F487600

General Info

Members Datasets Scaffolds Average Seq Length
990 518 1978 429

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1014737|Ga0055524_10147371
Length 497
Sequence VXASCPGPRLRLVHQGDXGQCRPVVPSTNEYKTRMDTTEIGERLVHRADTGPRNTALRDAAAAAHGEPDIAALPTLETVRLGVVGLGYVGLPLAVAFGRRYDTVGFDINAQRVVELREGRDSTLEVDSVELAQAQRLRCSSDLGMLQRCNVYIVTVPTPIDAAKRPDLTPLIRASEALGQVLKRGDVVVYESTVYPGCTEEVCVPILERASGLVFNRDFFAGYSPERINPGDKEHRLTRILKITSGSTKRAADFVDALYASIIEAGTHKASSIKVAEAAKVIENTQRDLNIALVNDLAILFNKLGIDTLEVLQAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQEIGHHPDVILAGRRTNDGMGAYIASEVVRLMVRKGINPVQARILVLGLAFKENCPDLRNTRVVDIVHALRGYNAQVDVHDPWVNTNDAAHEYGLSTIEAPAHGDYDAVIVAVAHREFAQLGAEGVRAFGKPVSIVYDVKYVLPRDAVDGRL

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
94 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
111 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
392 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
401 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
407 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
408 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
409 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
410 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
411 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
412 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
413 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
414 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
415 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
416 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
417 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
418 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
419 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
420 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
421 2643221596 Acidovorax sp. Root70 Isolate Unclassified
422 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
423 2643221695 Lysobacter sp. Root494 Isolate Unclassified
424 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
425 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
426 2734482264 Dyella sp. AD052 Isolate Unclassified
427 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
428 2738543009 Luteibacter sp. OK325 Isolate Unclassified
429 2739367700 Dyella sp. YR388 Isolate Unclassified
430 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
431 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
432 2842711865 Duganella sp. R-73148 Isolate Unclassified
433 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
434 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
435 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
436 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
437 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
438 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
439 2857558681 Duganella sp. R-74565 Isolate Unclassified
440 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
441 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
442 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
443 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
444 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
445 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
446 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
447 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
448 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
449 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
450 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
451 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
452 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
453 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
454 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
455 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
456 2884411467 Dyella sp. AD56 Isolate Rhizosphere
457 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
458 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
459 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
460 2902330777 Methylobacterium sp. 2A Isolate Unclassified
461 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
462 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
463 2904424332 Duganella sp. 1411 Isolate Rhizosphere
464 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
465 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
466 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
467 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
468 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
469 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
470 2914759650 Rhizosphaericola mali Isolate Rhizosphere
471 2919085039 Luteibacter sp. 1214 Isolate Unclassified
472 2919404418 Luteibacter sp. 3190 Isolate Unclassified
473 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
474 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
475 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
476 2928963466 Dyella japonica 1073 Isolate Unclassified
477 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
478 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
479 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
480 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
481 2941471342 Luteibacter sp. 621 Isolate Unclassified
482 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
483 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
484 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
485 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
486 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
487 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
488 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
489 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
490 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
491 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
492 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
493 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
494 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
495 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
496 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
497 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
498 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
499 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
500 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
501 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
502 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
503 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
504 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
505 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
506 3004167301 Mesorhizobium loti 582 Isolate Unclassified
507 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
508 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
509 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
510 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
511 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
512 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
513 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
514 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
515 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
516 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
517 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
518 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.67
Metatranscriptomes 1.31
Isolates 12.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.16
Nodule 6.87
Rhizoplane 3.33
Rhizosphere 60.81
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1014737 3300003775 Bacteria 2882
2 JGI24740J21852_10010186 3300001979 Bacteria 3633
3 JGI24739J22299_10001078 3300001989 Bacteria 10168
4 JGI24737J22298_10002950 3300001990 Bacteria 6035
5 JGI24735J21928_10008777 3300002067 Bacteria 3261
6 JGI24735J21928_10012187 3300002067 Bacteria 2719
7 JGI24738J21930_10002735 3300002075 Bacteria 4536
8 JGI25156J39149_1009512 3300002705 Bacteria 2354
9 JGI25162J39368_1000345 3300002737 Bacteria 40115
10 JGI25162J39368_1000407 3300002737 Bacteria 35211
11 JGI25162J39368_1000444 3300002737 Bacteria 32899
12 JGI25162J39368_1000618 3300002737 Bacteria 25452
13 JGI25162J39368_1001758 3300002737 Bacteria 10323
14 JGI25162J39368_1002058 3300002737 Bacteria 8760
15 JGI25157J39369_1000244 3300002741 Bacteria 41534
16 JGI25157J39369_1000317 3300002741 Bacteria 34756
17 JGI25157J39369_1000651 3300002741 Bacteria 19348
18 JGI25157J39369_1004792 3300002741 Bacteria 2354
19 JGI25163J39215_1000267 3300002771 Bacteria 18439
20 JGI25164J39214_1000161 3300002772 Bacteria 63192
21 JGI25164J39214_1000187 3300002772 Bacteria 54560
22 JGI25164J39214_1000208 3300002772 Bacteria 49986
23 JGI25164J39214_1000267 3300002772 Bacteria 38724
24 JGI25164J39214_1000294 3300002772 Bacteria 34889
25 JGI25152J39213_1013407 3300002773 Bacteria 1711
26 JGI25159J45721_1011794 3300002987 Bacteria 2118
27 JGI25151J46595_10029573 3300003187 Bacteria 2167
28 JGI25165J46597_1000059 3300003214 Bacteria 211634
29 JGI25165J46597_1000338 3300003214 Bacteria 54560
30 JGI25165J46597_1000481 3300003214 Bacteria 38724
31 JGI25165J46597_1001019 3300003214 Bacteria 18478
32 JGI25165J46597_1001527 3300003214 Bacteria 11588
33 JGI25153J46596_10008324 3300003215 Bacteria 4977
34 JGI25153J46596_10013658 3300003215 Bacteria 3420
35 rootH2_10133574 3300003320 Bacteria 7098
36 Ga0006562J51391_1041114 3300003578 Bacteria 5280
37 Ga0006562J51391_1041115 3300003578 Bacteria 3660
38 Ga0055538_1001452 3300003751 Bacteria 4542
39 Ga0055539_1001152 3300003752 Bacteria 5413
40 Ga0055533_1004498 3300003756 Bacteria 2481
41 Ga0055527_1000076 3300003760 Bacteria 79882
42 Ga0055535_1000120 3300003761 Bacteria 84144
43 Ga0055535_1000129 3300003761 Bacteria 79882
44 Ga0055535_1000417 3300003761 Bacteria 40115
45 Ga0055535_1001441 3300003761 Bacteria 12078
46 Ga0055542_1000054 3300003762 Bacteria 171728
47 Ga0055542_1000173 3300003762 Bacteria 79882
48 Ga0055542_1000422 3300003762 Bacteria 40988
49 Ga0055542_1000435 3300003762 Bacteria 40115
50 Ga0055542_1000832 3300003762 Bacteria 22084
51 Ga0055529_1000110 3300003763 Bacteria 120255
52 Ga0055529_1000200 3300003763 Bacteria 79875
53 Ga0055529_1000370 3300003763 Bacteria 48537
54 Ga0055526_1000001 3300003771 Bacteria 669703
55 Ga0055536_1009583 3300003781 Bacteria 3979
56 Ga0055530_10011606 3300003791 Bacteria 3147
57 Ga0055531_10000048 3300003794 Bacteria 131142
58 Ga0055531_10004530 3300003794 Bacteria 8428
59 Ga0055531_10010223 3300003794 Bacteria 4692
60 Ga0055531_10013337 3300003794 Bacteria 3794
61 Ga0065165_1000118 3300005262 Bacteria 134488
62 Ga0065165_1000500 3300005262 Bacteria 60723
63 Ga0065165_1002313 3300005262 Bacteria 16672
64 Ga0065707_10000820 3300005295 Bacteria 12690
65 Ga0065707_10082453 3300005295 Bacteria 14996
66 Ga0070658_10063984 3300005327 Bacteria 3000
67 Ga0070658_10297727 3300005327 Bacteria 1375
68 Ga0070676_10073869 3300005328 Bacteria 2052
69 Ga0070690_100025671 3300005330 Bacteria 3628
70 Ga0070670_100079731 3300005331 Bacteria 2814
71 Ga0070666_10000012 3300005335 Bacteria 244720
72 Ga0070680_100012391 3300005336 Bacteria 6623
73 Ga0070680_100060257 3300005336 Bacteria 3106
74 Ga0070682_100005716 3300005337 Bacteria 6934
75 Ga0070660_100030087 3300005339 Bacteria 4071
76 Ga0070660_100155666 3300005339 Bacteria 1839
77 Ga0070689_100004062 3300005340 Bacteria 9851
78 Ga0070691_10007359 3300005341 Bacteria 5039
79 Ga0070661_100011510 3300005344 Bacteria 6161
80 Ga0070661_100058650 3300005344 Bacteria 2821
81 Ga0070661_100069480 3300005344 Bacteria 2589
82 Ga0070668_100017643 3300005347 Bacteria 5352
83 Ga0070669_100077717 3300005353 Bacteria 2466
84 Ga0070674_100075070 3300005356 Unclassified 2400
85 Ga0070659_100000104 3300005366 Bacteria 62137
86 Ga0070659_100214588 3300005366 Bacteria 1587
87 Ga0070667_100001691 3300005367 Bacteria 19735
88 Ga0070709_10004581 3300005434 Bacteria 7464
89 Ga0070714_100000161 3300005435 Bacteria 54480
90 Ga0070713_100006944 3300005436 Bacteria 7903
91 Ga0070713_100009016 3300005436 Bacteria 7111
92 Ga0070713_100011820 3300005436 Bacteria 6378
93 Ga0070663_100010008 3300005455 Bacteria 5896
94 Ga0070663_100016227 3300005455 Bacteria 4830
95 Ga0070663_100173363 3300005455 Bacteria 1669
96 Ga0070678_100034166 3300005456 Bacteria 3539
97 Ga0070662_100026274 3300005457 Bacteria 4031
98 Ga0070662_100172291 3300005457 Unclassified 1700
99 Ga0070681_10021952 3300005458 Bacteria 6404
100 Ga0070681_10025990 3300005458 Bacteria 5886
101 Ga0070681_10031834 3300005458 Bacteria 5294
102 Ga0070681_10077516 3300005458 Bacteria 3281
103 Ga0070685_10000392 3300005466 Bacteria 26188
104 Ga0070679_100027197 3300005530 Bacteria 5627
105 Ga0070679_100038412 3300005530 Bacteria 4760
106 Ga0070679_100077779 3300005530 Bacteria 3307
107 Ga0068853_100067544 3300005539 Bacteria 3106
108 Ga0068853_100152823 3300005539 Bacteria 2078
109 Ga0070696_100002057 3300005546 Bacteria 13192
110 Ga0070696_100041275 3300005546 Bacteria 3187
111 Ga0070696_100092240 3300005546 Bacteria 2158
112 Ga0070693_100048750 3300005547 Bacteria 2413
113 Ga0070665_100000393 3300005548 Bacteria 64556
114 Ga0070665_100006459 3300005548 Bacteria 11931
115 Ga0070665_100024783 3300005548 Bacteria 6044
116 Ga0070665_100071388 3300005548 Bacteria 3479
117 Ga0070665_100192984 3300005548 Bacteria 2037
118 Ga0068855_100007961 3300005563 Bacteria 12805
119 Ga0068855_100015348 3300005563 Bacteria 9221
120 Ga0068855_100030409 3300005563 Bacteria 6460
121 Ga0068855_100091163 3300005563 Bacteria 3516
122 Ga0070664_100010444 3300005564 Bacteria 7528
123 Ga0068857_100027102 3300005577 Bacteria 5055
124 Ga0068857_100036971 3300005577 Bacteria 4325
125 Ga0068854_100000481 3300005578 Bacteria 24413
126 Ga0068856_100053060 3300005614 Bacteria 3999
127 Ga0068856_100058515 3300005614 Bacteria 3806
128 Ga0068856_100096465 3300005614 Bacteria 2945
129 Ga0068856_100125511 3300005614 Bacteria 2569
130 Ga0068856_100231145 3300005614 Bacteria 1865
131 Ga0068852_100023243 3300005616 Bacteria 4986
132 Ga0068859_100192198 3300005617 Bacteria 2125
133 Ga0068851_10010458 3300005834 Bacteria 4334
134 Ga0068858_100002138 3300005842 Bacteria 20024
135 Ga0068858_100249697 3300005842 Bacteria 1685
136 Ga0068860_100011037 3300005843 Bacteria 8907
137 Ga0068860_100059764 3300005843 Bacteria 3623
138 Ga0068860_100081529 3300005843 Bacteria 3076
139 Ga0068862_100030607 3300005844 Bacteria 4537
140 Ga0068862_100047012 3300005844 Bacteria 3682
141 Ga0081455_10006552 3300005937 Bacteria 12459
142 Ga0081539_10000001 3300005985 Bacteria 808331
143 Ga0070717_10031172 3300006028 Bacteria 4287
144 Ga0075365_10036363 3300006038 Bacteria 3190
145 Ga0075366_10000683 3300006195 Bacteria 16043
146 Ga0075366_10014537 3300006195 Bacteria 4495
147 Ga0068871_100005293 3300006358 Bacteria 9035
148 Ga0075430_100039982 3300006846 Bacteria 3970
149 Ga0075431_100004249 3300006847 Bacteria 14032
150 Ga0075431_100016318 3300006847 Bacteria 7533
151 Ga0075434_100063191 3300006871 Bacteria 3685
152 Ga0075434_100171240 3300006871 Bacteria 2191
153 Ga0097620_100192192 3300006931 Bacteria 2125
154 Ga0105240_10000113 3300009093 Bacteria 168192
155 Ga0105240_10000162 3300009093 Bacteria 136882
156 Ga0105240_10000317 3300009093 Bacteria 91950
157 Ga0105240_10000671 3300009093 Bacteria 62794
158 Ga0105240_10000884 3300009093 Bacteria 53814
159 Ga0105240_10006881 3300009093 Bacteria 16617
160 Ga0105240_10019958 3300009093 Bacteria 8949
161 Ga0105240_10034519 3300009093 Bacteria 6523
162 Ga0105240_10048297 3300009093 Bacteria 5380
163 Ga0105245_10002275 3300009098 Bacteria 17377
164 Ga0105247_10014455 3300009101 Bacteria 4735
165 Ga0114129_10171546 3300009147 Bacteria 2957
166 Ga0105242_10115127 3300009176 Bacteria 2298
167 Ga0105248_10013719 3300009177 Bacteria 8921
168 Ga0105237_10025261 3300009545 Bacteria 6076
169 Ga0105237_10119323 3300009545 Bacteria 2631
170 Ga0105238_10000109 3300009551 Bacteria 90227
171 Ga0105238_10018954 3300009551 Bacteria 7008
172 Ga0105238_10018971 3300009551 Bacteria 7005
173 Ga0105238_10072762 3300009551 Bacteria 3432
174 Ga0105249_10037277 3300009553 Bacteria 4413
175 Ga0105249_10055644 3300009553 Bacteria 3620
176 Ga0105030_100140 3300009987 Bacteria 5808
177 Ga0105239_10000033 3300010375 Bacteria 223933
178 Ga0105239_10000034 3300010375 Bacteria 219430
179 Ga0105239_10000050 3300010375 Bacteria 173908
180 Ga0157347_1000199 3300012502 Bacteria 3365
181 Ga0157339_1000718 3300012505 Bacteria 1793
182 Ga0157373_10000162 3300013100 Bacteria 54140
183 Ga0157373_10001336 3300013100 Bacteria 18878
184 Ga0157373_10001753 3300013100 Bacteria 16501
185 Ga0157373_10085407 3300013100 Bacteria 2224
186 Ga0157371_10001241 3300013102 Bacteria 26989
187 Ga0157371_10001357 3300013102 Bacteria 25727
188 Ga0157371_10064239 3300013102 Bacteria 2601
189 Ga0157370_10001027 3300013104 Bacteria 35101
190 Ga0157370_10002298 3300013104 Bacteria 23155
191 Ga0157370_10002411 3300013104 Bacteria 22533
192 Ga0157370_10008231 3300013104 Bacteria 11261
193 Ga0157370_10053054 3300013104 Bacteria 3868
194 Ga0157369_10000551 3300013105 Bacteria 49137
195 Ga0157369_10004459 3300013105 Bacteria 16497
196 Ga0157369_10051107 3300013105 Bacteria 4474
197 Ga0157369_10055334 3300013105 Bacteria 4283
198 Ga0157369_10116000 3300013105 Bacteria 2844
199 Ga0163162_10000127 3300013306 Bacteria 68205
200 Ga0163162_10015245 3300013306 Bacteria 7507
201 Ga0157372_10000017 3300013307 Bacteria 219543
202 Ga0157372_10002252 3300013307 Bacteria 20929
203 Ga0157372_10083127 3300013307 Bacteria 3626
204 Ga0157372_10160695 3300013307 Bacteria 2596
205 Ga0157375_10089689 3300013308 Bacteria 3131
206 Ga0157514_110596 3300013874 Bacteria 1492
207 Ga0163163_10022696 3300014325 Bacteria 5947
208 Ga0182008_10000578 3300014497 Bacteria 27014
209 Ga0182008_10001780 3300014497 Bacteria 14102
210 Ga0182008_10009136 3300014497 Bacteria 5366
211 Ga0182008_10035270 3300014497 Bacteria 2506
212 Ga0157379_10003252 3300014968 Bacteria 13770
213 Ga0157376_10003915 3300014969 Bacteria 10294
214 Ga0157376_10012095 3300014969 Bacteria 6390
215 Ga0157376_10043986 3300014969 Bacteria 3668
216 Ga0182006_1000049 3300015261 Bacteria 184514
217 Ga0182006_1000187 3300015261 Bacteria 64670
218 Ga0182006_1000484 3300015261 Bacteria 31191
219 Ga0182006_1006110 3300015261 Bacteria 5631
220 Ga0182006_1025512 3300015261 Bacteria 2427
221 Ga0182007_10006519 3300015262 Bacteria 5006
222 Ga0182005_1000004 3300015265 Bacteria 609645
223 Ga0182005_1000432 3300015265 Bacteria 22210
224 Ga0182005_1002203 3300015265 Bacteria 7158
225 Ga0183369_1003 3300015685 Bacteria 726443
226 Ga0183368_1004 3300015687 Bacteria 1211761
227 Ga0163161_10001992 3300017792 Bacteria 14802
228 Ga0206349_1291601 3300020075 Bacteria 2483
229 Ga0206351_10745720 3300020077 Bacteria 4782
230 Ga0213874_10017938 3300021377 Bacteria 1906
231 Ga0213871_10003319 3300021441 Bacteria 3088
232 Ga0224712_10000382 3300022467 Bacteria 8596
233 Ga0224712_10034351 3300022467 Bacteria 1864
234 Ga0209760_100405 3300025207 Bacteria 10640
235 Ga0209784_100026 3300025224 Bacteria 371540
236 Ga0209566_102091 3300025225 Bacteria 4119
237 Ga0209674_100016 3300025226 Bacteria 696756
238 Ga0209674_100026 3300025226 Bacteria 490631
239 Ga0209674_100452 3300025226 Bacteria 18762
240 Ga0209674_100462 3300025226 Bacteria 17957
241 Ga0209674_100901 3300025226 Bacteria 9613
242 Ga0209672_100017 3300025228 Bacteria 514236
243 Ga0209672_100119 3300025228 Bacteria 85578
244 Ga0209672_100560 3300025228 Bacteria 19793
245 Ga0209672_101944 3300025228 Bacteria 5842
246 Ga0207427_100023 3300025231 Bacteria 439725
247 Ga0207427_100046 3300025231 Bacteria 240976
248 Ga0207427_100080 3300025231 Bacteria 144947
249 Ga0207427_100133 3300025231 Bacteria 92763
250 Ga0207427_100203 3300025231 Bacteria 54842
251 Ga0207427_101231 3300025231 Bacteria 9822
252 Ga0207427_104824 3300025231 Bacteria 2100
253 Ga0209437_100005 3300025233 Bacteria 1071596
254 Ga0209437_100015 3300025233 Bacteria 713457
255 Ga0209437_100039 3300025233 Bacteria 448321
256 Ga0209437_100132 3300025233 Bacteria 178495
257 Ga0209437_100264 3300025233 Bacteria 80794
258 Ga0209437_100344 3300025233 Bacteria 54936
259 Ga0209437_100956 3300025233 Bacteria 10604
260 Ga0209437_101178 3300025233 Bacteria 7735
261 Ga0209258_100038 3300025242 Bacteria 398959
262 Ga0209258_100043 3300025242 Bacteria 380685
263 Ga0209258_100045 3300025242 Bacteria 369941
264 Ga0209258_100430 3300025242 Bacteria 48595
265 Ga0209258_101101 3300025242 Bacteria 11491
266 Ga0209646_1001454 3300025246 Bacteria 6325
267 Ga0209026_1000047 3300025250 Bacteria 261867
268 Ga0209026_1000270 3300025250 Bacteria 62482
269 Ga0209026_1000283 3300025250 Bacteria 58367
270 Ga0209026_1000544 3300025250 Bacteria 25922
271 Ga0209026_1001541 3300025250 Bacteria 10001
272 Ga0209677_103534 3300025253 Bacteria 4990
273 Ga0209148_1000002 3300025254 Bacteria 2399500
274 Ga0209148_1000009 3300025254 Bacteria 1395625
275 Ga0209148_1000010 3300025254 Bacteria 1265567
276 Ga0209148_1000052 3300025254 Bacteria 399449
277 Ga0209148_1000125 3300025254 Bacteria 184380
278 Ga0209148_1000856 3300025254 Bacteria 21337
279 Ga0209148_1000860 3300025254 Bacteria 21250
280 Ga0209759_1000124 3300025256 Bacteria 135714
281 Ga0209759_1000715 3300025256 Bacteria 29291
282 Ga0209759_1002933 3300025256 Bacteria 7129
283 Ga0209129_1000380 3300025258 Bacteria 35908
284 Ga0209129_1000419 3300025258 Bacteria 32732
285 Ga0209129_1003465 3300025258 Bacteria 6840
286 Ga0209233_1000009 3300025261 Bacteria 1265567
287 Ga0209233_1000011 3300025261 Bacteria 1071611
288 Ga0209233_1000090 3300025261 Bacteria 315680
289 Ga0209233_1000114 3300025261 Bacteria 246083
290 Ga0209233_1000270 3300025261 Bacteria 73977
291 Ga0209233_1000635 3300025261 Bacteria 17525
292 Ga0209233_1009777 3300025261 Bacteria 2904
293 Ga0209233_1014140 3300025261 Bacteria 2259
294 Ga0209455_1000020 3300025272 Bacteria 702259
295 Ga0209455_1000032 3300025272 Bacteria 514243
296 Ga0209455_1000077 3300025272 Bacteria 279165
297 Ga0209455_1002311 3300025272 Bacteria 7469
298 Ga0209455_1005606 3300025272 Bacteria 3847
299 Ga0209673_1002585 3300025273 Bacteria 12247
300 Ga0209130_1000739 3300025284 Bacteria 28635
301 Ga0209675_1003089 3300025291 Bacteria 8134
302 Ga0209675_1008310 3300025291 Bacteria 3836
303 Ga0209675_1015020 3300025291 Bacteria 2323
304 Ga0209676_1000652 3300025292 Bacteria 49719
305 Ga0209676_1002221 3300025292 Bacteria 14420
306 Ga0209676_1002767 3300025292 Bacteria 11714
307 Ga0209676_1003961 3300025292 Bacteria 8559
308 Ga0209676_1007785 3300025292 Bacteria 4933
309 Ga0209676_1025631 3300025292 Bacteria 1888
310 Ga0209025_1000739 3300025294 Bacteria 55161
311 Ga0209025_1016330 3300025294 Bacteria 4392
312 Ga0209564_1000002 3300025295 Bacteria 1636803
313 Ga0209758_1000264 3300025297 Bacteria 104107
314 Ga0209758_1001407 3300025297 Bacteria 28504
315 Ga0209758_1002634 3300025297 Bacteria 17817
316 Ga0209758_1013988 3300025297 Bacteria 4314
317 Ga0209050_1001726 3300025298 Bacteria 21753
318 Ga0209050_1002010 3300025298 Bacteria 18995
319 Ga0209050_1020151 3300025298 Bacteria 2494
320 Ga0209256_1001138 3300025299 Bacteria 30304
321 Ga0209256_1002995 3300025299 Bacteria 12553
322 Ga0209256_1015530 3300025299 Bacteria 2655
323 Ga0207426_1016466 3300025302 Bacteria 2654
324 Ga0209051_1005447 3300025303 Bacteria 7435
325 Ga0209051_1008459 3300025303 Bacteria 5444
326 Ga0209051_1021347 3300025303 Bacteria 2761
327 Ga0209257_1000007 3300025304 Bacteria 1564415
328 Ga0209257_1000243 3300025304 Bacteria 126291
329 Ga0209257_1000580 3300025304 Bacteria 61573
330 Ga0209257_1001540 3300025304 Bacteria 26823
331 Ga0209257_1003478 3300025304 Bacteria 13447
332 Ga0207680_10000013 3300025903 Bacteria 244716
333 Ga0207647_10000714 3300025904 Bacteria 26070
334 Ga0207647_10001141 3300025904 Bacteria 20417
335 Ga0207647_10003186 3300025904 Bacteria 12303
336 Ga0207647_10009780 3300025904 Bacteria 6801
337 Ga0207647_10041541 3300025904 Bacteria 2891
338 Ga0207705_10013087 3300025909 Bacteria 5987
339 Ga0207705_10046018 3300025909 Bacteria 3135
340 Ga0207705_10097740 3300025909 Bacteria 2157
341 Ga0207705_10174355 3300025909 Bacteria 1620
342 Ga0207707_10006788 3300025912 Bacteria 9989
343 Ga0207707_10021887 3300025912 Bacteria 5589
344 Ga0207707_10029550 3300025912 Bacteria 4793
345 Ga0207707_10059138 3300025912 Bacteria 3335
346 Ga0207695_10000198 3300025913 Bacteria 167880
347 Ga0207695_10000219 3300025913 Bacteria 153492
348 Ga0207695_10000322 3300025913 Bacteria 114700
349 Ga0207695_10000364 3300025913 Bacteria 103483
350 Ga0207695_10000874 3300025913 Bacteria 54860
351 Ga0207695_10000876 3300025913 Bacteria 54758
352 Ga0207695_10002095 3300025913 Bacteria 30360
353 Ga0207695_10002325 3300025913 Bacteria 28342
354 Ga0207695_10004297 3300025913 Bacteria 19525
355 Ga0207695_10005620 3300025913 Bacteria 16569
356 Ga0207695_10014125 3300025913 Bacteria 9478
357 Ga0207695_10031434 3300025913 Bacteria 5822
358 Ga0207695_10155805 3300025913 Bacteria 2219
359 Ga0207695_10185364 3300025913 Bacteria 2000
360 Ga0207671_10019774 3300025914 Bacteria 5141
361 Ga0207671_10076460 3300025914 Bacteria 2505
362 Ga0207671_10138368 3300025914 Bacteria 1874
363 Ga0207693_10035737 3300025915 Bacteria 3917
364 Ga0207693_10039576 3300025915 Bacteria 3713
365 Ga0207660_10056724 3300025917 Bacteria 2803
366 Ga0207660_10209474 3300025917 Bacteria 1526
367 Ga0207657_10007998 3300025919 Bacteria 10778
368 Ga0207657_10071270 3300025919 Bacteria 2943
369 Ga0207649_10012369 3300025920 Bacteria 4733
370 Ga0207652_10058476 3300025921 Bacteria 3322
371 Ga0207652_10119292 3300025921 Bacteria 2346
372 Ga0207694_10000398 3300025924 Bacteria 40446
373 Ga0207694_10000556 3300025924 Bacteria 33826
374 Ga0207694_10030229 3300025924 Bacteria 4136
375 Ga0207694_10053390 3300025924 Bacteria 3134
376 Ga0207694_10062967 3300025924 Bacteria 2889
377 Ga0207694_10095222 3300025924 Bacteria 2353
378 Ga0207694_10138514 3300025924 Bacteria 1956
379 Ga0207650_10021868 3300025925 Bacteria 4525
380 Ga0207650_10039828 3300025925 Bacteria 3435
381 Ga0207687_10071147 3300025927 Bacteria 2485
382 Ga0207700_10149076 3300025928 Bacteria 1931
383 Ga0207664_10000109 3300025929 Bacteria 72701
384 Ga0207664_10171759 3300025929 Bacteria 1856
385 Ga0207690_10000252 3300025932 Bacteria 38986
386 Ga0207690_10009148 3300025932 Bacteria 5879
387 Ga0207690_10028029 3300025932 Bacteria 3565
388 Ga0207706_10012378 3300025933 Bacteria 7770
389 Ga0207706_10025710 3300025933 Bacteria 5274
390 Ga0207686_10051324 3300025934 Bacteria 2569
391 Ga0207709_10139473 3300025935 Bacteria 1664
392 Ga0207670_10003972 3300025936 Bacteria 7896
393 Ga0207704_10087033 3300025938 Bacteria 2039
394 Ga0207665_10005858 3300025939 Bacteria 8177
395 Ga0207711_10008233 3300025941 Bacteria 8730
396 Ga0207679_10003789 3300025945 Bacteria 9371
397 Ga0207667_10000195 3300025949 Bacteria 88237
398 Ga0207667_10000406 3300025949 Bacteria 58424
399 Ga0207667_10000752 3300025949 Bacteria 42064
400 Ga0207667_10001181 3300025949 Bacteria 32820
401 Ga0207667_10135157 3300025949 Bacteria 2539
402 Ga0207667_10223402 3300025949 Bacteria 1929
403 Ga0207712_10035528 3300025961 Bacteria 3387
404 Ga0207712_10109894 3300025961 Bacteria 2066
405 Ga0207668_10063996 3300025972 Bacteria 2597
406 Ga0207640_10000025 3300025981 Bacteria 143903
407 Ga0207640_10000275 3300025981 Bacteria 34681
408 Ga0207640_10002524 3300025981 Bacteria 9809
409 Ga0207658_10114014 3300025986 Bacteria 2142
410 Ga0207703_10073426 3300026035 Bacteria 2830
411 Ga0207639_10000948 3300026041 Bacteria 19653
412 Ga0207639_10084484 3300026041 Bacteria 2522
413 Ga0207678_10015564 3300026067 Bacteria 6688
414 Ga0207702_10028222 3300026078 Bacteria 4663
415 Ga0207702_10278293 3300026078 Bacteria 1581
416 Ga0207674_10007294 3300026116 Bacteria 12889
417 Ga0207674_10031038 3300026116 Bacteria 5616
418 Ga0207674_10187386 3300026116 Bacteria 2019
419 Ga0207674_10228512 3300026116 Bacteria 1809
420 Ga0207675_100075125 3300026118 Bacteria 3163
421 Ga0209179_1000594 3300027512 Bacteria 3805
422 Ga0268266_10000021 3300028379 Bacteria 522453
423 Ga0268266_10000532 3300028379 Bacteria 53266
424 Ga0268266_10004337 3300028379 Bacteria 13631
425 Ga0268266_10018195 3300028379 Bacteria 5991
426 Ga0268265_10049937 3300028380 Bacteria 3149
427 Ga0268264_10039462 3300028381 Bacteria 3901
428 Ga0307515_10034644 3300028794 Bacteria 8251
429 Ga0265338_10009114 3300028800 Bacteria 11922
430 Ga0265338_10076126 3300028800 Bacteria 2844
431 Ga0265338_10222229 3300028800 Bacteria 1410
432 Ga0265330_10013639 3300031235 Bacteria 3785
433 Ga0265332_10007639 3300031238 Bacteria 4885
434 Ga0265328_10015580 3300031239 Bacteria 2974
435 Ga0265325_10038429 3300031241 Bacteria 2526
436 Ga0265331_10010281 3300031250 Bacteria 5187
437 Ga0307509_10082704 3300031507 Bacteria 3312
438 Ga0307408_100022881 3300031548 Bacteria 4252
439 Ga0307408_100110622 3300031548 Bacteria 2110
440 Ga0307408_100196070 3300031548 Bacteria 1631
441 Ga0265313_10013795 3300031595 Bacteria 4819
442 Ga0307508_10001382 3300031616 Bacteria 27344
443 Ga0307508_10014707 3300031616 Bacteria 7136
444 Ga0265342_10000309 3300031712 Bacteria 55309
445 Ga0265342_10000954 3300031712 Bacteria 28791
446 Ga0316576_10000401 3300031727 Bacteria 19976
447 Ga0316578_10000603 3300031728 Bacteria 12562
448 Ga0316578_10007507 3300031728 Bacteria 5475
449 Ga0316578_10110381 3300031728 Bacteria 1652
450 Ga0307516_10000012 3300031730 Bacteria 224120
451 Ga0307516_10000127 3300031730 Bacteria 90180
452 Ga0307405_10043830 3300031731 Bacteria 2732
453 Ga0307405_10145780 3300031731 Bacteria 1658
454 Ga0307413_10000993 3300031824 Bacteria 10213
455 Ga0307413_10023835 3300031824 Bacteria 3323
456 Ga0307413_10091242 3300031824 Bacteria 1984
457 Ga0307410_10020854 3300031852 Bacteria 4019
458 Ga0307410_10221311 3300031852 Bacteria 1456
459 Ga0307412_10001913 3300031911 Bacteria 11501
460 Ga0307412_10002808 3300031911 Bacteria 9666
461 Ga0307412_10053213 3300031911 Bacteria 2683
462 Ga0307412_10073288 3300031911 Bacteria 2342
463 Ga0307412_10100328 3300031911 Bacteria 2046
464 Ga0307409_100017567 3300031995 Bacteria 4774
465 Ga0307416_100001542 3300032002 Bacteria 12596
466 Ga0307416_100003400 3300032002 Bacteria 9335
467 Ga0307416_100057026 3300032002 Bacteria 3157
468 Ga0307414_10037573 3300032004 Bacteria 3244
469 Ga0307414_10063163 3300032004 Bacteria 2631
470 Ga0307411_10030914 3300032005 Bacteria 3288
471 Ga0307411_10099087 3300032005 Bacteria 2056
472 Ga0307415_100031012 3300032126 Bacteria 3439
473 Ga0316593_10002230 3300032168 Bacteria 4542
474 Ga0316593_10014225 3300032168 Bacteria 2369
475 Ga0307510_10023623 3300033180 Bacteria 7122
476 Ga0307510_10064118 3300033180 Bacteria 3734
477 Ga0316592_1011766 3300033524 Bacteria 1785
478 Ga0316588_1000533 3300033528 Bacteria 5282
479 Ga0316588_1011693 3300033528 Bacteria 1877
480 Ga0316588_1011956 3300033528 Bacteria 1861
481 Ga0316596_1010361 3300033541 Bacteria 2253
482 Ga0373944_0010269 3300035089 Bacteria 2550
483 Ga0373923_0005804 3300035111 Bacteria 4215
484 Ga0373936_0000250 3300035113 Bacteria 17785
485 Ga0373954_0018589 3300035118 Bacteria 3130
486 Ga0373956_0041166 3300035119 Bacteria 2051
487 Ga0373943_0007700 3300035170 Bacteria 4838
488 Ga0373946_0013254 3300035171 Bacteria 3096
489 Ga0373955_0012798 3300035172 Bacteria 4042
490 Ga0373935_0000277 3300035692 Bacteria 25244
491 Ga0373927_0003700 3300035695 Bacteria 10879
492 Ga0373933_0031207 3300035724 Bacteria 3091
493 Ga0373947_0002129 3300035725 Bacteria 12052
494 Ga0373937_0001170 3300036401 Bacteria 22036
495 Ga0316582_0038484 3300036647 Bacteria 2973
496 Ga0316584_0003979 3300036712 Bacteria 9721
497 Ga0373925_0000617 3300037068 Bacteria 33983
498 Ga0395899_0000046 3300037312 Bacteria 242486
499 Ga0395899_0000328 3300037312 Bacteria 60257
500 Ga0395899_0015649 3300037312 Bacteria 5784
501 Ga0395899_0025450 3300037312 Bacteria 4468
502 Ga0395899_0041577 3300037312 Bacteria 3435
503 Ga0395899_0084053 3300037312 Bacteria 2314
504 Ga0395900_0000034 3300037418 Bacteria 258846
505 Ga0395900_0000487 3300037418 Bacteria 56286
506 Ga0395900_0015814 3300037418 Bacteria 7690
507 Ga0395900_0055750 3300037418 Bacteria 4069
508 Ga0395900_0085141 3300037418 Bacteria 3249
509 Ga0395898_0000081 3300037466 Bacteria 242472
510 Ga0395898_0000835 3300037466 Bacteria 51046
511 Ga0395898_0005081 3300037466 Bacteria 14264
512 Ga0395898_0027720 3300037466 Bacteria 5680
513 Ga0395905_0000165 3300037471 Bacteria 109385
514 Ga0395905_0006346 3300037471 Bacteria 11914
515 Ga0395905_0034782 3300037471 Bacteria 4731
516 Ga0395905_0080441 3300037471 Bacteria 3054
517 Ga0395901_0000726 3300038443 Bacteria 37460
518 Ga0395901_0003055 3300038443 Bacteria 16853
519 Ga0395901_0005078 3300038443 Bacteria 13288
520 Ga0395901_0008198 3300038443 Bacteria 10557
521 Ga0395901_0051802 3300038443 Bacteria 4267
522 Ga0436365_0936435 3300039437 Bacteria 4766
523 Ga0436360_0314901 3300039438 Bacteria 5665
524 Ga0436360_0654994 3300039438 Bacteria 8074
525 Ga0436361_0556854 3300039447 Bacteria 2929
526 Ga0436363_1195502 3300039450 Bacteria 19945
527 Ga0436363_1357513 3300039450 Bacteria 4996
528 Ga0436362_0573719 3300039453 Bacteria 4899
529 Ga0439436_0000018 3300041404 Bacteria 71411
530 Ga0439436_0000061 3300041404 Bacteria 30168
531 Ga0439436_0014989 3300041404 Bacteria 2334
532 Ga0439465_0004527 3300041413 Bacteria 4494
533 Ga0451793_1604110 3300041452 Bacteria 1973
534 Ga0451807_0603001 3300041486 Bacteria 1472
535 Ga0439449_0000693 3300042007 Bacteria 12863
536 Ga0450896_001311 3300042133 Bacteria 3020
537 Ga0439446_0008934 3300042156 Bacteria 2672
538 Ga0450908_000052 3300042184 Bacteria 23279
539 Ga0450908_001644 3300042184 Bacteria 4353
540 Ga0439459_0001958 3300042438 Bacteria 3128
541 Ga0451577_0007968 3300042876 Bacteria 10343
542 Ga0451577_0016590 3300042876 Bacteria 6815
543 Ga0466969_0017713 3300044656 Bacteria 3716
544 Ga0466969_0028211 3300044656 Bacteria 2870
545 Ga0466969_0033434 3300044656 Bacteria 2610
546 Ga0466982_0000025 3300044672 Bacteria 74149
547 Ga0466982_0000056 3300044672 Bacteria 30789
548 Ga0453683_0018983 3300044673 Bacteria 4410
549 Ga0466966_0004819 3300044684 Bacteria 8871
550 Ga0466966_0008441 3300044684 Bacteria 6818
551 Ga0466966_0013196 3300044684 Bacteria 5471
552 Ga0466966_0065099 3300044684 Bacteria 2293
553 Ga0466961_0001433 3300044693 Bacteria 14798
554 Ga0466961_0004989 3300044693 Bacteria 8343
555 Ga0466961_0013131 3300044693 Bacteria 5298
556 Ga0466961_0016649 3300044693 Bacteria 4726
557 Ga0466961_0036641 3300044693 Bacteria 3148
558 Ga0466961_0061672 3300044693 Bacteria 2383
559 Ga0466961_0076095 3300044693 Bacteria 2127
560 Ga0466963_0048715 3300044694 Bacteria 2801
561 Ga0453684_0000046 3300044712 Bacteria 575242
562 Ga0453684_0193403 3300044712 Bacteria 2378
563 Ga0466971_0000694 3300044719 Bacteria 13464
564 Ga0466970_0081026 3300044765 Bacteria 1754
565 Ga0466957_0001623 3300044842 Bacteria 11789
566 Ga0466957_0065450 3300044842 Bacteria 2239
567 Ga0466959_0021363 3300045049 Bacteria 4773
568 Ga0466959_0042078 3300045049 Bacteria 3370
569 Ga0466959_0052113 3300045049 Bacteria 2998
570 Ga0466959_0132351 3300045049 Bacteria 1767
571 Ga0451576_0008271 3300045051 Bacteria 12232
572 Ga0451576_0036117 3300045051 Bacteria 5241
573 Ga0451576_0190066 3300045051 Bacteria 2144
574 Ga0466958_0091361 3300045836 Bacteria 1884
575 Ga0466967_0138591 3300045976 Bacteria 2264
576 Ga0495617_000019 3300046452 Bacteria 247938
577 Ga0495617_000865 3300046452 Bacteria 14315
578 Ga0495592_0000377 3300046454 Bacteria 35161
579 Ga0495590_0000002 3300046457 Bacteria 485720
580 Ga0495638_0000030 3300046460 Bacteria 318183
581 Ga0495638_0000069 3300046460 Bacteria 167503
582 Ga0495638_0000280 3300046460 Bacteria 68240
583 Ga0495638_0000311 3300046460 Bacteria 62620
584 Ga0495638_0001085 3300046460 Bacteria 26487
585 Ga0495653_0000027 3300046463 Bacteria 154096
586 Ga0495650_0000061 3300046471 Bacteria 283347
587 Ga0495650_0000501 3300046471 Bacteria 59165
588 Ga0495650_0000920 3300046471 Bacteria 34562
589 Ga0495650_0001244 3300046471 Bacteria 26410
590 Ga0495662_0011796 3300046476 Bacteria 4269
591 Ga0495584_0001702 3300046491 Bacteria 12894
592 Ga0495585_0000001 3300046492 Bacteria 609804
593 Ga0495585_0016990 3300046492 Bacteria 4213
594 Ga0495607_0000003 3300046501 Bacteria 366900
595 Ga0495607_0001172 3300046501 Bacteria 23725
596 Ga0495607_0001827 3300046501 Bacteria 18144
597 Ga0495607_0024313 3300046501 Bacteria 3779
598 Ga0495583_0000058 3300046506 Bacteria 200120
599 Ga0495583_0006205 3300046506 Bacteria 7866
600 Ga0495606_0000050 3300046507 Bacteria 203375
601 Ga0495606_0000097 3300046507 Bacteria 151339
602 Ga0495606_0000105 3300046507 Bacteria 143363
603 Ga0495606_0001098 3300046507 Bacteria 38718
604 Ga0495606_0001776 3300046507 Bacteria 27602
605 Ga0495606_0004944 3300046507 Bacteria 13018
606 Ga0495606_0014678 3300046507 Bacteria 6092
607 Ga0495606_0020249 3300046507 Bacteria 4913
608 Ga0495608_0000135 3300046511 Bacteria 53120
609 Ga0495610_0000380 3300046512 Bacteria 45916
610 Ga0495610_0000537 3300046512 Bacteria 38080
611 Ga0495610_0032907 3300046512 Bacteria 2687
612 Ga0495610_0039710 3300046512 Bacteria 2377
613 Ga0495616_0000001 3300046513 Bacteria 780061
614 Ga0495618_0000052 3300046514 Bacteria 85440
615 Ga0495620_0031578 3300046515 Bacteria 2425
616 Ga0495628_0000005 3300046516 Bacteria 420969
617 Ga0495630_0009097 3300046517 Bacteria 7139
618 Ga0495631_0000033 3300046518 Bacteria 84703
619 Ga0495631_0000205 3300046518 Bacteria 40628
620 Ga0495632_0000003 3300046519 Bacteria 396071
621 Ga0495632_0000120 3300046519 Bacteria 80853
622 Ga0495632_0004636 3300046519 Bacteria 9298
623 Ga0495643_0000078 3300046522 Bacteria 162974
624 Ga0495648_0000009 3300046524 Bacteria 317193
625 Ga0495648_0000083 3300046524 Bacteria 121164
626 Ga0495648_0045343 3300046524 Bacteria 2735
627 Ga0495663_0047254 3300046525 Bacteria 1325
628 Ga0495652_0000001 3300046529 Bacteria 1045081
629 Ga0495640_0000035 3300046533 Bacteria 73471
630 Ga0495587_0000012 3300046536 Bacteria 197088
631 Ga0495609_0000590 3300046538 Bacteria 28522
632 Ga0495609_0004654 3300046538 Bacteria 7445
633 Ga0495597_0000014 3300046542 Bacteria 177043
634 Ga0495645_0000014 3300046543 Bacteria 172712
635 Ga0495633_0000041 3300046558 Bacteria 176298
636 Ga0495667_0000001 3300046559 Bacteria 834831
637 Ga0495668_0000750 3300046616 Bacteria 38415
638 Ga0495668_0004788 3300046616 Bacteria 9437
639 Ga0495668_0005286 3300046616 Bacteria 8829
640 Ga0495668_0008417 3300046616 Bacteria 6446
641 Ga0495634_0000412 3300046642 Bacteria 42303
642 Ga0495611_0000001 3300046648 Bacteria 2628469
643 Ga0495611_0000008 3300046648 Bacteria 218134
644 Ga0495625_0000001 3300046660 Bacteria 1641829
645 Ga0495625_0000023 3300046660 Bacteria 274067
646 Ga0495625_0002867 3300046660 Bacteria 18070
647 Ga0495625_0005892 3300046660 Bacteria 11034
648 Ga0495625_0008485 3300046660 Bacteria 8764
649 Ga0495625_0041568 3300046660 Bacteria 3346
650 Ga0495625_0053433 3300046660 Bacteria 2889
651 Ga0495635_0000007 3300046663 Bacteria 278786
652 Ga0495661_0000672 3300046665 Bacteria 34212
653 Ga0495657_0000727 3300046675 Bacteria 29568
654 Ga0495599_0000002 3300046678 Bacteria 348168
655 Ga0495623_0000316 3300046679 Bacteria 31267
656 Ga0495646_0000133 3300046680 Bacteria 37629
657 Ga0495669_0000385 3300046684 Bacteria 22116
658 Ga0495669_0002242 3300046684 Bacteria 7930
659 Ga0495613_0019436 3300046689 Bacteria 5062
660 Ga0495670_0000407 3300046691 Bacteria 20550
661 Ga0495670_0008258 3300046691 Bacteria 5120
662 Ga0495670_0008842 3300046691 Bacteria 4954
663 Ga0495671_0000208 3300046692 Bacteria 51612
664 Ga0495649_0007164 3300046694 Bacteria 6848
665 Ga0495649_0008003 3300046694 Bacteria 6389
666 Ga0495649_0020260 3300046694 Bacteria 3731
667 Ga0495649_0037147 3300046694 Bacteria 2674
668 Ga0495589_0000446 3300046794 Bacteria 30389
669 Ga0495600_0000199 3300046809 Bacteria 34659
670 Ga0495660_0000008 3300046810 Bacteria 435769
671 Ga0495660_0000009 3300046810 Bacteria 427395
672 Ga0495660_0000159 3300046810 Bacteria 73231
673 Ga0495604_0000007 3300047317 Bacteria 412174
674 Ga0495674_0000001 3300047319 Bacteria 778665
675 Ga0495672_0116464 3300047320 Bacteria 1427
676 Ga0495680_0001769 3300047322 Bacteria 22885
677 Ga0495683_0000922 3300047323 Bacteria 20737
678 Ga0495687_014320 3300047443 Bacteria 4087
679 Ga0495687_014376 3300047443 Bacteria 4078
680 Ga0495675_0000539 3300047444 Bacteria 24523
681 Ga0495679_000001 3300047446 Bacteria 1607568
682 Ga0495673_0000001 3300047469 Bacteria 1630730
683 Ga0495673_0000030 3300047469 Bacteria 468915
684 Ga0495673_0002990 3300047469 Bacteria 11388
685 Ga0495681_0007223 3300047470 Bacteria 7139
686 Ga0495684_0000027 3300047471 Bacteria 124367
687 Ga0495686_0000019 3300047472 Bacteria 434054
688 Ga0495686_0000077 3300047472 Bacteria 205924
689 Ga0495686_0002878 3300047472 Bacteria 15459
690 Ga0495686_0011038 3300047472 Bacteria 6390
691 Ga0495686_0015188 3300047472 Bacteria 5270
692 Ga0495686_0027117 3300047472 Bacteria 3742
693 Ga0495593_0001637 3300047673 Bacteria 13262
694 Ga0495602_0000004 3300048088 Bacteria 326932
695 Ga0496100_0004314 3300048903 Bacteria 7528
696 Ga0496100_0202266 3300048903 Bacteria 1448
697 Ga0496101_0001940 3300048904 Bacteria 12527
698 Ga0496101_0007629 3300048904 Bacteria 7025
699 Ga0496101_0175731 3300048904 Bacteria 1647
700 Ga0496102_0004747 3300048905 Bacteria 11504
701 Ga0496102_0182089 3300048905 Bacteria 1980
702 Ga0496104_0005865 3300048907 Bacteria 10762
703 Ga0496105_0012174 3300048908 Bacteria 6810
704 Ga0496105_0014752 3300048908 Bacteria 6221
705 Ga0496105_0029955 3300048908 Bacteria 4456
706 Ga0496105_0038223 3300048908 Bacteria 3953
707 Ga0496106_0002177 3300048909 Bacteria 14641
708 Ga0496106_0265537 3300048909 Bacteria 1374
709 Ga0496107_0044077 3300048910 Bacteria 3207
710 Ga0496107_0049341 3300048910 Bacteria 3033
711 Ga0496109_0092320 3300048912 Bacteria 2800
712 Ga0496109_0121867 3300048912 Bacteria 2430
713 Ga0496111_0001591 3300048914 Bacteria 13121
714 Ga0496112_0118605 3300048915 Bacteria 2616
715 Ga0496113_0014675 3300048916 Bacteria 5355
716 Ga0496114_0024143 3300048917 Bacteria 4962
717 Ga0496115_0000039 3300048918 Bacteria 124044
718 Ga0496115_0000093 3300048918 Bacteria 83222
719 Ga0496115_0000536 3300048918 Bacteria 29579
720 Ga0496115_0001494 3300048918 Bacteria 16789
721 Ga0496115_0002717 3300048918 Bacteria 12716
722 Ga0496115_0003431 3300048918 Bacteria 11384
723 Ga0496115_0025650 3300048918 Bacteria 4592
724 Ga0496115_0036799 3300048918 Bacteria 3876
725 Ga0496115_0055709 3300048918 Bacteria 3176
726 Ga0496116_0001420 3300048919 Bacteria 26933
727 Ga0496116_0046768 3300048919 Bacteria 2918
728 Ga0496117_0003165 3300048920 Bacteria 19567
729 Ga0496117_0011918 3300048920 Bacteria 7729
730 Ga0496117_0019931 3300048920 Bacteria 5487
731 Ga0496117_0036716 3300048920 Bacteria 3662
732 Ga0496117_0128254 3300048920 Bacteria 1543
733 Ga0496118_0000839 3300048921 Bacteria 48884
734 Ga0496118_0001054 3300048921 Bacteria 43006
735 Ga0496118_0001398 3300048921 Bacteria 36389
736 Ga0496118_0002911 3300048921 Bacteria 22252
737 Ga0496118_0004037 3300048921 Bacteria 17839
738 Ga0496118_0004710 3300048921 Bacteria 15973
739 Ga0496118_0004745 3300048921 Bacteria 15908
740 Ga0496118_0011125 3300048921 Bacteria 8819
741 Ga0496118_0011275 3300048921 Bacteria 8745
742 Ga0496119_0000109 3300048922 Bacteria 116054
743 Ga0496119_0000113 3300048922 Bacteria 114626
744 Ga0496119_0001179 3300048922 Bacteria 32759
745 Ga0496119_0010208 3300048922 Bacteria 7925
746 Ga0496119_0011481 3300048922 Bacteria 7325
747 Ga0496120_0000124 3300048923 Bacteria 129191
748 Ga0496120_0000150 3300048923 Bacteria 116072
749 Ga0496120_0000153 3300048923 Bacteria 114778
750 Ga0496120_0001436 3300048923 Bacteria 28628
751 Ga0496120_0002007 3300048923 Bacteria 22138
752 Ga0496121_0000013 3300048924 Bacteria 614976
753 Ga0496121_0000315 3300048924 Bacteria 100898
754 Ga0496121_0000431 3300048924 Bacteria 82456
755 Ga0496121_0000835 3300048924 Bacteria 55903
756 Ga0496121_0005286 3300048924 Bacteria 16631
757 Ga0496121_0019069 3300048924 Bacteria 6881
758 Ga0496121_0031077 3300048924 Bacteria 4889
759 Ga0496121_0042921 3300048924 Bacteria 3924
760 Ga0496121_0043996 3300048924 Bacteria 3859
761 Ga0496121_0065220 3300048924 Bacteria 2964
762 Ga0496121_0069824 3300048924 Bacteria 2833
763 Ga0496121_0212958 3300048924 Bacteria 1367
764 Ga0496122_0010526 3300048925 Bacteria 9508
765 Ga0496122_0011599 3300048925 Bacteria 8896
766 Ga0496122_0037432 3300048925 Bacteria 3905
767 Ga0496123_0005858 3300048926 Bacteria 12170
768 Ga0496123_0008297 3300048926 Bacteria 9565
769 Ga0496123_0012876 3300048926 Bacteria 7082
770 Ga0496124_0000352 3300048927 Bacteria 83918
771 Ga0496124_0027391 3300048927 Bacteria 5116
772 Ga0496125_0002272 3300048928 Bacteria 25486
773 Ga0496125_0003057 3300048928 Bacteria 20914
774 Ga0496125_0009071 3300048928 Bacteria 10291
775 Ga0496126_0000160 3300048929 Bacteria 155144
776 Ga0496126_0000240 3300048929 Bacteria 117890
777 Ga0496126_0000402 3300048929 Bacteria 87911
778 Ga0496126_0002206 3300048929 Bacteria 26966
779 Ga0496126_0002667 3300048929 Bacteria 23631
780 Ga0496126_0012393 3300048929 Bacteria 8740
781 Ga0496126_0027190 3300048929 Bacteria 5468
782 Ga0496126_0055042 3300048929 Bacteria 3601
783 Ga0496126_0137468 3300048929 Bacteria 2106
784 Ga0496126_0253660 3300048929 Bacteria 1465
785 Ga0495678_000002 3300049459 Bacteria 999613
786 Ga0495678_000023 3300049459 Bacteria 233463
787 Ga0495678_002129 3300049459 Bacteria 14033
788 Ga0495682_0000421 3300049460 Bacteria 29820
789 Ga0495682_0007067 3300049460 Bacteria 4491
790 Ga0495682_0017800 3300049460 Bacteria 2678
791 Ga0501031_0130088 3300049568 Bacteria 1645
792 Ga0501033_0007031 3300049570 Bacteria 8790
793 Ga0501033_0013648 3300049570 Bacteria 6183
794 Ga0501033_0210190 3300049570 Bacteria 1388
795 Ga0501034_0159472 3300049571 Bacteria 2228
796 Ga0501037_0023000 3300049573 Bacteria 4609
797 Ga0501038_0058700 3300049574 Bacteria 3298
798 Ga0501040_0002246 3300049576 Bacteria 12430
799 Ga0501041_0047649 3300049577 Bacteria 2609
800 Ga0501042_0001136 3300049578 Bacteria 15349
801 Ga0501043_0001313 3300049579 Bacteria 21747
802 Ga0501043_0020678 3300049579 Bacteria 5163
803 Ga0501043_0032432 3300049579 Bacteria 4107
804 Ga0501043_0197332 3300049579 Bacteria 1563
805 Ga0501043_0226788 3300049579 Bacteria 1444
806 Ga0501046_0078693 3300049580 Bacteria 2550
807 Ga0501047_0004739 3300049581 Bacteria 12789
808 Ga0501047_0020953 3300049581 Bacteria 6279
809 Ga0501047_0029969 3300049581 Bacteria 5245
810 Ga0501047_0080883 3300049581 Bacteria 3123
811 Ga0501047_0290158 3300049581 Bacteria 1480
812 Ga0501048_0021540 3300049582 Bacteria 4720
813 Ga0501069_0009473 3300049585 Bacteria 5141
814 Ga0501070_0009715 3300049586 Bacteria 8136
815 Ga0501070_0012575 3300049586 Bacteria 7140
816 Ga0501070_0021044 3300049586 Bacteria 5472
817 Ga0501071_0064386 3300049587 Bacteria 2660
818 Ga0501072_0003414 3300049588 Bacteria 11966
819 Ga0501074_0077551 3300049590 Bacteria 2385
820 Ga0501075_0008845 3300049591 Bacteria 7022
821 Ga0501075_0177916 3300049591 Bacteria 1623
822 Ga0501076_0000461 3300049592 Bacteria 25817
823 Ga0501077_0008499 3300049593 Bacteria 6364
824 Ga0501225_0009703 3300049705 Bacteria 2738
825 Ga0501080_0143596 3300049742 Bacteria 2206
826 Ga0501081_0000792 3300049743 Bacteria 18613
827 Ga0501035_0011692 3300049822 Bacteria 8135
828 Ga0501035_0027960 3300049822 Bacteria 5152
829 Ga0501035_0197196 3300049822 Bacteria 1729
830 Ga0501035_0310685 3300049822 Bacteria 1326
831 Ga0501044_0092832 3300049823 Bacteria 3044
832 Ga0501044_0109324 3300049823 Bacteria 2774
833 Ga0501044_0122000 3300049823 Bacteria 2606
834 Ga0501044_0122210 3300049823 Bacteria 2603
835 Ga0501044_0126704 3300049823 Bacteria 2550
836 Ga0501045_0012533 3300049824 Bacteria 5971
837 nmdc:mga0k408_17808_c1 3300050493 Bacteria 3960
838 nmdc:mga0k408_60005_c1 3300050493 Bacteria 2210
839 nmdc:mga0qj67_18257_c1 3300050509 Bacteria 5344
840 nmdc:mga0qj67_67497_c1 3300050509 Bacteria 2849
841 nmdc:mga06r32_28584_c1 3300050510 Bacteria 5220
842 nmdc:mga06r32_8112_c1 3300050510 Bacteria 9447
843 nmdc:mga0n895_125557_c1 3300050512 Bacteria 2589
844 nmdc:mga0n895_25296_c1 3300050512 Bacteria 5607
845 Ga0495601_0000006 3300053077 Bacteria 373770
846 Ga0495612_0041556 3300053078 Bacteria 1875
847 Ga0495595_0000006 3300053084 Bacteria 231295
848 Ga0495619_0000011 3300053085 Bacteria 287128
849 Ga0500643_000002 3300053087 Bacteria 1277657
850 Ga0500556_0000407 3300053104 Bacteria 31365
851 Ga0500572_000662 3300053111 Bacteria 11397
852 Ga0500593_000156 3300053117 Bacteria 27265
853 Ga0500593_004183 3300053117 Bacteria 5559
854 Ga0500595_004307 3300053119 Bacteria 6412
855 Ga0500618_000065 3300053125 Bacteria 90667
856 Ga0500642_0040739 3300053130 Bacteria 2005
857 Ga0500652_020917 3300053131 Bacteria 2457
858 Ga0500559_0002081 3300053136 Bacteria 10697
859 Ga0500568_0000660 3300053139 Bacteria 24923
860 Ga0500616_0000070 3300053153 Bacteria 232610
861 Ga0500616_0074407 3300053153 Bacteria 1722
862 Ga0500633_0001136 3300053160 Bacteria 4815
863 Ga0500634_0000210 3300053161 Bacteria 18978
864 Ga0500636_0076683 3300053177 Bacteria 1932
865 Ga0500645_000191 3300053730 Bacteria 47668
866 Ga0501084_0007252 3300054114 Bacteria 9141
867 Ga0501084_0014305 3300054114 Bacteria 6574
868 Ga0501084_0160962 3300054114 Bacteria 1894
869 Ga0501082_0037943 3300060353 Bacteria 4155
870 Ga0501082_0167982 3300060353 Bacteria 1907
871 2509370903 2509276018 Bacteria 6910194
872 2509397982 2509276022 Bacteria 6200534
873 2510316553 2510065059 Bacteria 6847884
874 2513891789 2513237141 Bacteria 8496279
875 2514033887 2513237164 Bacteria 7563725
876 2514587936 2513237351 Bacteria 6968952
877 2525557267 2524614729 Bacteria 3091755
878 2538833549 2537561836 Bacteria 3910579
879 2595446050 2593339238 Bacteria 4182970
880 2595448450 2593339238 Bacteria 4182970
881 2595449483 2593339239 Bacteria 4124669
882 2595452501 2593339239 Bacteria 4124669
883 2630648863 2627854209 Bacteria 3093011
884 2643755340 2643221547 Bacteria 4740017
885 2643773902 2643221550 Bacteria 4619371
886 2643829227 2643221562 Bacteria 4048635
887 2643895548 2643221577 Bacteria 3710843
888 2643993802 2643221596 Bacteria 5006805
889 2644477730 2643221685 Bacteria 3673288
890 2644529563 2643221695 Bacteria 3441323
891 2687581803 2687453130 Bacteria 4227172
892 2721027615 2718218334 Bacteria 4765486
893 2735836825 2734482264 Unclassified 5014763
894 2738713995 2738541276 Bacteria 4690596
895 2739226230 2738543009 Bacteria 4944499
896 2739730840 2739367700 Bacteria 4747630
897 2819562601 2818991440 Bacteria 4774720
898 2838058267 2838054893 Bacteria 7451788
899 2842713354 2842711865 Bacteria 7155354
900 2842916360 2842914999 Bacteria 4419378
901 2842918982 2842918807 Bacteria 4289178
902 2842921774 2842918807 Bacteria 4289178
903 2844015703 2844009547 Bacteria 6728125
904 2856337480 2856334872 Bacteria 7037011
905 2857368435 2857367948 Bacteria 6965560
906 2857550854 2857547612 Bacteria 6179999
907 2857561460 2857558681 Bacteria 6617694
908 2869241215 2869234852 Bacteria 6654993
909 2869250516 2869249662 Bacteria 6868783
910 2869262231 2869256925 Bacteria 6981691
911 2869265826 2869264136 Bacteria 6880765
912 2871440803 2871435913 Bacteria 6880295
913 2871463383 2871459585 Bacteria 6866887
914 2871483074 2871481445 Bacteria 6700002
915 2874110609 2874109183 Bacteria 6517025
916 2874123131 2874116593 Bacteria 6674494
917 2874138978 2874131515 Bacteria 6820270
918 2876387381 2876386047 Bacteria 6698674
919 2876423843 2876420981 Bacteria 6687741
920 2878734303 2878730984 Bacteria 6380721
921 2878784777 2878781027 Bacteria 6834456
922 2883071345 2883068021 Bacteria 6192739
923 2884340419 2884338543 Bacteria 4610696
924 2884412296 2884411467 Bacteria 5246714
925 2885194468 2885192300 Bacteria 5882526
926 2889311947 2889306138 Bacteria 6358934
927 2894417097 2894414249 Bacteria 4405451
928 2902335004 2902330777 Bacteria 6395352
929 2902409912 2902405164 Bacteria 6784948
930 2903517806 2903513507 Bacteria 6344008
931 2904424904 2904424332 Bacteria 7633521
932 2904463206 2904463128 Bacteria 4775606
933 2906365399 2906363423 Bacteria 6856682
934 2906375043 2906370794 Bacteria 6881062
935 2906400379 2906393657 Bacteria 6790866
936 2906406518 2906401398 Bacteria 6693206
937 2913040306 2913036834 Bacteria 6704877
938 2914761997 2914759650 Bacteria 4701441
939 2919085505 2919085039 Bacteria 4532964
940 2919405311 2919404418 Bacteria 4232372
941 2919406005 2919404418 Bacteria 4232372
942 2922156215 2922151315 Bacteria 6902399
943 2924738551 2924733363 Bacteria 7574837
944 2924743898 2924741084 Bacteria 6661321
945 2928964086 2928963466 Bacteria 5165703
946 2937867059 2937861824 Bacteria 6660327
947 2937869066 2937868953 Bacteria 6639878
948 2937987882 2937980651 Bacteria 6517427
949 2939614770 2939611941 Bacteria 3892017
950 2941475789 2941471342 Bacteria 5018624
951 2953994728 2953994433 Bacteria 4303959
952 2953997791 2953994433 Bacteria 4303959
953 2958110730 2958108152 Bacteria 6681128
954 2958125964 2958122699 Bacteria 7280457
955 2961184650 2961183825 Bacteria 6688536
956 2965040249 2965032056 Bacteria 6887443
957 2965040472 2965040258 Bacteria 6855979
958 2965089511 2965089291 Bacteria 6866420
959 2968143135 2968138860 Bacteria 6605449
960 2970494671 2970489779 Bacteria 6517260
961 2970514569 2970510686 Bacteria 7006402
962 2970535680 2970532167 Bacteria 6553173
963 2970621924 2970619444 Bacteria 6986144
964 2970633494 2970627176 Bacteria 6680862
965 2977857573 2977851361 Bacteria 6694324
966 2977874935 2977872689 Bacteria 7270173
967 2977898765 2977898635 Bacteria 6675551
968 2977915099 2977907340 Bacteria 6577984
969 2977920392 2977915119 Bacteria 6829656
970 2977954184 2977950692 Bacteria 6893264
971 2979765105 2979764755 Bacteria 6610066
972 2979776388 2979772303 Bacteria 6618277
973 2979793815 2979793036 Bacteria 6808957
974 2987675672 2987673487 Bacteria 6884027
975 2996391908 2996386984 Bacteria 6978667
976 3004171190 3004167301 Bacteria 8330599
977 3004175311 3004167301 Bacteria 8330599
978 3004202269 3004195979 Bacteria 6776956
979 3004233195 3004232784 Bacteria 6662140
980 3004240199 3004239961 Bacteria 6892290
981 3004250651 3004248173 Bacteria 6563236
982 3004270539 3004268573 Bacteria 7043476
983 3004342715 3004334049 Bacteria 8449246
984 8003014663 8003014200 Bacteria 4059994
985 8004314049 8004312739 Bacteria 7444653
986 8004366937 8004361976 Bacteria 6858373
987 8004697175 8004695233 Bacteria 6731676
988 8004734157 8004727605 Bacteria 6643904
989 8016590493 8016583857 Bacteria 10421953
990 Ga0055524_1014737
991 JGI24740J21852_10010186
992 JGI24739J22299_10001078
993 JGI24737J22298_10002950
994 JGI24735J21928_10008777
995 JGI24735J21928_10012187
996 JGI24738J21930_10002735
997 JGI25156J39149_1009512
998 JGI25162J39368_1000345
999 JGI25162J39368_1000407
1000 JGI25162J39368_1000444
1001 JGI25162J39368_1000618
1002 JGI25162J39368_1001758
1003 JGI25162J39368_1002058
1004 JGI25157J39369_1000244
1005 JGI25157J39369_1000317
1006 JGI25157J39369_1000651
1007 JGI25157J39369_1004792
1008 JGI25163J39215_1000267
1009 JGI25164J39214_1000161
1010 JGI25164J39214_1000187
1011 JGI25164J39214_1000208
1012 JGI25164J39214_1000267
1013 JGI25164J39214_1000294
1014 JGI25152J39213_1013407
1015 JGI25159J45721_1011794
1016 JGI25151J46595_10029573
1017 JGI25165J46597_1000059
1018 JGI25165J46597_1000338
1019 JGI25165J46597_1000481
1020 JGI25165J46597_1001019
1021 JGI25165J46597_1001527
1022 JGI25153J46596_10008324
1023 JGI25153J46596_10013658
1024 rootH2_10133574
1025 Ga0006562J51391_1041114
1026 Ga0006562J51391_1041115
1027 Ga0055538_1001452
1028 Ga0055539_1001152
1029 Ga0055533_1004498
1030 Ga0055527_1000076
1031 Ga0055535_1000120
1032 Ga0055535_1000129
1033 Ga0055535_1000417
1034 Ga0055535_1001441
1035 Ga0055542_1000054
1036 Ga0055542_1000173
1037 Ga0055542_1000422
1038 Ga0055542_1000435
1039 Ga0055542_1000832
1040 Ga0055529_1000110
1041 Ga0055529_1000200
1042 Ga0055529_1000370
1043 Ga0055526_1000001
1044 Ga0055536_1009583
1045 Ga0055530_10011606
1046 Ga0055531_10000048
1047 Ga0055531_10004530
1048 Ga0055531_10010223
1049 Ga0055531_10013337
1050 Ga0065165_1000118
1051 Ga0065165_1000500
1052 Ga0065165_1002313
1053 Ga0065707_10000820
1054 Ga0065707_10082453
1055 Ga0070658_10063984
1056 Ga0070658_10297727
1057 Ga0070676_10073869
1058 Ga0070690_100025671
1059 Ga0070670_100079731
1060 Ga0070666_10000012
1061 Ga0070680_100012391
1062 Ga0070680_100060257
1063 Ga0070682_100005716
1064 Ga0070660_100030087
1065 Ga0070660_100155666
1066 Ga0070689_100004062
1067 Ga0070691_10007359
1068 Ga0070661_100011510
1069 Ga0070661_100058650
1070 Ga0070661_100069480
1071 Ga0070668_100017643
1072 Ga0070669_100077717
1073 Ga0070674_100075070
1074 Ga0070659_100000104
1075 Ga0070659_100214588
1076 Ga0070667_100001691
1077 Ga0070709_10004581
1078 Ga0070714_100000161
1079 Ga0070713_100006944
1080 Ga0070713_100009016
1081 Ga0070713_100011820
1082 Ga0070663_100010008
1083 Ga0070663_100016227
1084 Ga0070663_100173363
1085 Ga0070678_100034166
1086 Ga0070662_100026274
1087 Ga0070662_100172291
1088 Ga0070681_10021952
1089 Ga0070681_10025990
1090 Ga0070681_10031834
1091 Ga0070681_10077516
1092 Ga0070685_10000392
1093 Ga0070679_100027197
1094 Ga0070679_100038412
1095 Ga0070679_100077779
1096 Ga0068853_100067544
1097 Ga0068853_100152823
1098 Ga0070696_100002057
1099 Ga0070696_100041275
1100 Ga0070696_100092240
1101 Ga0070693_100048750
1102 Ga0070665_100000393
1103 Ga0070665_100006459
1104 Ga0070665_100024783
1105 Ga0070665_100071388
1106 Ga0070665_100192984
1107 Ga0068855_100007961
1108 Ga0068855_100015348
1109 Ga0068855_100030409
1110 Ga0068855_100091163
1111 Ga0070664_100010444
1112 Ga0068857_100027102
1113 Ga0068857_100036971
1114 Ga0068854_100000481
1115 Ga0068856_100053060
1116 Ga0068856_100058515
1117 Ga0068856_100096465
1118 Ga0068856_100125511
1119 Ga0068856_100231145
1120 Ga0068852_100023243
1121 Ga0068859_100192198
1122 Ga0068851_10010458
1123 Ga0068858_100002138
1124 Ga0068858_100249697
1125 Ga0068860_100011037
1126 Ga0068860_100059764
1127 Ga0068860_100081529
1128 Ga0068862_100030607
1129 Ga0068862_100047012
1130 Ga0081455_10006552
1131 Ga0081539_10000001
1132 Ga0070717_10031172
1133 Ga0075365_10036363
1134 Ga0075366_10000683
1135 Ga0075366_10014537
1136 Ga0068871_100005293
1137 Ga0075430_100039982
1138 Ga0075431_100004249
1139 Ga0075431_100016318
1140 Ga0075434_100063191
1141 Ga0075434_100171240
1142 Ga0097620_100192192
1143 Ga0105240_10000113
1144 Ga0105240_10000162
1145 Ga0105240_10000317
1146 Ga0105240_10000671
1147 Ga0105240_10000884
1148 Ga0105240_10006881
1149 Ga0105240_10019958
1150 Ga0105240_10034519
1151 Ga0105240_10048297
1152 Ga0105245_10002275
1153 Ga0105247_10014455
1154 Ga0114129_10171546
1155 Ga0105242_10115127
1156 Ga0105248_10013719
1157 Ga0105237_10025261
1158 Ga0105237_10119323
1159 Ga0105238_10000109
1160 Ga0105238_10018954
1161 Ga0105238_10018971
1162 Ga0105238_10072762
1163 Ga0105249_10037277
1164 Ga0105249_10055644
1165 Ga0105030_100140
1166 Ga0105239_10000033
1167 Ga0105239_10000034
1168 Ga0105239_10000050
1169 Ga0157347_1000199
1170 Ga0157339_1000718
1171 Ga0157373_10000162
1172 Ga0157373_10001336
1173 Ga0157373_10001753
1174 Ga0157373_10085407
1175 Ga0157371_10001241
1176 Ga0157371_10001357
1177 Ga0157371_10064239
1178 Ga0157370_10001027
1179 Ga0157370_10002298
1180 Ga0157370_10002411
1181 Ga0157370_10008231
1182 Ga0157370_10053054
1183 Ga0157369_10000551
1184 Ga0157369_10004459
1185 Ga0157369_10051107
1186 Ga0157369_10055334
1187 Ga0157369_10116000
1188 Ga0163162_10000127
1189 Ga0163162_10015245
1190 Ga0157372_10000017
1191 Ga0157372_10002252
1192 Ga0157372_10083127
1193 Ga0157372_10160695
1194 Ga0157375_10089689
1195 Ga0157514_110596
1196 Ga0163163_10022696
1197 Ga0182008_10000578
1198 Ga0182008_10001780
1199 Ga0182008_10009136
1200 Ga0182008_10035270
1201 Ga0157379_10003252
1202 Ga0157376_10003915
1203 Ga0157376_10012095
1204 Ga0157376_10043986
1205 Ga0182006_1000049
1206 Ga0182006_1000187
1207 Ga0182006_1000484
1208 Ga0182006_1006110
1209 Ga0182006_1025512
1210 Ga0182007_10006519
1211 Ga0182005_1000004
1212 Ga0182005_1000432
1213 Ga0182005_1002203
1214 Ga0183369_1003
1215 Ga0183368_1004
1216 Ga0163161_10001992
1217 Ga0206349_1291601
1218 Ga0206351_10745720
1219 Ga0213874_10017938
1220 Ga0213871_10003319
1221 Ga0224712_10000382
1222 Ga0224712_10034351
1223 Ga0209760_100405
1224 Ga0209784_100026
1225 Ga0209566_102091
1226 Ga0209674_100016
1227 Ga0209674_100026
1228 Ga0209674_100452
1229 Ga0209674_100462
1230 Ga0209674_100901
1231 Ga0209672_100017
1232 Ga0209672_100119
1233 Ga0209672_100560
1234 Ga0209672_101944
1235 Ga0207427_100023
1236 Ga0207427_100046
1237 Ga0207427_100080
1238 Ga0207427_100133
1239 Ga0207427_100203
1240 Ga0207427_101231
1241 Ga0207427_104824
1242 Ga0209437_100005
1243 Ga0209437_100015
1244 Ga0209437_100039
1245 Ga0209437_100132
1246 Ga0209437_100264
1247 Ga0209437_100344
1248 Ga0209437_100956
1249 Ga0209437_101178
1250 Ga0209258_100038
1251 Ga0209258_100043
1252 Ga0209258_100045
1253 Ga0209258_100430
1254 Ga0209258_101101
1255 Ga0209646_1001454
1256 Ga0209026_1000047
1257 Ga0209026_1000270
1258 Ga0209026_1000283
1259 Ga0209026_1000544
1260 Ga0209026_1001541
1261 Ga0209677_103534
1262 Ga0209148_1000002
1263 Ga0209148_1000009
1264 Ga0209148_1000010
1265 Ga0209148_1000052
1266 Ga0209148_1000125
1267 Ga0209148_1000856
1268 Ga0209148_1000860
1269 Ga0209759_1000124
1270 Ga0209759_1000715
1271 Ga0209759_1002933
1272 Ga0209129_1000380
1273 Ga0209129_1000419
1274 Ga0209129_1003465
1275 Ga0209233_1000009
1276 Ga0209233_1000011
1277 Ga0209233_1000090
1278 Ga0209233_1000114
1279 Ga0209233_1000270
1280 Ga0209233_1000635
1281 Ga0209233_1009777
1282 Ga0209233_1014140
1283 Ga0209455_1000020
1284 Ga0209455_1000032
1285 Ga0209455_1000077
1286 Ga0209455_1002311
1287 Ga0209455_1005606
1288 Ga0209673_1002585
1289 Ga0209130_1000739
1290 Ga0209675_1003089
1291 Ga0209675_1008310
1292 Ga0209675_1015020
1293 Ga0209676_1000652
1294 Ga0209676_1002221
1295 Ga0209676_1002767
1296 Ga0209676_1003961
1297 Ga0209676_1007785
1298 Ga0209676_1025631
1299 Ga0209025_1000739
1300 Ga0209025_1016330
1301 Ga0209564_1000002
1302 Ga0209758_1000264
1303 Ga0209758_1001407
1304 Ga0209758_1002634
1305 Ga0209758_1013988
1306 Ga0209050_1001726
1307 Ga0209050_1002010
1308 Ga0209050_1020151
1309 Ga0209256_1001138
1310 Ga0209256_1002995
1311 Ga0209256_1015530
1312 Ga0207426_1016466
1313 Ga0209051_1005447
1314 Ga0209051_1008459
1315 Ga0209051_1021347
1316 Ga0209257_1000007
1317 Ga0209257_1000243
1318 Ga0209257_1000580
1319 Ga0209257_1001540
1320 Ga0209257_1003478
1321 Ga0207680_10000013
1322 Ga0207647_10000714
1323 Ga0207647_10001141
1324 Ga0207647_10003186
1325 Ga0207647_10009780
1326 Ga0207647_10041541
1327 Ga0207705_10013087
1328 Ga0207705_10046018
1329 Ga0207705_10097740
1330 Ga0207705_10174355
1331 Ga0207707_10006788
1332 Ga0207707_10021887
1333 Ga0207707_10029550
1334 Ga0207707_10059138
1335 Ga0207695_10000198
1336 Ga0207695_10000219
1337 Ga0207695_10000322
1338 Ga0207695_10000364
1339 Ga0207695_10000874
1340 Ga0207695_10000876
1341 Ga0207695_10002095
1342 Ga0207695_10002325
1343 Ga0207695_10004297
1344 Ga0207695_10005620
1345 Ga0207695_10014125
1346 Ga0207695_10031434
1347 Ga0207695_10155805
1348 Ga0207695_10185364
1349 Ga0207671_10019774
1350 Ga0207671_10076460
1351 Ga0207671_10138368
1352 Ga0207693_10035737
1353 Ga0207693_10039576
1354 Ga0207660_10056724
1355 Ga0207660_10209474
1356 Ga0207657_10007998
1357 Ga0207657_10071270
1358 Ga0207649_10012369
1359 Ga0207652_10058476
1360 Ga0207652_10119292
1361 Ga0207694_10000398
1362 Ga0207694_10000556
1363 Ga0207694_10030229
1364 Ga0207694_10053390
1365 Ga0207694_10062967
1366 Ga0207694_10095222
1367 Ga0207694_10138514
1368 Ga0207650_10021868
1369 Ga0207650_10039828
1370 Ga0207687_10071147
1371 Ga0207700_10149076
1372 Ga0207664_10000109
1373 Ga0207664_10171759
1374 Ga0207690_10000252
1375 Ga0207690_10009148
1376 Ga0207690_10028029
1377 Ga0207706_10012378
1378 Ga0207706_10025710
1379 Ga0207686_10051324
1380 Ga0207709_10139473
1381 Ga0207670_10003972
1382 Ga0207704_10087033
1383 Ga0207665_10005858
1384 Ga0207711_10008233
1385 Ga0207679_10003789
1386 Ga0207667_10000195
1387 Ga0207667_10000406
1388 Ga0207667_10000752
1389 Ga0207667_10001181
1390 Ga0207667_10135157
1391 Ga0207667_10223402
1392 Ga0207712_10035528
1393 Ga0207712_10109894
1394 Ga0207668_10063996
1395 Ga0207640_10000025
1396 Ga0207640_10000275
1397 Ga0207640_10002524
1398 Ga0207658_10114014
1399 Ga0207703_10073426
1400 Ga0207639_10000948
1401 Ga0207639_10084484
1402 Ga0207678_10015564
1403 Ga0207702_10028222
1404 Ga0207702_10278293
1405 Ga0207674_10007294
1406 Ga0207674_10031038
1407 Ga0207674_10187386
1408 Ga0207674_10228512
1409 Ga0207675_100075125
1410 Ga0209179_1000594
1411 Ga0268266_10000021
1412 Ga0268266_10000532
1413 Ga0268266_10004337
1414 Ga0268266_10018195
1415 Ga0268265_10049937
1416 Ga0268264_10039462
1417 Ga0307515_10034644
1418 Ga0265338_10009114
1419 Ga0265338_10076126
1420 Ga0265338_10222229
1421 Ga0265330_10013639
1422 Ga0265332_10007639
1423 Ga0265328_10015580
1424 Ga0265325_10038429
1425 Ga0265331_10010281
1426 Ga0307509_10082704
1427 Ga0307408_100022881
1428 Ga0307408_100110622
1429 Ga0307408_100196070
1430 Ga0265313_10013795
1431 Ga0307508_10001382
1432 Ga0307508_10014707
1433 Ga0265342_10000309
1434 Ga0265342_10000954
1435 Ga0316576_10000401
1436 Ga0316578_10000603
1437 Ga0316578_10007507
1438 Ga0316578_10110381
1439 Ga0307516_10000012
1440 Ga0307516_10000127
1441 Ga0307405_10043830
1442 Ga0307405_10145780
1443 Ga0307413_10000993
1444 Ga0307413_10023835
1445 Ga0307413_10091242
1446 Ga0307410_10020854
1447 Ga0307410_10221311
1448 Ga0307412_10001913
1449 Ga0307412_10002808
1450 Ga0307412_10053213
1451 Ga0307412_10073288
1452 Ga0307412_10100328
1453 Ga0307409_100017567
1454 Ga0307416_100001542
1455 Ga0307416_100003400
1456 Ga0307416_100057026
1457 Ga0307414_10037573
1458 Ga0307414_10063163
1459 Ga0307411_10030914
1460 Ga0307411_10099087
1461 Ga0307415_100031012
1462 Ga0316593_10002230
1463 Ga0316593_10014225
1464 Ga0307510_10023623
1465 Ga0307510_10064118
1466 Ga0316592_1011766
1467 Ga0316588_1000533
1468 Ga0316588_1011693
1469 Ga0316588_1011956
1470 Ga0316596_1010361
1471 Ga0373944_0010269
1472 Ga0373923_0005804
1473 Ga0373936_0000250
1474 Ga0373954_0018589
1475 Ga0373956_0041166
1476 Ga0373943_0007700
1477 Ga0373946_0013254
1478 Ga0373955_0012798
1479 Ga0373935_0000277
1480 Ga0373927_0003700
1481 Ga0373933_0031207
1482 Ga0373947_0002129
1483 Ga0373937_0001170
1484 Ga0316582_0038484
1485 Ga0316584_0003979
1486 Ga0373925_0000617
1487 Ga0395899_0000046
1488 Ga0395899_0000328
1489 Ga0395899_0015649
1490 Ga0395899_0025450
1491 Ga0395899_0041577
1492 Ga0395899_0084053
1493 Ga0395900_0000034
1494 Ga0395900_0000487
1495 Ga0395900_0015814
1496 Ga0395900_0055750
1497 Ga0395900_0085141
1498 Ga0395898_0000081
1499 Ga0395898_0000835
1500 Ga0395898_0005081
1501 Ga0395898_0027720
1502 Ga0395905_0000165
1503 Ga0395905_0006346
1504 Ga0395905_0034782
1505 Ga0395905_0080441
1506 Ga0395901_0000726
1507 Ga0395901_0003055
1508 Ga0395901_0005078
1509 Ga0395901_0008198
1510 Ga0395901_0051802
1511 Ga0436365_0936435
1512 Ga0436360_0314901
1513 Ga0436360_0654994
1514 Ga0436361_0556854
1515 Ga0436363_1195502
1516 Ga0436363_1357513
1517 Ga0436362_0573719
1518 Ga0439436_0000018
1519 Ga0439436_0000061
1520 Ga0439436_0014989
1521 Ga0439465_0004527
1522 Ga0451793_1604110
1523 Ga0451807_0603001
1524 Ga0439449_0000693
1525 Ga0450896_001311
1526 Ga0439446_0008934
1527 Ga0450908_000052
1528 Ga0450908_001644
1529 Ga0439459_0001958
1530 Ga0451577_0007968
1531 Ga0451577_0016590
1532 Ga0466969_0017713
1533 Ga0466969_0028211
1534 Ga0466969_0033434
1535 Ga0466982_0000025
1536 Ga0466982_0000056
1537 Ga0453683_0018983
1538 Ga0466966_0004819
1539 Ga0466966_0008441
1540 Ga0466966_0013196
1541 Ga0466966_0065099
1542 Ga0466961_0001433
1543 Ga0466961_0004989
1544 Ga0466961_0013131
1545 Ga0466961_0016649
1546 Ga0466961_0036641
1547 Ga0466961_0061672
1548 Ga0466961_0076095
1549 Ga0466963_0048715
1550 Ga0453684_0000046
1551 Ga0453684_0193403
1552 Ga0466971_0000694
1553 Ga0466970_0081026
1554 Ga0466957_0001623
1555 Ga0466957_0065450
1556 Ga0466959_0021363
1557 Ga0466959_0042078
1558 Ga0466959_0052113
1559 Ga0466959_0132351
1560 Ga0451576_0008271
1561 Ga0451576_0036117
1562 Ga0451576_0190066
1563 Ga0466958_0091361
1564 Ga0466967_0138591
1565 Ga0495617_000019
1566 Ga0495617_000865
1567 Ga0495592_0000377
1568 Ga0495590_0000002
1569 Ga0495638_0000030
1570 Ga0495638_0000069
1571 Ga0495638_0000280
1572 Ga0495638_0000311
1573 Ga0495638_0001085
1574 Ga0495653_0000027
1575 Ga0495650_0000061
1576 Ga0495650_0000501
1577 Ga0495650_0000920
1578 Ga0495650_0001244
1579 Ga0495662_0011796
1580 Ga0495584_0001702
1581 Ga0495585_0000001
1582 Ga0495585_0016990
1583 Ga0495607_0000003
1584 Ga0495607_0001172
1585 Ga0495607_0001827
1586 Ga0495607_0024313
1587 Ga0495583_0000058
1588 Ga0495583_0006205
1589 Ga0495606_0000050
1590 Ga0495606_0000097
1591 Ga0495606_0000105
1592 Ga0495606_0001098
1593 Ga0495606_0001776
1594 Ga0495606_0004944
1595 Ga0495606_0014678
1596 Ga0495606_0020249
1597 Ga0495608_0000135
1598 Ga0495610_0000380
1599 Ga0495610_0000537
1600 Ga0495610_0032907
1601 Ga0495610_0039710
1602 Ga0495616_0000001
1603 Ga0495618_0000052
1604 Ga0495620_0031578
1605 Ga0495628_0000005
1606 Ga0495630_0009097
1607 Ga0495631_0000033
1608 Ga0495631_0000205
1609 Ga0495632_0000003
1610 Ga0495632_0000120
1611 Ga0495632_0004636
1612 Ga0495643_0000078
1613 Ga0495648_0000009
1614 Ga0495648_0000083
1615 Ga0495648_0045343
1616 Ga0495663_0047254
1617 Ga0495652_0000001
1618 Ga0495640_0000035
1619 Ga0495587_0000012
1620 Ga0495609_0000590
1621 Ga0495609_0004654
1622 Ga0495597_0000014
1623 Ga0495645_0000014
1624 Ga0495633_0000041
1625 Ga0495667_0000001
1626 Ga0495668_0000750
1627 Ga0495668_0004788
1628 Ga0495668_0005286
1629 Ga0495668_0008417
1630 Ga0495634_0000412
1631 Ga0495611_0000001
1632 Ga0495611_0000008
1633 Ga0495625_0000001
1634 Ga0495625_0000023
1635 Ga0495625_0002867
1636 Ga0495625_0005892
1637 Ga0495625_0008485
1638 Ga0495625_0041568
1639 Ga0495625_0053433
1640 Ga0495635_0000007
1641 Ga0495661_0000672
1642 Ga0495657_0000727
1643 Ga0495599_0000002
1644 Ga0495623_0000316
1645 Ga0495646_0000133
1646 Ga0495669_0000385
1647 Ga0495669_0002242
1648 Ga0495613_0019436
1649 Ga0495670_0000407
1650 Ga0495670_0008258
1651 Ga0495670_0008842
1652 Ga0495671_0000208
1653 Ga0495649_0007164
1654 Ga0495649_0008003
1655 Ga0495649_0020260
1656 Ga0495649_0037147
1657 Ga0495589_0000446
1658 Ga0495600_0000199
1659 Ga0495660_0000008
1660 Ga0495660_0000009
1661 Ga0495660_0000159
1662 Ga0495604_0000007
1663 Ga0495674_0000001
1664 Ga0495672_0116464
1665 Ga0495680_0001769
1666 Ga0495683_0000922
1667 Ga0495687_014320
1668 Ga0495687_014376
1669 Ga0495675_0000539
1670 Ga0495679_000001
1671 Ga0495673_0000001
1672 Ga0495673_0000030
1673 Ga0495673_0002990
1674 Ga0495681_0007223
1675 Ga0495684_0000027
1676 Ga0495686_0000019
1677 Ga0495686_0000077
1678 Ga0495686_0002878
1679 Ga0495686_0011038
1680 Ga0495686_0015188
1681 Ga0495686_0027117
1682 Ga0495593_0001637
1683 Ga0495602_0000004
1684 Ga0496100_0004314
1685 Ga0496100_0202266
1686 Ga0496101_0001940
1687 Ga0496101_0007629
1688 Ga0496101_0175731
1689 Ga0496102_0004747
1690 Ga0496102_0182089
1691 Ga0496104_0005865
1692 Ga0496105_0012174
1693 Ga0496105_0014752
1694 Ga0496105_0029955
1695 Ga0496105_0038223
1696 Ga0496106_0002177
1697 Ga0496106_0265537
1698 Ga0496107_0044077
1699 Ga0496107_0049341
1700 Ga0496109_0092320
1701 Ga0496109_0121867
1702 Ga0496111_0001591
1703 Ga0496112_0118605
1704 Ga0496113_0014675
1705 Ga0496114_0024143
1706 Ga0496115_0000039
1707 Ga0496115_0000093
1708 Ga0496115_0000536
1709 Ga0496115_0001494
1710 Ga0496115_0002717
1711 Ga0496115_0003431
1712 Ga0496115_0025650
1713 Ga0496115_0036799
1714 Ga0496115_0055709
1715 Ga0496116_0001420
1716 Ga0496116_0046768
1717 Ga0496117_0003165
1718 Ga0496117_0011918
1719 Ga0496117_0019931
1720 Ga0496117_0036716
1721 Ga0496117_0128254
1722 Ga0496118_0000839
1723 Ga0496118_0001054
1724 Ga0496118_0001398
1725 Ga0496118_0002911
1726 Ga0496118_0004037
1727 Ga0496118_0004710
1728 Ga0496118_0004745
1729 Ga0496118_0011125
1730 Ga0496118_0011275
1731 Ga0496119_0000109
1732 Ga0496119_0000113
1733 Ga0496119_0001179
1734 Ga0496119_0010208
1735 Ga0496119_0011481
1736 Ga0496120_0000124
1737 Ga0496120_0000150
1738 Ga0496120_0000153
1739 Ga0496120_0001436
1740 Ga0496120_0002007
1741 Ga0496121_0000013
1742 Ga0496121_0000315
1743 Ga0496121_0000431
1744 Ga0496121_0000835
1745 Ga0496121_0005286
1746 Ga0496121_0019069
1747 Ga0496121_0031077
1748 Ga0496121_0042921
1749 Ga0496121_0043996
1750 Ga0496121_0065220
1751 Ga0496121_0069824
1752 Ga0496121_0212958
1753 Ga0496122_0010526
1754 Ga0496122_0011599
1755 Ga0496122_0037432
1756 Ga0496123_0005858
1757 Ga0496123_0008297
1758 Ga0496123_0012876
1759 Ga0496124_0000352
1760 Ga0496124_0027391
1761 Ga0496125_0002272
1762 Ga0496125_0003057
1763 Ga0496125_0009071
1764 Ga0496126_0000160
1765 Ga0496126_0000240
1766 Ga0496126_0000402
1767 Ga0496126_0002206
1768 Ga0496126_0002667
1769 Ga0496126_0012393
1770 Ga0496126_0027190
1771 Ga0496126_0055042
1772 Ga0496126_0137468
1773 Ga0496126_0253660
1774 Ga0495678_000002
1775 Ga0495678_000023
1776 Ga0495678_002129
1777 Ga0495682_0000421
1778 Ga0495682_0007067
1779 Ga0495682_0017800
1780 Ga0501031_0130088
1781 Ga0501033_0007031
1782 Ga0501033_0013648
1783 Ga0501033_0210190
1784 Ga0501034_0159472
1785 Ga0501037_0023000
1786 Ga0501038_0058700
1787 Ga0501040_0002246
1788 Ga0501041_0047649
1789 Ga0501042_0001136
1790 Ga0501043_0001313
1791 Ga0501043_0020678
1792 Ga0501043_0032432
1793 Ga0501043_0197332
1794 Ga0501043_0226788
1795 Ga0501046_0078693
1796 Ga0501047_0004739
1797 Ga0501047_0020953
1798 Ga0501047_0029969
1799 Ga0501047_0080883
1800 Ga0501047_0290158
1801 Ga0501048_0021540
1802 Ga0501069_0009473
1803 Ga0501070_0009715
1804 Ga0501070_0012575
1805 Ga0501070_0021044
1806 Ga0501071_0064386
1807 Ga0501072_0003414
1808 Ga0501074_0077551
1809 Ga0501075_0008845
1810 Ga0501075_0177916
1811 Ga0501076_0000461
1812 Ga0501077_0008499
1813 Ga0501225_0009703
1814 Ga0501080_0143596
1815 Ga0501081_0000792
1816 Ga0501035_0011692
1817 Ga0501035_0027960
1818 Ga0501035_0197196
1819 Ga0501035_0310685
1820 Ga0501044_0092832
1821 Ga0501044_0109324
1822 Ga0501044_0122000
1823 Ga0501044_0122210
1824 Ga0501044_0126704
1825 Ga0501045_0012533
1826 nmdc:mga0k408_17808_c1
1827 nmdc:mga0k408_60005_c1
1828 nmdc:mga0qj67_18257_c1
1829 nmdc:mga0qj67_67497_c1
1830 nmdc:mga06r32_28584_c1
1831 nmdc:mga06r32_8112_c1
1832 nmdc:mga0n895_125557_c1
1833 nmdc:mga0n895_25296_c1
1834 Ga0495601_0000006
1835 Ga0495612_0041556
1836 Ga0495595_0000006
1837 Ga0495619_0000011
1838 Ga0500643_000002
1839 Ga0500556_0000407
1840 Ga0500572_000662
1841 Ga0500593_000156
1842 Ga0500593_004183
1843 Ga0500595_004307
1844 Ga0500618_000065
1845 Ga0500642_0040739
1846 Ga0500652_020917
1847 Ga0500559_0002081
1848 Ga0500568_0000660
1849 Ga0500616_0000070
1850 Ga0500616_0074407
1851 Ga0500633_0001136
1852 Ga0500634_0000210
1853 Ga0500636_0076683
1854 Ga0500645_000191
1855 Ga0501084_0007252
1856 Ga0501084_0014305
1857 Ga0501084_0160962
1858 Ga0501082_0037943
1859 Ga0501082_0167982
1860 2509370903
1861 2509397982
1862 2510316553
1863 2513891789
1864 2514033887
1865 2514587936
1866 2525557267
1867 2538833549
1868 2595446050
1869 2595448450
1870 2595449483
1871 2595452501
1872 2630648863
1873 2643755340
1874 2643773902
1875 2643829227
1876 2643895548
1877 2643993802
1878 2644477730
1879 2644529563
1880 2687581803
1881 2721027615
1882 2735836825
1883 2738713995
1884 2739226230
1885 2739730840
1886 2819562601
1887 2838058267
1888 2842713354
1889 2842916360
1890 2842918982
1891 2842921774
1892 2844015703
1893 2856337480
1894 2857368435
1895 2857550854
1896 2857561460
1897 2869241215
1898 2869250516
1899 2869262231
1900 2869265826
1901 2871440803
1902 2871463383
1903 2871483074
1904 2874110609
1905 2874123131
1906 2874138978
1907 2876387381
1908 2876423843
1909 2878734303
1910 2878784777
1911 2883071345
1912 2884340419
1913 2884412296
1914 2885194468
1915 2889311947
1916 2894417097
1917 2902335004
1918 2902409912
1919 2903517806
1920 2904424904
1921 2904463206
1922 2906365399
1923 2906375043
1924 2906400379
1925 2906406518
1926 2913040306
1927 2914761997
1928 2919085505
1929 2919405311
1930 2919406005
1931 2922156215
1932 2924738551
1933 2924743898
1934 2928964086
1935 2937867059
1936 2937869066
1937 2937987882
1938 2939614770
1939 2941475789
1940 2953994728
1941 2953997791
1942 2958110730
1943 2958125964
1944 2961184650
1945 2965040249
1946 2965040472
1947 2965089511
1948 2968143135
1949 2970494671
1950 2970514569
1951 2970535680
1952 2970621924
1953 2970633494
1954 2977857573
1955 2977874935
1956 2977898765
1957 2977915099
1958 2977920392
1959 2977954184
1960 2979765105
1961 2979776388
1962 2979793815
1963 2987675672
1964 2996391908
1965 3004171190
1966 3004175311
1967 3004202269
1968 3004233195
1969 3004240199
1970 3004250651
1971 3004270539
1972 3004342715
1973 8003014663
1974 8004314049
1975 8004366937
1976 8004697175
1977 8004734157
1978 8016590493

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00984

UDPG_MGDP_dh

UDP-glucose/GDP-mannose dehydrogenase family, central domain

274

364

0.98

PF03720

UDPG_MGDP_dh_C

UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

390

490

0.94

PF03721

UDPG_MGDP_dh_N

UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

79

260

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgs-assembly1.cif.gz_A crystal endo-deglycosylated hydroxynitrile lyase isozyme 5 mutant l343f from prunus communis 0.9552 9 34
6fjh-assembly1.cif.gz_B crystal structure of the seleniated lkce from streptomyces rochei 0.9067 6 38
6lum-assembly1.cif.gz_J structure of mycobacterium smegmatis succinate dehydrogenase 2 0.9006 7 34
6f7l-assembly1.cif.gz_B crystal structure of lkce r326q mutant in complex with its substrate 0.8962 5 38
4r16-assembly1.cif.gz_B structure of udp-d-mannac dehdrogeanse from pyrococcus horikoshii 0.8933 8 422
ID Description Score Start End Superfamily
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9113 8 199 3.40.50.720
af_Q58883_2_383_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9086 8 38 3.50.50.60
af_A0A1D8PDW7_22_394_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9072 9 38 3.50.50.60
4xr9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.903 1 198 3.40.50.720
af_P27829_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8941 5 198 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5I2T1-F1-model_v4 deleted 1.001 7 87
AF-Q04972-F1-model_v4 UDP-N-acetyl-D-glucosamine 6-dehydrogenase (UDP-GlcNAc 6-dehydrogenase) (EC 1.1.1.136) (Vi polysaccharide biosynthesis protein VipA/TviB) (Vi polysaccharide synthesis gene A) 0.9914 1 423 GO:0016616
GO:0016628
GO:0045227
GO:0051287
AF-A0A3D2R019-F1-model_v4 Vi polysaccharide biosynthesis protein VipA/TviB 0.9914 2 214 GO:0000271
GO:0016616
GO:0016628
GO:0051287
AF-A0A350BW87-F1-model_v4 Vi polysaccharide biosynthesis protein VipA/TviB 0.9912 2 187 GO:0000271
GO:0016616
GO:0016628
GO:0051287
AF-A0A661HFG7-F1-model_v4 Vi polysaccharide biosynthesis protein VipA/TviB 0.9905 7 216 GO:0000271
GO:0016616
GO:0016628
GO:0051287

Map