F487600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 518 | 1978 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1014737|Ga0055524_10147371 |
| Length | 497 |
| Sequence | VXASCPGPRLRLVHQGDXGQCRPVVPSTNEYKTRMDTTEIGERLVHRADTGPRNTALRDAAAAAHGEPDIAALPTLETVRLGVVGLGYVGLPLAVAFGRRYDTVGFDINAQRVVELREGRDSTLEVDSVELAQAQRLRCSSDLGMLQRCNVYIVTVPTPIDAAKRPDLTPLIRASEALGQVLKRGDVVVYESTVYPGCTEEVCVPILERASGLVFNRDFFAGYSPERINPGDKEHRLTRILKITSGSTKRAADFVDALYASIIEAGTHKASSIKVAEAAKVIENTQRDLNIALVNDLAILFNKLGIDTLEVLQAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQEIGHHPDVILAGRRTNDGMGAYIASEVVRLMVRKGINPVQARILVLGLAFKENCPDLRNTRVVDIVHALRGYNAQVDVHDPWVNTNDAAHEYGLSTIEAPAHGDYDAVIVAVAHREFAQLGAEGVRAFGKPVSIVYDVKYVLPRDAVDGRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 94 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 111 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 249 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 349 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 390 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 401 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 402 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 407 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 408 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 409 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 410 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 411 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 412 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 413 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 414 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 415 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 416 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 417 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 418 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 419 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 420 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 421 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 422 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 423 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 424 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 425 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 426 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 427 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 428 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 429 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 430 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 431 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 432 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 433 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 434 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 435 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 436 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 437 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 438 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 439 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 440 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 441 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 442 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 443 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 444 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 445 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 446 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 447 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 448 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 449 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 450 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 451 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 452 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 453 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 454 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 455 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 456 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 457 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 458 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 459 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 460 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 461 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 462 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 463 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 464 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 465 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 466 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 467 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 468 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 469 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 470 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 471 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 472 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 473 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 474 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 475 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 476 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 477 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 478 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 479 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 480 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 481 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 482 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 483 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 484 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 485 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 486 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 487 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 488 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 489 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 490 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 491 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 492 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 493 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 494 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 495 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 496 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 497 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 498 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 499 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 500 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 501 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 502 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 503 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 504 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 505 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 506 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 507 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 508 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 509 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 510 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 511 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 512 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 513 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 514 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 515 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 516 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 517 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 518 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.67 |
| Metatranscriptomes | 1.31 |
| Isolates | 12.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.16 |
| Nodule | 6.87 |
| Rhizoplane | 3.33 |
| Rhizosphere | 60.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1014737 | 3300003775 | Bacteria | 2882 |
| 2 | JGI24740J21852_10010186 | 3300001979 | Bacteria | 3633 |
| 3 | JGI24739J22299_10001078 | 3300001989 | Bacteria | 10168 |
| 4 | JGI24737J22298_10002950 | 3300001990 | Bacteria | 6035 |
| 5 | JGI24735J21928_10008777 | 3300002067 | Bacteria | 3261 |
| 6 | JGI24735J21928_10012187 | 3300002067 | Bacteria | 2719 |
| 7 | JGI24738J21930_10002735 | 3300002075 | Bacteria | 4536 |
| 8 | JGI25156J39149_1009512 | 3300002705 | Bacteria | 2354 |
| 9 | JGI25162J39368_1000345 | 3300002737 | Bacteria | 40115 |
| 10 | JGI25162J39368_1000407 | 3300002737 | Bacteria | 35211 |
| 11 | JGI25162J39368_1000444 | 3300002737 | Bacteria | 32899 |
| 12 | JGI25162J39368_1000618 | 3300002737 | Bacteria | 25452 |
| 13 | JGI25162J39368_1001758 | 3300002737 | Bacteria | 10323 |
| 14 | JGI25162J39368_1002058 | 3300002737 | Bacteria | 8760 |
| 15 | JGI25157J39369_1000244 | 3300002741 | Bacteria | 41534 |
| 16 | JGI25157J39369_1000317 | 3300002741 | Bacteria | 34756 |
| 17 | JGI25157J39369_1000651 | 3300002741 | Bacteria | 19348 |
| 18 | JGI25157J39369_1004792 | 3300002741 | Bacteria | 2354 |
| 19 | JGI25163J39215_1000267 | 3300002771 | Bacteria | 18439 |
| 20 | JGI25164J39214_1000161 | 3300002772 | Bacteria | 63192 |
| 21 | JGI25164J39214_1000187 | 3300002772 | Bacteria | 54560 |
| 22 | JGI25164J39214_1000208 | 3300002772 | Bacteria | 49986 |
| 23 | JGI25164J39214_1000267 | 3300002772 | Bacteria | 38724 |
| 24 | JGI25164J39214_1000294 | 3300002772 | Bacteria | 34889 |
| 25 | JGI25152J39213_1013407 | 3300002773 | Bacteria | 1711 |
| 26 | JGI25159J45721_1011794 | 3300002987 | Bacteria | 2118 |
| 27 | JGI25151J46595_10029573 | 3300003187 | Bacteria | 2167 |
| 28 | JGI25165J46597_1000059 | 3300003214 | Bacteria | 211634 |
| 29 | JGI25165J46597_1000338 | 3300003214 | Bacteria | 54560 |
| 30 | JGI25165J46597_1000481 | 3300003214 | Bacteria | 38724 |
| 31 | JGI25165J46597_1001019 | 3300003214 | Bacteria | 18478 |
| 32 | JGI25165J46597_1001527 | 3300003214 | Bacteria | 11588 |
| 33 | JGI25153J46596_10008324 | 3300003215 | Bacteria | 4977 |
| 34 | JGI25153J46596_10013658 | 3300003215 | Bacteria | 3420 |
| 35 | rootH2_10133574 | 3300003320 | Bacteria | 7098 |
| 36 | Ga0006562J51391_1041114 | 3300003578 | Bacteria | 5280 |
| 37 | Ga0006562J51391_1041115 | 3300003578 | Bacteria | 3660 |
| 38 | Ga0055538_1001452 | 3300003751 | Bacteria | 4542 |
| 39 | Ga0055539_1001152 | 3300003752 | Bacteria | 5413 |
| 40 | Ga0055533_1004498 | 3300003756 | Bacteria | 2481 |
| 41 | Ga0055527_1000076 | 3300003760 | Bacteria | 79882 |
| 42 | Ga0055535_1000120 | 3300003761 | Bacteria | 84144 |
| 43 | Ga0055535_1000129 | 3300003761 | Bacteria | 79882 |
| 44 | Ga0055535_1000417 | 3300003761 | Bacteria | 40115 |
| 45 | Ga0055535_1001441 | 3300003761 | Bacteria | 12078 |
| 46 | Ga0055542_1000054 | 3300003762 | Bacteria | 171728 |
| 47 | Ga0055542_1000173 | 3300003762 | Bacteria | 79882 |
| 48 | Ga0055542_1000422 | 3300003762 | Bacteria | 40988 |
| 49 | Ga0055542_1000435 | 3300003762 | Bacteria | 40115 |
| 50 | Ga0055542_1000832 | 3300003762 | Bacteria | 22084 |
| 51 | Ga0055529_1000110 | 3300003763 | Bacteria | 120255 |
| 52 | Ga0055529_1000200 | 3300003763 | Bacteria | 79875 |
| 53 | Ga0055529_1000370 | 3300003763 | Bacteria | 48537 |
| 54 | Ga0055526_1000001 | 3300003771 | Bacteria | 669703 |
| 55 | Ga0055536_1009583 | 3300003781 | Bacteria | 3979 |
| 56 | Ga0055530_10011606 | 3300003791 | Bacteria | 3147 |
| 57 | Ga0055531_10000048 | 3300003794 | Bacteria | 131142 |
| 58 | Ga0055531_10004530 | 3300003794 | Bacteria | 8428 |
| 59 | Ga0055531_10010223 | 3300003794 | Bacteria | 4692 |
| 60 | Ga0055531_10013337 | 3300003794 | Bacteria | 3794 |
| 61 | Ga0065165_1000118 | 3300005262 | Bacteria | 134488 |
| 62 | Ga0065165_1000500 | 3300005262 | Bacteria | 60723 |
| 63 | Ga0065165_1002313 | 3300005262 | Bacteria | 16672 |
| 64 | Ga0065707_10000820 | 3300005295 | Bacteria | 12690 |
| 65 | Ga0065707_10082453 | 3300005295 | Bacteria | 14996 |
| 66 | Ga0070658_10063984 | 3300005327 | Bacteria | 3000 |
| 67 | Ga0070658_10297727 | 3300005327 | Bacteria | 1375 |
| 68 | Ga0070676_10073869 | 3300005328 | Bacteria | 2052 |
| 69 | Ga0070690_100025671 | 3300005330 | Bacteria | 3628 |
| 70 | Ga0070670_100079731 | 3300005331 | Bacteria | 2814 |
| 71 | Ga0070666_10000012 | 3300005335 | Bacteria | 244720 |
| 72 | Ga0070680_100012391 | 3300005336 | Bacteria | 6623 |
| 73 | Ga0070680_100060257 | 3300005336 | Bacteria | 3106 |
| 74 | Ga0070682_100005716 | 3300005337 | Bacteria | 6934 |
| 75 | Ga0070660_100030087 | 3300005339 | Bacteria | 4071 |
| 76 | Ga0070660_100155666 | 3300005339 | Bacteria | 1839 |
| 77 | Ga0070689_100004062 | 3300005340 | Bacteria | 9851 |
| 78 | Ga0070691_10007359 | 3300005341 | Bacteria | 5039 |
| 79 | Ga0070661_100011510 | 3300005344 | Bacteria | 6161 |
| 80 | Ga0070661_100058650 | 3300005344 | Bacteria | 2821 |
| 81 | Ga0070661_100069480 | 3300005344 | Bacteria | 2589 |
| 82 | Ga0070668_100017643 | 3300005347 | Bacteria | 5352 |
| 83 | Ga0070669_100077717 | 3300005353 | Bacteria | 2466 |
| 84 | Ga0070674_100075070 | 3300005356 | Unclassified | 2400 |
| 85 | Ga0070659_100000104 | 3300005366 | Bacteria | 62137 |
| 86 | Ga0070659_100214588 | 3300005366 | Bacteria | 1587 |
| 87 | Ga0070667_100001691 | 3300005367 | Bacteria | 19735 |
| 88 | Ga0070709_10004581 | 3300005434 | Bacteria | 7464 |
| 89 | Ga0070714_100000161 | 3300005435 | Bacteria | 54480 |
| 90 | Ga0070713_100006944 | 3300005436 | Bacteria | 7903 |
| 91 | Ga0070713_100009016 | 3300005436 | Bacteria | 7111 |
| 92 | Ga0070713_100011820 | 3300005436 | Bacteria | 6378 |
| 93 | Ga0070663_100010008 | 3300005455 | Bacteria | 5896 |
| 94 | Ga0070663_100016227 | 3300005455 | Bacteria | 4830 |
| 95 | Ga0070663_100173363 | 3300005455 | Bacteria | 1669 |
| 96 | Ga0070678_100034166 | 3300005456 | Bacteria | 3539 |
| 97 | Ga0070662_100026274 | 3300005457 | Bacteria | 4031 |
| 98 | Ga0070662_100172291 | 3300005457 | Unclassified | 1700 |
| 99 | Ga0070681_10021952 | 3300005458 | Bacteria | 6404 |
| 100 | Ga0070681_10025990 | 3300005458 | Bacteria | 5886 |
| 101 | Ga0070681_10031834 | 3300005458 | Bacteria | 5294 |
| 102 | Ga0070681_10077516 | 3300005458 | Bacteria | 3281 |
| 103 | Ga0070685_10000392 | 3300005466 | Bacteria | 26188 |
| 104 | Ga0070679_100027197 | 3300005530 | Bacteria | 5627 |
| 105 | Ga0070679_100038412 | 3300005530 | Bacteria | 4760 |
| 106 | Ga0070679_100077779 | 3300005530 | Bacteria | 3307 |
| 107 | Ga0068853_100067544 | 3300005539 | Bacteria | 3106 |
| 108 | Ga0068853_100152823 | 3300005539 | Bacteria | 2078 |
| 109 | Ga0070696_100002057 | 3300005546 | Bacteria | 13192 |
| 110 | Ga0070696_100041275 | 3300005546 | Bacteria | 3187 |
| 111 | Ga0070696_100092240 | 3300005546 | Bacteria | 2158 |
| 112 | Ga0070693_100048750 | 3300005547 | Bacteria | 2413 |
| 113 | Ga0070665_100000393 | 3300005548 | Bacteria | 64556 |
| 114 | Ga0070665_100006459 | 3300005548 | Bacteria | 11931 |
| 115 | Ga0070665_100024783 | 3300005548 | Bacteria | 6044 |
| 116 | Ga0070665_100071388 | 3300005548 | Bacteria | 3479 |
| 117 | Ga0070665_100192984 | 3300005548 | Bacteria | 2037 |
| 118 | Ga0068855_100007961 | 3300005563 | Bacteria | 12805 |
| 119 | Ga0068855_100015348 | 3300005563 | Bacteria | 9221 |
| 120 | Ga0068855_100030409 | 3300005563 | Bacteria | 6460 |
| 121 | Ga0068855_100091163 | 3300005563 | Bacteria | 3516 |
| 122 | Ga0070664_100010444 | 3300005564 | Bacteria | 7528 |
| 123 | Ga0068857_100027102 | 3300005577 | Bacteria | 5055 |
| 124 | Ga0068857_100036971 | 3300005577 | Bacteria | 4325 |
| 125 | Ga0068854_100000481 | 3300005578 | Bacteria | 24413 |
| 126 | Ga0068856_100053060 | 3300005614 | Bacteria | 3999 |
| 127 | Ga0068856_100058515 | 3300005614 | Bacteria | 3806 |
| 128 | Ga0068856_100096465 | 3300005614 | Bacteria | 2945 |
| 129 | Ga0068856_100125511 | 3300005614 | Bacteria | 2569 |
| 130 | Ga0068856_100231145 | 3300005614 | Bacteria | 1865 |
| 131 | Ga0068852_100023243 | 3300005616 | Bacteria | 4986 |
| 132 | Ga0068859_100192198 | 3300005617 | Bacteria | 2125 |
| 133 | Ga0068851_10010458 | 3300005834 | Bacteria | 4334 |
| 134 | Ga0068858_100002138 | 3300005842 | Bacteria | 20024 |
| 135 | Ga0068858_100249697 | 3300005842 | Bacteria | 1685 |
| 136 | Ga0068860_100011037 | 3300005843 | Bacteria | 8907 |
| 137 | Ga0068860_100059764 | 3300005843 | Bacteria | 3623 |
| 138 | Ga0068860_100081529 | 3300005843 | Bacteria | 3076 |
| 139 | Ga0068862_100030607 | 3300005844 | Bacteria | 4537 |
| 140 | Ga0068862_100047012 | 3300005844 | Bacteria | 3682 |
| 141 | Ga0081455_10006552 | 3300005937 | Bacteria | 12459 |
| 142 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 143 | Ga0070717_10031172 | 3300006028 | Bacteria | 4287 |
| 144 | Ga0075365_10036363 | 3300006038 | Bacteria | 3190 |
| 145 | Ga0075366_10000683 | 3300006195 | Bacteria | 16043 |
| 146 | Ga0075366_10014537 | 3300006195 | Bacteria | 4495 |
| 147 | Ga0068871_100005293 | 3300006358 | Bacteria | 9035 |
| 148 | Ga0075430_100039982 | 3300006846 | Bacteria | 3970 |
| 149 | Ga0075431_100004249 | 3300006847 | Bacteria | 14032 |
| 150 | Ga0075431_100016318 | 3300006847 | Bacteria | 7533 |
| 151 | Ga0075434_100063191 | 3300006871 | Bacteria | 3685 |
| 152 | Ga0075434_100171240 | 3300006871 | Bacteria | 2191 |
| 153 | Ga0097620_100192192 | 3300006931 | Bacteria | 2125 |
| 154 | Ga0105240_10000113 | 3300009093 | Bacteria | 168192 |
| 155 | Ga0105240_10000162 | 3300009093 | Bacteria | 136882 |
| 156 | Ga0105240_10000317 | 3300009093 | Bacteria | 91950 |
| 157 | Ga0105240_10000671 | 3300009093 | Bacteria | 62794 |
| 158 | Ga0105240_10000884 | 3300009093 | Bacteria | 53814 |
| 159 | Ga0105240_10006881 | 3300009093 | Bacteria | 16617 |
| 160 | Ga0105240_10019958 | 3300009093 | Bacteria | 8949 |
| 161 | Ga0105240_10034519 | 3300009093 | Bacteria | 6523 |
| 162 | Ga0105240_10048297 | 3300009093 | Bacteria | 5380 |
| 163 | Ga0105245_10002275 | 3300009098 | Bacteria | 17377 |
| 164 | Ga0105247_10014455 | 3300009101 | Bacteria | 4735 |
| 165 | Ga0114129_10171546 | 3300009147 | Bacteria | 2957 |
| 166 | Ga0105242_10115127 | 3300009176 | Bacteria | 2298 |
| 167 | Ga0105248_10013719 | 3300009177 | Bacteria | 8921 |
| 168 | Ga0105237_10025261 | 3300009545 | Bacteria | 6076 |
| 169 | Ga0105237_10119323 | 3300009545 | Bacteria | 2631 |
| 170 | Ga0105238_10000109 | 3300009551 | Bacteria | 90227 |
| 171 | Ga0105238_10018954 | 3300009551 | Bacteria | 7008 |
| 172 | Ga0105238_10018971 | 3300009551 | Bacteria | 7005 |
| 173 | Ga0105238_10072762 | 3300009551 | Bacteria | 3432 |
| 174 | Ga0105249_10037277 | 3300009553 | Bacteria | 4413 |
| 175 | Ga0105249_10055644 | 3300009553 | Bacteria | 3620 |
| 176 | Ga0105030_100140 | 3300009987 | Bacteria | 5808 |
| 177 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 178 | Ga0105239_10000034 | 3300010375 | Bacteria | 219430 |
| 179 | Ga0105239_10000050 | 3300010375 | Bacteria | 173908 |
| 180 | Ga0157347_1000199 | 3300012502 | Bacteria | 3365 |
| 181 | Ga0157339_1000718 | 3300012505 | Bacteria | 1793 |
| 182 | Ga0157373_10000162 | 3300013100 | Bacteria | 54140 |
| 183 | Ga0157373_10001336 | 3300013100 | Bacteria | 18878 |
| 184 | Ga0157373_10001753 | 3300013100 | Bacteria | 16501 |
| 185 | Ga0157373_10085407 | 3300013100 | Bacteria | 2224 |
| 186 | Ga0157371_10001241 | 3300013102 | Bacteria | 26989 |
| 187 | Ga0157371_10001357 | 3300013102 | Bacteria | 25727 |
| 188 | Ga0157371_10064239 | 3300013102 | Bacteria | 2601 |
| 189 | Ga0157370_10001027 | 3300013104 | Bacteria | 35101 |
| 190 | Ga0157370_10002298 | 3300013104 | Bacteria | 23155 |
| 191 | Ga0157370_10002411 | 3300013104 | Bacteria | 22533 |
| 192 | Ga0157370_10008231 | 3300013104 | Bacteria | 11261 |
| 193 | Ga0157370_10053054 | 3300013104 | Bacteria | 3868 |
| 194 | Ga0157369_10000551 | 3300013105 | Bacteria | 49137 |
| 195 | Ga0157369_10004459 | 3300013105 | Bacteria | 16497 |
| 196 | Ga0157369_10051107 | 3300013105 | Bacteria | 4474 |
| 197 | Ga0157369_10055334 | 3300013105 | Bacteria | 4283 |
| 198 | Ga0157369_10116000 | 3300013105 | Bacteria | 2844 |
| 199 | Ga0163162_10000127 | 3300013306 | Bacteria | 68205 |
| 200 | Ga0163162_10015245 | 3300013306 | Bacteria | 7507 |
| 201 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 202 | Ga0157372_10002252 | 3300013307 | Bacteria | 20929 |
| 203 | Ga0157372_10083127 | 3300013307 | Bacteria | 3626 |
| 204 | Ga0157372_10160695 | 3300013307 | Bacteria | 2596 |
| 205 | Ga0157375_10089689 | 3300013308 | Bacteria | 3131 |
| 206 | Ga0157514_110596 | 3300013874 | Bacteria | 1492 |
| 207 | Ga0163163_10022696 | 3300014325 | Bacteria | 5947 |
| 208 | Ga0182008_10000578 | 3300014497 | Bacteria | 27014 |
| 209 | Ga0182008_10001780 | 3300014497 | Bacteria | 14102 |
| 210 | Ga0182008_10009136 | 3300014497 | Bacteria | 5366 |
| 211 | Ga0182008_10035270 | 3300014497 | Bacteria | 2506 |
| 212 | Ga0157379_10003252 | 3300014968 | Bacteria | 13770 |
| 213 | Ga0157376_10003915 | 3300014969 | Bacteria | 10294 |
| 214 | Ga0157376_10012095 | 3300014969 | Bacteria | 6390 |
| 215 | Ga0157376_10043986 | 3300014969 | Bacteria | 3668 |
| 216 | Ga0182006_1000049 | 3300015261 | Bacteria | 184514 |
| 217 | Ga0182006_1000187 | 3300015261 | Bacteria | 64670 |
| 218 | Ga0182006_1000484 | 3300015261 | Bacteria | 31191 |
| 219 | Ga0182006_1006110 | 3300015261 | Bacteria | 5631 |
| 220 | Ga0182006_1025512 | 3300015261 | Bacteria | 2427 |
| 221 | Ga0182007_10006519 | 3300015262 | Bacteria | 5006 |
| 222 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 223 | Ga0182005_1000432 | 3300015265 | Bacteria | 22210 |
| 224 | Ga0182005_1002203 | 3300015265 | Bacteria | 7158 |
| 225 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 226 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 227 | Ga0163161_10001992 | 3300017792 | Bacteria | 14802 |
| 228 | Ga0206349_1291601 | 3300020075 | Bacteria | 2483 |
| 229 | Ga0206351_10745720 | 3300020077 | Bacteria | 4782 |
| 230 | Ga0213874_10017938 | 3300021377 | Bacteria | 1906 |
| 231 | Ga0213871_10003319 | 3300021441 | Bacteria | 3088 |
| 232 | Ga0224712_10000382 | 3300022467 | Bacteria | 8596 |
| 233 | Ga0224712_10034351 | 3300022467 | Bacteria | 1864 |
| 234 | Ga0209760_100405 | 3300025207 | Bacteria | 10640 |
| 235 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 236 | Ga0209566_102091 | 3300025225 | Bacteria | 4119 |
| 237 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 238 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 239 | Ga0209674_100452 | 3300025226 | Bacteria | 18762 |
| 240 | Ga0209674_100462 | 3300025226 | Bacteria | 17957 |
| 241 | Ga0209674_100901 | 3300025226 | Bacteria | 9613 |
| 242 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 243 | Ga0209672_100119 | 3300025228 | Bacteria | 85578 |
| 244 | Ga0209672_100560 | 3300025228 | Bacteria | 19793 |
| 245 | Ga0209672_101944 | 3300025228 | Bacteria | 5842 |
| 246 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 247 | Ga0207427_100046 | 3300025231 | Bacteria | 240976 |
| 248 | Ga0207427_100080 | 3300025231 | Bacteria | 144947 |
| 249 | Ga0207427_100133 | 3300025231 | Bacteria | 92763 |
| 250 | Ga0207427_100203 | 3300025231 | Bacteria | 54842 |
| 251 | Ga0207427_101231 | 3300025231 | Bacteria | 9822 |
| 252 | Ga0207427_104824 | 3300025231 | Bacteria | 2100 |
| 253 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 254 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 255 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 256 | Ga0209437_100132 | 3300025233 | Bacteria | 178495 |
| 257 | Ga0209437_100264 | 3300025233 | Bacteria | 80794 |
| 258 | Ga0209437_100344 | 3300025233 | Bacteria | 54936 |
| 259 | Ga0209437_100956 | 3300025233 | Bacteria | 10604 |
| 260 | Ga0209437_101178 | 3300025233 | Bacteria | 7735 |
| 261 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 262 | Ga0209258_100043 | 3300025242 | Bacteria | 380685 |
| 263 | Ga0209258_100045 | 3300025242 | Bacteria | 369941 |
| 264 | Ga0209258_100430 | 3300025242 | Bacteria | 48595 |
| 265 | Ga0209258_101101 | 3300025242 | Bacteria | 11491 |
| 266 | Ga0209646_1001454 | 3300025246 | Bacteria | 6325 |
| 267 | Ga0209026_1000047 | 3300025250 | Bacteria | 261867 |
| 268 | Ga0209026_1000270 | 3300025250 | Bacteria | 62482 |
| 269 | Ga0209026_1000283 | 3300025250 | Bacteria | 58367 |
| 270 | Ga0209026_1000544 | 3300025250 | Bacteria | 25922 |
| 271 | Ga0209026_1001541 | 3300025250 | Bacteria | 10001 |
| 272 | Ga0209677_103534 | 3300025253 | Bacteria | 4990 |
| 273 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 274 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 275 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 276 | Ga0209148_1000052 | 3300025254 | Bacteria | 399449 |
| 277 | Ga0209148_1000125 | 3300025254 | Bacteria | 184380 |
| 278 | Ga0209148_1000856 | 3300025254 | Bacteria | 21337 |
| 279 | Ga0209148_1000860 | 3300025254 | Bacteria | 21250 |
| 280 | Ga0209759_1000124 | 3300025256 | Bacteria | 135714 |
| 281 | Ga0209759_1000715 | 3300025256 | Bacteria | 29291 |
| 282 | Ga0209759_1002933 | 3300025256 | Bacteria | 7129 |
| 283 | Ga0209129_1000380 | 3300025258 | Bacteria | 35908 |
| 284 | Ga0209129_1000419 | 3300025258 | Bacteria | 32732 |
| 285 | Ga0209129_1003465 | 3300025258 | Bacteria | 6840 |
| 286 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 287 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 288 | Ga0209233_1000090 | 3300025261 | Bacteria | 315680 |
| 289 | Ga0209233_1000114 | 3300025261 | Bacteria | 246083 |
| 290 | Ga0209233_1000270 | 3300025261 | Bacteria | 73977 |
| 291 | Ga0209233_1000635 | 3300025261 | Bacteria | 17525 |
| 292 | Ga0209233_1009777 | 3300025261 | Bacteria | 2904 |
| 293 | Ga0209233_1014140 | 3300025261 | Bacteria | 2259 |
| 294 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 295 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 296 | Ga0209455_1000077 | 3300025272 | Bacteria | 279165 |
| 297 | Ga0209455_1002311 | 3300025272 | Bacteria | 7469 |
| 298 | Ga0209455_1005606 | 3300025272 | Bacteria | 3847 |
| 299 | Ga0209673_1002585 | 3300025273 | Bacteria | 12247 |
| 300 | Ga0209130_1000739 | 3300025284 | Bacteria | 28635 |
| 301 | Ga0209675_1003089 | 3300025291 | Bacteria | 8134 |
| 302 | Ga0209675_1008310 | 3300025291 | Bacteria | 3836 |
| 303 | Ga0209675_1015020 | 3300025291 | Bacteria | 2323 |
| 304 | Ga0209676_1000652 | 3300025292 | Bacteria | 49719 |
| 305 | Ga0209676_1002221 | 3300025292 | Bacteria | 14420 |
| 306 | Ga0209676_1002767 | 3300025292 | Bacteria | 11714 |
| 307 | Ga0209676_1003961 | 3300025292 | Bacteria | 8559 |
| 308 | Ga0209676_1007785 | 3300025292 | Bacteria | 4933 |
| 309 | Ga0209676_1025631 | 3300025292 | Bacteria | 1888 |
| 310 | Ga0209025_1000739 | 3300025294 | Bacteria | 55161 |
| 311 | Ga0209025_1016330 | 3300025294 | Bacteria | 4392 |
| 312 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 313 | Ga0209758_1000264 | 3300025297 | Bacteria | 104107 |
| 314 | Ga0209758_1001407 | 3300025297 | Bacteria | 28504 |
| 315 | Ga0209758_1002634 | 3300025297 | Bacteria | 17817 |
| 316 | Ga0209758_1013988 | 3300025297 | Bacteria | 4314 |
| 317 | Ga0209050_1001726 | 3300025298 | Bacteria | 21753 |
| 318 | Ga0209050_1002010 | 3300025298 | Bacteria | 18995 |
| 319 | Ga0209050_1020151 | 3300025298 | Bacteria | 2494 |
| 320 | Ga0209256_1001138 | 3300025299 | Bacteria | 30304 |
| 321 | Ga0209256_1002995 | 3300025299 | Bacteria | 12553 |
| 322 | Ga0209256_1015530 | 3300025299 | Bacteria | 2655 |
| 323 | Ga0207426_1016466 | 3300025302 | Bacteria | 2654 |
| 324 | Ga0209051_1005447 | 3300025303 | Bacteria | 7435 |
| 325 | Ga0209051_1008459 | 3300025303 | Bacteria | 5444 |
| 326 | Ga0209051_1021347 | 3300025303 | Bacteria | 2761 |
| 327 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 328 | Ga0209257_1000243 | 3300025304 | Bacteria | 126291 |
| 329 | Ga0209257_1000580 | 3300025304 | Bacteria | 61573 |
| 330 | Ga0209257_1001540 | 3300025304 | Bacteria | 26823 |
| 331 | Ga0209257_1003478 | 3300025304 | Bacteria | 13447 |
| 332 | Ga0207680_10000013 | 3300025903 | Bacteria | 244716 |
| 333 | Ga0207647_10000714 | 3300025904 | Bacteria | 26070 |
| 334 | Ga0207647_10001141 | 3300025904 | Bacteria | 20417 |
| 335 | Ga0207647_10003186 | 3300025904 | Bacteria | 12303 |
| 336 | Ga0207647_10009780 | 3300025904 | Bacteria | 6801 |
| 337 | Ga0207647_10041541 | 3300025904 | Bacteria | 2891 |
| 338 | Ga0207705_10013087 | 3300025909 | Bacteria | 5987 |
| 339 | Ga0207705_10046018 | 3300025909 | Bacteria | 3135 |
| 340 | Ga0207705_10097740 | 3300025909 | Bacteria | 2157 |
| 341 | Ga0207705_10174355 | 3300025909 | Bacteria | 1620 |
| 342 | Ga0207707_10006788 | 3300025912 | Bacteria | 9989 |
| 343 | Ga0207707_10021887 | 3300025912 | Bacteria | 5589 |
| 344 | Ga0207707_10029550 | 3300025912 | Bacteria | 4793 |
| 345 | Ga0207707_10059138 | 3300025912 | Bacteria | 3335 |
| 346 | Ga0207695_10000198 | 3300025913 | Bacteria | 167880 |
| 347 | Ga0207695_10000219 | 3300025913 | Bacteria | 153492 |
| 348 | Ga0207695_10000322 | 3300025913 | Bacteria | 114700 |
| 349 | Ga0207695_10000364 | 3300025913 | Bacteria | 103483 |
| 350 | Ga0207695_10000874 | 3300025913 | Bacteria | 54860 |
| 351 | Ga0207695_10000876 | 3300025913 | Bacteria | 54758 |
| 352 | Ga0207695_10002095 | 3300025913 | Bacteria | 30360 |
| 353 | Ga0207695_10002325 | 3300025913 | Bacteria | 28342 |
| 354 | Ga0207695_10004297 | 3300025913 | Bacteria | 19525 |
| 355 | Ga0207695_10005620 | 3300025913 | Bacteria | 16569 |
| 356 | Ga0207695_10014125 | 3300025913 | Bacteria | 9478 |
| 357 | Ga0207695_10031434 | 3300025913 | Bacteria | 5822 |
| 358 | Ga0207695_10155805 | 3300025913 | Bacteria | 2219 |
| 359 | Ga0207695_10185364 | 3300025913 | Bacteria | 2000 |
| 360 | Ga0207671_10019774 | 3300025914 | Bacteria | 5141 |
| 361 | Ga0207671_10076460 | 3300025914 | Bacteria | 2505 |
| 362 | Ga0207671_10138368 | 3300025914 | Bacteria | 1874 |
| 363 | Ga0207693_10035737 | 3300025915 | Bacteria | 3917 |
| 364 | Ga0207693_10039576 | 3300025915 | Bacteria | 3713 |
| 365 | Ga0207660_10056724 | 3300025917 | Bacteria | 2803 |
| 366 | Ga0207660_10209474 | 3300025917 | Bacteria | 1526 |
| 367 | Ga0207657_10007998 | 3300025919 | Bacteria | 10778 |
| 368 | Ga0207657_10071270 | 3300025919 | Bacteria | 2943 |
| 369 | Ga0207649_10012369 | 3300025920 | Bacteria | 4733 |
| 370 | Ga0207652_10058476 | 3300025921 | Bacteria | 3322 |
| 371 | Ga0207652_10119292 | 3300025921 | Bacteria | 2346 |
| 372 | Ga0207694_10000398 | 3300025924 | Bacteria | 40446 |
| 373 | Ga0207694_10000556 | 3300025924 | Bacteria | 33826 |
| 374 | Ga0207694_10030229 | 3300025924 | Bacteria | 4136 |
| 375 | Ga0207694_10053390 | 3300025924 | Bacteria | 3134 |
| 376 | Ga0207694_10062967 | 3300025924 | Bacteria | 2889 |
| 377 | Ga0207694_10095222 | 3300025924 | Bacteria | 2353 |
| 378 | Ga0207694_10138514 | 3300025924 | Bacteria | 1956 |
| 379 | Ga0207650_10021868 | 3300025925 | Bacteria | 4525 |
| 380 | Ga0207650_10039828 | 3300025925 | Bacteria | 3435 |
| 381 | Ga0207687_10071147 | 3300025927 | Bacteria | 2485 |
| 382 | Ga0207700_10149076 | 3300025928 | Bacteria | 1931 |
| 383 | Ga0207664_10000109 | 3300025929 | Bacteria | 72701 |
| 384 | Ga0207664_10171759 | 3300025929 | Bacteria | 1856 |
| 385 | Ga0207690_10000252 | 3300025932 | Bacteria | 38986 |
| 386 | Ga0207690_10009148 | 3300025932 | Bacteria | 5879 |
| 387 | Ga0207690_10028029 | 3300025932 | Bacteria | 3565 |
| 388 | Ga0207706_10012378 | 3300025933 | Bacteria | 7770 |
| 389 | Ga0207706_10025710 | 3300025933 | Bacteria | 5274 |
| 390 | Ga0207686_10051324 | 3300025934 | Bacteria | 2569 |
| 391 | Ga0207709_10139473 | 3300025935 | Bacteria | 1664 |
| 392 | Ga0207670_10003972 | 3300025936 | Bacteria | 7896 |
| 393 | Ga0207704_10087033 | 3300025938 | Bacteria | 2039 |
| 394 | Ga0207665_10005858 | 3300025939 | Bacteria | 8177 |
| 395 | Ga0207711_10008233 | 3300025941 | Bacteria | 8730 |
| 396 | Ga0207679_10003789 | 3300025945 | Bacteria | 9371 |
| 397 | Ga0207667_10000195 | 3300025949 | Bacteria | 88237 |
| 398 | Ga0207667_10000406 | 3300025949 | Bacteria | 58424 |
| 399 | Ga0207667_10000752 | 3300025949 | Bacteria | 42064 |
| 400 | Ga0207667_10001181 | 3300025949 | Bacteria | 32820 |
| 401 | Ga0207667_10135157 | 3300025949 | Bacteria | 2539 |
| 402 | Ga0207667_10223402 | 3300025949 | Bacteria | 1929 |
| 403 | Ga0207712_10035528 | 3300025961 | Bacteria | 3387 |
| 404 | Ga0207712_10109894 | 3300025961 | Bacteria | 2066 |
| 405 | Ga0207668_10063996 | 3300025972 | Bacteria | 2597 |
| 406 | Ga0207640_10000025 | 3300025981 | Bacteria | 143903 |
| 407 | Ga0207640_10000275 | 3300025981 | Bacteria | 34681 |
| 408 | Ga0207640_10002524 | 3300025981 | Bacteria | 9809 |
| 409 | Ga0207658_10114014 | 3300025986 | Bacteria | 2142 |
| 410 | Ga0207703_10073426 | 3300026035 | Bacteria | 2830 |
| 411 | Ga0207639_10000948 | 3300026041 | Bacteria | 19653 |
| 412 | Ga0207639_10084484 | 3300026041 | Bacteria | 2522 |
| 413 | Ga0207678_10015564 | 3300026067 | Bacteria | 6688 |
| 414 | Ga0207702_10028222 | 3300026078 | Bacteria | 4663 |
| 415 | Ga0207702_10278293 | 3300026078 | Bacteria | 1581 |
| 416 | Ga0207674_10007294 | 3300026116 | Bacteria | 12889 |
| 417 | Ga0207674_10031038 | 3300026116 | Bacteria | 5616 |
| 418 | Ga0207674_10187386 | 3300026116 | Bacteria | 2019 |
| 419 | Ga0207674_10228512 | 3300026116 | Bacteria | 1809 |
| 420 | Ga0207675_100075125 | 3300026118 | Bacteria | 3163 |
| 421 | Ga0209179_1000594 | 3300027512 | Bacteria | 3805 |
| 422 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 423 | Ga0268266_10000532 | 3300028379 | Bacteria | 53266 |
| 424 | Ga0268266_10004337 | 3300028379 | Bacteria | 13631 |
| 425 | Ga0268266_10018195 | 3300028379 | Bacteria | 5991 |
| 426 | Ga0268265_10049937 | 3300028380 | Bacteria | 3149 |
| 427 | Ga0268264_10039462 | 3300028381 | Bacteria | 3901 |
| 428 | Ga0307515_10034644 | 3300028794 | Bacteria | 8251 |
| 429 | Ga0265338_10009114 | 3300028800 | Bacteria | 11922 |
| 430 | Ga0265338_10076126 | 3300028800 | Bacteria | 2844 |
| 431 | Ga0265338_10222229 | 3300028800 | Bacteria | 1410 |
| 432 | Ga0265330_10013639 | 3300031235 | Bacteria | 3785 |
| 433 | Ga0265332_10007639 | 3300031238 | Bacteria | 4885 |
| 434 | Ga0265328_10015580 | 3300031239 | Bacteria | 2974 |
| 435 | Ga0265325_10038429 | 3300031241 | Bacteria | 2526 |
| 436 | Ga0265331_10010281 | 3300031250 | Bacteria | 5187 |
| 437 | Ga0307509_10082704 | 3300031507 | Bacteria | 3312 |
| 438 | Ga0307408_100022881 | 3300031548 | Bacteria | 4252 |
| 439 | Ga0307408_100110622 | 3300031548 | Bacteria | 2110 |
| 440 | Ga0307408_100196070 | 3300031548 | Bacteria | 1631 |
| 441 | Ga0265313_10013795 | 3300031595 | Bacteria | 4819 |
| 442 | Ga0307508_10001382 | 3300031616 | Bacteria | 27344 |
| 443 | Ga0307508_10014707 | 3300031616 | Bacteria | 7136 |
| 444 | Ga0265342_10000309 | 3300031712 | Bacteria | 55309 |
| 445 | Ga0265342_10000954 | 3300031712 | Bacteria | 28791 |
| 446 | Ga0316576_10000401 | 3300031727 | Bacteria | 19976 |
| 447 | Ga0316578_10000603 | 3300031728 | Bacteria | 12562 |
| 448 | Ga0316578_10007507 | 3300031728 | Bacteria | 5475 |
| 449 | Ga0316578_10110381 | 3300031728 | Bacteria | 1652 |
| 450 | Ga0307516_10000012 | 3300031730 | Bacteria | 224120 |
| 451 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 452 | Ga0307405_10043830 | 3300031731 | Bacteria | 2732 |
| 453 | Ga0307405_10145780 | 3300031731 | Bacteria | 1658 |
| 454 | Ga0307413_10000993 | 3300031824 | Bacteria | 10213 |
| 455 | Ga0307413_10023835 | 3300031824 | Bacteria | 3323 |
| 456 | Ga0307413_10091242 | 3300031824 | Bacteria | 1984 |
| 457 | Ga0307410_10020854 | 3300031852 | Bacteria | 4019 |
| 458 | Ga0307410_10221311 | 3300031852 | Bacteria | 1456 |
| 459 | Ga0307412_10001913 | 3300031911 | Bacteria | 11501 |
| 460 | Ga0307412_10002808 | 3300031911 | Bacteria | 9666 |
| 461 | Ga0307412_10053213 | 3300031911 | Bacteria | 2683 |
| 462 | Ga0307412_10073288 | 3300031911 | Bacteria | 2342 |
| 463 | Ga0307412_10100328 | 3300031911 | Bacteria | 2046 |
| 464 | Ga0307409_100017567 | 3300031995 | Bacteria | 4774 |
| 465 | Ga0307416_100001542 | 3300032002 | Bacteria | 12596 |
| 466 | Ga0307416_100003400 | 3300032002 | Bacteria | 9335 |
| 467 | Ga0307416_100057026 | 3300032002 | Bacteria | 3157 |
| 468 | Ga0307414_10037573 | 3300032004 | Bacteria | 3244 |
| 469 | Ga0307414_10063163 | 3300032004 | Bacteria | 2631 |
| 470 | Ga0307411_10030914 | 3300032005 | Bacteria | 3288 |
| 471 | Ga0307411_10099087 | 3300032005 | Bacteria | 2056 |
| 472 | Ga0307415_100031012 | 3300032126 | Bacteria | 3439 |
| 473 | Ga0316593_10002230 | 3300032168 | Bacteria | 4542 |
| 474 | Ga0316593_10014225 | 3300032168 | Bacteria | 2369 |
| 475 | Ga0307510_10023623 | 3300033180 | Bacteria | 7122 |
| 476 | Ga0307510_10064118 | 3300033180 | Bacteria | 3734 |
| 477 | Ga0316592_1011766 | 3300033524 | Bacteria | 1785 |
| 478 | Ga0316588_1000533 | 3300033528 | Bacteria | 5282 |
| 479 | Ga0316588_1011693 | 3300033528 | Bacteria | 1877 |
| 480 | Ga0316588_1011956 | 3300033528 | Bacteria | 1861 |
| 481 | Ga0316596_1010361 | 3300033541 | Bacteria | 2253 |
| 482 | Ga0373944_0010269 | 3300035089 | Bacteria | 2550 |
| 483 | Ga0373923_0005804 | 3300035111 | Bacteria | 4215 |
| 484 | Ga0373936_0000250 | 3300035113 | Bacteria | 17785 |
| 485 | Ga0373954_0018589 | 3300035118 | Bacteria | 3130 |
| 486 | Ga0373956_0041166 | 3300035119 | Bacteria | 2051 |
| 487 | Ga0373943_0007700 | 3300035170 | Bacteria | 4838 |
| 488 | Ga0373946_0013254 | 3300035171 | Bacteria | 3096 |
| 489 | Ga0373955_0012798 | 3300035172 | Bacteria | 4042 |
| 490 | Ga0373935_0000277 | 3300035692 | Bacteria | 25244 |
| 491 | Ga0373927_0003700 | 3300035695 | Bacteria | 10879 |
| 492 | Ga0373933_0031207 | 3300035724 | Bacteria | 3091 |
| 493 | Ga0373947_0002129 | 3300035725 | Bacteria | 12052 |
| 494 | Ga0373937_0001170 | 3300036401 | Bacteria | 22036 |
| 495 | Ga0316582_0038484 | 3300036647 | Bacteria | 2973 |
| 496 | Ga0316584_0003979 | 3300036712 | Bacteria | 9721 |
| 497 | Ga0373925_0000617 | 3300037068 | Bacteria | 33983 |
| 498 | Ga0395899_0000046 | 3300037312 | Bacteria | 242486 |
| 499 | Ga0395899_0000328 | 3300037312 | Bacteria | 60257 |
| 500 | Ga0395899_0015649 | 3300037312 | Bacteria | 5784 |
| 501 | Ga0395899_0025450 | 3300037312 | Bacteria | 4468 |
| 502 | Ga0395899_0041577 | 3300037312 | Bacteria | 3435 |
| 503 | Ga0395899_0084053 | 3300037312 | Bacteria | 2314 |
| 504 | Ga0395900_0000034 | 3300037418 | Bacteria | 258846 |
| 505 | Ga0395900_0000487 | 3300037418 | Bacteria | 56286 |
| 506 | Ga0395900_0015814 | 3300037418 | Bacteria | 7690 |
| 507 | Ga0395900_0055750 | 3300037418 | Bacteria | 4069 |
| 508 | Ga0395900_0085141 | 3300037418 | Bacteria | 3249 |
| 509 | Ga0395898_0000081 | 3300037466 | Bacteria | 242472 |
| 510 | Ga0395898_0000835 | 3300037466 | Bacteria | 51046 |
| 511 | Ga0395898_0005081 | 3300037466 | Bacteria | 14264 |
| 512 | Ga0395898_0027720 | 3300037466 | Bacteria | 5680 |
| 513 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 514 | Ga0395905_0006346 | 3300037471 | Bacteria | 11914 |
| 515 | Ga0395905_0034782 | 3300037471 | Bacteria | 4731 |
| 516 | Ga0395905_0080441 | 3300037471 | Bacteria | 3054 |
| 517 | Ga0395901_0000726 | 3300038443 | Bacteria | 37460 |
| 518 | Ga0395901_0003055 | 3300038443 | Bacteria | 16853 |
| 519 | Ga0395901_0005078 | 3300038443 | Bacteria | 13288 |
| 520 | Ga0395901_0008198 | 3300038443 | Bacteria | 10557 |
| 521 | Ga0395901_0051802 | 3300038443 | Bacteria | 4267 |
| 522 | Ga0436365_0936435 | 3300039437 | Bacteria | 4766 |
| 523 | Ga0436360_0314901 | 3300039438 | Bacteria | 5665 |
| 524 | Ga0436360_0654994 | 3300039438 | Bacteria | 8074 |
| 525 | Ga0436361_0556854 | 3300039447 | Bacteria | 2929 |
| 526 | Ga0436363_1195502 | 3300039450 | Bacteria | 19945 |
| 527 | Ga0436363_1357513 | 3300039450 | Bacteria | 4996 |
| 528 | Ga0436362_0573719 | 3300039453 | Bacteria | 4899 |
| 529 | Ga0439436_0000018 | 3300041404 | Bacteria | 71411 |
| 530 | Ga0439436_0000061 | 3300041404 | Bacteria | 30168 |
| 531 | Ga0439436_0014989 | 3300041404 | Bacteria | 2334 |
| 532 | Ga0439465_0004527 | 3300041413 | Bacteria | 4494 |
| 533 | Ga0451793_1604110 | 3300041452 | Bacteria | 1973 |
| 534 | Ga0451807_0603001 | 3300041486 | Bacteria | 1472 |
| 535 | Ga0439449_0000693 | 3300042007 | Bacteria | 12863 |
| 536 | Ga0450896_001311 | 3300042133 | Bacteria | 3020 |
| 537 | Ga0439446_0008934 | 3300042156 | Bacteria | 2672 |
| 538 | Ga0450908_000052 | 3300042184 | Bacteria | 23279 |
| 539 | Ga0450908_001644 | 3300042184 | Bacteria | 4353 |
| 540 | Ga0439459_0001958 | 3300042438 | Bacteria | 3128 |
| 541 | Ga0451577_0007968 | 3300042876 | Bacteria | 10343 |
| 542 | Ga0451577_0016590 | 3300042876 | Bacteria | 6815 |
| 543 | Ga0466969_0017713 | 3300044656 | Bacteria | 3716 |
| 544 | Ga0466969_0028211 | 3300044656 | Bacteria | 2870 |
| 545 | Ga0466969_0033434 | 3300044656 | Bacteria | 2610 |
| 546 | Ga0466982_0000025 | 3300044672 | Bacteria | 74149 |
| 547 | Ga0466982_0000056 | 3300044672 | Bacteria | 30789 |
| 548 | Ga0453683_0018983 | 3300044673 | Bacteria | 4410 |
| 549 | Ga0466966_0004819 | 3300044684 | Bacteria | 8871 |
| 550 | Ga0466966_0008441 | 3300044684 | Bacteria | 6818 |
| 551 | Ga0466966_0013196 | 3300044684 | Bacteria | 5471 |
| 552 | Ga0466966_0065099 | 3300044684 | Bacteria | 2293 |
| 553 | Ga0466961_0001433 | 3300044693 | Bacteria | 14798 |
| 554 | Ga0466961_0004989 | 3300044693 | Bacteria | 8343 |
| 555 | Ga0466961_0013131 | 3300044693 | Bacteria | 5298 |
| 556 | Ga0466961_0016649 | 3300044693 | Bacteria | 4726 |
| 557 | Ga0466961_0036641 | 3300044693 | Bacteria | 3148 |
| 558 | Ga0466961_0061672 | 3300044693 | Bacteria | 2383 |
| 559 | Ga0466961_0076095 | 3300044693 | Bacteria | 2127 |
| 560 | Ga0466963_0048715 | 3300044694 | Bacteria | 2801 |
| 561 | Ga0453684_0000046 | 3300044712 | Bacteria | 575242 |
| 562 | Ga0453684_0193403 | 3300044712 | Bacteria | 2378 |
| 563 | Ga0466971_0000694 | 3300044719 | Bacteria | 13464 |
| 564 | Ga0466970_0081026 | 3300044765 | Bacteria | 1754 |
| 565 | Ga0466957_0001623 | 3300044842 | Bacteria | 11789 |
| 566 | Ga0466957_0065450 | 3300044842 | Bacteria | 2239 |
| 567 | Ga0466959_0021363 | 3300045049 | Bacteria | 4773 |
| 568 | Ga0466959_0042078 | 3300045049 | Bacteria | 3370 |
| 569 | Ga0466959_0052113 | 3300045049 | Bacteria | 2998 |
| 570 | Ga0466959_0132351 | 3300045049 | Bacteria | 1767 |
| 571 | Ga0451576_0008271 | 3300045051 | Bacteria | 12232 |
| 572 | Ga0451576_0036117 | 3300045051 | Bacteria | 5241 |
| 573 | Ga0451576_0190066 | 3300045051 | Bacteria | 2144 |
| 574 | Ga0466958_0091361 | 3300045836 | Bacteria | 1884 |
| 575 | Ga0466967_0138591 | 3300045976 | Bacteria | 2264 |
| 576 | Ga0495617_000019 | 3300046452 | Bacteria | 247938 |
| 577 | Ga0495617_000865 | 3300046452 | Bacteria | 14315 |
| 578 | Ga0495592_0000377 | 3300046454 | Bacteria | 35161 |
| 579 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 580 | Ga0495638_0000030 | 3300046460 | Bacteria | 318183 |
| 581 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 582 | Ga0495638_0000280 | 3300046460 | Bacteria | 68240 |
| 583 | Ga0495638_0000311 | 3300046460 | Bacteria | 62620 |
| 584 | Ga0495638_0001085 | 3300046460 | Bacteria | 26487 |
| 585 | Ga0495653_0000027 | 3300046463 | Bacteria | 154096 |
| 586 | Ga0495650_0000061 | 3300046471 | Bacteria | 283347 |
| 587 | Ga0495650_0000501 | 3300046471 | Bacteria | 59165 |
| 588 | Ga0495650_0000920 | 3300046471 | Bacteria | 34562 |
| 589 | Ga0495650_0001244 | 3300046471 | Bacteria | 26410 |
| 590 | Ga0495662_0011796 | 3300046476 | Bacteria | 4269 |
| 591 | Ga0495584_0001702 | 3300046491 | Bacteria | 12894 |
| 592 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 593 | Ga0495585_0016990 | 3300046492 | Bacteria | 4213 |
| 594 | Ga0495607_0000003 | 3300046501 | Bacteria | 366900 |
| 595 | Ga0495607_0001172 | 3300046501 | Bacteria | 23725 |
| 596 | Ga0495607_0001827 | 3300046501 | Bacteria | 18144 |
| 597 | Ga0495607_0024313 | 3300046501 | Bacteria | 3779 |
| 598 | Ga0495583_0000058 | 3300046506 | Bacteria | 200120 |
| 599 | Ga0495583_0006205 | 3300046506 | Bacteria | 7866 |
| 600 | Ga0495606_0000050 | 3300046507 | Bacteria | 203375 |
| 601 | Ga0495606_0000097 | 3300046507 | Bacteria | 151339 |
| 602 | Ga0495606_0000105 | 3300046507 | Bacteria | 143363 |
| 603 | Ga0495606_0001098 | 3300046507 | Bacteria | 38718 |
| 604 | Ga0495606_0001776 | 3300046507 | Bacteria | 27602 |
| 605 | Ga0495606_0004944 | 3300046507 | Bacteria | 13018 |
| 606 | Ga0495606_0014678 | 3300046507 | Bacteria | 6092 |
| 607 | Ga0495606_0020249 | 3300046507 | Bacteria | 4913 |
| 608 | Ga0495608_0000135 | 3300046511 | Bacteria | 53120 |
| 609 | Ga0495610_0000380 | 3300046512 | Bacteria | 45916 |
| 610 | Ga0495610_0000537 | 3300046512 | Bacteria | 38080 |
| 611 | Ga0495610_0032907 | 3300046512 | Bacteria | 2687 |
| 612 | Ga0495610_0039710 | 3300046512 | Bacteria | 2377 |
| 613 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 614 | Ga0495618_0000052 | 3300046514 | Bacteria | 85440 |
| 615 | Ga0495620_0031578 | 3300046515 | Bacteria | 2425 |
| 616 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 617 | Ga0495630_0009097 | 3300046517 | Bacteria | 7139 |
| 618 | Ga0495631_0000033 | 3300046518 | Bacteria | 84703 |
| 619 | Ga0495631_0000205 | 3300046518 | Bacteria | 40628 |
| 620 | Ga0495632_0000003 | 3300046519 | Bacteria | 396071 |
| 621 | Ga0495632_0000120 | 3300046519 | Bacteria | 80853 |
| 622 | Ga0495632_0004636 | 3300046519 | Bacteria | 9298 |
| 623 | Ga0495643_0000078 | 3300046522 | Bacteria | 162974 |
| 624 | Ga0495648_0000009 | 3300046524 | Bacteria | 317193 |
| 625 | Ga0495648_0000083 | 3300046524 | Bacteria | 121164 |
| 626 | Ga0495648_0045343 | 3300046524 | Bacteria | 2735 |
| 627 | Ga0495663_0047254 | 3300046525 | Bacteria | 1325 |
| 628 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 629 | Ga0495640_0000035 | 3300046533 | Bacteria | 73471 |
| 630 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 631 | Ga0495609_0000590 | 3300046538 | Bacteria | 28522 |
| 632 | Ga0495609_0004654 | 3300046538 | Bacteria | 7445 |
| 633 | Ga0495597_0000014 | 3300046542 | Bacteria | 177043 |
| 634 | Ga0495645_0000014 | 3300046543 | Bacteria | 172712 |
| 635 | Ga0495633_0000041 | 3300046558 | Bacteria | 176298 |
| 636 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 637 | Ga0495668_0000750 | 3300046616 | Bacteria | 38415 |
| 638 | Ga0495668_0004788 | 3300046616 | Bacteria | 9437 |
| 639 | Ga0495668_0005286 | 3300046616 | Bacteria | 8829 |
| 640 | Ga0495668_0008417 | 3300046616 | Bacteria | 6446 |
| 641 | Ga0495634_0000412 | 3300046642 | Bacteria | 42303 |
| 642 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 643 | Ga0495611_0000008 | 3300046648 | Bacteria | 218134 |
| 644 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 645 | Ga0495625_0000023 | 3300046660 | Bacteria | 274067 |
| 646 | Ga0495625_0002867 | 3300046660 | Bacteria | 18070 |
| 647 | Ga0495625_0005892 | 3300046660 | Bacteria | 11034 |
| 648 | Ga0495625_0008485 | 3300046660 | Bacteria | 8764 |
| 649 | Ga0495625_0041568 | 3300046660 | Bacteria | 3346 |
| 650 | Ga0495625_0053433 | 3300046660 | Bacteria | 2889 |
| 651 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 652 | Ga0495661_0000672 | 3300046665 | Bacteria | 34212 |
| 653 | Ga0495657_0000727 | 3300046675 | Bacteria | 29568 |
| 654 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 655 | Ga0495623_0000316 | 3300046679 | Bacteria | 31267 |
| 656 | Ga0495646_0000133 | 3300046680 | Bacteria | 37629 |
| 657 | Ga0495669_0000385 | 3300046684 | Bacteria | 22116 |
| 658 | Ga0495669_0002242 | 3300046684 | Bacteria | 7930 |
| 659 | Ga0495613_0019436 | 3300046689 | Bacteria | 5062 |
| 660 | Ga0495670_0000407 | 3300046691 | Bacteria | 20550 |
| 661 | Ga0495670_0008258 | 3300046691 | Bacteria | 5120 |
| 662 | Ga0495670_0008842 | 3300046691 | Bacteria | 4954 |
| 663 | Ga0495671_0000208 | 3300046692 | Bacteria | 51612 |
| 664 | Ga0495649_0007164 | 3300046694 | Bacteria | 6848 |
| 665 | Ga0495649_0008003 | 3300046694 | Bacteria | 6389 |
| 666 | Ga0495649_0020260 | 3300046694 | Bacteria | 3731 |
| 667 | Ga0495649_0037147 | 3300046694 | Bacteria | 2674 |
| 668 | Ga0495589_0000446 | 3300046794 | Bacteria | 30389 |
| 669 | Ga0495600_0000199 | 3300046809 | Bacteria | 34659 |
| 670 | Ga0495660_0000008 | 3300046810 | Bacteria | 435769 |
| 671 | Ga0495660_0000009 | 3300046810 | Bacteria | 427395 |
| 672 | Ga0495660_0000159 | 3300046810 | Bacteria | 73231 |
| 673 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 674 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 675 | Ga0495672_0116464 | 3300047320 | Bacteria | 1427 |
| 676 | Ga0495680_0001769 | 3300047322 | Bacteria | 22885 |
| 677 | Ga0495683_0000922 | 3300047323 | Bacteria | 20737 |
| 678 | Ga0495687_014320 | 3300047443 | Bacteria | 4087 |
| 679 | Ga0495687_014376 | 3300047443 | Bacteria | 4078 |
| 680 | Ga0495675_0000539 | 3300047444 | Bacteria | 24523 |
| 681 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 682 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 683 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 684 | Ga0495673_0002990 | 3300047469 | Bacteria | 11388 |
| 685 | Ga0495681_0007223 | 3300047470 | Bacteria | 7139 |
| 686 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 687 | Ga0495686_0000019 | 3300047472 | Bacteria | 434054 |
| 688 | Ga0495686_0000077 | 3300047472 | Bacteria | 205924 |
| 689 | Ga0495686_0002878 | 3300047472 | Bacteria | 15459 |
| 690 | Ga0495686_0011038 | 3300047472 | Bacteria | 6390 |
| 691 | Ga0495686_0015188 | 3300047472 | Bacteria | 5270 |
| 692 | Ga0495686_0027117 | 3300047472 | Bacteria | 3742 |
| 693 | Ga0495593_0001637 | 3300047673 | Bacteria | 13262 |
| 694 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 695 | Ga0496100_0004314 | 3300048903 | Bacteria | 7528 |
| 696 | Ga0496100_0202266 | 3300048903 | Bacteria | 1448 |
| 697 | Ga0496101_0001940 | 3300048904 | Bacteria | 12527 |
| 698 | Ga0496101_0007629 | 3300048904 | Bacteria | 7025 |
| 699 | Ga0496101_0175731 | 3300048904 | Bacteria | 1647 |
| 700 | Ga0496102_0004747 | 3300048905 | Bacteria | 11504 |
| 701 | Ga0496102_0182089 | 3300048905 | Bacteria | 1980 |
| 702 | Ga0496104_0005865 | 3300048907 | Bacteria | 10762 |
| 703 | Ga0496105_0012174 | 3300048908 | Bacteria | 6810 |
| 704 | Ga0496105_0014752 | 3300048908 | Bacteria | 6221 |
| 705 | Ga0496105_0029955 | 3300048908 | Bacteria | 4456 |
| 706 | Ga0496105_0038223 | 3300048908 | Bacteria | 3953 |
| 707 | Ga0496106_0002177 | 3300048909 | Bacteria | 14641 |
| 708 | Ga0496106_0265537 | 3300048909 | Bacteria | 1374 |
| 709 | Ga0496107_0044077 | 3300048910 | Bacteria | 3207 |
| 710 | Ga0496107_0049341 | 3300048910 | Bacteria | 3033 |
| 711 | Ga0496109_0092320 | 3300048912 | Bacteria | 2800 |
| 712 | Ga0496109_0121867 | 3300048912 | Bacteria | 2430 |
| 713 | Ga0496111_0001591 | 3300048914 | Bacteria | 13121 |
| 714 | Ga0496112_0118605 | 3300048915 | Bacteria | 2616 |
| 715 | Ga0496113_0014675 | 3300048916 | Bacteria | 5355 |
| 716 | Ga0496114_0024143 | 3300048917 | Bacteria | 4962 |
| 717 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 718 | Ga0496115_0000093 | 3300048918 | Bacteria | 83222 |
| 719 | Ga0496115_0000536 | 3300048918 | Bacteria | 29579 |
| 720 | Ga0496115_0001494 | 3300048918 | Bacteria | 16789 |
| 721 | Ga0496115_0002717 | 3300048918 | Bacteria | 12716 |
| 722 | Ga0496115_0003431 | 3300048918 | Bacteria | 11384 |
| 723 | Ga0496115_0025650 | 3300048918 | Bacteria | 4592 |
| 724 | Ga0496115_0036799 | 3300048918 | Bacteria | 3876 |
| 725 | Ga0496115_0055709 | 3300048918 | Bacteria | 3176 |
| 726 | Ga0496116_0001420 | 3300048919 | Bacteria | 26933 |
| 727 | Ga0496116_0046768 | 3300048919 | Bacteria | 2918 |
| 728 | Ga0496117_0003165 | 3300048920 | Bacteria | 19567 |
| 729 | Ga0496117_0011918 | 3300048920 | Bacteria | 7729 |
| 730 | Ga0496117_0019931 | 3300048920 | Bacteria | 5487 |
| 731 | Ga0496117_0036716 | 3300048920 | Bacteria | 3662 |
| 732 | Ga0496117_0128254 | 3300048920 | Bacteria | 1543 |
| 733 | Ga0496118_0000839 | 3300048921 | Bacteria | 48884 |
| 734 | Ga0496118_0001054 | 3300048921 | Bacteria | 43006 |
| 735 | Ga0496118_0001398 | 3300048921 | Bacteria | 36389 |
| 736 | Ga0496118_0002911 | 3300048921 | Bacteria | 22252 |
| 737 | Ga0496118_0004037 | 3300048921 | Bacteria | 17839 |
| 738 | Ga0496118_0004710 | 3300048921 | Bacteria | 15973 |
| 739 | Ga0496118_0004745 | 3300048921 | Bacteria | 15908 |
| 740 | Ga0496118_0011125 | 3300048921 | Bacteria | 8819 |
| 741 | Ga0496118_0011275 | 3300048921 | Bacteria | 8745 |
| 742 | Ga0496119_0000109 | 3300048922 | Bacteria | 116054 |
| 743 | Ga0496119_0000113 | 3300048922 | Bacteria | 114626 |
| 744 | Ga0496119_0001179 | 3300048922 | Bacteria | 32759 |
| 745 | Ga0496119_0010208 | 3300048922 | Bacteria | 7925 |
| 746 | Ga0496119_0011481 | 3300048922 | Bacteria | 7325 |
| 747 | Ga0496120_0000124 | 3300048923 | Bacteria | 129191 |
| 748 | Ga0496120_0000150 | 3300048923 | Bacteria | 116072 |
| 749 | Ga0496120_0000153 | 3300048923 | Bacteria | 114778 |
| 750 | Ga0496120_0001436 | 3300048923 | Bacteria | 28628 |
| 751 | Ga0496120_0002007 | 3300048923 | Bacteria | 22138 |
| 752 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 753 | Ga0496121_0000315 | 3300048924 | Bacteria | 100898 |
| 754 | Ga0496121_0000431 | 3300048924 | Bacteria | 82456 |
| 755 | Ga0496121_0000835 | 3300048924 | Bacteria | 55903 |
| 756 | Ga0496121_0005286 | 3300048924 | Bacteria | 16631 |
| 757 | Ga0496121_0019069 | 3300048924 | Bacteria | 6881 |
| 758 | Ga0496121_0031077 | 3300048924 | Bacteria | 4889 |
| 759 | Ga0496121_0042921 | 3300048924 | Bacteria | 3924 |
| 760 | Ga0496121_0043996 | 3300048924 | Bacteria | 3859 |
| 761 | Ga0496121_0065220 | 3300048924 | Bacteria | 2964 |
| 762 | Ga0496121_0069824 | 3300048924 | Bacteria | 2833 |
| 763 | Ga0496121_0212958 | 3300048924 | Bacteria | 1367 |
| 764 | Ga0496122_0010526 | 3300048925 | Bacteria | 9508 |
| 765 | Ga0496122_0011599 | 3300048925 | Bacteria | 8896 |
| 766 | Ga0496122_0037432 | 3300048925 | Bacteria | 3905 |
| 767 | Ga0496123_0005858 | 3300048926 | Bacteria | 12170 |
| 768 | Ga0496123_0008297 | 3300048926 | Bacteria | 9565 |
| 769 | Ga0496123_0012876 | 3300048926 | Bacteria | 7082 |
| 770 | Ga0496124_0000352 | 3300048927 | Bacteria | 83918 |
| 771 | Ga0496124_0027391 | 3300048927 | Bacteria | 5116 |
| 772 | Ga0496125_0002272 | 3300048928 | Bacteria | 25486 |
| 773 | Ga0496125_0003057 | 3300048928 | Bacteria | 20914 |
| 774 | Ga0496125_0009071 | 3300048928 | Bacteria | 10291 |
| 775 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 776 | Ga0496126_0000240 | 3300048929 | Bacteria | 117890 |
| 777 | Ga0496126_0000402 | 3300048929 | Bacteria | 87911 |
| 778 | Ga0496126_0002206 | 3300048929 | Bacteria | 26966 |
| 779 | Ga0496126_0002667 | 3300048929 | Bacteria | 23631 |
| 780 | Ga0496126_0012393 | 3300048929 | Bacteria | 8740 |
| 781 | Ga0496126_0027190 | 3300048929 | Bacteria | 5468 |
| 782 | Ga0496126_0055042 | 3300048929 | Bacteria | 3601 |
| 783 | Ga0496126_0137468 | 3300048929 | Bacteria | 2106 |
| 784 | Ga0496126_0253660 | 3300048929 | Bacteria | 1465 |
| 785 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 786 | Ga0495678_000023 | 3300049459 | Bacteria | 233463 |
| 787 | Ga0495678_002129 | 3300049459 | Bacteria | 14033 |
| 788 | Ga0495682_0000421 | 3300049460 | Bacteria | 29820 |
| 789 | Ga0495682_0007067 | 3300049460 | Bacteria | 4491 |
| 790 | Ga0495682_0017800 | 3300049460 | Bacteria | 2678 |
| 791 | Ga0501031_0130088 | 3300049568 | Bacteria | 1645 |
| 792 | Ga0501033_0007031 | 3300049570 | Bacteria | 8790 |
| 793 | Ga0501033_0013648 | 3300049570 | Bacteria | 6183 |
| 794 | Ga0501033_0210190 | 3300049570 | Bacteria | 1388 |
| 795 | Ga0501034_0159472 | 3300049571 | Bacteria | 2228 |
| 796 | Ga0501037_0023000 | 3300049573 | Bacteria | 4609 |
| 797 | Ga0501038_0058700 | 3300049574 | Bacteria | 3298 |
| 798 | Ga0501040_0002246 | 3300049576 | Bacteria | 12430 |
| 799 | Ga0501041_0047649 | 3300049577 | Bacteria | 2609 |
| 800 | Ga0501042_0001136 | 3300049578 | Bacteria | 15349 |
| 801 | Ga0501043_0001313 | 3300049579 | Bacteria | 21747 |
| 802 | Ga0501043_0020678 | 3300049579 | Bacteria | 5163 |
| 803 | Ga0501043_0032432 | 3300049579 | Bacteria | 4107 |
| 804 | Ga0501043_0197332 | 3300049579 | Bacteria | 1563 |
| 805 | Ga0501043_0226788 | 3300049579 | Bacteria | 1444 |
| 806 | Ga0501046_0078693 | 3300049580 | Bacteria | 2550 |
| 807 | Ga0501047_0004739 | 3300049581 | Bacteria | 12789 |
| 808 | Ga0501047_0020953 | 3300049581 | Bacteria | 6279 |
| 809 | Ga0501047_0029969 | 3300049581 | Bacteria | 5245 |
| 810 | Ga0501047_0080883 | 3300049581 | Bacteria | 3123 |
| 811 | Ga0501047_0290158 | 3300049581 | Bacteria | 1480 |
| 812 | Ga0501048_0021540 | 3300049582 | Bacteria | 4720 |
| 813 | Ga0501069_0009473 | 3300049585 | Bacteria | 5141 |
| 814 | Ga0501070_0009715 | 3300049586 | Bacteria | 8136 |
| 815 | Ga0501070_0012575 | 3300049586 | Bacteria | 7140 |
| 816 | Ga0501070_0021044 | 3300049586 | Bacteria | 5472 |
| 817 | Ga0501071_0064386 | 3300049587 | Bacteria | 2660 |
| 818 | Ga0501072_0003414 | 3300049588 | Bacteria | 11966 |
| 819 | Ga0501074_0077551 | 3300049590 | Bacteria | 2385 |
| 820 | Ga0501075_0008845 | 3300049591 | Bacteria | 7022 |
| 821 | Ga0501075_0177916 | 3300049591 | Bacteria | 1623 |
| 822 | Ga0501076_0000461 | 3300049592 | Bacteria | 25817 |
| 823 | Ga0501077_0008499 | 3300049593 | Bacteria | 6364 |
| 824 | Ga0501225_0009703 | 3300049705 | Bacteria | 2738 |
| 825 | Ga0501080_0143596 | 3300049742 | Bacteria | 2206 |
| 826 | Ga0501081_0000792 | 3300049743 | Bacteria | 18613 |
| 827 | Ga0501035_0011692 | 3300049822 | Bacteria | 8135 |
| 828 | Ga0501035_0027960 | 3300049822 | Bacteria | 5152 |
| 829 | Ga0501035_0197196 | 3300049822 | Bacteria | 1729 |
| 830 | Ga0501035_0310685 | 3300049822 | Bacteria | 1326 |
| 831 | Ga0501044_0092832 | 3300049823 | Bacteria | 3044 |
| 832 | Ga0501044_0109324 | 3300049823 | Bacteria | 2774 |
| 833 | Ga0501044_0122000 | 3300049823 | Bacteria | 2606 |
| 834 | Ga0501044_0122210 | 3300049823 | Bacteria | 2603 |
| 835 | Ga0501044_0126704 | 3300049823 | Bacteria | 2550 |
| 836 | Ga0501045_0012533 | 3300049824 | Bacteria | 5971 |
| 837 | nmdc:mga0k408_17808_c1 | 3300050493 | Bacteria | 3960 |
| 838 | nmdc:mga0k408_60005_c1 | 3300050493 | Bacteria | 2210 |
| 839 | nmdc:mga0qj67_18257_c1 | 3300050509 | Bacteria | 5344 |
| 840 | nmdc:mga0qj67_67497_c1 | 3300050509 | Bacteria | 2849 |
| 841 | nmdc:mga06r32_28584_c1 | 3300050510 | Bacteria | 5220 |
| 842 | nmdc:mga06r32_8112_c1 | 3300050510 | Bacteria | 9447 |
| 843 | nmdc:mga0n895_125557_c1 | 3300050512 | Bacteria | 2589 |
| 844 | nmdc:mga0n895_25296_c1 | 3300050512 | Bacteria | 5607 |
| 845 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 846 | Ga0495612_0041556 | 3300053078 | Bacteria | 1875 |
| 847 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 848 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 849 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 850 | Ga0500556_0000407 | 3300053104 | Bacteria | 31365 |
| 851 | Ga0500572_000662 | 3300053111 | Bacteria | 11397 |
| 852 | Ga0500593_000156 | 3300053117 | Bacteria | 27265 |
| 853 | Ga0500593_004183 | 3300053117 | Bacteria | 5559 |
| 854 | Ga0500595_004307 | 3300053119 | Bacteria | 6412 |
| 855 | Ga0500618_000065 | 3300053125 | Bacteria | 90667 |
| 856 | Ga0500642_0040739 | 3300053130 | Bacteria | 2005 |
| 857 | Ga0500652_020917 | 3300053131 | Bacteria | 2457 |
| 858 | Ga0500559_0002081 | 3300053136 | Bacteria | 10697 |
| 859 | Ga0500568_0000660 | 3300053139 | Bacteria | 24923 |
| 860 | Ga0500616_0000070 | 3300053153 | Bacteria | 232610 |
| 861 | Ga0500616_0074407 | 3300053153 | Bacteria | 1722 |
| 862 | Ga0500633_0001136 | 3300053160 | Bacteria | 4815 |
| 863 | Ga0500634_0000210 | 3300053161 | Bacteria | 18978 |
| 864 | Ga0500636_0076683 | 3300053177 | Bacteria | 1932 |
| 865 | Ga0500645_000191 | 3300053730 | Bacteria | 47668 |
| 866 | Ga0501084_0007252 | 3300054114 | Bacteria | 9141 |
| 867 | Ga0501084_0014305 | 3300054114 | Bacteria | 6574 |
| 868 | Ga0501084_0160962 | 3300054114 | Bacteria | 1894 |
| 869 | Ga0501082_0037943 | 3300060353 | Bacteria | 4155 |
| 870 | Ga0501082_0167982 | 3300060353 | Bacteria | 1907 |
| 871 | 2509370903 | 2509276018 | Bacteria | 6910194 |
| 872 | 2509397982 | 2509276022 | Bacteria | 6200534 |
| 873 | 2510316553 | 2510065059 | Bacteria | 6847884 |
| 874 | 2513891789 | 2513237141 | Bacteria | 8496279 |
| 875 | 2514033887 | 2513237164 | Bacteria | 7563725 |
| 876 | 2514587936 | 2513237351 | Bacteria | 6968952 |
| 877 | 2525557267 | 2524614729 | Bacteria | 3091755 |
| 878 | 2538833549 | 2537561836 | Bacteria | 3910579 |
| 879 | 2595446050 | 2593339238 | Bacteria | 4182970 |
| 880 | 2595448450 | 2593339238 | Bacteria | 4182970 |
| 881 | 2595449483 | 2593339239 | Bacteria | 4124669 |
| 882 | 2595452501 | 2593339239 | Bacteria | 4124669 |
| 883 | 2630648863 | 2627854209 | Bacteria | 3093011 |
| 884 | 2643755340 | 2643221547 | Bacteria | 4740017 |
| 885 | 2643773902 | 2643221550 | Bacteria | 4619371 |
| 886 | 2643829227 | 2643221562 | Bacteria | 4048635 |
| 887 | 2643895548 | 2643221577 | Bacteria | 3710843 |
| 888 | 2643993802 | 2643221596 | Bacteria | 5006805 |
| 889 | 2644477730 | 2643221685 | Bacteria | 3673288 |
| 890 | 2644529563 | 2643221695 | Bacteria | 3441323 |
| 891 | 2687581803 | 2687453130 | Bacteria | 4227172 |
| 892 | 2721027615 | 2718218334 | Bacteria | 4765486 |
| 893 | 2735836825 | 2734482264 | Unclassified | 5014763 |
| 894 | 2738713995 | 2738541276 | Bacteria | 4690596 |
| 895 | 2739226230 | 2738543009 | Bacteria | 4944499 |
| 896 | 2739730840 | 2739367700 | Bacteria | 4747630 |
| 897 | 2819562601 | 2818991440 | Bacteria | 4774720 |
| 898 | 2838058267 | 2838054893 | Bacteria | 7451788 |
| 899 | 2842713354 | 2842711865 | Bacteria | 7155354 |
| 900 | 2842916360 | 2842914999 | Bacteria | 4419378 |
| 901 | 2842918982 | 2842918807 | Bacteria | 4289178 |
| 902 | 2842921774 | 2842918807 | Bacteria | 4289178 |
| 903 | 2844015703 | 2844009547 | Bacteria | 6728125 |
| 904 | 2856337480 | 2856334872 | Bacteria | 7037011 |
| 905 | 2857368435 | 2857367948 | Bacteria | 6965560 |
| 906 | 2857550854 | 2857547612 | Bacteria | 6179999 |
| 907 | 2857561460 | 2857558681 | Bacteria | 6617694 |
| 908 | 2869241215 | 2869234852 | Bacteria | 6654993 |
| 909 | 2869250516 | 2869249662 | Bacteria | 6868783 |
| 910 | 2869262231 | 2869256925 | Bacteria | 6981691 |
| 911 | 2869265826 | 2869264136 | Bacteria | 6880765 |
| 912 | 2871440803 | 2871435913 | Bacteria | 6880295 |
| 913 | 2871463383 | 2871459585 | Bacteria | 6866887 |
| 914 | 2871483074 | 2871481445 | Bacteria | 6700002 |
| 915 | 2874110609 | 2874109183 | Bacteria | 6517025 |
| 916 | 2874123131 | 2874116593 | Bacteria | 6674494 |
| 917 | 2874138978 | 2874131515 | Bacteria | 6820270 |
| 918 | 2876387381 | 2876386047 | Bacteria | 6698674 |
| 919 | 2876423843 | 2876420981 | Bacteria | 6687741 |
| 920 | 2878734303 | 2878730984 | Bacteria | 6380721 |
| 921 | 2878784777 | 2878781027 | Bacteria | 6834456 |
| 922 | 2883071345 | 2883068021 | Bacteria | 6192739 |
| 923 | 2884340419 | 2884338543 | Bacteria | 4610696 |
| 924 | 2884412296 | 2884411467 | Bacteria | 5246714 |
| 925 | 2885194468 | 2885192300 | Bacteria | 5882526 |
| 926 | 2889311947 | 2889306138 | Bacteria | 6358934 |
| 927 | 2894417097 | 2894414249 | Bacteria | 4405451 |
| 928 | 2902335004 | 2902330777 | Bacteria | 6395352 |
| 929 | 2902409912 | 2902405164 | Bacteria | 6784948 |
| 930 | 2903517806 | 2903513507 | Bacteria | 6344008 |
| 931 | 2904424904 | 2904424332 | Bacteria | 7633521 |
| 932 | 2904463206 | 2904463128 | Bacteria | 4775606 |
| 933 | 2906365399 | 2906363423 | Bacteria | 6856682 |
| 934 | 2906375043 | 2906370794 | Bacteria | 6881062 |
| 935 | 2906400379 | 2906393657 | Bacteria | 6790866 |
| 936 | 2906406518 | 2906401398 | Bacteria | 6693206 |
| 937 | 2913040306 | 2913036834 | Bacteria | 6704877 |
| 938 | 2914761997 | 2914759650 | Bacteria | 4701441 |
| 939 | 2919085505 | 2919085039 | Bacteria | 4532964 |
| 940 | 2919405311 | 2919404418 | Bacteria | 4232372 |
| 941 | 2919406005 | 2919404418 | Bacteria | 4232372 |
| 942 | 2922156215 | 2922151315 | Bacteria | 6902399 |
| 943 | 2924738551 | 2924733363 | Bacteria | 7574837 |
| 944 | 2924743898 | 2924741084 | Bacteria | 6661321 |
| 945 | 2928964086 | 2928963466 | Bacteria | 5165703 |
| 946 | 2937867059 | 2937861824 | Bacteria | 6660327 |
| 947 | 2937869066 | 2937868953 | Bacteria | 6639878 |
| 948 | 2937987882 | 2937980651 | Bacteria | 6517427 |
| 949 | 2939614770 | 2939611941 | Bacteria | 3892017 |
| 950 | 2941475789 | 2941471342 | Bacteria | 5018624 |
| 951 | 2953994728 | 2953994433 | Bacteria | 4303959 |
| 952 | 2953997791 | 2953994433 | Bacteria | 4303959 |
| 953 | 2958110730 | 2958108152 | Bacteria | 6681128 |
| 954 | 2958125964 | 2958122699 | Bacteria | 7280457 |
| 955 | 2961184650 | 2961183825 | Bacteria | 6688536 |
| 956 | 2965040249 | 2965032056 | Bacteria | 6887443 |
| 957 | 2965040472 | 2965040258 | Bacteria | 6855979 |
| 958 | 2965089511 | 2965089291 | Bacteria | 6866420 |
| 959 | 2968143135 | 2968138860 | Bacteria | 6605449 |
| 960 | 2970494671 | 2970489779 | Bacteria | 6517260 |
| 961 | 2970514569 | 2970510686 | Bacteria | 7006402 |
| 962 | 2970535680 | 2970532167 | Bacteria | 6553173 |
| 963 | 2970621924 | 2970619444 | Bacteria | 6986144 |
| 964 | 2970633494 | 2970627176 | Bacteria | 6680862 |
| 965 | 2977857573 | 2977851361 | Bacteria | 6694324 |
| 966 | 2977874935 | 2977872689 | Bacteria | 7270173 |
| 967 | 2977898765 | 2977898635 | Bacteria | 6675551 |
| 968 | 2977915099 | 2977907340 | Bacteria | 6577984 |
| 969 | 2977920392 | 2977915119 | Bacteria | 6829656 |
| 970 | 2977954184 | 2977950692 | Bacteria | 6893264 |
| 971 | 2979765105 | 2979764755 | Bacteria | 6610066 |
| 972 | 2979776388 | 2979772303 | Bacteria | 6618277 |
| 973 | 2979793815 | 2979793036 | Bacteria | 6808957 |
| 974 | 2987675672 | 2987673487 | Bacteria | 6884027 |
| 975 | 2996391908 | 2996386984 | Bacteria | 6978667 |
| 976 | 3004171190 | 3004167301 | Bacteria | 8330599 |
| 977 | 3004175311 | 3004167301 | Bacteria | 8330599 |
| 978 | 3004202269 | 3004195979 | Bacteria | 6776956 |
| 979 | 3004233195 | 3004232784 | Bacteria | 6662140 |
| 980 | 3004240199 | 3004239961 | Bacteria | 6892290 |
| 981 | 3004250651 | 3004248173 | Bacteria | 6563236 |
| 982 | 3004270539 | 3004268573 | Bacteria | 7043476 |
| 983 | 3004342715 | 3004334049 | Bacteria | 8449246 |
| 984 | 8003014663 | 8003014200 | Bacteria | 4059994 |
| 985 | 8004314049 | 8004312739 | Bacteria | 7444653 |
| 986 | 8004366937 | 8004361976 | Bacteria | 6858373 |
| 987 | 8004697175 | 8004695233 | Bacteria | 6731676 |
| 988 | 8004734157 | 8004727605 | Bacteria | 6643904 |
| 989 | 8016590493 | 8016583857 | Bacteria | 10421953 |
| 990 | Ga0055524_1014737 | |||
| 991 | JGI24740J21852_10010186 | |||
| 992 | JGI24739J22299_10001078 | |||
| 993 | JGI24737J22298_10002950 | |||
| 994 | JGI24735J21928_10008777 | |||
| 995 | JGI24735J21928_10012187 | |||
| 996 | JGI24738J21930_10002735 | |||
| 997 | JGI25156J39149_1009512 | |||
| 998 | JGI25162J39368_1000345 | |||
| 999 | JGI25162J39368_1000407 | |||
| 1000 | JGI25162J39368_1000444 | |||
| 1001 | JGI25162J39368_1000618 | |||
| 1002 | JGI25162J39368_1001758 | |||
| 1003 | JGI25162J39368_1002058 | |||
| 1004 | JGI25157J39369_1000244 | |||
| 1005 | JGI25157J39369_1000317 | |||
| 1006 | JGI25157J39369_1000651 | |||
| 1007 | JGI25157J39369_1004792 | |||
| 1008 | JGI25163J39215_1000267 | |||
| 1009 | JGI25164J39214_1000161 | |||
| 1010 | JGI25164J39214_1000187 | |||
| 1011 | JGI25164J39214_1000208 | |||
| 1012 | JGI25164J39214_1000267 | |||
| 1013 | JGI25164J39214_1000294 | |||
| 1014 | JGI25152J39213_1013407 | |||
| 1015 | JGI25159J45721_1011794 | |||
| 1016 | JGI25151J46595_10029573 | |||
| 1017 | JGI25165J46597_1000059 | |||
| 1018 | JGI25165J46597_1000338 | |||
| 1019 | JGI25165J46597_1000481 | |||
| 1020 | JGI25165J46597_1001019 | |||
| 1021 | JGI25165J46597_1001527 | |||
| 1022 | JGI25153J46596_10008324 | |||
| 1023 | JGI25153J46596_10013658 | |||
| 1024 | rootH2_10133574 | |||
| 1025 | Ga0006562J51391_1041114 | |||
| 1026 | Ga0006562J51391_1041115 | |||
| 1027 | Ga0055538_1001452 | |||
| 1028 | Ga0055539_1001152 | |||
| 1029 | Ga0055533_1004498 | |||
| 1030 | Ga0055527_1000076 | |||
| 1031 | Ga0055535_1000120 | |||
| 1032 | Ga0055535_1000129 | |||
| 1033 | Ga0055535_1000417 | |||
| 1034 | Ga0055535_1001441 | |||
| 1035 | Ga0055542_1000054 | |||
| 1036 | Ga0055542_1000173 | |||
| 1037 | Ga0055542_1000422 | |||
| 1038 | Ga0055542_1000435 | |||
| 1039 | Ga0055542_1000832 | |||
| 1040 | Ga0055529_1000110 | |||
| 1041 | Ga0055529_1000200 | |||
| 1042 | Ga0055529_1000370 | |||
| 1043 | Ga0055526_1000001 | |||
| 1044 | Ga0055536_1009583 | |||
| 1045 | Ga0055530_10011606 | |||
| 1046 | Ga0055531_10000048 | |||
| 1047 | Ga0055531_10004530 | |||
| 1048 | Ga0055531_10010223 | |||
| 1049 | Ga0055531_10013337 | |||
| 1050 | Ga0065165_1000118 | |||
| 1051 | Ga0065165_1000500 | |||
| 1052 | Ga0065165_1002313 | |||
| 1053 | Ga0065707_10000820 | |||
| 1054 | Ga0065707_10082453 | |||
| 1055 | Ga0070658_10063984 | |||
| 1056 | Ga0070658_10297727 | |||
| 1057 | Ga0070676_10073869 | |||
| 1058 | Ga0070690_100025671 | |||
| 1059 | Ga0070670_100079731 | |||
| 1060 | Ga0070666_10000012 | |||
| 1061 | Ga0070680_100012391 | |||
| 1062 | Ga0070680_100060257 | |||
| 1063 | Ga0070682_100005716 | |||
| 1064 | Ga0070660_100030087 | |||
| 1065 | Ga0070660_100155666 | |||
| 1066 | Ga0070689_100004062 | |||
| 1067 | Ga0070691_10007359 | |||
| 1068 | Ga0070661_100011510 | |||
| 1069 | Ga0070661_100058650 | |||
| 1070 | Ga0070661_100069480 | |||
| 1071 | Ga0070668_100017643 | |||
| 1072 | Ga0070669_100077717 | |||
| 1073 | Ga0070674_100075070 | |||
| 1074 | Ga0070659_100000104 | |||
| 1075 | Ga0070659_100214588 | |||
| 1076 | Ga0070667_100001691 | |||
| 1077 | Ga0070709_10004581 | |||
| 1078 | Ga0070714_100000161 | |||
| 1079 | Ga0070713_100006944 | |||
| 1080 | Ga0070713_100009016 | |||
| 1081 | Ga0070713_100011820 | |||
| 1082 | Ga0070663_100010008 | |||
| 1083 | Ga0070663_100016227 | |||
| 1084 | Ga0070663_100173363 | |||
| 1085 | Ga0070678_100034166 | |||
| 1086 | Ga0070662_100026274 | |||
| 1087 | Ga0070662_100172291 | |||
| 1088 | Ga0070681_10021952 | |||
| 1089 | Ga0070681_10025990 | |||
| 1090 | Ga0070681_10031834 | |||
| 1091 | Ga0070681_10077516 | |||
| 1092 | Ga0070685_10000392 | |||
| 1093 | Ga0070679_100027197 | |||
| 1094 | Ga0070679_100038412 | |||
| 1095 | Ga0070679_100077779 | |||
| 1096 | Ga0068853_100067544 | |||
| 1097 | Ga0068853_100152823 | |||
| 1098 | Ga0070696_100002057 | |||
| 1099 | Ga0070696_100041275 | |||
| 1100 | Ga0070696_100092240 | |||
| 1101 | Ga0070693_100048750 | |||
| 1102 | Ga0070665_100000393 | |||
| 1103 | Ga0070665_100006459 | |||
| 1104 | Ga0070665_100024783 | |||
| 1105 | Ga0070665_100071388 | |||
| 1106 | Ga0070665_100192984 | |||
| 1107 | Ga0068855_100007961 | |||
| 1108 | Ga0068855_100015348 | |||
| 1109 | Ga0068855_100030409 | |||
| 1110 | Ga0068855_100091163 | |||
| 1111 | Ga0070664_100010444 | |||
| 1112 | Ga0068857_100027102 | |||
| 1113 | Ga0068857_100036971 | |||
| 1114 | Ga0068854_100000481 | |||
| 1115 | Ga0068856_100053060 | |||
| 1116 | Ga0068856_100058515 | |||
| 1117 | Ga0068856_100096465 | |||
| 1118 | Ga0068856_100125511 | |||
| 1119 | Ga0068856_100231145 | |||
| 1120 | Ga0068852_100023243 | |||
| 1121 | Ga0068859_100192198 | |||
| 1122 | Ga0068851_10010458 | |||
| 1123 | Ga0068858_100002138 | |||
| 1124 | Ga0068858_100249697 | |||
| 1125 | Ga0068860_100011037 | |||
| 1126 | Ga0068860_100059764 | |||
| 1127 | Ga0068860_100081529 | |||
| 1128 | Ga0068862_100030607 | |||
| 1129 | Ga0068862_100047012 | |||
| 1130 | Ga0081455_10006552 | |||
| 1131 | Ga0081539_10000001 | |||
| 1132 | Ga0070717_10031172 | |||
| 1133 | Ga0075365_10036363 | |||
| 1134 | Ga0075366_10000683 | |||
| 1135 | Ga0075366_10014537 | |||
| 1136 | Ga0068871_100005293 | |||
| 1137 | Ga0075430_100039982 | |||
| 1138 | Ga0075431_100004249 | |||
| 1139 | Ga0075431_100016318 | |||
| 1140 | Ga0075434_100063191 | |||
| 1141 | Ga0075434_100171240 | |||
| 1142 | Ga0097620_100192192 | |||
| 1143 | Ga0105240_10000113 | |||
| 1144 | Ga0105240_10000162 | |||
| 1145 | Ga0105240_10000317 | |||
| 1146 | Ga0105240_10000671 | |||
| 1147 | Ga0105240_10000884 | |||
| 1148 | Ga0105240_10006881 | |||
| 1149 | Ga0105240_10019958 | |||
| 1150 | Ga0105240_10034519 | |||
| 1151 | Ga0105240_10048297 | |||
| 1152 | Ga0105245_10002275 | |||
| 1153 | Ga0105247_10014455 | |||
| 1154 | Ga0114129_10171546 | |||
| 1155 | Ga0105242_10115127 | |||
| 1156 | Ga0105248_10013719 | |||
| 1157 | Ga0105237_10025261 | |||
| 1158 | Ga0105237_10119323 | |||
| 1159 | Ga0105238_10000109 | |||
| 1160 | Ga0105238_10018954 | |||
| 1161 | Ga0105238_10018971 | |||
| 1162 | Ga0105238_10072762 | |||
| 1163 | Ga0105249_10037277 | |||
| 1164 | Ga0105249_10055644 | |||
| 1165 | Ga0105030_100140 | |||
| 1166 | Ga0105239_10000033 | |||
| 1167 | Ga0105239_10000034 | |||
| 1168 | Ga0105239_10000050 | |||
| 1169 | Ga0157347_1000199 | |||
| 1170 | Ga0157339_1000718 | |||
| 1171 | Ga0157373_10000162 | |||
| 1172 | Ga0157373_10001336 | |||
| 1173 | Ga0157373_10001753 | |||
| 1174 | Ga0157373_10085407 | |||
| 1175 | Ga0157371_10001241 | |||
| 1176 | Ga0157371_10001357 | |||
| 1177 | Ga0157371_10064239 | |||
| 1178 | Ga0157370_10001027 | |||
| 1179 | Ga0157370_10002298 | |||
| 1180 | Ga0157370_10002411 | |||
| 1181 | Ga0157370_10008231 | |||
| 1182 | Ga0157370_10053054 | |||
| 1183 | Ga0157369_10000551 | |||
| 1184 | Ga0157369_10004459 | |||
| 1185 | Ga0157369_10051107 | |||
| 1186 | Ga0157369_10055334 | |||
| 1187 | Ga0157369_10116000 | |||
| 1188 | Ga0163162_10000127 | |||
| 1189 | Ga0163162_10015245 | |||
| 1190 | Ga0157372_10000017 | |||
| 1191 | Ga0157372_10002252 | |||
| 1192 | Ga0157372_10083127 | |||
| 1193 | Ga0157372_10160695 | |||
| 1194 | Ga0157375_10089689 | |||
| 1195 | Ga0157514_110596 | |||
| 1196 | Ga0163163_10022696 | |||
| 1197 | Ga0182008_10000578 | |||
| 1198 | Ga0182008_10001780 | |||
| 1199 | Ga0182008_10009136 | |||
| 1200 | Ga0182008_10035270 | |||
| 1201 | Ga0157379_10003252 | |||
| 1202 | Ga0157376_10003915 | |||
| 1203 | Ga0157376_10012095 | |||
| 1204 | Ga0157376_10043986 | |||
| 1205 | Ga0182006_1000049 | |||
| 1206 | Ga0182006_1000187 | |||
| 1207 | Ga0182006_1000484 | |||
| 1208 | Ga0182006_1006110 | |||
| 1209 | Ga0182006_1025512 | |||
| 1210 | Ga0182007_10006519 | |||
| 1211 | Ga0182005_1000004 | |||
| 1212 | Ga0182005_1000432 | |||
| 1213 | Ga0182005_1002203 | |||
| 1214 | Ga0183369_1003 | |||
| 1215 | Ga0183368_1004 | |||
| 1216 | Ga0163161_10001992 | |||
| 1217 | Ga0206349_1291601 | |||
| 1218 | Ga0206351_10745720 | |||
| 1219 | Ga0213874_10017938 | |||
| 1220 | Ga0213871_10003319 | |||
| 1221 | Ga0224712_10000382 | |||
| 1222 | Ga0224712_10034351 | |||
| 1223 | Ga0209760_100405 | |||
| 1224 | Ga0209784_100026 | |||
| 1225 | Ga0209566_102091 | |||
| 1226 | Ga0209674_100016 | |||
| 1227 | Ga0209674_100026 | |||
| 1228 | Ga0209674_100452 | |||
| 1229 | Ga0209674_100462 | |||
| 1230 | Ga0209674_100901 | |||
| 1231 | Ga0209672_100017 | |||
| 1232 | Ga0209672_100119 | |||
| 1233 | Ga0209672_100560 | |||
| 1234 | Ga0209672_101944 | |||
| 1235 | Ga0207427_100023 | |||
| 1236 | Ga0207427_100046 | |||
| 1237 | Ga0207427_100080 | |||
| 1238 | Ga0207427_100133 | |||
| 1239 | Ga0207427_100203 | |||
| 1240 | Ga0207427_101231 | |||
| 1241 | Ga0207427_104824 | |||
| 1242 | Ga0209437_100005 | |||
| 1243 | Ga0209437_100015 | |||
| 1244 | Ga0209437_100039 | |||
| 1245 | Ga0209437_100132 | |||
| 1246 | Ga0209437_100264 | |||
| 1247 | Ga0209437_100344 | |||
| 1248 | Ga0209437_100956 | |||
| 1249 | Ga0209437_101178 | |||
| 1250 | Ga0209258_100038 | |||
| 1251 | Ga0209258_100043 | |||
| 1252 | Ga0209258_100045 | |||
| 1253 | Ga0209258_100430 | |||
| 1254 | Ga0209258_101101 | |||
| 1255 | Ga0209646_1001454 | |||
| 1256 | Ga0209026_1000047 | |||
| 1257 | Ga0209026_1000270 | |||
| 1258 | Ga0209026_1000283 | |||
| 1259 | Ga0209026_1000544 | |||
| 1260 | Ga0209026_1001541 | |||
| 1261 | Ga0209677_103534 | |||
| 1262 | Ga0209148_1000002 | |||
| 1263 | Ga0209148_1000009 | |||
| 1264 | Ga0209148_1000010 | |||
| 1265 | Ga0209148_1000052 | |||
| 1266 | Ga0209148_1000125 | |||
| 1267 | Ga0209148_1000856 | |||
| 1268 | Ga0209148_1000860 | |||
| 1269 | Ga0209759_1000124 | |||
| 1270 | Ga0209759_1000715 | |||
| 1271 | Ga0209759_1002933 | |||
| 1272 | Ga0209129_1000380 | |||
| 1273 | Ga0209129_1000419 | |||
| 1274 | Ga0209129_1003465 | |||
| 1275 | Ga0209233_1000009 | |||
| 1276 | Ga0209233_1000011 | |||
| 1277 | Ga0209233_1000090 | |||
| 1278 | Ga0209233_1000114 | |||
| 1279 | Ga0209233_1000270 | |||
| 1280 | Ga0209233_1000635 | |||
| 1281 | Ga0209233_1009777 | |||
| 1282 | Ga0209233_1014140 | |||
| 1283 | Ga0209455_1000020 | |||
| 1284 | Ga0209455_1000032 | |||
| 1285 | Ga0209455_1000077 | |||
| 1286 | Ga0209455_1002311 | |||
| 1287 | Ga0209455_1005606 | |||
| 1288 | Ga0209673_1002585 | |||
| 1289 | Ga0209130_1000739 | |||
| 1290 | Ga0209675_1003089 | |||
| 1291 | Ga0209675_1008310 | |||
| 1292 | Ga0209675_1015020 | |||
| 1293 | Ga0209676_1000652 | |||
| 1294 | Ga0209676_1002221 | |||
| 1295 | Ga0209676_1002767 | |||
| 1296 | Ga0209676_1003961 | |||
| 1297 | Ga0209676_1007785 | |||
| 1298 | Ga0209676_1025631 | |||
| 1299 | Ga0209025_1000739 | |||
| 1300 | Ga0209025_1016330 | |||
| 1301 | Ga0209564_1000002 | |||
| 1302 | Ga0209758_1000264 | |||
| 1303 | Ga0209758_1001407 | |||
| 1304 | Ga0209758_1002634 | |||
| 1305 | Ga0209758_1013988 | |||
| 1306 | Ga0209050_1001726 | |||
| 1307 | Ga0209050_1002010 | |||
| 1308 | Ga0209050_1020151 | |||
| 1309 | Ga0209256_1001138 | |||
| 1310 | Ga0209256_1002995 | |||
| 1311 | Ga0209256_1015530 | |||
| 1312 | Ga0207426_1016466 | |||
| 1313 | Ga0209051_1005447 | |||
| 1314 | Ga0209051_1008459 | |||
| 1315 | Ga0209051_1021347 | |||
| 1316 | Ga0209257_1000007 | |||
| 1317 | Ga0209257_1000243 | |||
| 1318 | Ga0209257_1000580 | |||
| 1319 | Ga0209257_1001540 | |||
| 1320 | Ga0209257_1003478 | |||
| 1321 | Ga0207680_10000013 | |||
| 1322 | Ga0207647_10000714 | |||
| 1323 | Ga0207647_10001141 | |||
| 1324 | Ga0207647_10003186 | |||
| 1325 | Ga0207647_10009780 | |||
| 1326 | Ga0207647_10041541 | |||
| 1327 | Ga0207705_10013087 | |||
| 1328 | Ga0207705_10046018 | |||
| 1329 | Ga0207705_10097740 | |||
| 1330 | Ga0207705_10174355 | |||
| 1331 | Ga0207707_10006788 | |||
| 1332 | Ga0207707_10021887 | |||
| 1333 | Ga0207707_10029550 | |||
| 1334 | Ga0207707_10059138 | |||
| 1335 | Ga0207695_10000198 | |||
| 1336 | Ga0207695_10000219 | |||
| 1337 | Ga0207695_10000322 | |||
| 1338 | Ga0207695_10000364 | |||
| 1339 | Ga0207695_10000874 | |||
| 1340 | Ga0207695_10000876 | |||
| 1341 | Ga0207695_10002095 | |||
| 1342 | Ga0207695_10002325 | |||
| 1343 | Ga0207695_10004297 | |||
| 1344 | Ga0207695_10005620 | |||
| 1345 | Ga0207695_10014125 | |||
| 1346 | Ga0207695_10031434 | |||
| 1347 | Ga0207695_10155805 | |||
| 1348 | Ga0207695_10185364 | |||
| 1349 | Ga0207671_10019774 | |||
| 1350 | Ga0207671_10076460 | |||
| 1351 | Ga0207671_10138368 | |||
| 1352 | Ga0207693_10035737 | |||
| 1353 | Ga0207693_10039576 | |||
| 1354 | Ga0207660_10056724 | |||
| 1355 | Ga0207660_10209474 | |||
| 1356 | Ga0207657_10007998 | |||
| 1357 | Ga0207657_10071270 | |||
| 1358 | Ga0207649_10012369 | |||
| 1359 | Ga0207652_10058476 | |||
| 1360 | Ga0207652_10119292 | |||
| 1361 | Ga0207694_10000398 | |||
| 1362 | Ga0207694_10000556 | |||
| 1363 | Ga0207694_10030229 | |||
| 1364 | Ga0207694_10053390 | |||
| 1365 | Ga0207694_10062967 | |||
| 1366 | Ga0207694_10095222 | |||
| 1367 | Ga0207694_10138514 | |||
| 1368 | Ga0207650_10021868 | |||
| 1369 | Ga0207650_10039828 | |||
| 1370 | Ga0207687_10071147 | |||
| 1371 | Ga0207700_10149076 | |||
| 1372 | Ga0207664_10000109 | |||
| 1373 | Ga0207664_10171759 | |||
| 1374 | Ga0207690_10000252 | |||
| 1375 | Ga0207690_10009148 | |||
| 1376 | Ga0207690_10028029 | |||
| 1377 | Ga0207706_10012378 | |||
| 1378 | Ga0207706_10025710 | |||
| 1379 | Ga0207686_10051324 | |||
| 1380 | Ga0207709_10139473 | |||
| 1381 | Ga0207670_10003972 | |||
| 1382 | Ga0207704_10087033 | |||
| 1383 | Ga0207665_10005858 | |||
| 1384 | Ga0207711_10008233 | |||
| 1385 | Ga0207679_10003789 | |||
| 1386 | Ga0207667_10000195 | |||
| 1387 | Ga0207667_10000406 | |||
| 1388 | Ga0207667_10000752 | |||
| 1389 | Ga0207667_10001181 | |||
| 1390 | Ga0207667_10135157 | |||
| 1391 | Ga0207667_10223402 | |||
| 1392 | Ga0207712_10035528 | |||
| 1393 | Ga0207712_10109894 | |||
| 1394 | Ga0207668_10063996 | |||
| 1395 | Ga0207640_10000025 | |||
| 1396 | Ga0207640_10000275 | |||
| 1397 | Ga0207640_10002524 | |||
| 1398 | Ga0207658_10114014 | |||
| 1399 | Ga0207703_10073426 | |||
| 1400 | Ga0207639_10000948 | |||
| 1401 | Ga0207639_10084484 | |||
| 1402 | Ga0207678_10015564 | |||
| 1403 | Ga0207702_10028222 | |||
| 1404 | Ga0207702_10278293 | |||
| 1405 | Ga0207674_10007294 | |||
| 1406 | Ga0207674_10031038 | |||
| 1407 | Ga0207674_10187386 | |||
| 1408 | Ga0207674_10228512 | |||
| 1409 | Ga0207675_100075125 | |||
| 1410 | Ga0209179_1000594 | |||
| 1411 | Ga0268266_10000021 | |||
| 1412 | Ga0268266_10000532 | |||
| 1413 | Ga0268266_10004337 | |||
| 1414 | Ga0268266_10018195 | |||
| 1415 | Ga0268265_10049937 | |||
| 1416 | Ga0268264_10039462 | |||
| 1417 | Ga0307515_10034644 | |||
| 1418 | Ga0265338_10009114 | |||
| 1419 | Ga0265338_10076126 | |||
| 1420 | Ga0265338_10222229 | |||
| 1421 | Ga0265330_10013639 | |||
| 1422 | Ga0265332_10007639 | |||
| 1423 | Ga0265328_10015580 | |||
| 1424 | Ga0265325_10038429 | |||
| 1425 | Ga0265331_10010281 | |||
| 1426 | Ga0307509_10082704 | |||
| 1427 | Ga0307408_100022881 | |||
| 1428 | Ga0307408_100110622 | |||
| 1429 | Ga0307408_100196070 | |||
| 1430 | Ga0265313_10013795 | |||
| 1431 | Ga0307508_10001382 | |||
| 1432 | Ga0307508_10014707 | |||
| 1433 | Ga0265342_10000309 | |||
| 1434 | Ga0265342_10000954 | |||
| 1435 | Ga0316576_10000401 | |||
| 1436 | Ga0316578_10000603 | |||
| 1437 | Ga0316578_10007507 | |||
| 1438 | Ga0316578_10110381 | |||
| 1439 | Ga0307516_10000012 | |||
| 1440 | Ga0307516_10000127 | |||
| 1441 | Ga0307405_10043830 | |||
| 1442 | Ga0307405_10145780 | |||
| 1443 | Ga0307413_10000993 | |||
| 1444 | Ga0307413_10023835 | |||
| 1445 | Ga0307413_10091242 | |||
| 1446 | Ga0307410_10020854 | |||
| 1447 | Ga0307410_10221311 | |||
| 1448 | Ga0307412_10001913 | |||
| 1449 | Ga0307412_10002808 | |||
| 1450 | Ga0307412_10053213 | |||
| 1451 | Ga0307412_10073288 | |||
| 1452 | Ga0307412_10100328 | |||
| 1453 | Ga0307409_100017567 | |||
| 1454 | Ga0307416_100001542 | |||
| 1455 | Ga0307416_100003400 | |||
| 1456 | Ga0307416_100057026 | |||
| 1457 | Ga0307414_10037573 | |||
| 1458 | Ga0307414_10063163 | |||
| 1459 | Ga0307411_10030914 | |||
| 1460 | Ga0307411_10099087 | |||
| 1461 | Ga0307415_100031012 | |||
| 1462 | Ga0316593_10002230 | |||
| 1463 | Ga0316593_10014225 | |||
| 1464 | Ga0307510_10023623 | |||
| 1465 | Ga0307510_10064118 | |||
| 1466 | Ga0316592_1011766 | |||
| 1467 | Ga0316588_1000533 | |||
| 1468 | Ga0316588_1011693 | |||
| 1469 | Ga0316588_1011956 | |||
| 1470 | Ga0316596_1010361 | |||
| 1471 | Ga0373944_0010269 | |||
| 1472 | Ga0373923_0005804 | |||
| 1473 | Ga0373936_0000250 | |||
| 1474 | Ga0373954_0018589 | |||
| 1475 | Ga0373956_0041166 | |||
| 1476 | Ga0373943_0007700 | |||
| 1477 | Ga0373946_0013254 | |||
| 1478 | Ga0373955_0012798 | |||
| 1479 | Ga0373935_0000277 | |||
| 1480 | Ga0373927_0003700 | |||
| 1481 | Ga0373933_0031207 | |||
| 1482 | Ga0373947_0002129 | |||
| 1483 | Ga0373937_0001170 | |||
| 1484 | Ga0316582_0038484 | |||
| 1485 | Ga0316584_0003979 | |||
| 1486 | Ga0373925_0000617 | |||
| 1487 | Ga0395899_0000046 | |||
| 1488 | Ga0395899_0000328 | |||
| 1489 | Ga0395899_0015649 | |||
| 1490 | Ga0395899_0025450 | |||
| 1491 | Ga0395899_0041577 | |||
| 1492 | Ga0395899_0084053 | |||
| 1493 | Ga0395900_0000034 | |||
| 1494 | Ga0395900_0000487 | |||
| 1495 | Ga0395900_0015814 | |||
| 1496 | Ga0395900_0055750 | |||
| 1497 | Ga0395900_0085141 | |||
| 1498 | Ga0395898_0000081 | |||
| 1499 | Ga0395898_0000835 | |||
| 1500 | Ga0395898_0005081 | |||
| 1501 | Ga0395898_0027720 | |||
| 1502 | Ga0395905_0000165 | |||
| 1503 | Ga0395905_0006346 | |||
| 1504 | Ga0395905_0034782 | |||
| 1505 | Ga0395905_0080441 | |||
| 1506 | Ga0395901_0000726 | |||
| 1507 | Ga0395901_0003055 | |||
| 1508 | Ga0395901_0005078 | |||
| 1509 | Ga0395901_0008198 | |||
| 1510 | Ga0395901_0051802 | |||
| 1511 | Ga0436365_0936435 | |||
| 1512 | Ga0436360_0314901 | |||
| 1513 | Ga0436360_0654994 | |||
| 1514 | Ga0436361_0556854 | |||
| 1515 | Ga0436363_1195502 | |||
| 1516 | Ga0436363_1357513 | |||
| 1517 | Ga0436362_0573719 | |||
| 1518 | Ga0439436_0000018 | |||
| 1519 | Ga0439436_0000061 | |||
| 1520 | Ga0439436_0014989 | |||
| 1521 | Ga0439465_0004527 | |||
| 1522 | Ga0451793_1604110 | |||
| 1523 | Ga0451807_0603001 | |||
| 1524 | Ga0439449_0000693 | |||
| 1525 | Ga0450896_001311 | |||
| 1526 | Ga0439446_0008934 | |||
| 1527 | Ga0450908_000052 | |||
| 1528 | Ga0450908_001644 | |||
| 1529 | Ga0439459_0001958 | |||
| 1530 | Ga0451577_0007968 | |||
| 1531 | Ga0451577_0016590 | |||
| 1532 | Ga0466969_0017713 | |||
| 1533 | Ga0466969_0028211 | |||
| 1534 | Ga0466969_0033434 | |||
| 1535 | Ga0466982_0000025 | |||
| 1536 | Ga0466982_0000056 | |||
| 1537 | Ga0453683_0018983 | |||
| 1538 | Ga0466966_0004819 | |||
| 1539 | Ga0466966_0008441 | |||
| 1540 | Ga0466966_0013196 | |||
| 1541 | Ga0466966_0065099 | |||
| 1542 | Ga0466961_0001433 | |||
| 1543 | Ga0466961_0004989 | |||
| 1544 | Ga0466961_0013131 | |||
| 1545 | Ga0466961_0016649 | |||
| 1546 | Ga0466961_0036641 | |||
| 1547 | Ga0466961_0061672 | |||
| 1548 | Ga0466961_0076095 | |||
| 1549 | Ga0466963_0048715 | |||
| 1550 | Ga0453684_0000046 | |||
| 1551 | Ga0453684_0193403 | |||
| 1552 | Ga0466971_0000694 | |||
| 1553 | Ga0466970_0081026 | |||
| 1554 | Ga0466957_0001623 | |||
| 1555 | Ga0466957_0065450 | |||
| 1556 | Ga0466959_0021363 | |||
| 1557 | Ga0466959_0042078 | |||
| 1558 | Ga0466959_0052113 | |||
| 1559 | Ga0466959_0132351 | |||
| 1560 | Ga0451576_0008271 | |||
| 1561 | Ga0451576_0036117 | |||
| 1562 | Ga0451576_0190066 | |||
| 1563 | Ga0466958_0091361 | |||
| 1564 | Ga0466967_0138591 | |||
| 1565 | Ga0495617_000019 | |||
| 1566 | Ga0495617_000865 | |||
| 1567 | Ga0495592_0000377 | |||
| 1568 | Ga0495590_0000002 | |||
| 1569 | Ga0495638_0000030 | |||
| 1570 | Ga0495638_0000069 | |||
| 1571 | Ga0495638_0000280 | |||
| 1572 | Ga0495638_0000311 | |||
| 1573 | Ga0495638_0001085 | |||
| 1574 | Ga0495653_0000027 | |||
| 1575 | Ga0495650_0000061 | |||
| 1576 | Ga0495650_0000501 | |||
| 1577 | Ga0495650_0000920 | |||
| 1578 | Ga0495650_0001244 | |||
| 1579 | Ga0495662_0011796 | |||
| 1580 | Ga0495584_0001702 | |||
| 1581 | Ga0495585_0000001 | |||
| 1582 | Ga0495585_0016990 | |||
| 1583 | Ga0495607_0000003 | |||
| 1584 | Ga0495607_0001172 | |||
| 1585 | Ga0495607_0001827 | |||
| 1586 | Ga0495607_0024313 | |||
| 1587 | Ga0495583_0000058 | |||
| 1588 | Ga0495583_0006205 | |||
| 1589 | Ga0495606_0000050 | |||
| 1590 | Ga0495606_0000097 | |||
| 1591 | Ga0495606_0000105 | |||
| 1592 | Ga0495606_0001098 | |||
| 1593 | Ga0495606_0001776 | |||
| 1594 | Ga0495606_0004944 | |||
| 1595 | Ga0495606_0014678 | |||
| 1596 | Ga0495606_0020249 | |||
| 1597 | Ga0495608_0000135 | |||
| 1598 | Ga0495610_0000380 | |||
| 1599 | Ga0495610_0000537 | |||
| 1600 | Ga0495610_0032907 | |||
| 1601 | Ga0495610_0039710 | |||
| 1602 | Ga0495616_0000001 | |||
| 1603 | Ga0495618_0000052 | |||
| 1604 | Ga0495620_0031578 | |||
| 1605 | Ga0495628_0000005 | |||
| 1606 | Ga0495630_0009097 | |||
| 1607 | Ga0495631_0000033 | |||
| 1608 | Ga0495631_0000205 | |||
| 1609 | Ga0495632_0000003 | |||
| 1610 | Ga0495632_0000120 | |||
| 1611 | Ga0495632_0004636 | |||
| 1612 | Ga0495643_0000078 | |||
| 1613 | Ga0495648_0000009 | |||
| 1614 | Ga0495648_0000083 | |||
| 1615 | Ga0495648_0045343 | |||
| 1616 | Ga0495663_0047254 | |||
| 1617 | Ga0495652_0000001 | |||
| 1618 | Ga0495640_0000035 | |||
| 1619 | Ga0495587_0000012 | |||
| 1620 | Ga0495609_0000590 | |||
| 1621 | Ga0495609_0004654 | |||
| 1622 | Ga0495597_0000014 | |||
| 1623 | Ga0495645_0000014 | |||
| 1624 | Ga0495633_0000041 | |||
| 1625 | Ga0495667_0000001 | |||
| 1626 | Ga0495668_0000750 | |||
| 1627 | Ga0495668_0004788 | |||
| 1628 | Ga0495668_0005286 | |||
| 1629 | Ga0495668_0008417 | |||
| 1630 | Ga0495634_0000412 | |||
| 1631 | Ga0495611_0000001 | |||
| 1632 | Ga0495611_0000008 | |||
| 1633 | Ga0495625_0000001 | |||
| 1634 | Ga0495625_0000023 | |||
| 1635 | Ga0495625_0002867 | |||
| 1636 | Ga0495625_0005892 | |||
| 1637 | Ga0495625_0008485 | |||
| 1638 | Ga0495625_0041568 | |||
| 1639 | Ga0495625_0053433 | |||
| 1640 | Ga0495635_0000007 | |||
| 1641 | Ga0495661_0000672 | |||
| 1642 | Ga0495657_0000727 | |||
| 1643 | Ga0495599_0000002 | |||
| 1644 | Ga0495623_0000316 | |||
| 1645 | Ga0495646_0000133 | |||
| 1646 | Ga0495669_0000385 | |||
| 1647 | Ga0495669_0002242 | |||
| 1648 | Ga0495613_0019436 | |||
| 1649 | Ga0495670_0000407 | |||
| 1650 | Ga0495670_0008258 | |||
| 1651 | Ga0495670_0008842 | |||
| 1652 | Ga0495671_0000208 | |||
| 1653 | Ga0495649_0007164 | |||
| 1654 | Ga0495649_0008003 | |||
| 1655 | Ga0495649_0020260 | |||
| 1656 | Ga0495649_0037147 | |||
| 1657 | Ga0495589_0000446 | |||
| 1658 | Ga0495600_0000199 | |||
| 1659 | Ga0495660_0000008 | |||
| 1660 | Ga0495660_0000009 | |||
| 1661 | Ga0495660_0000159 | |||
| 1662 | Ga0495604_0000007 | |||
| 1663 | Ga0495674_0000001 | |||
| 1664 | Ga0495672_0116464 | |||
| 1665 | Ga0495680_0001769 | |||
| 1666 | Ga0495683_0000922 | |||
| 1667 | Ga0495687_014320 | |||
| 1668 | Ga0495687_014376 | |||
| 1669 | Ga0495675_0000539 | |||
| 1670 | Ga0495679_000001 | |||
| 1671 | Ga0495673_0000001 | |||
| 1672 | Ga0495673_0000030 | |||
| 1673 | Ga0495673_0002990 | |||
| 1674 | Ga0495681_0007223 | |||
| 1675 | Ga0495684_0000027 | |||
| 1676 | Ga0495686_0000019 | |||
| 1677 | Ga0495686_0000077 | |||
| 1678 | Ga0495686_0002878 | |||
| 1679 | Ga0495686_0011038 | |||
| 1680 | Ga0495686_0015188 | |||
| 1681 | Ga0495686_0027117 | |||
| 1682 | Ga0495593_0001637 | |||
| 1683 | Ga0495602_0000004 | |||
| 1684 | Ga0496100_0004314 | |||
| 1685 | Ga0496100_0202266 | |||
| 1686 | Ga0496101_0001940 | |||
| 1687 | Ga0496101_0007629 | |||
| 1688 | Ga0496101_0175731 | |||
| 1689 | Ga0496102_0004747 | |||
| 1690 | Ga0496102_0182089 | |||
| 1691 | Ga0496104_0005865 | |||
| 1692 | Ga0496105_0012174 | |||
| 1693 | Ga0496105_0014752 | |||
| 1694 | Ga0496105_0029955 | |||
| 1695 | Ga0496105_0038223 | |||
| 1696 | Ga0496106_0002177 | |||
| 1697 | Ga0496106_0265537 | |||
| 1698 | Ga0496107_0044077 | |||
| 1699 | Ga0496107_0049341 | |||
| 1700 | Ga0496109_0092320 | |||
| 1701 | Ga0496109_0121867 | |||
| 1702 | Ga0496111_0001591 | |||
| 1703 | Ga0496112_0118605 | |||
| 1704 | Ga0496113_0014675 | |||
| 1705 | Ga0496114_0024143 | |||
| 1706 | Ga0496115_0000039 | |||
| 1707 | Ga0496115_0000093 | |||
| 1708 | Ga0496115_0000536 | |||
| 1709 | Ga0496115_0001494 | |||
| 1710 | Ga0496115_0002717 | |||
| 1711 | Ga0496115_0003431 | |||
| 1712 | Ga0496115_0025650 | |||
| 1713 | Ga0496115_0036799 | |||
| 1714 | Ga0496115_0055709 | |||
| 1715 | Ga0496116_0001420 | |||
| 1716 | Ga0496116_0046768 | |||
| 1717 | Ga0496117_0003165 | |||
| 1718 | Ga0496117_0011918 | |||
| 1719 | Ga0496117_0019931 | |||
| 1720 | Ga0496117_0036716 | |||
| 1721 | Ga0496117_0128254 | |||
| 1722 | Ga0496118_0000839 | |||
| 1723 | Ga0496118_0001054 | |||
| 1724 | Ga0496118_0001398 | |||
| 1725 | Ga0496118_0002911 | |||
| 1726 | Ga0496118_0004037 | |||
| 1727 | Ga0496118_0004710 | |||
| 1728 | Ga0496118_0004745 | |||
| 1729 | Ga0496118_0011125 | |||
| 1730 | Ga0496118_0011275 | |||
| 1731 | Ga0496119_0000109 | |||
| 1732 | Ga0496119_0000113 | |||
| 1733 | Ga0496119_0001179 | |||
| 1734 | Ga0496119_0010208 | |||
| 1735 | Ga0496119_0011481 | |||
| 1736 | Ga0496120_0000124 | |||
| 1737 | Ga0496120_0000150 | |||
| 1738 | Ga0496120_0000153 | |||
| 1739 | Ga0496120_0001436 | |||
| 1740 | Ga0496120_0002007 | |||
| 1741 | Ga0496121_0000013 | |||
| 1742 | Ga0496121_0000315 | |||
| 1743 | Ga0496121_0000431 | |||
| 1744 | Ga0496121_0000835 | |||
| 1745 | Ga0496121_0005286 | |||
| 1746 | Ga0496121_0019069 | |||
| 1747 | Ga0496121_0031077 | |||
| 1748 | Ga0496121_0042921 | |||
| 1749 | Ga0496121_0043996 | |||
| 1750 | Ga0496121_0065220 | |||
| 1751 | Ga0496121_0069824 | |||
| 1752 | Ga0496121_0212958 | |||
| 1753 | Ga0496122_0010526 | |||
| 1754 | Ga0496122_0011599 | |||
| 1755 | Ga0496122_0037432 | |||
| 1756 | Ga0496123_0005858 | |||
| 1757 | Ga0496123_0008297 | |||
| 1758 | Ga0496123_0012876 | |||
| 1759 | Ga0496124_0000352 | |||
| 1760 | Ga0496124_0027391 | |||
| 1761 | Ga0496125_0002272 | |||
| 1762 | Ga0496125_0003057 | |||
| 1763 | Ga0496125_0009071 | |||
| 1764 | Ga0496126_0000160 | |||
| 1765 | Ga0496126_0000240 | |||
| 1766 | Ga0496126_0000402 | |||
| 1767 | Ga0496126_0002206 | |||
| 1768 | Ga0496126_0002667 | |||
| 1769 | Ga0496126_0012393 | |||
| 1770 | Ga0496126_0027190 | |||
| 1771 | Ga0496126_0055042 | |||
| 1772 | Ga0496126_0137468 | |||
| 1773 | Ga0496126_0253660 | |||
| 1774 | Ga0495678_000002 | |||
| 1775 | Ga0495678_000023 | |||
| 1776 | Ga0495678_002129 | |||
| 1777 | Ga0495682_0000421 | |||
| 1778 | Ga0495682_0007067 | |||
| 1779 | Ga0495682_0017800 | |||
| 1780 | Ga0501031_0130088 | |||
| 1781 | Ga0501033_0007031 | |||
| 1782 | Ga0501033_0013648 | |||
| 1783 | Ga0501033_0210190 | |||
| 1784 | Ga0501034_0159472 | |||
| 1785 | Ga0501037_0023000 | |||
| 1786 | Ga0501038_0058700 | |||
| 1787 | Ga0501040_0002246 | |||
| 1788 | Ga0501041_0047649 | |||
| 1789 | Ga0501042_0001136 | |||
| 1790 | Ga0501043_0001313 | |||
| 1791 | Ga0501043_0020678 | |||
| 1792 | Ga0501043_0032432 | |||
| 1793 | Ga0501043_0197332 | |||
| 1794 | Ga0501043_0226788 | |||
| 1795 | Ga0501046_0078693 | |||
| 1796 | Ga0501047_0004739 | |||
| 1797 | Ga0501047_0020953 | |||
| 1798 | Ga0501047_0029969 | |||
| 1799 | Ga0501047_0080883 | |||
| 1800 | Ga0501047_0290158 | |||
| 1801 | Ga0501048_0021540 | |||
| 1802 | Ga0501069_0009473 | |||
| 1803 | Ga0501070_0009715 | |||
| 1804 | Ga0501070_0012575 | |||
| 1805 | Ga0501070_0021044 | |||
| 1806 | Ga0501071_0064386 | |||
| 1807 | Ga0501072_0003414 | |||
| 1808 | Ga0501074_0077551 | |||
| 1809 | Ga0501075_0008845 | |||
| 1810 | Ga0501075_0177916 | |||
| 1811 | Ga0501076_0000461 | |||
| 1812 | Ga0501077_0008499 | |||
| 1813 | Ga0501225_0009703 | |||
| 1814 | Ga0501080_0143596 | |||
| 1815 | Ga0501081_0000792 | |||
| 1816 | Ga0501035_0011692 | |||
| 1817 | Ga0501035_0027960 | |||
| 1818 | Ga0501035_0197196 | |||
| 1819 | Ga0501035_0310685 | |||
| 1820 | Ga0501044_0092832 | |||
| 1821 | Ga0501044_0109324 | |||
| 1822 | Ga0501044_0122000 | |||
| 1823 | Ga0501044_0122210 | |||
| 1824 | Ga0501044_0126704 | |||
| 1825 | Ga0501045_0012533 | |||
| 1826 | nmdc:mga0k408_17808_c1 | |||
| 1827 | nmdc:mga0k408_60005_c1 | |||
| 1828 | nmdc:mga0qj67_18257_c1 | |||
| 1829 | nmdc:mga0qj67_67497_c1 | |||
| 1830 | nmdc:mga06r32_28584_c1 | |||
| 1831 | nmdc:mga06r32_8112_c1 | |||
| 1832 | nmdc:mga0n895_125557_c1 | |||
| 1833 | nmdc:mga0n895_25296_c1 | |||
| 1834 | Ga0495601_0000006 | |||
| 1835 | Ga0495612_0041556 | |||
| 1836 | Ga0495595_0000006 | |||
| 1837 | Ga0495619_0000011 | |||
| 1838 | Ga0500643_000002 | |||
| 1839 | Ga0500556_0000407 | |||
| 1840 | Ga0500572_000662 | |||
| 1841 | Ga0500593_000156 | |||
| 1842 | Ga0500593_004183 | |||
| 1843 | Ga0500595_004307 | |||
| 1844 | Ga0500618_000065 | |||
| 1845 | Ga0500642_0040739 | |||
| 1846 | Ga0500652_020917 | |||
| 1847 | Ga0500559_0002081 | |||
| 1848 | Ga0500568_0000660 | |||
| 1849 | Ga0500616_0000070 | |||
| 1850 | Ga0500616_0074407 | |||
| 1851 | Ga0500633_0001136 | |||
| 1852 | Ga0500634_0000210 | |||
| 1853 | Ga0500636_0076683 | |||
| 1854 | Ga0500645_000191 | |||
| 1855 | Ga0501084_0007252 | |||
| 1856 | Ga0501084_0014305 | |||
| 1857 | Ga0501084_0160962 | |||
| 1858 | Ga0501082_0037943 | |||
| 1859 | Ga0501082_0167982 | |||
| 1860 | 2509370903 | |||
| 1861 | 2509397982 | |||
| 1862 | 2510316553 | |||
| 1863 | 2513891789 | |||
| 1864 | 2514033887 | |||
| 1865 | 2514587936 | |||
| 1866 | 2525557267 | |||
| 1867 | 2538833549 | |||
| 1868 | 2595446050 | |||
| 1869 | 2595448450 | |||
| 1870 | 2595449483 | |||
| 1871 | 2595452501 | |||
| 1872 | 2630648863 | |||
| 1873 | 2643755340 | |||
| 1874 | 2643773902 | |||
| 1875 | 2643829227 | |||
| 1876 | 2643895548 | |||
| 1877 | 2643993802 | |||
| 1878 | 2644477730 | |||
| 1879 | 2644529563 | |||
| 1880 | 2687581803 | |||
| 1881 | 2721027615 | |||
| 1882 | 2735836825 | |||
| 1883 | 2738713995 | |||
| 1884 | 2739226230 | |||
| 1885 | 2739730840 | |||
| 1886 | 2819562601 | |||
| 1887 | 2838058267 | |||
| 1888 | 2842713354 | |||
| 1889 | 2842916360 | |||
| 1890 | 2842918982 | |||
| 1891 | 2842921774 | |||
| 1892 | 2844015703 | |||
| 1893 | 2856337480 | |||
| 1894 | 2857368435 | |||
| 1895 | 2857550854 | |||
| 1896 | 2857561460 | |||
| 1897 | 2869241215 | |||
| 1898 | 2869250516 | |||
| 1899 | 2869262231 | |||
| 1900 | 2869265826 | |||
| 1901 | 2871440803 | |||
| 1902 | 2871463383 | |||
| 1903 | 2871483074 | |||
| 1904 | 2874110609 | |||
| 1905 | 2874123131 | |||
| 1906 | 2874138978 | |||
| 1907 | 2876387381 | |||
| 1908 | 2876423843 | |||
| 1909 | 2878734303 | |||
| 1910 | 2878784777 | |||
| 1911 | 2883071345 | |||
| 1912 | 2884340419 | |||
| 1913 | 2884412296 | |||
| 1914 | 2885194468 | |||
| 1915 | 2889311947 | |||
| 1916 | 2894417097 | |||
| 1917 | 2902335004 | |||
| 1918 | 2902409912 | |||
| 1919 | 2903517806 | |||
| 1920 | 2904424904 | |||
| 1921 | 2904463206 | |||
| 1922 | 2906365399 | |||
| 1923 | 2906375043 | |||
| 1924 | 2906400379 | |||
| 1925 | 2906406518 | |||
| 1926 | 2913040306 | |||
| 1927 | 2914761997 | |||
| 1928 | 2919085505 | |||
| 1929 | 2919405311 | |||
| 1930 | 2919406005 | |||
| 1931 | 2922156215 | |||
| 1932 | 2924738551 | |||
| 1933 | 2924743898 | |||
| 1934 | 2928964086 | |||
| 1935 | 2937867059 | |||
| 1936 | 2937869066 | |||
| 1937 | 2937987882 | |||
| 1938 | 2939614770 | |||
| 1939 | 2941475789 | |||
| 1940 | 2953994728 | |||
| 1941 | 2953997791 | |||
| 1942 | 2958110730 | |||
| 1943 | 2958125964 | |||
| 1944 | 2961184650 | |||
| 1945 | 2965040249 | |||
| 1946 | 2965040472 | |||
| 1947 | 2965089511 | |||
| 1948 | 2968143135 | |||
| 1949 | 2970494671 | |||
| 1950 | 2970514569 | |||
| 1951 | 2970535680 | |||
| 1952 | 2970621924 | |||
| 1953 | 2970633494 | |||
| 1954 | 2977857573 | |||
| 1955 | 2977874935 | |||
| 1956 | 2977898765 | |||
| 1957 | 2977915099 | |||
| 1958 | 2977920392 | |||
| 1959 | 2977954184 | |||
| 1960 | 2979765105 | |||
| 1961 | 2979776388 | |||
| 1962 | 2979793815 | |||
| 1963 | 2987675672 | |||
| 1964 | 2996391908 | |||
| 1965 | 3004171190 | |||
| 1966 | 3004175311 | |||
| 1967 | 3004202269 | |||
| 1968 | 3004233195 | |||
| 1969 | 3004240199 | |||
| 1970 | 3004250651 | |||
| 1971 | 3004270539 | |||
| 1972 | 3004342715 | |||
| 1973 | 8003014663 | |||
| 1974 | 8004314049 | |||
| 1975 | 8004366937 | |||
| 1976 | 8004697175 | |||
| 1977 | 8004734157 | |||
| 1978 | 8016590493 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF03720
UDPG_MGDP_dh_C
UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain
390
490
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cgs-assembly1.cif.gz_A | crystal endo-deglycosylated hydroxynitrile lyase isozyme 5 mutant l343f from prunus communis | 0.9552 | 9 | 34 |
| 6fjh-assembly1.cif.gz_B | crystal structure of the seleniated lkce from streptomyces rochei | 0.9067 | 6 | 38 |
| 6lum-assembly1.cif.gz_J | structure of mycobacterium smegmatis succinate dehydrogenase 2 | 0.9006 | 7 | 34 |
| 6f7l-assembly1.cif.gz_B | crystal structure of lkce r326q mutant in complex with its substrate | 0.8962 | 5 | 38 |
| 4r16-assembly1.cif.gz_B | structure of udp-d-mannac dehdrogeanse from pyrococcus horikoshii | 0.8933 | 8 | 422 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mfzC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9113 | 8 | 199 | 3.40.50.720 |
| af_Q58883_2_383_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9086 | 8 | 38 | 3.50.50.60 |
| af_A0A1D8PDW7_22_394_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9072 | 9 | 38 | 3.50.50.60 |
| 4xr9B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.903 | 1 | 198 | 3.40.50.720 |
| af_P27829_1_202_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8941 | 5 | 198 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5I2T1-F1-model_v4 | deleted | 1.001 | 7 | 87 |
|
| AF-Q04972-F1-model_v4 | UDP-N-acetyl-D-glucosamine 6-dehydrogenase (UDP-GlcNAc 6-dehydrogenase) (EC 1.1.1.136) (Vi polysaccharide biosynthesis protein VipA/TviB) (Vi polysaccharide synthesis gene A) | 0.9914 | 1 | 423 |
GO:0016616
GO:0016628 GO:0045227 GO:0051287 |
| AF-A0A3D2R019-F1-model_v4 | Vi polysaccharide biosynthesis protein VipA/TviB | 0.9914 | 2 | 214 |
GO:0000271
GO:0016616 GO:0016628 GO:0051287 |
| AF-A0A350BW87-F1-model_v4 | Vi polysaccharide biosynthesis protein VipA/TviB | 0.9912 | 2 | 187 |
GO:0000271
GO:0016616 GO:0016628 GO:0051287 |
| AF-A0A661HFG7-F1-model_v4 | Vi polysaccharide biosynthesis protein VipA/TviB | 0.9905 | 7 | 216 |
GO:0000271
GO:0016616 GO:0016628 GO:0051287 |