309 |
| 247 | 3300005577 | Ga0068857_100006850 | Ga0068857_10000685011 | 309 |
| 248 | 3300005577 | Ga0068857_100140938 | Ga0068857_1001409382 | 309 |
| 249 | 3300005578 | Ga0068854_100005152 | Ga0068854_1000051528 | 309 |
| 250 | 3300005614 | Ga0068856_100016323 | Ga0068856_1000163233 | 309 |
| 251 | 3300005614 | Ga0068856_100092120 | Ga0068856_1000921205 | 309 |
| 252 | 3300005616 | Ga0068852_100001206 | Ga0068852_1000012069 | 309 |
| 253 | 3300005616 | Ga0068852_100095514 | Ga0068852_1000955141 | 309 |
| 254 | 3300005617 | Ga0068859_100001745 | Ga0068859_10000174513 | 309 |
| 255 | 3300005617 | Ga0068859_100080974 | Ga0068859_1000809744 | 309 |
| 256 | 3300005718 | Ga0068866_10150941 | Ga0068866_101509412 | 309 |
| 257 | 3300005719 | Ga0068861_100208178 | Ga0068861_1002081782 | 309 |
| 258 | 3300005719 | Ga0068861_100335508 | Ga0068861_1003355082 | 309 |
| 259 | 3300005841 | Ga0068863_100008065 | Ga0068863_1000080656 | 309 |
| 260 | 3300005841 | Ga0068863_100017541 | Ga0068863_1000175415 | 309 |
| 261 | 3300005842 | Ga0068858_100001018 | Ga0068858_10000101818 | 309 |
| 262 | 3300005842 | Ga0068858_100017352 | Ga0068858_1000173527 | 309 |
| 263 | 3300005842 | Ga0068858_100428549 | Ga0068858_1004285492 | 309 |
| 264 | 3300005843 | Ga0068860_100004168 | Ga0068860_1000041683 | 309 |
| 265 | 3300005844 | Ga0068862_100036344 | Ga0068862_1000363444 | 309 |
| 266 | 3300006048 | Ga0075363_100002122 | Ga0075363_1000021221 | 309 |
| 267 | 3300006178 | Ga0075367_10013597 | Ga0075367_100135972 | 309 |
| 268 | 3300006186 | Ga0075369_10064583 | Ga0075369_100645832 | 309 |
| 269 | 3300006195 | Ga0075366_10123535 | Ga0075366_101235352 | 309 |
| 270 | 3300006846 | Ga0075430_100011821 | Ga0075430_10001182110 | 309 |
| 271 | 3300006847 | Ga0075431_100035076 | Ga0075431_1000350763 | 309 |
| 272 | 3300006847 | Ga0075431_100104471 | Ga0075431_1001044713 | 309 |
| 273 | 3300006881 | Ga0068865_100008565 | Ga0068865_1000085655 | 309 |
| 274 | 3300006931 | Ga0097620_100001745 | Ga0097620_10000174513 | 309 |
| 275 | 3300006931 | Ga0097620_100080966 | Ga0097620_1000809662 | 309 |
| 276 | 3300009093 | Ga0105240_10059153 | Ga0105240_100591532 | 309 |
| 277 | 3300009094 | Ga0111539_10012880 | Ga0111539_1001288011 | 309 |
| 278 | 3300009094 | Ga0111539_10429433 | Ga0111539_104294331 | 309 |
| 279 | 3300009101 | Ga0105247_10018455 | Ga0105247_100184555 | 309 |
| 280 | 3300009174 | Ga0105241_10044133 | Ga0105241_100441332 | 309 |
| 281 | 3300009174 | Ga0105241_10082865 | Ga0105241_100828651 | 309 |
| 282 | 3300009176 | Ga0105242_10054998 | Ga0105242_100549984 | 309 |
| 283 | 3300009177 | Ga0105248_10123619 | Ga0105248_101236193 | 309 |
| 284 | 3300009545 | Ga0105237_10023342 | Ga0105237_100233424 | 309 |
| 285 | 3300009545 | Ga0105237_10310823 | Ga0105237_103108232 | 309 |
| 286 | 3300009551 | Ga0105238_10003217 | Ga0105238_100032175 | 309 |
| 287 | 3300009551 | Ga0105238_10049013 | Ga0105238_100490135 | 309 |
| 288 | 3300009551 | Ga0105238_10371117 | Ga0105238_103711172 | 309 |
| 289 | 3300009553 | Ga0105249_10070890 | Ga0105249_100708902 | 309 |
| 290 | 3300009553 | Ga0105249_10263908 | Ga0105249_102639082 | 309 |
| 291 | 3300013100 | Ga0157373_10006638 | Ga0157373_100066385 | 309 |
| 292 | 3300013104 | Ga0157370_10031830 | Ga0157370_100318303 | 309 |
| 293 | 3300013105 | Ga0157369_10004689 | Ga0157369_1000468915 | 309 |
| 294 | 3300013105 | Ga0157369_10019811 | Ga0157369_100198112 | 309 |
| 295 | 3300013296 | Ga0157374_10265654 | Ga0157374_102656542 | 309 |
| 296 | 3300013297 | Ga0157378_10012175 | Ga0157378_100121753 | 309 |
| 297 | 3300013306 | Ga0163162_10002139 | Ga0163162_100021395 | 309 |
| 298 | 3300013306 | Ga0163162_10021561 | Ga0163162_100215612 | 309 |
| 299 | 3300013307 | Ga0157372_10020911 | Ga0157372_100209115 | 309 |
| 300 | 3300013308 | Ga0157375_10171726 | Ga0157375_101717262 | 309 |
| 301 | 3300014325 | Ga0163163_10144606 | Ga0163163_101446062 | 309 |
| 302 | 3300014497 | Ga0182008_10103316 | Ga0182008_101033162 | 309 |
| 303 | 3300014968 | Ga0157379_10034926 | Ga0157379_100349262 | 309 |
| 304 | 3300014968 | Ga0157379_10247486 | Ga0157379_102474862 | 309 |
| 305 | 3300014969 | Ga0157376_10396632 | Ga0157376_103966322 | 309 |
| 306 | 3300017792 | Ga0163161_10165647 | Ga0163161_101656472 | 309 |
| 307 | 3300021361 | Ga0213872_10001047 | Ga0213872_1000104713 | 309 |
| 308 | 3300021361 | Ga0213872_10011598 | Ga0213872_100115983 | 309 |
| 309 | 3300021384 | Ga0213876_10107712 | Ga0213876_101077122 | 309 |
| 310 | 3300025893 | Ga0207682_10000363 | Ga0207682_1000036311 | 309 |
| 311 | 3300025899 | Ga0207642_10030040 | Ga0207642_100300403 | 309 |
| 312 | 3300025900 | Ga0207710_10000230 | Ga0207710_1000023017 | 309 |
| 313 | 3300025900 | Ga0207710_10070795 | Ga0207710_100707951 | 309 |
| 314 | 3300025903 | Ga0207680_10041684 | Ga0207680_100416844 | 309 |
| 315 | 3300025907 | Ga0207645_10000178 | Ga0207645_1000017814 | 309 |
| 316 | 3300025907 | Ga0207645_10008955 | Ga0207645_100089558 | 309 |
| 317 | 3300025908 | Ga0207643_10020654 | Ga0207643_100206544 | 309 |
| 318 | 3300025908 | Ga0207643_10174565 | Ga0207643_101745651 | 309 |
| 319 | 3300025911 | Ga0207654_10280643 | Ga0207654_102806432 | 309 |
| 320 | 3300025912 | Ga0207707_10024558 | Ga0207707_100245586 | 309 |
| 321 | 3300025912 | Ga0207707_10045689 | Ga0207707_100456894 | 309 |
| 322 | 3300025913 | Ga0207695_10018572 | Ga0207695_100185727 | 309 |
| 323 | 3300025913 | Ga0207695_10073110 | Ga0207695_100731102 | 309 |
| 324 | 3300025914 | Ga0207671_10182076 | Ga0207671_101820762 | 309 |
| 325 | 3300025917 | Ga0207660_10027094 | Ga0207660_100270945 | 309 |
| 326 | 3300025918 | Ga0207662_10015635 | Ga0207662_100156355 | 309 |
| 327 | 3300025919 | Ga0207657_10019066 | Ga0207657_100190665 | 309 |
| 328 | 3300025920 | Ga0207649_10000924 | Ga0207649_100009246 | 309 |
| 329 | 3300025921 | Ga0207652_10375354 | Ga0207652_103753542 | 309 |
| 330 | 3300025924 | Ga0207694_10003088 | Ga0207694_100030887 | 309 |
| 331 | 3300025924 | Ga0207694_10015470 | Ga0207694_100154704 | 309 |
| 332 | 3300025924 | Ga0207694_10040729 | Ga0207694_100407293 | 309 |
| 333 | 3300025924 | Ga0207694_10260318 | Ga0207694_102603182 | 309 |
| 334 | 3300025929 | Ga0207664_10015733 | Ga0207664_100157334 | 309 |
| 335 | 3300025931 | Ga0207644_10001003 | Ga0207644_100010037 | 309 |
| 336 | 3300025931 | Ga0207644_10036298 | Ga0207644_100362984 | 309 |
| 337 | 3300025933 | Ga0207706_10000721 | Ga0207706_100007216 | 309 |
| 338 | 3300025933 | Ga0207706_10007741 | Ga0207706_1000774112 | 309 |
| 339 | 3300025935 | Ga0207709_10040362 | Ga0207709_100403623 | 309 |
| 340 | 3300025940 | Ga0207691_10191110 | Ga0207691_101911102 | 309 |
| 341 | 3300025942 | Ga0207689_10043003 | Ga0207689_100430032 | 309 |
| 342 | 3300025945 | Ga0207679_10066044 | Ga0207679_100660442 | 309 |
| 343 | 3300025945 | Ga0207679_10069762 | Ga0207679_100697622 | 309 |
| 344 | 3300025949 | Ga0207667_10019236 | Ga0207667_100192366 | 309 |
| 345 | 3300025981 | Ga0207640_10207290 | Ga0207640_102072902 | 309 |
| 346 | 3300025986 | Ga0207658_10021308 | Ga0207658_100213083 | 309 |
| 347 | 3300025986 | Ga0207658_10048303 | Ga0207658_100483032 | 309 |
| 348 | 3300026035 | Ga0207703_10000931 | Ga0207703_1000093112 | 309 |
| 349 | 3300026035 | Ga0207703_10001837 | Ga0207703_100018372 | 309 |
| 350 | 3300026067 | Ga0207678_10028049 | Ga0207678_100280495 | 309 |
| 351 | 3300026075 | Ga0207708_10003301 | Ga0207708_1000330113 | 309 |
| 352 | 3300026078 | Ga0207702_10003782 | Ga0207702_1000378212 | 309 |
| 353 | 3300026088 | Ga0207641_10002241 | Ga0207641_1000224114 | 309 |
| 354 | 3300026089 | Ga0207648_10001407 | Ga0207648_1000140718 | 309 |
| 355 | 3300026116 | Ga0207674_10000536 | Ga0207674_100005367 | 309 |
| 356 | 3300026116 | Ga0207674_10260873 | Ga0207674_102608732 | 309 |
| 357 | 3300026116 | Ga0207674_10281293 | Ga0207674_102812932 | 309 |
| 358 | 3300026118 | Ga0207675_100000345 | Ga0207675_10000034522 | 309 |
| 359 | 3300026118 | Ga0207675_100009265 | Ga0207675_1000092656 | 309 |
| 360 | 3300026118 | Ga0207675_100010996 | Ga0207675_1000109962 | 309 |
| 361 | 3300026121 | Ga0207683_10047615 | Ga0207683_100476151 | 309 |
| 362 | 3300026142 | Ga0207698_10012426 | Ga0207698_100124266 | 309 |
| 363 | 3300028016 | Ga0265354_1000774 | Ga0265354_10007747 | 309 |
| 364 | 3300028379 | Ga0268266_10001083 | Ga0268266_1000108310 | 309 |
| 365 | 3300028379 | Ga0268266_10047347 | Ga0268266_100473472 | 309 |
| 366 | 3300028379 | Ga0268266_10409662 | Ga0268266_104096621 | 309 |
| 367 | 3300028381 | Ga0268264_10000179 | Ga0268264_1000017970 | 309 |
| 368 | 3300028794 | Ga0307515_10299892 | Ga0307515_102998922 | 309 |
| 369 | 3300030521 | Ga0307511_10000040 | Ga0307511_1000004070 | 309 |
| 370 | 3300030878 | Ga0265770_1000354 | Ga0265770_10003545 | 309 |
| 371 | 3300031251 | Ga0265327_10000014 | Ga0265327_1000001488 | 309 |
| 372 | 3300031507 | Ga0307509_10001628 | Ga0307509_1000162828 | 309 |
| 373 | 3300031733 | Ga0316577_10009802 | Ga0316577_100098027 | 309 |
| 374 | 3300032126 | Ga0307415_100139537 | Ga0307415_1001395372 | 309 |
| 375 | 3300033180 | Ga0307510_10000013 | Ga0307510_10000013128 | 309 |
| 376 | 3300033180 | Ga0307510_10010455 | Ga0307510_1001045511 | 309 |
| 377 | 3300035113 | Ga0373936_0015718 | Ga0373936_0015718_295_1260 | 309 |
| 378 | 3300035398 | Ga0316574_0021798 | Ga0316574_0021798_1706_2641 | 309 |
| 379 | 3300035398 | Ga0316574_0023127 | Ga0316574_0023127_2208_3167 | 309 |
| 380 | 3300037466 | Ga0395898_0003704 | Ga0395898_0003704_15125_16069 | 309 |
| 381 | 3300037471 | Ga0395905_0242584 | Ga0395905_0242584_152_1087 | 309 |
| 382 | 3300039447 | Ga0436361_0119299 | Ga0436361_0119299_16562_17494 | 309 |
| 383 | 3300039447 | Ga0436361_0837724 | Ga0436361_0837724_1087_2019 | 309 |
| 384 | 3300039453 | Ga0436362_0176928 | Ga0436362_0176928_1648_2601 | 309 |
| 385 | 3300041486 | Ga0451807_1281246 | Ga0451807_1281246_324_1271 | 309 |
| 386 | 3300042876 | Ga0451577_0097310 | Ga0451577_0097310_1344_2279 | 309 |
| 387 | 3300042876 | Ga0451577_0104243 | Ga0451577_0104243_354_1289 | 309 |
| 388 | 3300044673 | Ga0453683_0068607 | Ga0453683_0068607_1028_1963 | 309 |
| 389 | 3300044901 | Ga0466960_0126220 | Ga0466960_0126220_264_1208 | 309 |
| 390 | 3300045049 | Ga0466959_0045778 | Ga0466959_0045778_946_1875 | 309 |
| 391 | 3300045049 | Ga0466959_0080319 | Ga0466959_0080319_74_1018 | 309 |
| 392 | 3300045051 | Ga0451576_0000250 | Ga0451576_0000250_126531_127466 | 309 |
| 393 | 3300046459 | Ga0495629_0132375 | Ga0495629_0132375_478_1410 | 309 |
| 394 | 3300046460 | Ga0495638_0048144 | Ga0495638_0048144_749_1681 | 309 |
| 395 | 3300046474 | Ga0495605_0003370 | Ga0495605_0003370_308_1240 | 309 |
| 396 | 3300046522 | Ga0495643_0019252 | Ga0495643_0019252_560_1489 | 309 |
| 397 | 3300046531 | Ga0495665_0030666 | Ga0495665_0030666_1436_2368 | 309 |
| 398 | 3300046537 | Ga0495598_0022846 | Ga0495598_0022846_44_988 | 309 |
| 399 | 3300046674 | Ga0495588_0067940 | Ga0495588_0067940_288_1217 | 309 |
| 400 | 3300048905 | Ga0496102_0039013 | Ga0496102_0039013_1725_2669 | 309 |
| 401 | 3300048905 | Ga0496102_0073083 | Ga0496102_0073083_657_1589 | 309 |
| 402 | 3300048916 | Ga0496113_0347407 | Ga0496113_0347407_228_1163 | 309 |
| 403 | 3300048919 | Ga0496116_0046354 | Ga0496116_0046354_1794_2738 | 309 |
| 404 | 3300048920 | Ga0496117_0000057 | Ga0496117_0000057_173123_174067 | 309 |
| 405 | 3300048921 | Ga0496118_0000028 | Ga0496118_0000028_126953_127897 | 309 |
| 406 | 3300048922 | Ga0496119_0005745 | Ga0496119_0005745_1148_2104 | 309 |
| 407 | 3300048922 | Ga0496119_0009417 | Ga0496119_0009417_6193_7137 | 309 |
| 408 | 3300048923 | Ga0496120_0007468 | Ga0496120_0007468_1147_2103 | 309 |
| 409 | 3300048923 | Ga0496120_0014995 | Ga0496120_0014995_2739_3683 | 309 |
| 410 | 3300048923 | Ga0496120_0056979 | Ga0496120_0056979_406_1350 | 309 |
| 411 | 3300048924 | Ga0496121_0029970 | Ga0496121_0029970_928_1872 | 309 |
| 412 | 3300048927 | Ga0496124_0012916 | Ga0496124_0012916_6907_7851 | 309 |
| 413 | 3300048928 | Ga0496125_0011721 | Ga0496125_0011721_7676_8617 | 309 |
| 414 | 3300048928 | Ga0496125_0013698 | Ga0496125_0013698_6147_7091 | 309 |
| 415 | 3300048929 | Ga0496126_0038970 | Ga0496126_0038970_30_971 | 309 |
| 416 | 3300048929 | Ga0496126_0068887 | Ga0496126_0068887_1286_2230 | 309 |
| 417 | 3300049573 | Ga0501037_0008788 | Ga0501037_0008788_4927_5871 | 309 |
| 418 | 3300049575 | Ga0501039_0030179 | Ga0501039_0030179_2967_3911 | 309 |
| 419 | 3300049576 | Ga0501040_0049070 | Ga0501040_0049070_1188_2141 | 309 |
| 420 | 3300049580 | Ga0501046_0012173 | Ga0501046_0012173_318_1262 | 309 |
| 421 | 3300049581 | Ga0501047_0098639 | Ga0501047_0098639_1075_2013 | 309 |
| 422 | 3300049585 | Ga0501069_0020201 | Ga0501069_0020201_1104_2048 | 309 |
| 423 | 3300049586 | Ga0501070_0008303 | Ga0501070_0008303_4829_5773 | 309 |
| 424 | 3300049743 | Ga0501081_0244740 | Ga0501081_0244740_284_1237 | 309 |
| 425 | 3300050496 | nmdc:mga07m45_124896_c1 | nmdc:mga07m45_124896_c1_532_1461 | 309 |
| 426 | 3300050509 | nmdc:mga0qj67_232795_c1 | nmdc:mga0qj67_232795_c1_224_1177 | 309 |
| 427 | 3300050509 | nmdc:mga0qj67_7557_c1 | nmdc:mga0qj67_7557_c1_1594_2532 | 309 |
| 428 | 3300050510 | nmdc:mga06r32_166393_c1 | nmdc:mga06r32_166393_c1_587_1525 | 309 |
| 429 | 3300050510 | nmdc:mga06r32_34635_c1 | nmdc:mga06r32_34635_c1_2846_3799 | 309 |
| 430 | 3300053090 | Ga0500646_0031268 | Ga0500646_0031268_96_1049 | 309 |
| 431 | 3300053092 | Ga0500583_0001580 | Ga0500583_0001580_5156_6109 | 309 |
| 432 | 3300053095 | Ga0500640_090446 | Ga0500640_090446_251_1207 | 309 |
| 433 | 3300053139 | Ga0500568_0004577 | Ga0500568_0004577_2037_2975 | 309 |
| 434 | 3300053160 | Ga0500633_0115889 | Ga0500633_0115889_17_970 | 309 |
| 435 | iso_pu_bacteria | 8001522603 | 8001526377 | 309 |
| 436 | 3300002705 | JGI25156J39149_1004435 | JGI25156J39149_10044353 | 310 |
| 437 | 3300002737 | JGI25162J39368_1000036 | JGI25162J39368_100003693 | 310 |
| 438 | 3300002738 | JGI25154J39366_1002733 | JGI25154J39366_10027333 | 310 |
| 439 | 3300002774 | JGI25150J39212_1005125 | JGI25150J39212_10051252 | 310 |
| 440 | 3300003214 | JGI25165J46597_1000022 | JGI25165J46597_1000022265 | 310 |
| 441 | 3300003574 | Ga0007410J51695_1012750 | Ga0007410J51695_10127505 | 310 |
| 442 | 3300003575 | Ga0007409J51694_1006362 | Ga0007409J51694_10063625 | 310 |
| 443 | 3300003577 | Ga0007416J51690_1012585 | Ga0007416J51690_10125853 | 310 |
| 444 | 3300003693 | Ga0032354_1023937 | Ga0032354_10239371 | 310 |
| 445 | 3300003751 | Ga0055538_1000011 | Ga0055538_100001192 | 310 |
| 446 | 3300003752 | Ga0055539_1000016 | Ga0055539_1000016265 | 310 |
| 447 | 3300003756 | Ga0055533_1000019 | Ga0055533_1000019265 | 310 |
| 448 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001555 | 310 |
| 449 | 3300003759 | Ga0055525_1000042 | Ga0055525_100004293 | 310 |
| 450 | 3300003762 | Ga0055542_1010239 | Ga0055542_10102392 | 310 |
| 451 | 3300003841 | Ga0055541_1000017 | Ga0055541_1000017200 | 310 |
| 452 | 3300005328 | Ga0070676_10102203 | Ga0070676_101022032 | 310 |
| 453 | 3300005331 | Ga0070670_100127161 | Ga0070670_1001271613 | 310 |
| 454 | 3300005334 | Ga0068869_100040075 | Ga0068869_1000400755 | 310 |
| 455 | 3300005334 | Ga0068869_100087511 | Ga0068869_1000875112 | 310 |
| 456 | 3300005334 | Ga0068869_100182469 | Ga0068869_1001824692 | 310 |
| 457 | 3300005337 | Ga0070682_100003924 | Ga0070682_1000039242 | 310 |
| 458 | 3300005339 | Ga0070660_100041122 | Ga0070660_1000411222 | 310 |
| 459 | 3300005340 | Ga0070689_100016914 | Ga0070689_1000169147 | 310 |
| 460 | 3300005344 | Ga0070661_100036959 | Ga0070661_1000369592 | 310 |
| 461 | 3300005353 | Ga0070669_100164633 | Ga0070669_1001646331 | 310 |
| 462 | 3300005354 | Ga0070675_100024523 | Ga0070675_1000245232 | 310 |
| 463 | 3300005354 | Ga0070675_100031692 | Ga0070675_1000316926 | 310 |
| 464 | 3300005356 | Ga0070674_100013910 | Ga0070674_1000139102 | 310 |
| 465 | 3300005364 | Ga0070673_100060284 | Ga0070673_1000602842 | 310 |
| 466 | 3300005366 | Ga0070659_100053692 | Ga0070659_1000536922 | 310 |
| 467 | 3300005366 | Ga0070659_100070043 | Ga0070659_1000700433 | 310 |
| 468 | 3300005367 | Ga0070667_100247902 | Ga0070667_1002479022 | 310 |
| 469 | 3300005438 | Ga0070701_10052915 | Ga0070701_100529151 | 310 |
| 470 | 3300005440 | Ga0070705_100009205 | Ga0070705_1000092054 | 310 |
| 471 | 3300005456 | Ga0070678_100025418 | Ga0070678_1000254182 | 310 |
| 472 | 3300005459 | Ga0068867_100005237 | Ga0068867_1000052374 | 310 |
| 473 | 3300005459 | Ga0068867_100034852 | Ga0068867_1000348524 | 310 |
| 474 | 3300005459 | Ga0068867_100113656 | Ga0068867_1001136562 | 310 |
| 475 | 3300005466 | Ga0070685_10159859 | Ga0070685_101598592 | 310 |
| 476 | 3300005544 | Ga0070686_100027798 | Ga0070686_1000277984 | 310 |
| 477 | 3300005546 | Ga0070696_100031637 | Ga0070696_1000316376 | 310 |
| 478 | 3300005549 | Ga0070704_100032448 | Ga0070704_1000324485 | 310 |
| 479 | 3300005563 | Ga0068855_100220292 | Ga0068855_1002202922 | 310 |
| 480 | 3300005564 | Ga0070664_100065531 | Ga0070664_1000655313 | 310 |
| 481 | 3300005564 | Ga0070664_100216824 | Ga0070664_1002168242 | 310 |
| 482 | 3300005577 | Ga0068857_100396467 | Ga0068857_1003964671 | 310 |
| 483 | 3300005615 | Ga0070702_100017140 | Ga0070702_1000171404 | 310 |
| 484 | 3300005617 | Ga0068859_100150062 | Ga0068859_1001500623 | 310 |
| 485 | 3300005618 | Ga0068864_100037858 | Ga0068864_1000378582 | 310 |
| 486 | 3300005719 | Ga0068861_100000962 | Ga0068861_1000009624 | 310 |
| 487 | 3300005719 | Ga0068861_100101784 | Ga0068861_1001017842 | 310 |
| 488 | 3300005844 | Ga0068862_100033113 | Ga0068862_1000331136 | 310 |
| 489 | 3300005844 | Ga0068862_100209238 | Ga0068862_1002092382 | 310 |
| 490 | 3300006237 | Ga0097621_100068678 | Ga0097621_1000686784 | 310 |
| 491 | 3300006358 | Ga0068871_100100355 | Ga0068871_1001003552 | 310 |
| 492 | 3300006881 | Ga0068865_100023560 | Ga0068865_1000235603 | 310 |
| 493 | 3300006881 | Ga0068865_100278869 | Ga0068865_1002788692 | 310 |
| 494 | 3300006931 | Ga0097620_100150062 | Ga0097620_1001500623 | 310 |
| 495 | 3300009093 | Ga0105240_10038598 | Ga0105240_100385983 | 310 |
| 496 | 3300009148 | Ga0105243_10216785 | Ga0105243_102167852 | 310 |
| 497 | 3300009176 | Ga0105242_10030398 | Ga0105242_100303982 | 310 |
| 498 | 3300009176 | Ga0105242_10045340 | Ga0105242_100453402 | 310 |
| 499 | 3300013102 | Ga0157371_10000078 | Ga0157371_1000007873 | 310 |
| 500 | 3300013306 | Ga0163162_10012636 | Ga0163162_100126367 | 310 |
| 501 | 3300013307 | Ga0157372_10651454 | Ga0157372_106514541 | 310 |
| 502 | 3300013308 | Ga0157375_10088560 | Ga0157375_100885602 | 310 |
| 503 | 3300013308 | Ga0157375_10160315 | Ga0157375_101603153 | 310 |
| 504 | 3300013308 | Ga0157375_10310817 | Ga0157375_103108172 | 310 |
| 505 | 3300014326 | Ga0157380_10020523 | Ga0157380_100205232 | 310 |
| 506 | 3300014326 | Ga0157380_10080085 | Ga0157380_100800852 | 310 |
| 507 | 3300014326 | Ga0157380_10189332 | Ga0157380_101893322 | 310 |
| 508 | 3300014497 | Ga0182008_10117790 | Ga0182008_101177902 | 310 |
| 509 | 3300014969 | Ga0157376_10222159 | Ga0157376_102221592 | 310 |
| 510 | 3300015261 | Ga0182006_1010763 | Ga0182006_10107634 | 310 |
| 511 | 3300015262 | Ga0182007_10021648 | Ga0182007_100216482 | 310 |
| 512 | 3300015265 | Ga0182005_1000307 | Ga0182005_100030727 | 310 |
| 513 | 3300017792 | Ga0163161_10012670 | Ga0163161_100126702 | 310 |
| 514 | 3300021361 | Ga0213872_10000263 | Ga0213872_1000026338 | 310 |
| 515 | 3300021361 | Ga0213872_10012586 | Ga0213872_100125863 | 310 |
| 516 | 3300025206 | Ga0209435_100716 | Ga0209435_1007164 | 310 |
| 517 | 3300025224 | Ga0209784_100019 | Ga0209784_100019342 | 310 |
| 518 | 3300025225 | Ga0209566_100017 | Ga0209566_100017342 | 310 |
| 519 | 3300025226 | Ga0209674_100031 | Ga0209674_100031342 | 310 |
| 520 | 3300025228 | Ga0209672_106450 | Ga0209672_1064501 | 310 |
| 521 | 3300025230 | Ga0209563_100007 | Ga0209563_100007541 | 310 |
| 522 | 3300025230 | Ga0209563_100035 | Ga0209563_100035342 | 310 |
| 523 | 3300025231 | Ga0207427_100255 | Ga0207427_10025520 | 310 |
| 524 | 3300025233 | Ga0209437_100038 | Ga0209437_100038342 | 310 |
| 525 | 3300025246 | Ga0209646_1000872 | Ga0209646_10008723 | 310 |
| 526 | 3300025250 | Ga0209026_1003950 | Ga0209026_10039504 | 310 |
| 527 | 3300025253 | Ga0209677_100020 | Ga0209677_100020342 | 310 |
| 528 | 3300025254 | Ga0209148_1000992 | Ga0209148_10009929 | 310 |
| 529 | 3300025256 | Ga0209759_1000359 | Ga0209759_10003593 | 310 |
| 530 | 3300025261 | Ga0209233_1000049 | Ga0209233_1000049342 | 310 |
| 531 | 3300025893 | Ga0207682_10000537 | Ga0207682_1000053714 | 310 |
| 532 | 3300025907 | Ga0207645_10144605 | Ga0207645_101446051 | 310 |
| 533 | 3300025909 | Ga0207705_10023618 | Ga0207705_100236184 | 310 |
| 534 | 3300025913 | Ga0207695_10032578 | Ga0207695_100325787 | 310 |
| 535 | 3300025917 | Ga0207660_10094123 | Ga0207660_100941232 | 310 |
| 536 | 3300025919 | Ga0207657_10037258 | Ga0207657_100372584 | 310 |
| 537 | 3300025920 | Ga0207649_10035200 | Ga0207649_100352003 | 310 |
| 538 | 3300025933 | Ga0207706_10023309 | Ga0207706_100233092 | 310 |
| 539 | 3300025933 | Ga0207706_10070140 | Ga0207706_100701404 | 310 |
| 540 | 3300025934 | Ga0207686_10049440 | Ga0207686_100494402 | 310 |
| 541 | 3300025937 | Ga0207669_10100246 | Ga0207669_101002462 | 310 |
| 542 | 3300025938 | Ga0207704_10020566 | Ga0207704_100205665 | 310 |
| 543 | 3300025940 | Ga0207691_10007249 | Ga0207691_100072493 | 310 |
| 544 | 3300025940 | Ga0207691_10092587 | Ga0207691_100925872 | 310 |
| 545 | 3300025942 | Ga0207689_10012093 | Ga0207689_100120936 | 310 |
| 546 | 3300025942 | Ga0207689_10100862 | Ga0207689_101008622 | 310 |
| 547 | 3300025945 | Ga0207679_10004443 | Ga0207679_100044433 | 310 |
| 548 | 3300025945 | Ga0207679_10167752 | Ga0207679_101677522 | 310 |
| 549 | 3300025972 | Ga0207668_10220837 | Ga0207668_102208372 | 310 |
| 550 | 3300026067 | Ga0207678_10155218 | Ga0207678_101552183 | 310 |
| 551 | 3300026075 | Ga0207708_10106735 | Ga0207708_101067353 | 310 |
| 552 | 3300026089 | Ga0207648_10036960 | Ga0207648_100369602 | 310 |
| 553 | 3300026089 | Ga0207648_10307240 | Ga0207648_103072402 | 310 |
| 554 | 3300026095 | Ga0207676_10005269 | Ga0207676_1000526910 | 310 |
| 555 | 3300026116 | Ga0207674_10083098 | Ga0207674_100830984 | 310 |
| 556 | 3300026118 | Ga0207675_100001625 | Ga0207675_10000162511 | 310 |
| 557 | 3300026118 | Ga0207675_100012530 | Ga0207675_1000125304 | 310 |
| 558 | 3300026118 | Ga0207675_100105310 | Ga0207675_1001053103 | 310 |
| 559 | 3300026118 | Ga0207675_100276354 | Ga0207675_1002763542 | 310 |
| 560 | 3300026121 | Ga0207683_10034525 | Ga0207683_100345256 | 310 |
| 561 | 3300026121 | Ga0207683_10064063 | Ga0207683_100640634 | 310 |
| 562 | 3300026142 | Ga0207698_10057160 | Ga0207698_100571604 | 310 |
| 563 | 3300028380 | Ga0268265_10025833 | Ga0268265_100258334 | 310 |
| 564 | 3300028380 | Ga0268265_10284555 | Ga0268265_102845552 | 310 |
| 565 | 3300028381 | Ga0268264_10027283 | Ga0268264_100272833 | 310 |
| 566 | 3300031456 | Ga0307513_10063236 | Ga0307513_100632362 | 310 |
| 567 | 3300031507 | Ga0307509_10170332 | Ga0307509_101703322 | 310 |
| 568 | 3300031507 | Ga0307509_10176859 | Ga0307509_101768592 | 310 |
| 569 | 3300031507 | Ga0307509_10199032 | Ga0307509_101990322 | 310 |
| 570 | 3300031548 | Ga0307408_100001210 | Ga0307408_1000012104 | 310 |
| 571 | 3300031649 | Ga0307514_10091103 | Ga0307514_100911032 | 310 |
| 572 | 3300031852 | Ga0307410_10004428 | Ga0307410_100044286 | 310 |
| 573 | 3300031903 | Ga0307407_10005254 | Ga0307407_100052544 | 310 |
| 574 | 3300031995 | Ga0307409_100002705 | Ga0307409_1000027056 | 310 |
| 575 | 3300032168 | Ga0316593_10031252 | Ga0316593_100312522 | 310 |
| 576 | 3300033524 | Ga0316592_1000192 | Ga0316592_10001925 | 310 |
| 577 | 3300033541 | Ga0316596_1000369 | Ga0316596_10003695 | 310 |
| 578 | 3300037312 | Ga0395899_0000128 | Ga0395899_0000128_21033_21986 | 310 |
| 579 | 3300037312 | Ga0395899_0000904 | Ga0395899_0000904_18314_19246 | 310 |
| 580 | 3300037312 | Ga0395899_0002101 | Ga0395899_0002101_13096_14028 | 310 |
| 581 | 3300037312 | Ga0395899_0036149 | Ga0395899_0036149_1292_2227 | 310 |
| 582 | 3300037418 | Ga0395900_0000874 | Ga0395900_0000874_35372_36307 | 310 |
| 583 | 3300037418 | Ga0395900_0036284 | Ga0395900_0036284_3273_4205 | 310 |
| 584 | 3300037418 | Ga0395900_0050571 | Ga0395900_0050571_2409_3347 | 310 |
| 585 | 3300037418 | Ga0395900_0062747 | Ga0395900_0062747_949_1881 | 310 |
| 586 | 3300037418 | Ga0395900_0163739 | Ga0395900_0163739_1107_2039 | 310 |
| 587 | 3300037418 | Ga0395900_0322603 | Ga0395900_0322603_515_1453 | 310 |
| 588 | 3300037466 | Ga0395898_0039391 | Ga0395898_0039391_3411_4343 | 310 |
| 589 | 3300037466 | Ga0395898_0154334 | Ga0395898_0154334_1140_2078 | 310 |
| 590 | 3300037466 | Ga0395898_0157087 | Ga0395898_0157087_71_1006 | 310 |
| 591 | 3300037466 | Ga0395898_0160048 | Ga0395898_0160048_240_1175 | 310 |
| 592 | 3300037466 | Ga0395898_0207310 | Ga0395898_0207310_351_1286 | 310 |
| 593 | 3300037471 | Ga0395905_0009571 | Ga0395905_0009571_4645_5577 | 310 |
| 594 | 3300037471 | Ga0395905_0010272 | Ga0395905_0010272_8008_8940 | 310 |
| 595 | 3300037471 | Ga0395905_0075118 | Ga0395905_0075118_1274_2209 | 310 |
| 596 | 3300037471 | Ga0395905_0295595 | Ga0395905_0295595_404_1354 | 310 |
| 597 | 3300038443 | Ga0395901_0000054 | Ga0395901_0000054_10546_11481 | 310 |
| 598 | 3300038443 | Ga0395901_0003565 | Ga0395901_0003565_1939_2871 | 310 |
| 599 | 3300038443 | Ga0395901_0127852 | Ga0395901_0127852_485_1420 | 310 |
| 600 | 3300038443 | Ga0395901_0155312 | Ga0395901_0155312_575_1507 | 310 |
| 601 | 3300038443 | Ga0395901_0426283 | Ga0395901_0426283_280_1218 | 310 |
| 602 | 3300038725 | Ga0400484_03261 | Ga0400484_03261_17493_18434 | 310 |
| 603 | 3300038725 | Ga0400484_07350 | Ga0400484_07350_6008_6949 | 310 |
| 604 | 3300038726 | Ga0400490_20091 | Ga0400490_20091_6691_7632 | 310 |
| 605 | 3300038726 | Ga0400490_21770 | Ga0400490_21770_913_1854 | 310 |
| 606 | 3300038726 | Ga0400490_45662 | Ga0400490_45662_11927_12868 | 310 |
| 607 | 3300038726 | Ga0400490_51771 | Ga0400490_51771_920_1861 | 310 |
| 608 | 3300038727 | Ga0400491_10244 | Ga0400491_10244_932_1873 | 310 |
| 609 | 3300038727 | Ga0400491_16906 | Ga0400491_16906_205_1146 | 310 |
| 610 | 3300038741 | Ga0400488_04816 | Ga0400488_04816_32_973 | 310 |
| 611 | 3300038741 | Ga0400488_18372 | Ga0400488_18372_978_1925 | 310 |
| 612 | 3300038741 | Ga0400488_31619 | Ga0400488_31619_361_1302 | 310 |
| 613 | 3300038742 | Ga0400486_10786 | Ga0400486_10786_869_1810 | 310 |
| 614 | 3300039062 | Ga0400483_048826 | Ga0400483_048826_7489_8430 | 310 |
| 615 | 3300039062 | Ga0400483_163381 | Ga0400483_163381_1882_2823 | 310 |
| 616 | 3300039110 | Ga0400487_41427 | Ga0400487_41427_167_1108 | 310 |
| 617 | 3300039110 | Ga0400487_47735 | Ga0400487_47735_31266_32207 | 310 |
| 618 | 3300039110 | Ga0400487_51105 | Ga0400487_51105_464_1405 | 310 |
| 619 | 3300039447 | Ga0436361_0080172 | Ga0436361_0080172_37386_38318 | 310 |
| 620 | 3300039447 | Ga0436361_0944997 | Ga0436361_0944997_2070_3002 | 310 |
| 621 | 3300041441 | Ga0451787_573112 | Ga0451787_573112_1007_1972 | 310 |
| 622 | 3300041443 | Ga0451789_1220021 | Ga0451789_1220021_74_1039 | 310 |
| 623 | 3300041452 | Ga0451793_0865321 | Ga0451793_0865321_337_1287 | 310 |
| 624 | 3300042005 | Ga0439448_0003707 | Ga0439448_0003707_2349_3284 | 310 |
| 625 | 3300042005 | Ga0439448_0045297 | Ga0439448_0045297_352_1287 | 310 |
| 626 | 3300042008 | Ga0439450_024169 | Ga0439450_024169_212_1147 | 310 |
| 627 | 3300042008 | Ga0439450_039179 | Ga0439450_039179_11_946 | 310 |
| 628 | 3300042139 | Ga0450904_001557 | Ga0450904_001557_1370_2308 | 310 |
| 629 | 3300042157 | Ga0439458_0001531 | Ga0439458_0001531_3235_4170 | 310 |
| 630 | 3300044656 | Ga0466969_0015826 | Ga0466969_0015826_2385_3320 | 310 |
| 631 | 3300044658 | Ga0466972_0002881 | Ga0466972_0002881_748_1683 | 310 |
| 632 | 3300044683 | Ga0466965_0014133 | Ga0466965_0014133_2395_3330 | 310 |
| 633 | 3300044683 | Ga0466965_0016917 | Ga0466965_0016917_472_1407 | 310 |
| 634 | 3300044683 | Ga0466965_0043666 | Ga0466965_0043666_774_1721 | 310 |
| 635 | 3300044684 | Ga0466966_0005305 | Ga0466966_0005305_874_1806 | 310 |
| 636 | 3300044684 | Ga0466966_0033545 | Ga0466966_0033545_2295_3233 | 310 |
| 637 | 3300044684 | Ga0466966_0221696 | Ga0466966_0221696_121_1068 | 310 |
| 638 | 3300044684 | Ga0466966_0239292 | Ga0466966_0239292_59_994 | 310 |
| 639 | 3300044693 | Ga0466961_0124576 | Ga0466961_0124576_271_1206 | 310 |
| 640 | 3300044706 | Ga0466964_0001227 | Ga0466964_0001227_5396_6331 | 310 |
| 641 | 3300044706 | Ga0466964_0001931 | Ga0466964_0001931_1234_2169 | 310 |
| 642 | 3300044719 | Ga0466971_0010136 | Ga0466971_0010136_1229_2161 | 310 |
| 643 | 3300044719 | Ga0466971_0132277 | Ga0466971_0132277_108_1043 | 310 |
| 644 | 3300044735 | Ga0466968_0001801 | Ga0466968_0001801_4998_5933 | 310 |
| 645 | 3300044735 | Ga0466968_0099409 | Ga0466968_0099409_261_1196 | 310 |
| 646 | 3300044842 | Ga0466957_0046829 | Ga0466957_0046829_775_1722 | 310 |
| 647 | 3300044842 | Ga0466957_0159888 | Ga0466957_0159888_423_1358 | 310 |
| 648 | 3300045049 | Ga0466959_0145988 | Ga0466959_0145988_70_1017 | 310 |
| 649 | 3300045836 | Ga0466958_0075060 | Ga0466958_0075060_382_1317 | 310 |
| 650 | 3300046452 | Ga0495617_000057 | Ga0495617_000057_23968_24909 | 310 |
| 651 | 3300046452 | Ga0495617_000303 | Ga0495617_000303_16297_17235 | 310 |
| 652 | 3300046452 | Ga0495617_046083 | Ga0495617_046083_109_1047 | 310 |
| 653 | 3300046453 | Ga0495627_001817 | Ga0495627_001817_7800_8741 | 310 |
| 654 | 3300046453 | Ga0495627_006174 | Ga0495627_006174_1992_2927 | 310 |
| 655 | 3300046454 | Ga0495592_0046495 | Ga0495592_0046495_57_989 | 310 |
| 656 | 3300046457 | Ga0495590_0000018 | Ga0495590_0000018_207954_208892 | 310 |
| 657 | 3300046457 | Ga0495590_0002149 | Ga0495590_0002149_5654_6604 | 310 |
| 658 | 3300046457 | Ga0495590_0002928 | Ga0495590_0002928_1451_2404 | 310 |
| 659 | 3300046457 | Ga0495590_0058050 | Ga0495590_0058050_163_1101 | 310 |
| 660 | 3300046458 | Ga0495591_012498 | Ga0495591_012498_1788_2726 | 310 |
| 661 | 3300046458 | Ga0495591_019841 | Ga0495591_019841_389_1321 | 310 |
| 662 | 3300046460 | Ga0495638_0010108 | Ga0495638_0010108_2954_3892 | 310 |
| 663 | 3300046460 | Ga0495638_0027791 | Ga0495638_0027791_1935_2897 | 310 |
| 664 | 3300046460 | Ga0495638_0112870 | Ga0495638_0112870_362_1315 | 310 |
| 665 | 3300046462 | Ga0495651_0028201 | Ga0495651_0028201_2532_3464 | 310 |
| 666 | 3300046462 | Ga0495651_0100413 | Ga0495651_0100413_217_1149 | 310 |
| 667 | 3300046463 | Ga0495653_0028643 | Ga0495653_0028643_2189_3133 | 310 |
| 668 | 3300046463 | Ga0495653_0078585 | Ga0495653_0078585_408_1343 | 310 |
| 669 | 3300046471 | Ga0495650_0000108 | Ga0495650_0000108_61230_62168 | 310 |
| 670 | 3300046471 | Ga0495650_0000140 | Ga0495650_0000140_66272_67207 | 310 |
| 671 | 3300046471 | Ga0495650_0032139 | Ga0495650_0032139_657_1601 | 310 |
| 672 | 3300046474 | Ga0495605_0000416 | Ga0495605_0000416_13903_14844 | 310 |
| 673 | 3300046474 | Ga0495605_0000438 | Ga0495605_0000438_35663_36598 | 310 |
| 674 | 3300046474 | Ga0495605_0011441 | Ga0495605_0011441_1110_2048 | 310 |
| 675 | 3300046474 | Ga0495605_0027851 | Ga0495605_0027851_1521_2456 | 310 |
| 676 | 3300046474 | Ga0495605_0029379 | Ga0495605_0029379_310_1248 | 310 |
| 677 | 3300046474 | Ga0495605_0041158 | Ga0495605_0041158_409_1347 | 310 |
| 678 | 3300046474 | Ga0495605_0045539 | Ga0495605_0045539_892_1833 | 310 |
| 679 | 3300046474 | Ga0495605_0124866 | Ga0495605_0124866_23_958 | 310 |
| 680 | 3300046491 | Ga0495584_0000006 | Ga0495584_0000006_207139_208077 | 310 |
| 681 | 3300046491 | Ga0495584_0000281 | Ga0495584_0000281_434_1372 | 310 |
| 682 | 3300046491 | Ga0495584_0009627 | Ga0495584_0009627_3420_4358 | 310 |
| 683 | 3300046491 | Ga0495584_0013652 | Ga0495584_0013652_994_1926 | 310 |
| 684 | 3300046491 | Ga0495584_0033622 | Ga0495584_0033622_1325_2266 | 310 |
| 685 | 3300046491 | Ga0495584_0036504 | Ga0495584_0036504_426_1364 | 310 |
| 686 | 3300046491 | Ga0495584_0043266 | Ga0495584_0043266_267_1211 | 310 |
| 687 | 3300046491 | Ga0495584_0171850 | Ga0495584_0171850_29_976 | 310 |
| 688 | 3300046492 | Ga0495585_0000193 | Ga0495585_0000193_8149_9087 | 310 |
| 689 | 3300046492 | Ga0495585_0000515 | Ga0495585_0000515_17981_18919 | 310 |
| 690 | 3300046492 | Ga0495585_0002529 | Ga0495585_0002529_6591_7529 | 310 |
| 691 | 3300046492 | Ga0495585_0003683 | Ga0495585_0003683_6662_7600 | 310 |
| 692 | 3300046492 | Ga0495585_0005187 | Ga0495585_0005187_2377_3312 | 310 |
| 693 | 3300046492 | Ga0495585_0007454 | Ga0495585_0007454_4873_5805 | 310 |
| 694 | 3300046492 | Ga0495585_0014980 | Ga0495585_0014980_1207_2145 | 310 |
| 695 | 3300046492 | Ga0495585_0038339 | Ga0495585_0038339_1587_2522 | 310 |
| 696 | 3300046492 | Ga0495585_0064979 | Ga0495585_0064979_822_1760 | 310 |
| 697 | 3300046492 | Ga0495585_0065981 | Ga0495585_0065981_57_992 | 310 |
| 698 | 3300046492 | Ga0495585_0115949 | Ga0495585_0115949_470_1408 | 310 |
| 699 | 3300046499 | Ga0495594_0039206 | Ga0495594_0039206_604_1542 | 310 |
| 700 | 3300046499 | Ga0495594_0206510 | Ga0495594_0206510_142_1086 | 310 |
| 701 | 3300046500 | Ga0495596_0001089 | Ga0495596_0001089_8548_9486 | 310 |
| 702 | 3300046500 | Ga0495596_0001435 | Ga0495596_0001435_9253_10191 | 310 |
| 703 | 3300046500 | Ga0495596_0001794 | Ga0495596_0001794_7207_8145 | 310 |
| 704 | 3300046500 | Ga0495596_0007906 | Ga0495596_0007906_2562_3500 | 310 |
| 705 | 3300046500 | Ga0495596_0011978 | Ga0495596_0011978_170_1111 | 310 |
| 706 | 3300046500 | Ga0495596_0012711 | Ga0495596_0012711_2365_3309 | 310 |
| 707 | 3300046500 | Ga0495596_0020949 | Ga0495596_0020949_1403_2344 | 310 |
| 708 | 3300046500 | Ga0495596_0023469 | Ga0495596_0023469_1019_1957 | 310 |
| 709 | 3300046500 | Ga0495596_0023665 | Ga0495596_0023665_1115_2047 | 310 |
| 710 | 3300046500 | Ga0495596_0052210 | Ga0495596_0052210_652_1590 | 310 |
| 711 | 3300046500 | Ga0495596_0053292 | Ga0495596_0053292_168_1106 | 310 |
| 712 | 3300046500 | Ga0495596_0057895 | Ga0495596_0057895_329_1270 | 310 |
| 713 | 3300046501 | Ga0495607_0003330 | Ga0495607_0003330_525_1460 | 310 |
| 714 | 3300046501 | Ga0495607_0011000 | Ga0495607_0011000_925_1863 | 310 |
| 715 | 3300046501 | Ga0495607_0019846 | Ga0495607_0019846_955_1890 | 310 |
| 716 | 3300046501 | Ga0495607_0025658 | Ga0495607_0025658_999_1934 | 310 |
| 717 | 3300046501 | Ga0495607_0031999 | Ga0495607_0031999_2153_3085 | 310 |
| 718 | 3300046501 | Ga0495607_0050509 | Ga0495607_0050509_623_1564 | 310 |
| 719 | 3300046501 | Ga0495607_0069694 | Ga0495607_0069694_258_1196 | 310 |
| 720 | 3300046506 | Ga0495583_0003816 | Ga0495583_0003816_2467_3414 | 310 |
| 721 | 3300046506 | Ga0495583_0012109 | Ga0495583_0012109_2538_3476 | 310 |
| 722 | 3300046506 | Ga0495583_0014101 | Ga0495583_0014101_2446_3384 | 310 |
| 723 | 3300046506 | Ga0495583_0020486 | Ga0495583_0020486_2278_3210 | 310 |
| 724 | 3300046506 | Ga0495583_0029563 | Ga0495583_0029563_778_1713 | 310 |
| 725 | 3300046506 | Ga0495583_0032217 | Ga0495583_0032217_582_1547 | 310 |
| 726 | 3300046506 | Ga0495583_0032488 | Ga0495583_0032488_1369_2313 | 310 |
| 727 | 3300046506 | Ga0495583_0037057 | Ga0495583_0037057_757_1692 | 310 |
| 728 | 3300046507 | Ga0495606_0006986 | Ga0495606_0006986_8646_9578 | 310 |
| 729 | 3300046507 | Ga0495606_0011967 | Ga0495606_0011967_3224_4162 | 310 |
| 730 | 3300046507 | Ga0495606_0027851 | Ga0495606_0027851_2336_3268 | 310 |
| 731 | 3300046507 | Ga0495606_0086107 | Ga0495606_0086107_845_1780 | 310 |
| 732 | 3300046507 | Ga0495606_0113794 | Ga0495606_0113794_196_1248 | 310 |
| 733 | 3300046511 | Ga0495608_0041553 | Ga0495608_0041553_2002_2934 | 310 |
| 734 | 3300046512 | Ga0495610_0002329 | Ga0495610_0002329_8026_8964 | 310 |
| 735 | 3300046513 | Ga0495616_0000662 | Ga0495616_0000662_694_1629 | 310 |
| 736 | 3300046513 | Ga0495616_0002684 | Ga0495616_0002684_8639_9586 | 310 |
| 737 | 3300046513 | Ga0495616_0003012 | Ga0495616_0003012_1037_1975 | 310 |
| 738 | 3300046513 | Ga0495616_0004448 | Ga0495616_0004448_2644_3582 | 310 |
| 739 | 3300046513 | Ga0495616_0013824 | Ga0495616_0013824_2702_3646 | 310 |
| 740 | 3300046513 | Ga0495616_0018343 | Ga0495616_0018343_2333_3298 | 310 |
| 741 | 3300046513 | Ga0495616_0026851 | Ga0495616_0026851_914_1846 | 310 |
| 742 | 3300046513 | Ga0495616_0033272 | Ga0495616_0033272_541_1476 | 310 |
| 743 | 3300046513 | Ga0495616_0034518 | Ga0495616_0034518_761_1699 | 310 |
| 744 | 3300046513 | Ga0495616_0057056 | Ga0495616_0057056_712_1647 | 310 |
| 745 | 3300046513 | Ga0495616_0068379 | Ga0495616_0068379_324_1265 | 310 |
| 746 | 3300046513 | Ga0495616_0111702 | Ga0495616_0111702_126_1076 | 310 |
| 747 | 3300046515 | Ga0495620_0004669 | Ga0495620_0004669_6742_7680 | 310 |
| 748 | 3300046516 | Ga0495628_0004565 | Ga0495628_0004565_10394_11326 | 310 |
| 749 | 3300046517 | Ga0495630_0084205 | Ga0495630_0084205_28_963 | 310 |
| 750 | 3300046518 | Ga0495631_0000632 | Ga0495631_0000632_7422_8357 | 310 |
| 751 | 3300046518 | Ga0495631_0001483 | Ga0495631_0001483_5918_6856 | 310 |
| 752 | 3300046518 | Ga0495631_0007116 | Ga0495631_0007116_348_1286 | 310 |
| 753 | 3300046518 | Ga0495631_0011740 | Ga0495631_0011740_932_1870 | 310 |
| 754 | 3300046518 | Ga0495631_0016053 | Ga0495631_0016053_1102_2043 | 310 |
| 755 | 3300046518 | Ga0495631_0018121 | Ga0495631_0018121_52_984 | 310 |
| 756 | 3300046518 | Ga0495631_0041077 | Ga0495631_0041077_440_1381 | 310 |
| 757 | 3300046518 | Ga0495631_0042382 | Ga0495631_0042382_555_1490 | 310 |
| 758 | 3300046518 | Ga0495631_0052764 | Ga0495631_0052764_276_1241 | 310 |
| 759 | 3300046519 | Ga0495632_0000214 | Ga0495632_0000214_42473_43438 | 310 |
| 760 | 3300046519 | Ga0495632_0000364 | Ga0495632_0000364_40336_41280 | 310 |
| 761 | 3300046519 | Ga0495632_0003852 | Ga0495632_0003852_1007_1951 | 310 |
| 762 | 3300046519 | Ga0495632_0009850 | Ga0495632_0009850_1805_2743 | 310 |
| 763 | 3300046519 | Ga0495632_0011405 | Ga0495632_0011405_3309_4256 | 310 |
| 764 | 3300046519 | Ga0495632_0014316 | Ga0495632_0014316_392_1330 | 310 |
| 765 | 3300046519 | Ga0495632_0015456 | Ga0495632_0015456_2431_3366 | 310 |
| 766 | 3300046519 | Ga0495632_0026674 | Ga0495632_0026674_1053_2006 | 310 |
| 767 | 3300046519 | Ga0495632_0027244 | Ga0495632_0027244_530_1462 | 310 |
| 768 | 3300046519 | Ga0495632_0056759 | Ga0495632_0056759_559_1494 | 310 |
| 769 | 3300046519 | Ga0495632_0056879 | Ga0495632_0056879_712_1647 | 310 |
| 770 | 3300046520 | Ga0495637_0000612 | Ga0495637_0000612_12729_13667 | 310 |
| 771 | 3300046522 | Ga0495643_0000141 | Ga0495643_0000141_101159_102097 | 310 |
| 772 | 3300046522 | Ga0495643_0004483 | Ga0495643_0004483_7880_8815 | 310 |
| 773 | 3300046522 | Ga0495643_0021003 | Ga0495643_0021003_1679_2614 | 310 |
| 774 | 3300046522 | Ga0495643_0032721 | Ga0495643_0032721_1775_2713 | 310 |
| 775 | 3300046522 | Ga0495643_0043697 | Ga0495643_0043697_1120_2055 | 310 |
| 776 | 3300046522 | Ga0495643_0061065 | Ga0495643_0061065_149_1087 | 310 |
| 777 | 3300046523 | Ga0495644_0002371 | Ga0495644_0002371_6522_7469 | 310 |
| 778 | 3300046523 | Ga0495644_0005317 | Ga0495644_0005317_1812_2750 | 310 |
| 779 | 3300046523 | Ga0495644_0007533 | Ga0495644_0007533_2356_3288 | 310 |
| 780 | 3300046523 | Ga0495644_0025164 | Ga0495644_0025164_930_1868 | 310 |
| 781 | 3300046523 | Ga0495644_0030060 | Ga0495644_0030060_601_1539 | 310 |
| 782 | 3300046524 | Ga0495648_0000109 | Ga0495648_0000109_77540_78478 | 310 |
| 783 | 3300046524 | Ga0495648_0004137 | Ga0495648_0004137_2575_3513 | 310 |
| 784 | 3300046524 | Ga0495648_0019039 | Ga0495648_0019039_656_1591 | 310 |
| 785 | 3300046526 | Ga0495666_0012627 | Ga0495666_0012627_2743_3678 | 310 |
| 786 | 3300046528 | Ga0495642_0000741 | Ga0495642_0000741_7294_8241 | 310 |
| 787 | 3300046528 | Ga0495642_0001464 | Ga0495642_0001464_8551_9492 | 310 |
| 788 | 3300046528 | Ga0495642_0007631 | Ga0495642_0007631_2318_3262 | 310 |
| 789 | 3300046528 | Ga0495642_0013970 | Ga0495642_0013970_1624_2556 | 310 |
| 790 | 3300046528 | Ga0495642_0037500 | Ga0495642_0037500_676_1617 | 310 |
| 791 | 3300046528 | Ga0495642_0054460 | Ga0495642_0054460_545_1510 | 310 |
| 792 | 3300046528 | Ga0495642_0065860 | Ga0495642_0065860_454_1392 | 310 |
| 793 | 3300046529 | Ga0495652_0012068 | Ga0495652_0012068_5145_6080 | 310 |
| 794 | 3300046529 | Ga0495652_0040085 | Ga0495652_0040085_644_1576 | 310 |
| 795 | 3300046530 | Ga0495654_0047746 | Ga0495654_0047746_319_1263 | 310 |
| 796 | 3300046530 | Ga0495654_0048172 | Ga0495654_0048172_843_1778 | 310 |
| 797 | 3300046530 | Ga0495654_0059366 | Ga0495654_0059366_289_1224 | 310 |
| 798 | 3300046530 | Ga0495654_0094487 | Ga0495654_0094487_343_1284 | 310 |
| 799 | 3300046531 | Ga0495665_0019053 | Ga0495665_0019053_2649_3584 | 310 |
| 800 | 3300046531 | Ga0495665_0026571 | Ga0495665_0026571_895_1833 | 310 |
| 801 | 3300046538 | Ga0495609_0000009 | Ga0495609_0000009_167541_168476 | 310 |
| 802 | 3300046538 | Ga0495609_0001562 | Ga0495609_0001562_1923_2861 | 310 |
| 803 | 3300046538 | Ga0495609_0006657 | Ga0495609_0006657_3437_4375 | 310 |
| 804 | 3300046538 | Ga0495609_0018010 | Ga0495609_0018010_617_1561 | 310 |
| 805 | 3300046538 | Ga0495609_0020796 | Ga0495609_0020796_297_1238 | 310 |
| 806 | 3300046538 | Ga0495609_0037586 | Ga0495609_0037586_962_1897 | 310 |
| 807 | 3300046538 | Ga0495609_0049452 | Ga0495609_0049452_449_1387 | 310 |
| 808 | 3300046538 | Ga0495609_0049544 | Ga0495609_0049544_919_1851 | 310 |
| 809 | 3300046538 | Ga0495609_0114655 | Ga0495609_0114655_81_1025 | 310 |
| 810 | 3300046542 | Ga0495597_0002044 | Ga0495597_0002044_848_1780 | 310 |
| 811 | 3300046542 | Ga0495597_0003097 | Ga0495597_0003097_1048_1983 | 310 |
| 812 | 3300046542 | Ga0495597_0042966 | Ga0495597_0042966_60_998 | 310 |
| 813 | 3300046543 | Ga0495645_0027376 | Ga0495645_0027376_2170_3102 | 310 |
| 814 | 3300046557 | Ga0495622_0038097 | Ga0495622_0038097_133_1074 | 310 |
| 815 | 3300046557 | Ga0495622_0049436 | Ga0495622_0049436_370_1302 | 310 |
| 816 | 3300046558 | Ga0495633_0006086 | Ga0495633_0006086_4175_5119 | 310 |
| 817 | 3300046558 | Ga0495633_0007030 | Ga0495633_0007030_807_1745 | 310 |
| 818 | 3300046558 | Ga0495633_0007058 | Ga0495633_0007058_4543_5481 | 310 |
| 819 | 3300046558 | Ga0495633_0026986 | Ga0495633_0026986_561_1499 | 310 |
| 820 | 3300046558 | Ga0495633_0088992 | Ga0495633_0088992_228_1166 | 310 |
| 821 | 3300046615 | Ga0495656_0022919 | Ga0495656_0022919_962_1897 | 310 |
| 822 | 3300046615 | Ga0495656_0053279 | Ga0495656_0053279_370_1308 | 310 |
| 823 | 3300046616 | Ga0495668_0003200 | Ga0495668_0003200_3384_4322 | 310 |
| 824 | 3300046616 | Ga0495668_0003639 | Ga0495668_0003639_8103_9038 | 310 |
| 825 | 3300046616 | Ga0495668_0015431 | Ga0495668_0015431_2591_3532 | 310 |
| 826 | 3300046616 | Ga0495668_0016287 | Ga0495668_0016287_1007_1942 | 310 |
| 827 | 3300046616 | Ga0495668_0020369 | Ga0495668_0020369_2839_3786 | 310 |
| 828 | 3300046616 | Ga0495668_0051043 | Ga0495668_0051043_795_1733 | 310 |
| 829 | 3300046616 | Ga0495668_0114115 | Ga0495668_0114115_282_1223 | 310 |
| 830 | 3300046642 | Ga0495634_0201412 | Ga0495634_0201412_267_1202 | 310 |
| 831 | 3300046648 | Ga0495611_0000499 | Ga0495611_0000499_12735_13673 | 310 |
| 832 | 3300046648 | Ga0495611_0002457 | Ga0495611_0002457_2497_3444 | 310 |
| 833 | 3300046648 | Ga0495611_0019231 | Ga0495611_0019231_743_1681 | 310 |
| 834 | 3300046648 | Ga0495611_0019315 | Ga0495611_0019315_869_1804 | 310 |
| 835 | 3300046648 | Ga0495611_0024956 | Ga0495611_0024956_1126_2064 | 310 |
| 836 | 3300046648 | Ga0495611_0026413 | Ga0495611_0026413_389_1321 | 310 |
| 837 | 3300046648 | Ga0495611_0031348 | Ga0495611_0031348_1024_1962 | 310 |
| 838 | 3300046660 | Ga0495625_0032776 | Ga0495625_0032776_2377_3312 | 310 |
| 839 | 3300046660 | Ga0495625_0066343 | Ga0495625_0066343_1280_2227 | 310 |
| 840 | 3300046660 | Ga0495625_0124604 | Ga0495625_0124604_506_1444 | 310 |
| 841 | 3300046663 | Ga0495635_0002454 | Ga0495635_0002454_7599_8543 | 310 |
| 842 | 3300046665 | Ga0495661_0001929 | Ga0495661_0001929_2383_3318 | 310 |
| 843 | 3300046665 | Ga0495661_0007429 | Ga0495661_0007429_832_1767 | 310 |
| 844 | 3300046665 | Ga0495661_0012238 | Ga0495661_0012238_2365_3309 | 310 |
| 845 | 3300046665 | Ga0495661_0013191 | Ga0495661_0013191_2285_3220 | 310 |
| 846 | 3300046665 | Ga0495661_0027110 | Ga0495661_0027110_1673_2638 | 310 |
| 847 | 3300046665 | Ga0495661_0035807 | Ga0495661_0035807_919_1851 | 310 |
| 848 | 3300046665 | Ga0495661_0064902 | Ga0495661_0064902_1045_1983 | 310 |
| 849 | 3300046665 | Ga0495661_0065409 | Ga0495661_0065409_189_1127 | 310 |
| 850 | 3300046665 | Ga0495661_0071191 | Ga0495661_0071191_934_1869 | 310 |
| 851 | 3300046665 | Ga0495661_0075659 | Ga0495661_0075659_955_1890 | 310 |
| 852 | 3300046665 | Ga0495661_0153789 | Ga0495661_0153789_30_977 | 310 |
| 853 | 3300046665 | Ga0495661_0171609 | Ga0495661_0171609_134_1069 | 310 |
| 854 | 3300046674 | Ga0495588_0000077 | Ga0495588_0000077_168759_169694 | 310 |
| 855 | 3300046674 | Ga0495588_0010399 | Ga0495588_0010399_2484_3428 | 310 |
| 856 | 3300046674 | Ga0495588_0012275 | Ga0495588_0012275_2646_3584 | 310 |
| 857 | 3300046674 | Ga0495588_0027405 | Ga0495588_0027405_955_1899 | 310 |
| 858 | 3300046674 | Ga0495588_0031167 | Ga0495588_0031167_519_1460 | 310 |
| 859 | 3300046674 | Ga0495588_0055912 | Ga0495588_0055912_493_1425 | 310 |
| 860 | 3300046675 | Ga0495657_0073728 | Ga0495657_0073728_153_1085 | 310 |
| 861 | 3300046678 | Ga0495599_0004944 | Ga0495599_0004944_184_1116 | 310 |
| 862 | 3300046679 | Ga0495623_0011364 | Ga0495623_0011364_918_1853 | 310 |
| 863 | 3300046680 | Ga0495646_0012052 | Ga0495646_0012052_1538_2470 | 310 |
| 864 | 3300046684 | Ga0495669_0000116 | Ga0495669_0000116_9450_10391 | 310 |
| 865 | 3300046684 | Ga0495669_0007431 | Ga0495669_0007431_2623_3567 | 310 |
| 866 | 3300046684 | Ga0495669_0011905 | Ga0495669_0011905_631_1569 | 310 |
| 867 | 3300046684 | Ga0495669_0030253 | Ga0495669_0030253_819_1757 | 310 |
| 868 | 3300046691 | Ga0495670_0001273 | Ga0495670_0001273_6169_7107 | 310 |
| 869 | 3300046691 | Ga0495670_0005019 | Ga0495670_0005019_2481_3425 | 310 |
| 870 | 3300046691 | Ga0495670_0016363 | Ga0495670_0016363_2669_3607 | 310 |
| 871 | 3300046691 | Ga0495670_0041425 | Ga0495670_0041425_903_1835 | 310 |
| 872 | 3300046691 | Ga0495670_0049421 | Ga0495670_0049421_301_1239 | 310 |
| 873 | 3300046691 | Ga0495670_0072508 | Ga0495670_0072508_326_1261 | 310 |
| 874 | 3300046692 | Ga0495671_0002689 | Ga0495671_0002689_3133_4074 | 310 |
| 875 | 3300046692 | Ga0495671_0016637 | Ga0495671_0016637_838_1773 | 310 |
| 876 | 3300046694 | Ga0495649_0003311 | Ga0495649_0003311_8179_9114 | 310 |
| 877 | 3300046694 | Ga0495649_0003561 | Ga0495649_0003561_4569_5525 | 310 |
| 878 | 3300046694 | Ga0495649_0011717 | Ga0495649_0011717_1009_1947 | 310 |
| 879 | 3300046694 | Ga0495649_0057116 | Ga0495649_0057116_216_1163 | 310 |
| 880 | 3300046694 | Ga0495649_0082868 | Ga0495649_0082868_626_1561 | 310 |
| 881 | 3300046794 | Ga0495589_0001060 | Ga0495589_0001060_13199_14134 | 310 |
| 882 | 3300046794 | Ga0495589_0007613 | Ga0495589_0007613_998_1936 | 310 |
| 883 | 3300046794 | Ga0495589_0013208 | Ga0495589_0013208_2372_3307 | 310 |
| 884 | 3300046794 | Ga0495589_0017044 | Ga0495589_0017044_876_1817 | 310 |
| 885 | 3300046794 | Ga0495589_0019655 | Ga0495589_0019655_1575_2507 | 310 |
| 886 | 3300046810 | Ga0495660_0000178 | Ga0495660_0000178_56009_56944 | 310 |
| 887 | 3300046810 | Ga0495660_0020825 | Ga0495660_0020825_2610_3557 | 310 |
| 888 | 3300046810 | Ga0495660_0070404 | Ga0495660_0070404_433_1371 | 310 |
| 889 | 3300046810 | Ga0495660_0070610 | Ga0495660_0070610_675_1640 | 310 |
| 890 | 3300046810 | Ga0495660_0108124 | Ga0495660_0108124_460_1404 | 310 |
| 891 | 3300046810 | Ga0495660_0117839 | Ga0495660_0117839_130_1068 | 310 |
| 892 | 3300047317 | Ga0495604_0027131 | Ga0495604_0027131_2471_3406 | 310 |
| 893 | 3300047320 | Ga0495672_0000033 | Ga0495672_0000033_279686_280624 | 310 |
| 894 | 3300047320 | Ga0495672_0000437 | Ga0495672_0000437_7472_8416 | 310 |
| 895 | 3300047320 | Ga0495672_0001623 | Ga0495672_0001623_12071_13009 | 310 |
| 896 | 3300047320 | Ga0495672_0009440 | Ga0495672_0009440_1022_1957 | 310 |
| 897 | 3300047320 | Ga0495672_0010123 | Ga0495672_0010123_503_1447 | 310 |
| 898 | 3300047320 | Ga0495672_0072525 | Ga0495672_0072525_388_1326 | 310 |
| 899 | 3300047321 | Ga0495676_0000121 | Ga0495676_0000121_42321_43262 | 310 |
| 900 | 3300047321 | Ga0495676_0049524 | Ga0495676_0049524_1471_2457 | 310 |
| 901 | 3300047322 | Ga0495680_0007548 | Ga0495680_0007548_8957_9889 | 310 |
| 902 | 3300047323 | Ga0495683_0000182 | Ga0495683_0000182_8671_9609 | 310 |
| 903 | 3300047323 | Ga0495683_0001151 | Ga0495683_0001151_12729_13667 | 310 |
| 904 | 3300047323 | Ga0495683_0011839 | Ga0495683_0011839_3407_4354 | 310 |
| 905 | 3300047323 | Ga0495683_0018583 | Ga0495683_0018583_583_1521 | 310 |
| 906 | 3300047323 | Ga0495683_0020136 | Ga0495683_0020136_1908_2843 | 310 |
| 907 | 3300047323 | Ga0495683_0020827 | Ga0495683_0020827_1162_2094 | 310 |
| 908 | 3300047443 | Ga0495687_000017 | Ga0495687_000017_174582_175526 | 310 |
| 909 | 3300047443 | Ga0495687_000024 | Ga0495687_000024_254592_255527 | 310 |
| 910 | 3300047443 | Ga0495687_000458 | Ga0495687_000458_36064_37011 | 310 |
| 911 | 3300047443 | Ga0495687_014022 | Ga0495687_014022_2258_3193 | 310 |
| 912 | 3300047444 | Ga0495675_0016790 | Ga0495675_0016790_2772_3716 | 310 |
| 913 | 3300047445 | Ga0495677_0000117 | Ga0495677_0000117_982_1917 | 310 |
| 914 | 3300047445 | Ga0495677_0003340 | Ga0495677_0003340_3203_4147 | 310 |
| 915 | 3300047445 | Ga0495677_0004846 | Ga0495677_0004846_1032_1970 | 310 |
| 916 | 3300047445 | Ga0495677_0005027 | Ga0495677_0005027_118_1056 | 310 |
| 917 | 3300047445 | Ga0495677_0005223 | Ga0495677_0005223_1141_2079 | 310 |
| 918 | 3300047445 | Ga0495677_0008846 | Ga0495677_0008846_2386_3321 | 310 |
| 919 | 3300047445 | Ga0495677_0010361 | Ga0495677_0010361_1513_2454 | 310 |
| 920 | 3300047445 | Ga0495677_0017662 | Ga0495677_0017662_906_1841 | 310 |
| 921 | 3300047445 | Ga0495677_0026283 | Ga0495677_0026283_209_1156 | 310 |
| 922 | 3300047445 | Ga0495677_0027824 | Ga0495677_0027824_132_1064 | 310 |
| 923 | 3300047445 | Ga0495677_0028764 | Ga0495677_0028764_331_1269 | 310 |
| 924 | 3300047445 | Ga0495677_0029631 | Ga0495677_0029631_380_1315 | 310 |
| 925 | 3300047446 | Ga0495679_003474 | Ga0495679_003474_573_1511 | 310 |
| 926 | 3300047446 | Ga0495679_004009 | Ga0495679_004009_146_1093 | 310 |
| 927 | 3300047446 | Ga0495679_013040 | Ga0495679_013040_1217_2152 | 310 |
| 928 | 3300047447 | Ga0495685_004997 | Ga0495685_004997_2427_3359 | 310 |
| 929 | 3300047470 | Ga0495681_0000994 | Ga0495681_0000994_15912_16859 | 310 |
| 930 | 3300047470 | Ga0495681_0012084 | Ga0495681_0012084_1826_2770 | 310 |
| 931 | 3300047470 | Ga0495681_0014560 | Ga0495681_0014560_962_1897 | 310 |
| 932 | 3300047470 | Ga0495681_0023578 | Ga0495681_0023578_128_1063 | 310 |
| 933 | 3300047470 | Ga0495681_0031695 | Ga0495681_0031695_140_1075 | 310 |
| 934 | 3300047470 | Ga0495681_0058051 | Ga0495681_0058051_40_978 | 310 |
| 935 | 3300047472 | Ga0495686_0000591 | Ga0495686_0000591_3223_4161 | 310 |
| 936 | 3300047472 | Ga0495686_0001614 | Ga0495686_0001614_12261_13205 | 310 |
| 937 | 3300047472 | Ga0495686_0082989 | Ga0495686_0082989_168_1106 | 310 |
| 938 | 3300047673 | Ga0495593_0088157 | Ga0495593_0088157_302_1246 | 310 |
| 939 | 3300048088 | Ga0495602_0077771 | Ga0495602_0077771_1567_2505 | 310 |
| 940 | 3300048089 | Ga0495614_0004132 | Ga0495614_0004132_3123_4067 | 310 |
| 941 | 3300048091 | Ga0495626_0000004 | Ga0495626_0000004_289512_290447 | 310 |
| 942 | 3300048091 | Ga0495626_0000016 | Ga0495626_0000016_26903_27838 | 310 |
| 943 | 3300048091 | Ga0495626_0000693 | Ga0495626_0000693_802_1737 | 310 |
| 944 | 3300048091 | Ga0495626_0006971 | Ga0495626_0006971_985_1923 | 310 |
| 945 | 3300048091 | Ga0495626_0012875 | Ga0495626_0012875_2797_3732 | 310 |
| 946 | 3300048091 | Ga0495626_0015332 | Ga0495626_0015332_12_950 | 310 |
| 947 | 3300048091 | Ga0495626_0030305 | Ga0495626_0030305_1535_2473 | 310 |
| 948 | 3300048091 | Ga0495626_0035415 | Ga0495626_0035415_1321_2253 | 310 |
| 949 | 3300048091 | Ga0495626_0042550 | Ga0495626_0042550_195_1133 | 310 |
| 950 | 3300048091 | Ga0495626_0042772 | Ga0495626_0042772_728_1666 | 310 |
| 951 | 3300048091 | Ga0495626_0079806 | Ga0495626_0079806_284_1231 | 310 |
| 952 | 3300048904 | Ga0496101_0100541 | Ga0496101_0100541_1051_1986 | 310 |
| 953 | 3300048905 | Ga0496102_0000340 | Ga0496102_0000340_53153_54088 | 310 |
| 954 | 3300048905 | Ga0496102_0189580 | Ga0496102_0189580_373_1308 | 310 |
| 955 | 3300048905 | Ga0496102_0285842 | Ga0496102_0285842_512_1447 | 310 |
| 956 | 3300048906 | Ga0496103_0013246 | Ga0496103_0013246_83_1018 | 310 |
| 957 | 3300048906 | Ga0496103_0201425 | Ga0496103_0201425_178_1113 | 310 |
| 958 | 3300048909 | Ga0496106_0239107 | Ga0496106_0239107_113_1048 | 310 |
| 959 | 3300048912 | Ga0496109_0005210 | Ga0496109_0005210_8891_9826 | 310 |
| 960 | 3300048913 | Ga0496110_0004929 | Ga0496110_0004929_1207_2142 | 310 |
| 961 | 3300048915 | Ga0496112_0321442 | Ga0496112_0321442_274_1209 | 310 |
| 962 | 3300048916 | Ga0496113_0023519 | Ga0496113_0023519_2419_3354 | 310 |
| 963 | 3300048916 | Ga0496113_0176820 | Ga0496113_0176820_489_1424 | 310 |
| 964 | 3300048918 | Ga0496115_0143915 | Ga0496115_0143915_405_1340 | 310 |
| 965 | 3300048924 | Ga0496121_0046034 | Ga0496121_0046034_2277_3209 | 310 |
| 966 | 3300048925 | Ga0496122_0009237 | Ga0496122_0009237_1051_1986 | 310 |
| 967 | 3300048925 | Ga0496122_0009551 | Ga0496122_0009551_450_1385 | 310 |
| 968 | 3300048925 | Ga0496122_0090290 | Ga0496122_0090290_161_1096 | 310 |
| 969 | 3300048926 | Ga0496123_0026217 | Ga0496123_0026217_2388_3323 | 310 |
| 970 | 3300048926 | Ga0496123_0042315 | Ga0496123_0042315_149_1084 | 310 |
| 971 | 3300048926 | Ga0496123_0093738 | Ga0496123_0093738_511_1446 | 310 |
| 972 | 3300048927 | Ga0496124_0002724 | Ga0496124_0002724_10873_11811 | 310 |
| 973 | 3300048927 | Ga0496124_0003292 | Ga0496124_0003292_8404_9348 | 310 |
| 974 | 3300048927 | Ga0496124_0035599 | Ga0496124_0035599_1132_2067 | 310 |
| 975 | 3300048927 | Ga0496124_0056406 | Ga0496124_0056406_1017_1952 | 310 |
| 976 | 3300048927 | Ga0496124_0091173 | Ga0496124_0091173_1050_2018 | 310 |
| 977 | 3300048928 | Ga0496125_0103905 | Ga0496125_0103905_776_1711 | 310 |
| 978 | 3300048928 | Ga0496125_0203493 | Ga0496125_0203493_146_1081 | 310 |
| 979 | 3300049128 | Ga0501308_000102 | Ga0501308_000102_945_1880 | 310 |
| 980 | 3300049160 | Ga0501304_000184 | Ga0501304_000184_949_1884 | 310 |
| 981 | 3300049459 | Ga0495678_000275 | Ga0495678_000275_10685_11623 | 310 |
| 982 | 3300049459 | Ga0495678_000746 | Ga0495678_000746_27501_28466 | 310 |
| 983 | 3300049459 | Ga0495678_001983 | Ga0495678_001983_7676_8623 | 310 |
| 984 | 3300049459 | Ga0495678_002319 | Ga0495678_002319_2370_3305 | 310 |
| 985 | 3300049459 | Ga0495678_004447 | Ga0495678_004447_943_1878 | 310 |
| 986 | 3300049459 | Ga0495678_014319 | Ga0495678_014319_2175_3140 | 310 |
| 987 | 3300049460 | Ga0495682_0002099 | Ga0495682_0002099_2401_3366 | 310 |
| 988 | 3300049460 | Ga0495682_0017114 | Ga0495682_0017114_812_1750 | 310 |
| 989 | 3300049460 | Ga0495682_0019757 | Ga0495682_0019757_1497_2435 | 310 |
| 990 | 3300049460 | Ga0495682_0027473 | Ga0495682_0027473_54_992 | 310 |
| 991 | 3300049460 | Ga0495682_0074150 | Ga0495682_0074150_47_982 | 310 |
| 992 | 3300049583 | Ga0501067_0003287 | Ga0501067_0003287_7452_8405 | 310 |
| 993 | 3300049584 | Ga0501068_0000097 | Ga0501068_0000097_16768_17721 | 310 |
| 994 | 3300049586 | Ga0501070_0003050 | Ga0501070_0003050_11389_12342 | 310 |
| 995 | 3300049587 | Ga0501071_0068445 | Ga0501071_0068445_1576_2529 | 310 |
| 996 | 3300049588 | Ga0501072_0028213 | Ga0501072_0028213_3379_4332 | 310 |
| 997 | 3300049589 | Ga0501073_0000086 | Ga0501073_0000086_18245_19198 | 310 |
| 998 | 3300049590 | Ga0501074_0057987 | Ga0501074_0057987_820_1773 | 310 |
| 999 | 3300049592 | Ga0501076_0061458 | Ga0501076_0061458_1142_2095 | 310 |
| 1000 | 3300049593 | Ga0501077_0001839 | Ga0501077_0001839_10050_11003 | 310 |
| 1001 | 3300049741 | Ga0501079_0000201 | Ga0501079_0000201_17216_18169 | 310 |
| 1002 | 3300049742 | Ga0501080_0003269 | Ga0501080_0003269_10634_11587 | 310 |
| 1003 | 3300049744 | Ga0501083_0001294 | Ga0501083_0001294_15851_16804 | 310 |
| 1004 | 3300049822 | Ga0501035_0004380 | Ga0501035_0004380_2127_3062 | 310 |
| 1005 | 3300054114 | Ga0501084_0001279 | Ga0501084_0001279_18746_19699 | 310 |
| 1006 | 3300059640 | Ga0587067_002624 | Ga0587067_002624_945_1880 | 310 |
| 1007 | 3300061719 | Ga0466962_0108370 | Ga0466962_0108370_16_963 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6smd-assembly2.cif.gz_C | plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase | 0.987 | 2 | 308 |
| 3h0p-assembly1.cif.gz_A | 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. | 0.9869 | 2 | 306 |
| 6u0j-assembly1.cif.gz_A | crosslinked crystal structure of malonyl-coa acyl carrier protein transacylase, fabd, and acyl carrier protein, acpp | 0.985 | 1 | 306 |
| 3tqe-assembly1.cif.gz_A | structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii | 0.9831 | 2 | 307 |
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.9809 | 3 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9851 | 6 | 285 | 3.20.10.10 |
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9782 | 6 | 285 | 3.20.10.10 |
| 2g1hA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.978 | 3 | 307 | 3.40.366.10 |
| 3tqeA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding | 0.9744 | 124 | 196 | 3.30.70.250 |
| 2cuyB01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.971 | 4 | 308 | 3.40.366.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T8QRA5-F1-model_v4 | deleted | 0.9933 | 198 | 307 |
|
| AF-V5U0C8-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9919 | 23 | 307 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A378CU40-F1-model_v4 | deleted | 0.9914 | 183 | 307 |
|
| AF-A0A7W9TU84-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9903 | 2 | 309 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A1H7MJD1-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9903 | 2 | 310 |
GO:0004314
GO:0005829 GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar