F487517

General Info

Members Datasets Scaffolds Average Seq Length
986 458 960 318

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10134664|Ga0081455_101346642
Length 319
Sequence MSLDSDVIVDRRRIRRKLTFWRVFAALVAILAVVTIGVIATPGGRGSLATTGSIARVKIDGLIRSDSDRVEALERLEKSQTAAVIVHINSPGGTTAGSEQLYDSLMRLKTKKPLVVVVEGLAASGGYITAIAADHIVAQQSSLIGSIGVLFQYPNFAELLKTVGVKVEEIKSNGYEPTSPEARAAIDALVKDSYAWFRSLVKERRGMDDAQIEKVADGRVFTGRQAVELKLIDALGDEKAAVAWLEANKNVKKGLPVRDYKLTPRFGDLTFLRTATSITLDAIGLSGIARRIEQSGVTQAVDRLSMDGMLALWQPGASN

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
6 2791355199
7 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
8 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
9 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
10 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
11 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
12 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
15 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
16 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
19 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
20 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
21 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
22 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
134 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
135 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
136 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
264 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
389 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
390 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
416 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
417 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
418 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
421 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
422 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
423 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
424 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
425 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
426 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
429 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
430 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
431 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
435 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
436 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
437 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
438 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
439 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
440 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
441 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
442 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
443 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
444 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
445 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
446 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
447 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
448 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
449 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
450 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
451 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
452 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
455 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
456 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
457 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
458 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 2.03
Rhizoplane 7.2
Rhizosphere 68.66
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005816 3300001979 Bacteria 5177
2 JGI24737J22298_10003455 3300001990 Bacteria 5582
3 JGI25406J46586_10001269 3300003203 Bacteria 11845
4 JGI25406J46586_10001837 3300003203 Bacteria 9963
5 JGI25406J46586_10005215 3300003203 Bacteria 6025
6 JGI25153J46596_10009381 3300003215 Bacteria 4558
7 JGI25153J46596_10031830 3300003215 Bacteria 1768
8 JGI25153J46596_10032438 3300003215 Bacteria 1742
9 JGI25153J46596_10034898 3300003215 Bacteria 1637
10 rootH2_10095142 3300003320 Bacteria 2257
11 JGI25160J50197_1020957 3300003354 Bacteria 1956
12 JGI25160J50197_1031796 3300003354 Bacteria 1352
13 JGI25404J52841_10010710 3300003659 Bacteria 1972
14 Ga0055531_10007516 3300003794 Bacteria 5927
15 Ga0065165_1027884 3300005262 Bacteria 1832
16 Ga0065165_1030603 3300005262 Bacteria 1710
17 Ga0065165_1032286 3300005262 Bacteria 1643
18 Ga0070658_10023727 3300005327 Bacteria 4919
19 Ga0070683_100030491 3300005329 Bacteria 4897
20 Ga0070683_100044264 3300005329 Bacteria 4104
21 Ga0070690_100372690 3300005330 Bacteria 1042
22 Ga0070670_100136854 3300005331 Bacteria 2117
23 Ga0070670_100200985 3300005331 Bacteria 1731
24 Ga0068869_100179485 3300005334 Bacteria 1659
25 Ga0070680_100018066 3300005336 Bacteria 5570
26 Ga0070680_100081192 3300005336 Bacteria 2675
27 Ga0070682_100202985 3300005337 Bacteria 1400
28 Ga0068868_100017439 3300005338 Bacteria 5351
29 Ga0068868_100123391 3300005338 Bacteria 2114
30 Ga0070660_100118721 3300005339 Bacteria 2109
31 Ga0070660_100403070 3300005339 Bacteria 1131
32 Ga0070689_100271375 3300005340 Bacteria 1404
33 Ga0070661_100146714 3300005344 Bacteria 1781
34 Ga0070668_100088248 3300005347 Bacteria 2441
35 Ga0070668_100129749 3300005347 Bacteria 2022
36 Ga0070668_100154825 3300005347 Bacteria 1856
37 Ga0070668_100194289 3300005347 Bacteria 1663
38 Ga0070669_100141779 3300005353 Bacteria 1853
39 Ga0070669_100207161 3300005353 Bacteria 1545
40 Ga0070669_100405920 3300005353 Bacteria 1116
41 Ga0070671_100172339 3300005355 Bacteria 1830
42 Ga0070671_100182917 3300005355 Bacteria 1775
43 Ga0070674_100156801 3300005356 Bacteria 1723
44 Ga0070673_100279431 3300005364 Bacteria 1464
45 Ga0070659_100187887 3300005366 Bacteria 1697
46 Ga0070659_100444061 3300005366 Bacteria 1099
47 Ga0070667_100085231 3300005367 Bacteria 2709
48 Ga0070667_100249256 3300005367 Bacteria 1587
49 Ga0070667_100305633 3300005367 Bacteria 1433
50 Ga0070709_10008846 3300005434 Bacteria 5543
51 Ga0070714_100006113 3300005435 Bacteria 9251
52 Ga0070714_100013348 3300005435 Bacteria 6584
53 Ga0070714_100089955 3300005435 Bacteria 2688
54 Ga0070713_100033309 3300005436 Bacteria 4125
55 Ga0070713_100035723 3300005436 Bacteria 4004
56 Ga0070713_100046936 3300005436 Bacteria 3547
57 Ga0070713_100091253 3300005436 Bacteria 2620
58 Ga0070713_100245358 3300005436 Bacteria 1632
59 Ga0070710_10000629 3300005437 Bacteria 16796
60 Ga0070710_10002613 3300005437 Bacteria 8561
61 Ga0070711_100007337 3300005439 Bacteria 6709
62 Ga0070711_100007770 3300005439 Bacteria 6531
63 Ga0070711_100091165 3300005439 Bacteria 2196
64 Ga0070700_100101950 3300005441 Bacteria 1892
65 Ga0070694_100109692 3300005444 Bacteria 1964
66 Ga0070663_100005737 3300005455 Bacteria 7404
67 Ga0070663_100030169 3300005455 Bacteria 3713
68 Ga0070663_100082650 3300005455 Bacteria 2363
69 Ga0070663_100105313 3300005455 Bacteria 2111
70 Ga0070663_100121391 3300005455 Bacteria 1974
71 Ga0070663_100176525 3300005455 Bacteria 1654
72 Ga0070663_100223453 3300005455 Bacteria 1479
73 Ga0070678_100179341 3300005456 Bacteria 1732
74 Ga0070678_100270236 3300005456 Bacteria 1433
75 Ga0070662_100152209 3300005457 Bacteria 1802
76 Ga0070662_100349043 3300005457 Bacteria 1212
77 Ga0070681_10065324 3300005458 Bacteria 3607
78 Ga0070681_10138275 3300005458 Bacteria 2365
79 Ga0070681_10140700 3300005458 Bacteria 2343
80 Ga0070681_10286788 3300005458 Bacteria 1557
81 Ga0070685_10140521 3300005466 Bacteria 1520
82 Ga0070707_100074049 3300005468 Bacteria 3283
83 Ga0070707_100117076 3300005468 Bacteria 2586
84 Ga0070698_100270947 3300005471 Bacteria 1629
85 Ga0070698_100338567 3300005471 Bacteria 1436
86 Ga0070679_100111200 3300005530 Bacteria 2726
87 Ga0070679_100243743 3300005530 Bacteria 1754
88 Ga0070679_100334017 3300005530 Bacteria 1464
89 Ga0070684_100003879 3300005535 Bacteria 11314
90 Ga0070684_100052912 3300005535 Bacteria 3532
91 Ga0070684_100335350 3300005535 Bacteria 1390
92 Ga0068853_100001617 3300005539 Bacteria 16448
93 Ga0068853_100012905 3300005539 Bacteria 6808
94 Ga0068853_100029373 3300005539 Bacteria 4634
95 Ga0068853_100126841 3300005539 Bacteria 2280
96 Ga0068853_100180047 3300005539 Bacteria 1916
97 Ga0070686_100088905 3300005544 Bacteria 2062
98 Ga0070665_100019142 3300005548 Bacteria 6869
99 Ga0070665_100128458 3300005548 Bacteria 2537
100 Ga0070665_100277819 3300005548 Bacteria 1677
101 Ga0070665_100442234 3300005548 Bacteria 1309
102 Ga0068855_100057419 3300005563 Bacteria 4562
103 Ga0068855_100090885 3300005563 Bacteria 3522
104 Ga0068855_100188548 3300005563 Bacteria 2327
105 Ga0070664_100138901 3300005564 Bacteria 2138
106 Ga0068857_100040874 3300005577 Bacteria 4111
107 Ga0068857_100088196 3300005577 Bacteria 2775
108 Ga0068854_100026066 3300005578 Bacteria 4014
109 Ga0068854_100096044 3300005578 Bacteria 2213
110 Ga0068856_100074933 3300005614 Bacteria 3351
111 Ga0068856_100197610 3300005614 Bacteria 2025
112 Ga0068856_100231152 3300005614 Bacteria 1865
113 Ga0068856_100247067 3300005614 Bacteria 1800
114 Ga0070702_100042184 3300005615 Bacteria 2564
115 Ga0068852_100020357 3300005616 Bacteria 5275
116 Ga0068859_100177940 3300005617 Bacteria 2209
117 Ga0068859_100378331 3300005617 Bacteria 1511
118 Ga0068864_100055720 3300005618 Bacteria 3414
119 Ga0068864_100094342 3300005618 Bacteria 2645
120 Ga0068864_100325057 3300005618 Bacteria 1445
121 Ga0068864_100347988 3300005618 Bacteria 1398
122 Ga0068866_10062985 3300005718 Bacteria 1931
123 Ga0068866_10166041 3300005718 Bacteria 1292
124 Ga0068866_10269179 3300005718 Bacteria 1051
125 Ga0068861_100169819 3300005719 Bacteria 1807
126 Ga0068861_100185350 3300005719 Bacteria 1735
127 Ga0068861_100352524 3300005719 Bacteria 1291
128 Ga0068851_10004728 3300005834 Bacteria 6164
129 Ga0068863_100415836 3300005841 Bacteria 1317
130 Ga0068863_100609846 3300005841 Bacteria 1081
131 Ga0068858_100195042 3300005842 Bacteria 1914
132 Ga0068860_100001803 3300005843 Bacteria 22784
133 Ga0068860_100112266 3300005843 Bacteria 2606
134 Ga0068862_100273969 3300005844 Bacteria 1544
135 Ga0081455_10049478 3300005937 Bacteria 3623
136 Ga0081455_10050463 3300005937 Bacteria 3578
137 Ga0081455_10061926 3300005937 Bacteria 3147
138 Ga0081455_10134664 3300005937 Bacteria 1927
139 Ga0081538_10042376 3300005981 Bacteria 2874
140 Ga0081540_1011691 3300005983 Bacteria 5845
141 Ga0081540_1014715 3300005983 Bacteria 4995
142 Ga0081540_1021762 3300005983 Bacteria 3807
143 Ga0081540_1024510 3300005983 Bacteria 3500
144 Ga0081540_1033318 3300005983 Bacteria 2800
145 Ga0081540_1035887 3300005983 Bacteria 2652
146 Ga0081540_1060263 3300005983 Bacteria 1817
147 Ga0081540_1065822 3300005983 Bacteria 1702
148 Ga0081539_10000064 3300005985 Bacteria 247020
149 Ga0081539_10002206 3300005985 Bacteria 28466
150 Ga0081539_10079352 3300005985 Bacteria 1730
151 Ga0081539_10114377 3300005985 Bacteria 1352
152 Ga0070717_10001080 3300006028 Bacteria 18339
153 Ga0075365_10066556 3300006038 Bacteria 2417
154 Ga0075365_10126224 3300006038 Bacteria 1768
155 Ga0075365_10171066 3300006038 Bacteria 1516
156 Ga0075365_10176074 3300006038 Bacteria 1494
157 Ga0075365_10221546 3300006038 Bacteria 1327
158 Ga0075365_10284016 3300006038 Bacteria 1165
159 Ga0075368_10021396 3300006042 Bacteria 2456
160 Ga0075363_100005325 3300006048 Bacteria 5711
161 Ga0075363_100030237 3300006048 Bacteria 2802
162 Ga0075364_10005413 3300006051 Bacteria 7413
163 Ga0075364_10022995 3300006051 Bacteria 3943
164 Ga0075364_10098288 3300006051 Bacteria 1947
165 Ga0075364_10139088 3300006051 Bacteria 1632
166 Ga0070715_10088356 3300006163 Bacteria 1421
167 Ga0070716_100000664 3300006173 Bacteria 14620
168 Ga0070716_100000748 3300006173 Bacteria 13913
169 Ga0070716_100068077 3300006173 Bacteria 2082
170 Ga0070716_100145980 3300006173 Bacteria 1515
171 Ga0070712_100006771 3300006175 Bacteria 7128
172 Ga0070712_100022828 3300006175 Bacteria 4125
173 Ga0070712_100061362 3300006175 Bacteria 2656
174 Ga0070712_100161689 3300006175 Bacteria 1730
175 Ga0075367_10015170 3300006178 Bacteria 4182
176 Ga0075367_10041093 3300006178 Bacteria 2702
177 Ga0075367_10114965 3300006178 Bacteria 1654
178 Ga0075369_10056747 3300006186 Bacteria 1702
179 Ga0075369_10057758 3300006186 Bacteria 1688
180 Ga0075369_10066856 3300006186 Bacteria 1577
181 Ga0075366_10085515 3300006195 Bacteria 1886
182 Ga0075366_10110989 3300006195 Bacteria 1649
183 Ga0075366_10115633 3300006195 Bacteria 1615
184 Ga0075370_10136286 3300006353 Bacteria 1434
185 Ga0075370_10163340 3300006353 Bacteria 1307
186 Ga0068871_100226482 3300006358 Bacteria 1621
187 Ga0068871_100237795 3300006358 Bacteria 1582
188 Ga0075434_100028847 3300006871 Bacteria 5458
189 Ga0075434_100502283 3300006871 Bacteria 1234
190 Ga0068865_100076637 3300006881 Bacteria 2387
191 Ga0097620_100177946 3300006931 Bacteria 2209
192 Ga0097620_100378367 3300006931 Bacteria 1511
193 Ga0099824_1035261 3300006942 Bacteria 1538
194 Ga0099822_1048339 3300006943 Bacteria 1888
195 Ga0075435_100130333 3300007076 Bacteria 2104
196 Ga0099795_10018310 3300007788 Bacteria 2249
197 Ga0099795_10022791 3300007788 Bacteria 2071
198 Ga0105240_10001754 3300009093 Bacteria 36622
199 Ga0105240_10096404 3300009093 Bacteria 3604
200 Ga0111539_10170198 3300009094 Bacteria 2545
201 Ga0105245_10047428 3300009098 Bacteria 3841
202 Ga0105245_10476191 3300009098 Bacteria 1261
203 Ga0105247_10110443 3300009101 Bacteria 1769
204 Ga0105243_10088250 3300009148 Bacteria 2548
205 Ga0105241_10002619 3300009174 Bacteria 13477
206 Ga0105241_10149265 3300009174 Bacteria 1911
207 Ga0105242_10216101 3300009176 Bacteria 1711
208 Ga0105242_10223162 3300009176 Bacteria 1685
209 Ga0105242_10306837 3300009176 Bacteria 1451
210 Ga0105248_10169571 3300009177 Bacteria 2460
211 Ga0105248_10269055 3300009177 Bacteria 1919
212 Ga0105248_10305134 3300009177 Bacteria 1793
213 Ga0105248_10385848 3300009177 Bacteria 1577
214 Ga0105237_10005399 3300009545 Bacteria 14437
215 Ga0105237_10056521 3300009545 Bacteria 3928
216 Ga0105237_10155584 3300009545 Bacteria 2283
217 Ga0105237_10427826 3300009545 Bacteria 1329
218 Ga0105237_10436441 3300009545 Bacteria 1315
219 Ga0105238_10001086 3300009551 Bacteria 27451
220 Ga0105238_10012034 3300009551 Bacteria 8716
221 Ga0105238_10041846 3300009551 Bacteria 4640
222 Ga0105238_10046561 3300009551 Bacteria 4375
223 Ga0105238_10090291 3300009551 Bacteria 3051
224 Ga0105238_10259535 3300009551 Bacteria 1717
225 Ga0105239_10087195 3300010375 Bacteria 3441
226 Ga0105239_10089479 3300010375 Bacteria 3395
227 Ga0105239_10095047 3300010375 Bacteria 3293
228 Ga0105239_10118948 3300010375 Bacteria 2932
229 Ga0105239_10123251 3300010375 Bacteria 2880
230 Ga0105239_10201621 3300010375 Bacteria 2229
231 Ga0105239_10582780 3300010375 Bacteria 1275
232 Ga0105246_10055737 3300011119 Bacteria 2729
233 Ga0105246_10094231 3300011119 Bacteria 2165
234 Ga0105246_10156765 3300011119 Bacteria 1730
235 Ga0157370_10148044 3300013104 Bacteria 2186
236 Ga0157370_10179694 3300013104 Bacteria 1966
237 Ga0157369_10010838 3300013105 Bacteria 10382
238 Ga0157369_10206061 3300013105 Bacteria 2063
239 Ga0157374_10232416 3300013296 Bacteria 1811
240 Ga0157374_10242658 3300013296 Bacteria 1772
241 Ga0163162_10091446 3300013306 Bacteria 3126
242 Ga0163162_10134721 3300013306 Bacteria 2581
243 Ga0163162_10314595 3300013306 Bacteria 1698
244 Ga0157372_10244664 3300013307 Bacteria 2081
245 Ga0157375_10014475 3300013308 Bacteria 7038
246 Ga0157375_10459482 3300013308 Bacteria 1439
247 Ga0163163_10151405 3300014325 Bacteria 2363
248 Ga0163163_10272647 3300014325 Bacteria 1743
249 Ga0157380_10275534 3300014326 Bacteria 1536
250 Ga0157380_10309704 3300014326 Bacteria 1459
251 Ga0157380_10464666 3300014326 Bacteria 1219
252 Ga0157377_10121907 3300014745 Bacteria 1581
253 Ga0157379_10149877 3300014968 Bacteria 2104
254 Ga0157379_10183167 3300014968 Bacteria 1892
255 Ga0157379_10451192 3300014968 Bacteria 1187
256 Ga0157376_10285751 3300014969 Bacteria 1555
257 Ga0163161_10271152 3300017792 Bacteria 1328
258 Ga0214544_1000056 3300021320 Bacteria 132760
259 Ga0214542_1000071 3300021321 Bacteria 124568
260 Ga0214545_1000033 3300021324 Bacteria 124568
261 Ga0214543_1000105 3300021327 Bacteria 108404
262 Ga0213876_10001803 3300021384 Bacteria 12975
263 Ga0213876_10140647 3300021384 Bacteria 1284
264 Ga0209563_103943 3300025230 Bacteria 2930
265 Ga0209677_102065 3300025253 Bacteria 7934
266 Ga0209677_103578 3300025253 Bacteria 4941
267 Ga0209455_1002169 3300025272 Bacteria 7785
268 Ga0209455_1005163 3300025272 Bacteria 4102
269 Ga0209564_1000494 3300025295 Bacteria 65041
270 Ga0209564_1004819 3300025295 Bacteria 8035
271 Ga0209564_1014152 3300025295 Bacteria 3338
272 Ga0209758_1000293 3300025297 Bacteria 98643
273 Ga0209758_1000363 3300025297 Bacteria 80753
274 Ga0209758_1002182 3300025297 Bacteria 20519
275 Ga0209758_1002431 3300025297 Bacteria 19009
276 Ga0209758_1007289 3300025297 Bacteria 7587
277 Ga0209758_1020122 3300025297 Bacteria 3176
278 Ga0209758_1021319 3300025297 Bacteria 3023
279 Ga0209758_1043810 3300025297 Bacteria 1644
280 Ga0209758_1044141 3300025297 Bacteria 1634
281 Ga0209256_1025597 3300025299 Bacteria 1715
282 Ga0207426_1000628 3300025302 Bacteria 44820
283 Ga0207426_1021037 3300025302 Bacteria 2259
284 Ga0207426_1032857 3300025302 Bacteria 1678
285 Ga0209051_1049651 3300025303 Bacteria 1411
286 Ga0209257_1004770 3300025304 Bacteria 10117
287 Ga0207656_10003723 3300025321 Bacteria 5277
288 Ga0207656_10034381 3300025321 Bacteria 2116
289 Ga0207653_10037315 3300025885 Bacteria 1585
290 Ga0207692_10000489 3300025898 Bacteria 13992
291 Ga0207692_10001833 3300025898 Bacteria 8070
292 Ga0207692_10146904 3300025898 Bacteria 1346
293 Ga0207688_10094818 3300025901 Bacteria 1717
294 Ga0207688_10119321 3300025901 Bacteria 1538
295 Ga0207647_10005928 3300025904 Bacteria 8911
296 Ga0207647_10022688 3300025904 Bacteria 4165
297 Ga0207647_10112955 3300025904 Bacteria 1605
298 Ga0207685_10017251 3300025905 Bacteria 2330
299 Ga0207699_10004893 3300025906 Bacteria 6408
300 Ga0207699_10177335 3300025906 Bacteria 1430
301 Ga0207645_10054999 3300025907 Bacteria 2541
302 Ga0207654_10000175 3300025911 Bacteria 39744
303 Ga0207654_10057116 3300025911 Bacteria 2267
304 Ga0207654_10114889 3300025911 Bacteria 1681
305 Ga0207654_10275673 3300025911 Bacteria 1136
306 Ga0207707_10006420 3300025912 Bacteria 10269
307 Ga0207707_10094981 3300025912 Bacteria 2606
308 Ga0207707_10174435 3300025912 Bacteria 1878
309 Ga0207695_10009236 3300025913 Bacteria 12220
310 Ga0207695_10069546 3300025913 Bacteria 3602
311 Ga0207695_10182037 3300025913 Bacteria 2022
312 Ga0207695_10349839 3300025913 Bacteria 1365
313 Ga0207671_10049421 3300025914 Bacteria 3114
314 Ga0207671_10066601 3300025914 Bacteria 2681
315 Ga0207671_10068734 3300025914 Bacteria 2640
316 Ga0207671_10072485 3300025914 Bacteria 2571
317 Ga0207671_10117218 3300025914 Bacteria 2032
318 Ga0207671_10187877 3300025914 Bacteria 1610
319 Ga0207693_10011033 3300025915 Bacteria 7323
320 Ga0207693_10011474 3300025915 Bacteria 7168
321 Ga0207693_10015141 3300025915 Bacteria 6190
322 Ga0207693_10022773 3300025915 Bacteria 4974
323 Ga0207663_10058429 3300025916 Bacteria 2434
324 Ga0207663_10062979 3300025916 Bacteria 2360
325 Ga0207663_10116758 3300025916 Bacteria 1820
326 Ga0207663_10396334 3300025916 Bacteria 1055
327 Ga0207660_10006956 3300025917 Bacteria 7325
328 Ga0207660_10107988 3300025917 Bacteria 2089
329 Ga0207660_10180179 3300025917 Bacteria 1641
330 Ga0207660_10208081 3300025917 Bacteria 1531
331 Ga0207662_10162946 3300025918 Bacteria 1426
332 Ga0207657_10004312 3300025919 Bacteria 15074
333 Ga0207657_10030642 3300025919 Bacteria 4881
334 Ga0207657_10181769 3300025919 Bacteria 1700
335 Ga0207657_10189204 3300025919 Bacteria 1661
336 Ga0207652_10010962 3300025921 Bacteria 7308
337 Ga0207652_10103551 3300025921 Bacteria 2516
338 Ga0207652_10275043 3300025921 Bacteria 1519
339 Ga0207652_10358357 3300025921 Bacteria 1316
340 Ga0207646_10062005 3300025922 Bacteria 3338
341 Ga0207681_10341544 3300025923 Bacteria 1196
342 Ga0207694_10000226 3300025924 Bacteria 54504
343 Ga0207694_10018472 3300025924 Bacteria 5271
344 Ga0207694_10062964 3300025924 Bacteria 2889
345 Ga0207694_10086361 3300025924 Bacteria 2470
346 Ga0207650_10090200 3300025925 Bacteria 2341
347 Ga0207659_10350710 3300025926 Bacteria 1224
348 Ga0207687_10144393 3300025927 Bacteria 1809
349 Ga0207687_10159431 3300025927 Bacteria 1730
350 Ga0207700_10027465 3300025928 Bacteria 3986
351 Ga0207700_10053782 3300025928 Bacteria 3018
352 Ga0207700_10083890 3300025928 Bacteria 2496
353 Ga0207700_10147668 3300025928 Bacteria 1940
354 Ga0207700_10249354 3300025928 Bacteria 1516
355 Ga0207700_10302826 3300025928 Bacteria 1381
356 Ga0207664_10004352 3300025929 Bacteria 9590
357 Ga0207664_10042658 3300025929 Bacteria 3542
358 Ga0207664_10043916 3300025929 Bacteria 3498
359 Ga0207664_10239471 3300025929 Bacteria 1580
360 Ga0207644_10052228 3300025931 Bacteria 2937
361 Ga0207644_10214732 3300025931 Bacteria 1522
362 Ga0207644_10218990 3300025931 Bacteria 1508
363 Ga0207690_10296022 3300025932 Bacteria 1265
364 Ga0207706_10080388 3300025933 Bacteria 2866
365 Ga0207706_10239310 3300025933 Bacteria 1587
366 Ga0207686_10243828 3300025934 Bacteria 1309
367 Ga0207709_10189716 3300025935 Bacteria 1459
368 Ga0207670_10103182 3300025936 Bacteria 2040
369 Ga0207665_10000235 3300025939 Bacteria 37854
370 Ga0207665_10001984 3300025939 Bacteria 13791
371 Ga0207665_10105429 3300025939 Bacteria 1974
372 Ga0207665_10167723 3300025939 Bacteria 1583
373 Ga0207691_10089157 3300025940 Bacteria 2766
374 Ga0207711_10220555 3300025941 Bacteria 1734
375 Ga0207711_10254365 3300025941 Bacteria 1614
376 Ga0207689_10145962 3300025942 Bacteria 1949
377 Ga0207689_10203379 3300025942 Bacteria 1635
378 Ga0207689_10325570 3300025942 Bacteria 1276
379 Ga0207661_10001179 3300025944 Bacteria 17473
380 Ga0207661_10039390 3300025944 Bacteria 3709
381 Ga0207679_10247549 3300025945 Bacteria 1513
382 Ga0207679_10265154 3300025945 Bacteria 1467
383 Ga0207667_10004170 3300025949 Bacteria 17753
384 Ga0207667_10004673 3300025949 Bacteria 16774
385 Ga0207667_10010892 3300025949 Bacteria 10602
386 Ga0207667_10047542 3300025949 Bacteria 4541
387 Ga0207667_10153908 3300025949 Bacteria 2366
388 Ga0207667_10186840 3300025949 Bacteria 2127
389 Ga0207667_10363491 3300025949 Bacteria 1476
390 Ga0207668_10081435 3300025972 Bacteria 2348
391 Ga0207668_10115575 3300025972 Bacteria 2021
392 Ga0207640_10004452 3300025981 Bacteria 7593
393 Ga0207640_10021376 3300025981 Bacteria 3856
394 Ga0207658_10147266 3300025986 Bacteria 1914
395 Ga0207677_10013346 3300026023 Bacteria 4757
396 Ga0207703_10138291 3300026035 Bacteria 2111
397 Ga0207639_10006164 3300026041 Bacteria 8141
398 Ga0207639_10019626 3300026041 Bacteria 4824
399 Ga0207639_10021327 3300026041 Bacteria 4652
400 Ga0207639_10104816 3300026041 Bacteria 2293
401 Ga0207639_10308097 3300026041 Bacteria 1402
402 Ga0207678_10052756 3300026067 Bacteria 3507
403 Ga0207678_10060689 3300026067 Bacteria 3252
404 Ga0207678_10068056 3300026067 Bacteria 3056
405 Ga0207678_10121258 3300026067 Bacteria 2231
406 Ga0207678_10169969 3300026067 Bacteria 1861
407 Ga0207678_10190307 3300026067 Bacteria 1753
408 Ga0207678_10204927 3300026067 Bacteria 1687
409 Ga0207678_10209987 3300026067 Bacteria 1665
410 Ga0207678_10259286 3300026067 Bacteria 1490
411 Ga0207708_10175218 3300026075 Bacteria 1701
412 Ga0207708_10294888 3300026075 Bacteria 1317
413 Ga0207702_10000004 3300026078 Bacteria 422182
414 Ga0207702_10052064 3300026078 Bacteria 3462
415 Ga0207702_10530611 3300026078 Bacteria 1150
416 Ga0207641_10127533 3300026088 Bacteria 2280
417 Ga0207641_10251432 3300026088 Bacteria 1651
418 Ga0207641_10569331 3300026088 Bacteria 1106
419 Ga0207648_10286296 3300026089 Bacteria 1474
420 Ga0207648_10351005 3300026089 Bacteria 1330
421 Ga0207676_10158453 3300026095 Bacteria 1958
422 Ga0207676_10317651 3300026095 Bacteria 1428
423 Ga0207674_10008354 3300026116 Bacteria 11974
424 Ga0207674_10021710 3300026116 Bacteria 6909
425 Ga0207674_10035034 3300026116 Bacteria 5240
426 Ga0207674_10231467 3300026116 Bacteria 1795
427 Ga0207674_10388239 3300026116 Bacteria 1350
428 Ga0207675_100199827 3300026118 Bacteria 1920
429 Ga0207683_10061295 3300026121 Bacteria 3310
430 Ga0207683_10117340 3300026121 Bacteria 2386
431 Ga0207683_10227305 3300026121 Bacteria 1701
432 Ga0207683_10248661 3300026121 Bacteria 1622
433 Ga0207698_10025144 3300026142 Bacteria 4189
434 Ga0207698_10297811 3300026142 Bacteria 1500
435 Ga0209389_1045303 3300027296 Bacteria 3237
436 Ga0209589_1000032 3300027357 Bacteria 141881
437 Ga0209813_10052997 3300027866 Bacteria 1274
438 Ga0268266_10002812 3300028379 Bacteria 18151
439 Ga0268266_10029434 3300028379 Bacteria 4668
440 Ga0268266_10159216 3300028379 Bacteria 2041
441 Ga0268265_10175233 3300028380 Bacteria 1837
442 Ga0268265_10219803 3300028380 Bacteria 1661
443 Ga0268265_10266720 3300028380 Bacteria 1525
444 Ga0268264_10000157 3300028381 Bacteria 155163
445 Ga0265337_1016358 3300028556 Bacteria 2399
446 Ga0265318_10012173 3300028577 Bacteria 3671
447 Ga0265323_10001778 3300028653 Bacteria 10233
448 Ga0265336_10000235 3300028666 Bacteria 39578
449 Ga0307517_10000563 3300028786 Bacteria 63467
450 Ga0307515_10008720 3300028794 Bacteria 19712
451 Ga0307515_10216473 3300028794 Bacteria 1745
452 Ga0307515_10306556 3300028794 Bacteria 1267
453 Ga0265338_10005155 3300028800 Bacteria 17189
454 Ga0265330_10028933 3300031235 Bacteria 2494
455 Ga0265330_10031347 3300031235 Bacteria 2383
456 Ga0265330_10038596 3300031235 Bacteria 2123
457 Ga0265325_10013306 3300031241 Bacteria 4686
458 Ga0265340_10018279 3300031247 Bacteria 3616
459 Ga0265339_10004403 3300031249 Bacteria 9609
460 Ga0265339_10031070 3300031249 Bacteria 3020
461 Ga0265331_10124615 3300031250 Bacteria 1177
462 Ga0265331_10140112 3300031250 Bacteria 1100
463 Ga0265316_10045955 3300031344 Bacteria 3463
464 Ga0307513_10112840 3300031456 Bacteria 2707
465 Ga0307509_10146627 3300031507 Bacteria 2284
466 Ga0307508_10111626 3300031616 Bacteria 2334
467 Ga0307508_10197490 3300031616 Bacteria 1613
468 Ga0265314_10003979 3300031711 Bacteria 13976
469 Ga0265314_10039691 3300031711 Bacteria 3387
470 Ga0265314_10056041 3300031711 Bacteria 2716
471 Ga0307516_10008798 3300031730 Bacteria 11346
472 Ga0307516_10029494 3300031730 Bacteria 5547
473 Ga0307516_10072493 3300031730 Bacteria 3303
474 Ga0307516_10123753 3300031730 Bacteria 2373
475 Ga0307516_10150815 3300031730 Bacteria 2085
476 Ga0307405_10122141 3300031731 Bacteria 1784
477 Ga0307412_10021273 3300031911 Bacteria 3960
478 Ga0307409_100188945 3300031995 Bacteria 1831
479 Ga0307416_100731718 3300032002 Bacteria 1081
480 Ga0307414_10274834 3300032004 Bacteria 1413
481 Ga0307415_100137369 3300032126 Bacteria 1861
482 Ga0307507_10127820 3300033179 Bacteria 2002
483 Ga0307510_10016268 3300033180 Bacteria 8782
484 Ga0373929_0011781 3300035085 Bacteria 1653
485 Ga0373934_0014023 3300035086 Bacteria 3034
486 Ga0373934_0017026 3300035086 Bacteria 2770
487 Ga0373923_0036024 3300035111 Bacteria 2017
488 Ga0373923_0054605 3300035111 Bacteria 1682
489 Ga0373923_0059945 3300035111 Bacteria 1614
490 Ga0373923_0097735 3300035111 Bacteria 1291
491 Ga0373932_0020184 3300035112 Bacteria 1745
492 Ga0373945_0004476 3300035116 Bacteria 4442
493 Ga0373945_0014361 3300035116 Bacteria 2652
494 Ga0373945_0048748 3300035116 Bacteria 1553
495 Ga0373953_0002371 3300035117 Bacteria 5685
496 Ga0373953_0017348 3300035117 Bacteria 2645
497 Ga0373954_0000485 3300035118 Bacteria 14918
498 Ga0373954_0011861 3300035118 Bacteria 3870
499 Ga0373956_0002322 3300035119 Bacteria 7818
500 Ga0373957_0002098 3300035120 Bacteria 5594
501 Ga0373943_0041100 3300035170 Bacteria 2235
502 Ga0373946_0006060 3300035171 Bacteria 4383
503 Ga0373946_0026634 3300035171 Bacteria 2282
504 Ga0373955_0001048 3300035172 Bacteria 11759
505 Ga0373955_0020825 3300035172 Bacteria 3301
506 Ga0373955_0029460 3300035172 Bacteria 2855
507 Ga0373924_0010097 3300035410 Bacteria 3476
508 Ga0373931_0001548 3300035691 Bacteria 9916
509 Ga0373935_0053046 3300035692 Bacteria 2579
510 Ga0373927_0003498 3300035695 Bacteria 11247
511 Ga0373927_0022428 3300035695 Bacteria 4136
512 Ga0373927_0062796 3300035695 Bacteria 2402
513 Ga0373927_0101520 3300035695 Bacteria 1871
514 Ga0373933_0000118 3300035724 Bacteria 51316
515 Ga0373933_0006053 3300035724 Bacteria 6581
516 Ga0373933_0097317 3300035724 Bacteria 1822
517 Ga0373947_0004053 3300035725 Bacteria 8620
518 Ga0373947_0009689 3300035725 Bacteria 5527
519 Ga0373947_0021326 3300035725 Bacteria 3749
520 Ga0373947_0041568 3300035725 Bacteria 2741
521 Ga0373947_0046047 3300035725 Bacteria 2611
522 Ga0373947_0133742 3300035725 Bacteria 1585
523 Ga0373937_0012128 3300036401 Bacteria 7565
524 Ga0373937_0300788 3300036401 Bacteria 1516
525 Ga0373925_0033366 3300037068 Bacteria 3793
526 Ga0373925_0106535 3300037068 Bacteria 2161
527 Ga0373925_0249118 3300037068 Bacteria 1424
528 Ga0395899_0021904 3300037312 Bacteria 4847
529 Ga0395900_0021426 3300037418 Bacteria 6608
530 Ga0395900_0139445 3300037418 Bacteria 2484
531 Ga0395900_0166459 3300037418 Bacteria 2246
532 Ga0395898_0173338 3300037466 Bacteria 2062
533 Ga0395905_0023934 3300037471 Bacteria 5766
534 Ga0395905_0108510 3300037471 Bacteria 2606
535 Ga0395901_0181332 3300038443 Bacteria 2209
536 Ga0395901_0306555 3300038443 Bacteria 1645
537 Ga0395901_0431503 3300038443 Bacteria 1350
538 Ga0436365_0361268 3300039437 Bacteria 2498
539 Ga0436365_0517722 3300039437 Bacteria 5048
540 Ga0436360_0293778 3300039438 Bacteria 2982
541 Ga0436361_1023898 3300039447 Bacteria 3273
542 Ga0436363_1514070 3300039450 Bacteria 1125
543 Ga0436362_1162178 3300039453 Bacteria 3662
544 Ga0439465_0068274 3300041413 Bacteria 1188
545 Ga0451853_0973839 3300041512 Bacteria 1978
546 Ga0466965_0017444 3300044683 Bacteria 3432
547 Ga0466963_0044606 3300044694 Bacteria 2919
548 Ga0466970_0065407 3300044765 Bacteria 1951
549 Ga0466959_0195472 3300045049 Bacteria 1410
550 Ga0466967_0044378 3300045976 Bacteria 3856
551 Ga0466967_0131367 3300045976 Bacteria 2325
552 Ga0495592_0000993 3300046454 Bacteria 19682
553 Ga0495592_0024966 3300046454 Bacteria 4540
554 Ga0495603_0000826 3300046455 Bacteria 17795
555 Ga0495603_0003332 3300046455 Bacteria 9567
556 Ga0495603_0011755 3300046455 Bacteria 5297
557 Ga0495603_0038493 3300046455 Bacteria 2867
558 Ga0495603_0041753 3300046455 Bacteria 2742
559 Ga0495603_0189697 3300046455 Bacteria 1189
560 Ga0495590_0033206 3300046457 Bacteria 1804
561 Ga0495629_0000337 3300046459 Bacteria 40017
562 Ga0495629_0000587 3300046459 Bacteria 29538
563 Ga0495629_0046968 3300046459 Bacteria 3028
564 Ga0495629_0098022 3300046459 Bacteria 2045
565 Ga0495629_0230143 3300046459 Bacteria 1278
566 Ga0495638_0009712 3300046460 Bacteria 6725
567 Ga0495638_0051601 3300046460 Bacteria 2565
568 Ga0495638_0166544 3300046460 Bacteria 1267
569 Ga0495641_0003504 3300046461 Bacteria 11691
570 Ga0495651_0003587 3300046462 Bacteria 11904
571 Ga0495651_0039355 3300046462 Bacteria 3681
572 Ga0495651_0044737 3300046462 Bacteria 3431
573 Ga0495651_0088120 3300046462 Bacteria 2333
574 Ga0495653_0010108 3300046463 Bacteria 7721
575 Ga0495653_0030974 3300046463 Bacteria 4255
576 Ga0495653_0081954 3300046463 Bacteria 2383
577 Ga0495580_0025540 3300046472 Bacteria 4317
578 Ga0495582_0000018 3300046473 Bacteria 93753
579 Ga0495582_0057510 3300046473 Bacteria 2144
580 Ga0495639_0000272 3300046475 Bacteria 25666
581 Ga0495639_0041989 3300046475 Bacteria 2061
582 Ga0495662_0002085 3300046476 Bacteria 10023
583 Ga0495662_0013233 3300046476 Bacteria 4016
584 Ga0495664_0006563 3300046477 Bacteria 6428
585 Ga0495664_0020862 3300046477 Bacteria 3782
586 Ga0495664_0071543 3300046477 Bacteria 2071
587 Ga0495664_0238881 3300046477 Bacteria 1099
588 Ga0495584_0091861 3300046491 Bacteria 1531
589 Ga0495585_0035860 3300046492 Bacteria 2800
590 Ga0495594_0000155 3300046499 Bacteria 32688
591 Ga0495594_0075554 3300046499 Bacteria 1878
592 Ga0495594_0109963 3300046499 Bacteria 1554
593 Ga0495583_0042472 3300046506 Bacteria 2123
594 Ga0495606_0000676 3300046507 Bacteria 53366
595 Ga0495606_0117167 3300046507 Bacteria 1599
596 Ga0495606_0153692 3300046507 Bacteria 1348
597 Ga0495608_0001320 3300046511 Bacteria 17655
598 Ga0495608_0051601 3300046511 Bacteria 2725
599 Ga0495616_0016900 3300046513 Bacteria 4029
600 Ga0495616_0025703 3300046513 Bacteria 3142
601 Ga0495618_0004991 3300046514 Bacteria 8108
602 Ga0495620_0040570 3300046515 Bacteria 2047
603 Ga0495628_0010505 3300046516 Bacteria 7859
604 Ga0495628_0016528 3300046516 Bacteria 6154
605 Ga0495628_0064930 3300046516 Bacteria 2857
606 Ga0495630_0018269 3300046517 Bacteria 5149
607 Ga0495630_0079856 3300046517 Bacteria 2467
608 Ga0495630_0119514 3300046517 Bacteria 1999
609 Ga0495631_0055303 3300046518 Bacteria 1729
610 Ga0495632_0061977 3300046519 Bacteria 1814
611 Ga0495643_0014351 3300046522 Bacteria 4714
612 Ga0495648_0001519 3300046524 Bacteria 22713
613 Ga0495648_0189502 3300046524 Bacteria 1039
614 Ga0495666_0151344 3300046526 Bacteria 1079
615 Ga0495666_0162627 3300046526 Bacteria 1035
616 Ga0495652_0001922 3300046529 Bacteria 22097
617 Ga0495652_0025697 3300046529 Bacteria 5205
618 Ga0495652_0047147 3300046529 Bacteria 3696
619 Ga0495654_0032538 3300046530 Bacteria 2643
620 Ga0495665_0009932 3300046531 Bacteria 5153
621 Ga0495640_0020760 3300046533 Bacteria 4830
622 Ga0495640_0038318 3300046533 Bacteria 3372
623 Ga0495640_0122210 3300046533 Bacteria 1691
624 Ga0495587_0003825 3300046536 Bacteria 9992
625 Ga0495645_0121085 3300046543 Bacteria 1842
626 Ga0495622_0006549 3300046557 Bacteria 5401
627 Ga0495622_0010378 3300046557 Bacteria 4307
628 Ga0495622_0090200 3300046557 Bacteria 1408
629 Ga0495633_0098374 3300046558 Bacteria 1358
630 Ga0495633_0137069 3300046558 Bacteria 1132
631 Ga0495667_0000270 3300046559 Bacteria 33708
632 Ga0495667_0083208 3300046559 Bacteria 2078
633 Ga0495656_0003938 3300046615 Bacteria 5044
634 Ga0495656_0023834 3300046615 Bacteria 2411
635 Ga0495656_0139055 3300046615 Bacteria 1163
636 Ga0495634_0005445 3300046642 Bacteria 9793
637 Ga0495634_0006589 3300046642 Bacteria 8808
638 Ga0495634_0015449 3300046642 Bacteria 5486
639 Ga0495634_0034758 3300046642 Bacteria 3456
640 Ga0495611_0067269 3300046648 Bacteria 1635
641 Ga0495625_0094725 3300046660 Bacteria 2059
642 Ga0495635_0017934 3300046663 Bacteria 4944
643 Ga0495635_0025981 3300046663 Bacteria 4077
644 Ga0495659_0020954 3300046664 Bacteria 2199
645 Ga0495661_0125050 3300046665 Bacteria 1416
646 Ga0495588_0024462 3300046674 Bacteria 3000
647 Ga0495588_0040661 3300046674 Bacteria 2372
648 Ga0495657_0007029 3300046675 Bacteria 8728
649 Ga0495599_0000635 3300046678 Bacteria 19831
650 Ga0495599_0011248 3300046678 Bacteria 5496
651 Ga0495623_0019394 3300046679 Bacteria 4396
652 Ga0495623_0026008 3300046679 Bacteria 3769
653 Ga0495646_0002988 3300046680 Bacteria 10483
654 Ga0495646_0026378 3300046680 Bacteria 3649
655 Ga0495646_0100179 3300046680 Bacteria 1662
656 Ga0495647_0000364 3300046681 Bacteria 12782
657 Ga0495658_0001654 3300046683 Bacteria 11591
658 Ga0495658_0085375 3300046683 Bacteria 1860
659 Ga0495669_0039055 3300046684 Bacteria 2101
660 Ga0495613_0077391 3300046689 Bacteria 2420
661 Ga0495613_0114019 3300046689 Bacteria 1946
662 Ga0495624_0001316 3300046690 Bacteria 19466
663 Ga0495670_0139870 3300046691 Bacteria 1265
664 Ga0495589_0076920 3300046794 Bacteria 1626
665 Ga0495600_0000400 3300046809 Bacteria 22448
666 Ga0495600_0034034 3300046809 Bacteria 3308
667 Ga0495660_0090475 3300046810 Bacteria 1591
668 Ga0495581_0001084 3300047315 Bacteria 14807
669 Ga0495581_0103630 3300047315 Bacteria 1653
670 Ga0495604_0001388 3300047317 Bacteria 19846
671 Ga0495604_0037402 3300047317 Bacteria 3823
672 Ga0495604_0213363 3300047317 Bacteria 1333
673 Ga0495636_0055830 3300047318 Bacteria 1661
674 Ga0495636_0163128 3300047318 Bacteria 1005
675 Ga0495674_0003842 3300047319 Bacteria 14589
676 Ga0495674_0035096 3300047319 Bacteria 4527
677 Ga0495674_0039376 3300047319 Bacteria 4237
678 Ga0495674_0118784 3300047319 Bacteria 2235
679 Ga0495672_0013378 3300047320 Bacteria 5664
680 Ga0495676_0033669 3300047321 Bacteria 4311
681 Ga0495676_0045100 3300047321 Bacteria 3592
682 Ga0495676_0149290 3300047321 Bacteria 1666
683 Ga0495680_0002455 3300047322 Bacteria 18966
684 Ga0495683_0122973 3300047323 Bacteria 1230
685 Ga0495675_0002361 3300047444 Bacteria 11267
686 Ga0495675_0003169 3300047444 Bacteria 9876
687 Ga0495677_0060857 3300047445 Bacteria 1400
688 Ga0495673_0018066 3300047469 Bacteria 3565
689 Ga0495681_0038298 3300047470 Bacteria 2351
690 Ga0495681_0081924 3300047470 Bacteria 1439
691 Ga0495684_0000766 3300047471 Bacteria 25966
692 Ga0495684_0049392 3300047471 Bacteria 3214
693 Ga0495684_0067312 3300047471 Bacteria 2724
694 Ga0495686_0056518 3300047472 Bacteria 2451
695 Ga0495686_0140171 3300047472 Bacteria 1427
696 Ga0495686_0148132 3300047472 Bacteria 1380
697 Ga0495593_0000120 3300047673 Bacteria 37884
698 Ga0495593_0000419 3300047673 Bacteria 23659
699 Ga0495602_0028204 3300048088 Bacteria 5376
700 Ga0495602_0142965 3300048088 Bacteria 1892
701 Ga0495615_0009784 3300048090 Bacteria 1897
702 Ga0495615_0012694 3300048090 Bacteria 1743
703 Ga0496100_0187894 3300048903 Bacteria 1498
704 Ga0496101_0047737 3300048904 Bacteria 3075
705 Ga0496101_0086361 3300048904 Bacteria 2326
706 Ga0496101_0117688 3300048904 Bacteria 2006
707 Ga0496101_0206518 3300048904 Bacteria 1520
708 Ga0496102_0001803 3300048905 Bacteria 18529
709 Ga0496102_0093012 3300048905 Bacteria 2793
710 Ga0496102_0109527 3300048905 Bacteria 2574
711 Ga0496102_0124592 3300048905 Bacteria 2408
712 Ga0496102_0191935 3300048905 Bacteria 1925
713 Ga0496102_0242013 3300048905 Bacteria 1701
714 Ga0496102_0244804 3300048905 Bacteria 1691
715 Ga0496102_0359249 3300048905 Bacteria 1371
716 Ga0496103_0074424 3300048906 Bacteria 2129
717 Ga0496103_0090204 3300048906 Bacteria 1934
718 Ga0496103_0150626 3300048906 Bacteria 1490
719 Ga0496104_0003129 3300048907 Bacteria 14269
720 Ga0496104_0363437 3300048907 Bacteria 1360
721 Ga0496105_0026604 3300048908 Bacteria 4721
722 Ga0496105_0254621 3300048908 Bacteria 1421
723 Ga0496106_0005088 3300048909 Bacteria 9736
724 Ga0496106_0006879 3300048909 Bacteria 8416
725 Ga0496106_0014676 3300048909 Bacteria 5790
726 Ga0496106_0158620 3300048909 Bacteria 1788
727 Ga0496106_0238368 3300048909 Bacteria 1453
728 Ga0496106_0299069 3300048909 Bacteria 1290
729 Ga0496106_0367271 3300048909 Bacteria 1156
730 Ga0496106_0426917 3300048909 Bacteria 1065
731 Ga0496107_0054072 3300048910 Bacteria 2897
732 Ga0496107_0149029 3300048910 Bacteria 1730
733 Ga0496107_0366972 3300048910 Bacteria 1071
734 Ga0496108_0000489 3300048911 Bacteria 31675
735 Ga0496108_0029193 3300048911 Bacteria 4566
736 Ga0496108_0120168 3300048911 Bacteria 2253
737 Ga0496108_0190547 3300048911 Bacteria 1777
738 Ga0496109_0002105 3300048912 Bacteria 16544
739 Ga0496109_0022102 3300048912 Bacteria 5630
740 Ga0496109_0054089 3300048912 Bacteria 3663
741 Ga0496109_0059949 3300048912 Bacteria 3477
742 Ga0496109_0182720 3300048912 Bacteria 1970
743 Ga0496109_0392401 3300048912 Bacteria 1311
744 Ga0496109_0437752 3300048912 Bacteria 1235
745 Ga0496110_0003310 3300048913 Bacteria 12308
746 Ga0496110_0013612 3300048913 Bacteria 6734
747 Ga0496110_0065232 3300048913 Bacteria 3219
748 Ga0496110_0104648 3300048913 Bacteria 2539
749 Ga0496110_0120601 3300048913 Bacteria 2362
750 Ga0496110_0146047 3300048913 Bacteria 2139
751 Ga0496110_0337332 3300048913 Bacteria 1373
752 Ga0496111_0038120 3300048914 Bacteria 3442
753 Ga0496111_0117296 3300048914 Bacteria 1964
754 Ga0496111_0135324 3300048914 Bacteria 1825
755 Ga0496111_0249230 3300048914 Bacteria 1318
756 Ga0496112_0000015 3300048915 Bacteria 206423
757 Ga0496112_0001918 3300048915 Bacteria 16401
758 Ga0496112_0002702 3300048915 Bacteria 14343
759 Ga0496112_0038437 3300048915 Bacteria 4673
760 Ga0496112_0097212 3300048915 Bacteria 2915
761 Ga0496113_0013883 3300048916 Bacteria 5475
762 Ga0496113_0024191 3300048916 Bacteria 4314
763 Ga0496113_0090147 3300048916 Bacteria 2361
764 Ga0496113_0141387 3300048916 Bacteria 1894
765 Ga0496113_0156802 3300048916 Bacteria 1798
766 Ga0496114_0040283 3300048917 Bacteria 3867
767 Ga0496114_0096292 3300048917 Bacteria 2520
768 Ga0496114_0122395 3300048917 Bacteria 2239
769 Ga0496115_0008944 3300048918 Bacteria 7428
770 Ga0496115_0078751 3300048918 Bacteria 2681
771 Ga0496115_0150684 3300048918 Bacteria 1920
772 Ga0496115_0194441 3300048918 Bacteria 1676
773 Ga0496116_0122458 3300048919 Bacteria 1502
774 Ga0496116_0143726 3300048919 Bacteria 1337
775 Ga0496117_0045804 3300048920 Bacteria 3154
776 Ga0496117_0079333 3300048920 Bacteria 2163
777 Ga0496118_0024960 3300048921 Bacteria 5143
778 Ga0496118_0186683 3300048921 Bacteria 1245
779 Ga0496119_0074108 3300048922 Bacteria 1983
780 Ga0496119_0078447 3300048922 Bacteria 1910
781 Ga0496119_0105608 3300048922 Bacteria 1573
782 Ga0496119_0133008 3300048922 Bacteria 1353
783 Ga0496120_0024597 3300048923 Bacteria 3752
784 Ga0496120_0036759 3300048923 Bacteria 2911
785 Ga0496121_0000423 3300048924 Bacteria 83271
786 Ga0496121_0000786 3300048924 Bacteria 57998
787 Ga0496121_0007421 3300048924 Bacteria 13247
788 Ga0496121_0024035 3300048924 Bacteria 5841
789 Ga0496121_0025033 3300048924 Bacteria 5682
790 Ga0496121_0047595 3300048924 Bacteria 3657
791 Ga0496121_0075538 3300048924 Bacteria 2691
792 Ga0496121_0082258 3300048924 Bacteria 2546
793 Ga0496121_0111142 3300048924 Bacteria 2090
794 Ga0496121_0153967 3300048924 Bacteria 1688
795 Ga0496122_0043747 3300048925 Bacteria 3504
796 Ga0496122_0068887 3300048925 Bacteria 2537
797 Ga0496123_0015148 3300048926 Bacteria 6344
798 Ga0496123_0038344 3300048926 Bacteria 3369
799 Ga0496123_0167882 3300048926 Bacteria 1161
800 Ga0496124_0001593 3300048927 Bacteria 32664
801 Ga0496124_0074254 3300048927 Bacteria 2811
802 Ga0496124_0201352 3300048927 Bacteria 1514
803 Ga0496124_0304529 3300048927 Bacteria 1149
804 Ga0496125_0000136 3300048928 Bacteria 160544
805 Ga0496125_0005117 3300048928 Bacteria 14761
806 Ga0496125_0006320 3300048928 Bacteria 12853
807 Ga0496125_0017029 3300048928 Bacteria 6946
808 Ga0496125_0022131 3300048928 Bacteria 5909
809 Ga0496125_0103548 3300048928 Bacteria 2088
810 Ga0496126_0023465 3300048929 Bacteria 5978
811 Ga0496126_0024069 3300048929 Bacteria 5884
812 Ga0496126_0038548 3300048929 Bacteria 4445
813 Ga0496126_0068807 3300048929 Bacteria 3159
814 Ga0496126_0072836 3300048929 Bacteria 3055
815 Ga0496126_0087116 3300048929 Bacteria 2751
816 Ga0496126_0104032 3300048929 Bacteria 2480
817 Ga0496126_0119044 3300048929 Bacteria 2292
818 Ga0496126_0182386 3300048929 Bacteria 1782
819 Ga0501031_0026397 3300049568 Bacteria 3787
820 Ga0501031_0203827 3300049568 Bacteria 1290
821 Ga0501032_0010560 3300049569 Bacteria 6658
822 Ga0501032_0095074 3300049569 Bacteria 1975
823 Ga0501032_0291089 3300049569 Bacteria 1056
824 Ga0501033_0035144 3300049570 Bacteria 3757
825 Ga0501033_0049938 3300049570 Bacteria 3104
826 Ga0501033_0166711 3300049570 Bacteria 1583
827 Ga0501034_0015387 3300049571 Bacteria 7863
828 Ga0501034_0098131 3300049571 Bacteria 2925
829 Ga0501034_0149927 3300049571 Bacteria 2308
830 Ga0501034_0150221 3300049571 Bacteria 2305
831 Ga0501034_0349274 3300049571 Bacteria 1408
832 Ga0501036_0051626 3300049572 Bacteria 3482
833 Ga0501036_0157941 3300049572 Bacteria 1912
834 Ga0501036_0349503 3300049572 Bacteria 1235
835 Ga0501037_0029576 3300049573 Bacteria 4047
836 Ga0501037_0056096 3300049573 Bacteria 2879
837 Ga0501038_0031073 3300049574 Bacteria 4721
838 Ga0501038_0044142 3300049574 Bacteria 3874
839 Ga0501038_0279885 3300049574 Bacteria 1313
840 Ga0501040_0065785 3300049576 Bacteria 2497
841 Ga0501042_0008575 3300049578 Bacteria 6761
842 Ga0501043_0042774 3300049579 Bacteria 3560
843 Ga0501043_0100630 3300049579 Bacteria 2272
844 Ga0501043_0205655 3300049579 Bacteria 1526
845 Ga0501046_0078270 3300049580 Bacteria 2558
846 Ga0501047_0084929 3300049581 Bacteria 3042
847 Ga0501047_0136951 3300049581 Bacteria 2328
848 Ga0501048_0045118 3300049582 Bacteria 3149
849 Ga0501048_0057296 3300049582 Bacteria 2763
850 Ga0501067_0053201 3300049583 Bacteria 2243
851 Ga0501069_0025024 3300049585 Bacteria 3260
852 Ga0501070_0099502 3300049586 Bacteria 2406
853 Ga0501070_0109604 3300049586 Bacteria 2281
854 Ga0501071_0032121 3300049587 Bacteria 3726
855 Ga0501073_0075704 3300049589 Bacteria 2343
856 Ga0501074_0005077 3300049590 Bacteria 9447
857 Ga0501075_0382022 3300049591 Bacteria 1074
858 Ga0501079_0009435 3300049741 Bacteria 7395
859 Ga0501080_0103274 3300049742 Bacteria 2643
860 Ga0501083_0018549 3300049744 Bacteria 4848
861 Ga0501035_0054458 3300049822 Bacteria 3574
862 Ga0501035_0057786 3300049822 Bacteria 3458
863 Ga0501035_0121456 3300049822 Bacteria 2283
864 Ga0501044_0037590 3300049823 Bacteria 5059
865 Ga0501044_0084757 3300049823 Bacteria 3202
866 Ga0501044_0204729 3300049823 Bacteria 1930
867 Ga0501045_0134990 3300049824 Bacteria 1835
868 Ga0501045_0191489 3300049824 Bacteria 1524
869 nmdc:mga03n38_46701_c1 3300050490 Bacteria 1913
870 nmdc:mga00v17_4589_c1 3300050491 Bacteria 7203
871 nmdc:mga00v17_69330_c2 3300050491 Bacteria 1738
872 nmdc:mga00v17_93038_c1 3300050491 Bacteria 1895
873 nmdc:mga0yw44_12452_c1 3300050492 Bacteria 4434
874 nmdc:mga0yw44_131120_c1 3300050492 Bacteria 1623
875 nmdc:mga0yw44_30877_c1 3300050492 Bacteria 3111
876 nmdc:mga0yw44_45205_c1 3300050492 Bacteria 2639
877 nmdc:mga0k408_105376_c1 3300050493 Bacteria 1665
878 nmdc:mga0k408_110834_c1 3300050493 Bacteria 1622
879 nmdc:mga0k408_143337_c1 3300050493 Bacteria 1422
880 nmdc:mga06z11_111727_c1 3300050494 Bacteria 1514
881 nmdc:mga06z11_46459_c1 3300050494 Bacteria 2201
882 nmdc:mga04h51_28933_c1 3300050495 Bacteria 1732
883 nmdc:mga07m45_245287_c1 3300050496 Bacteria 1042
884 nmdc:mga07m45_46313_c1 3300050496 Bacteria 2443
885 nmdc:mga07m45_4675_c1 3300050496 Bacteria 6719
886 nmdc:mga08y16_173922_c1 3300050511 Bacteria 2236
887 nmdc:mga0n895_126914_c1 3300050512 Bacteria 2575
888 nmdc:mga0rr50_82438_c1 3300050513 Bacteria 2484
889 Ga0495601_0019393 3300053077 Bacteria 4147
890 Ga0495601_0034162 3300053077 Bacteria 3171
891 Ga0495601_0196507 3300053077 Bacteria 1318
892 Ga0495612_0014435 3300053078 Bacteria 3177
893 Ga0495612_0070345 3300053078 Bacteria 1458
894 Ga0500635_0098286 3300053080 Bacteria 1073
895 Ga0495595_0005744 3300053084 Bacteria 5026
896 Ga0495619_0004552 3300053085 Bacteria 8856
897 Ga0500643_007421 3300053087 Bacteria 4426
898 Ga0500644_0010381 3300053088 Bacteria 2520
899 Ga0500644_0096081 3300053088 Bacteria 1118
900 Ga0500647_0084833 3300053091 Bacteria 1519
901 Ga0500583_0055049 3300053092 Bacteria 1859
902 Ga0500651_0227913 3300053093 Bacteria 1090
903 Ga0500566_0001223 3300053094 Bacteria 15020
904 Ga0500566_0003804 3300053094 Bacteria 8999
905 Ga0500566_0010050 3300053094 Bacteria 5581
906 Ga0500566_0020729 3300053094 Bacteria 3866
907 Ga0500566_0076480 3300053094 Bacteria 1870
908 Ga0500641_0019753 3300053096 Bacteria 2550
909 Ga0500650_0008217 3300053098 Bacteria 4110
910 Ga0500554_002687 3300053102 Bacteria 3537
911 Ga0500554_012553 3300053102 Bacteria 2133
912 Ga0500556_0000006 3300053104 Bacteria 453982
913 Ga0500572_000415 3300053111 Bacteria 14990
914 Ga0500572_014670 3300053111 Bacteria 1962
915 Ga0500591_081609 3300053115 Bacteria 1435
916 Ga0500594_0032330 3300053118 Bacteria 1385
917 Ga0500595_009735 3300053119 Bacteria 3864
918 Ga0500595_015694 3300053119 Bacteria 2837
919 Ga0500595_018065 3300053119 Bacteria 2586
920 Ga0500595_029480 3300053119 Bacteria 1861
921 Ga0500595_033463 3300053119 Bacteria 1706
922 Ga0500608_002047 3300053122 Bacteria 7229
923 Ga0500608_012388 3300053122 Bacteria 3738
924 Ga0500642_0000004 3300053130 Bacteria 433122
925 Ga0500655_026347 3300053133 Bacteria 1106
926 Ga0500559_0000106 3300053136 Bacteria 65670
927 Ga0500559_0001060 3300053136 Bacteria 16703
928 Ga0500568_0002722 3300053139 Bacteria 10242
929 Ga0500568_0014183 3300053139 Bacteria 3607
930 Ga0500573_0099806 3300053140 Bacteria 1634
931 Ga0500577_0000027 3300053142 Bacteria 36211
932 Ga0500577_0041005 3300053142 Bacteria 1686
933 Ga0500586_000522 3300053145 Bacteria 7721
934 Ga0500603_001404 3300053150 Bacteria 5498
935 Ga0500603_006415 3300053150 Bacteria 2556
936 Ga0500603_038289 3300053150 Bacteria 1269
937 Ga0500604_0009029 3300053151 Bacteria 2652
938 Ga0500616_0000022 3300053153 Bacteria 460463
939 Ga0500616_0000038 3300053153 Bacteria 386801
940 Ga0500622_0004710 3300053156 Bacteria 8433
941 Ga0500622_0046249 3300053156 Bacteria 2251
942 Ga0500630_030914 3300053159 Bacteria 2633
943 Ga0500634_0096205 3300053161 Bacteria 1491
944 Ga0500638_013381 3300053162 Bacteria 3709
945 Ga0500638_031306 3300053162 Bacteria 2565
946 Ga0500639_013822 3300053163 Bacteria 4244
947 Ga0500639_033760 3300053163 Bacteria 2704
948 Ga0500636_0005964 3300053177 Bacteria 6980
949 Ga0500636_0016050 3300053177 Bacteria 4413
950 Ga0500637_0004377 3300053178 Bacteria 6696
951 Ga0500637_0020058 3300053178 Bacteria 3614
952 Ga0500567_076007 3300053723 Bacteria 1462
953 Ga0500645_054444 3300053730 Bacteria 1163
954 Ga0500552_001030 3300053733 Bacteria 2635
955 Ga0500596_000930 3300053735 Bacteria 5843
956 Ga0500596_007751 3300053735 Bacteria 1742
957 Ga0501084_0021758 3300054114 Bacteria 5348
958 Ga0500661_005155 3300055283 Bacteria 2446
959 Ga0501082_0139935 3300060353 Bacteria 2100
960 Ga0466962_0013365 3300061719 Bacteria 3952

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0119514 Ga0495630_0119514_1040_1969 287
2 3300053730 Ga0500645_054444 Ga0500645_054444_264_1148 289
3 3300011119 Ga0105246_10156765 Ga0105246_101567652 291
4 3300046524 Ga0495648_0189502 Ga0495648_0189502_115_1029 293
5 3300048907 Ga0496104_0363437 Ga0496104_0363437_296_1264 293
6 3300031911 Ga0307412_10021273 Ga0307412_100212731 294
7 3300048909 Ga0496106_0367271 Ga0496106_0367271_17_928 295
8 3300009177 Ga0105248_10169571 Ga0105248_101695714 296
9 3300003203 JGI25406J46586_10001269 JGI25406J46586_100012691 297
10 3300005985 Ga0081539_10002206 Ga0081539_1000220612 297
11 3300005985 Ga0081539_10079352 Ga0081539_100793521 297
12 3300031456 Ga0307513_10112840 Ga0307513_101128404 297
13 3300046648 Ga0495611_0067269 Ga0495611_0067269_294_1274 297
14 3300046660 Ga0495625_0094725 Ga0495625_0094725_994_1974 297
15 3300048914 Ga0496111_0249230 Ga0496111_0249230_80_1060 297
16 3300050491 nmdc:mga00v17_93038_c1 nmdc:mga00v17_93038_c1_676_1719 297
17 3300053088 Ga0500644_0010381 Ga0500644_0010381_1455_2435 297
18 3300053153 Ga0500616_0000022 Ga0500616_0000022_452486_453466 297
19 3300005983 Ga0081540_1021762 Ga0081540_10217625 298
20 3300006178 Ga0075367_10114965 Ga0075367_101149652 298
21 3300006195 Ga0075366_10115633 Ga0075366_101156332 298
22 3300046499 Ga0495594_0109963 Ga0495594_0109963_236_1216 298
23 3300047315 Ga0495581_0103630 Ga0495581_0103630_649_1629 298
24 3300050493 nmdc:mga0k408_143337_c1 nmdc:mga0k408_143337_c1_225_1205 298
25 3300050494 nmdc:mga06z11_111727_c1 nmdc:mga06z11_111727_c1_329_1309 298
26 3300006051 Ga0075364_10139088 Ga0075364_101390882 299
27 3300006195 Ga0075366_10110989 Ga0075366_101109892 299
28 3300006353 Ga0075370_10136286 Ga0075370_101362862 299
29 3300009545 Ga0105237_10436441 Ga0105237_104364411 299
30 3300025913 Ga0207695_10182037 Ga0207695_101820371 299
31 3300025921 Ga0207652_10358357 Ga0207652_103583571 299
32 3300037418 Ga0395900_0021426 Ga0395900_0021426_1168_2145 299
33 3300044683 Ga0466965_0017444 Ga0466965_0017444_2008_2988 299
34 3300050493 nmdc:mga0k408_105376_c1 nmdc:mga0k408_105376_c1_438_1418 299
35 3300005937 Ga0081455_10061926 Ga0081455_100619262 300
36 3300006038 Ga0075365_10221546 Ga0075365_102215461 300
37 3300006051 Ga0075364_10022995 Ga0075364_100229954 300
38 3300025295 Ga0209564_1004819 Ga0209564_10048198 300
39 3300025297 Ga0209758_1044141 Ga0209758_10441412 300
40 3300031730 Ga0307516_10123753 Ga0307516_101237532 300
41 3300048905 Ga0496102_0109527 Ga0496102_0109527_630_1610 300
42 3300048920 Ga0496117_0079333 Ga0496117_0079333_47_1027 300
43 3300048926 Ga0496123_0167882 Ga0496123_0167882_92_1072 300
44 3300048927 Ga0496124_0074254 Ga0496124_0074254_908_1888 300
45 3300048928 Ga0496125_0017029 Ga0496125_0017029_949_1929 300
46 3300050492 nmdc:mga0yw44_30877_c1 nmdc:mga0yw44_30877_c1_1952_2932 300
47 3300003215 JGI25153J46596_10009381 JGI25153J46596_100093815 301
48 3300005458 Ga0070681_10140700 Ga0070681_101407002 301
49 3300006186 Ga0075369_10066856 Ga0075369_100668562 301
50 3300021320 Ga0214544_1000056 Ga0214544_100005696 301
51 3300021321 Ga0214542_1000071 Ga0214542_100007139 301
52 3300021324 Ga0214545_1000033 Ga0214545_100003383 301
53 3300021327 Ga0214543_1000105 Ga0214543_100010583 301
54 3300025297 Ga0209758_1021319 Ga0209758_10213194 301
55 3300025912 Ga0207707_10094981 Ga0207707_100949812 301
56 3300025917 Ga0207660_10208081 Ga0207660_102080812 301
57 3300031616 Ga0307508_10111626 Ga0307508_101116263 301
58 3300046519 Ga0495632_0061977 Ga0495632_0061977_217_1197 301
59 3300046526 Ga0495666_0162627 Ga0495666_0162627_10_933 301
60 3300048905 Ga0496102_0244804 Ga0496102_0244804_109_1110 301
61 3300048906 Ga0496103_0074424 Ga0496103_0074424_725_1732 301
62 3300048917 Ga0496114_0122395 Ga0496114_0122395_745_1725 301
63 3300048918 Ga0496115_0078751 Ga0496115_0078751_1384_2385 301
64 3300050492 nmdc:mga0yw44_45205_c1 nmdc:mga0yw44_45205_c1_370_1350 301
65 3300053115 Ga0500591_081609 Ga0500591_081609_487_1416 301
66 3300003215 JGI25153J46596_10032438 JGI25153J46596_100324382 302
67 3300003794 Ga0055531_10007516 Ga0055531_100075166 302
68 3300005262 Ga0065165_1030603 Ga0065165_10306032 302
69 3300005330 Ga0070690_100372690 Ga0070690_1003726901 302
70 3300025295 Ga0209564_1014152 Ga0209564_10141522 302
71 3300025297 Ga0209758_1000293 Ga0209758_100029388 302
72 3300025297 Ga0209758_1000363 Ga0209758_100036372 302
73 3300025299 Ga0209256_1025597 Ga0209256_10255972 302
74 3300025302 Ga0207426_1032857 Ga0207426_10328572 302
75 3300025303 Ga0209051_1049651 Ga0209051_10496511 302
76 3300025304 Ga0209257_1004770 Ga0209257_10047703 302
77 3300037471 Ga0395905_0023934 Ga0395905_0023934_455_1435 302
78 3300048909 Ga0496106_0426917 Ga0496106_0426917_17_976 302
79 3300044765 Ga0466970_0065407 Ga0466970_0065407_651_1631 303
80 3300061719 Ga0466962_0013365 Ga0466962_0013365_907_1887 303
81 3300003215 JGI25153J46596_10031830 JGI25153J46596_100318301 304
82 3300005436 Ga0070713_100245358 Ga0070713_1002453582 304
83 3300014969 Ga0157376_10285751 Ga0157376_102857512 304
84 3300025297 Ga0209758_1002182 Ga0209758_10021822 304
85 3300025928 Ga0207700_10083890 Ga0207700_100838902 304
86 3300025929 Ga0207664_10043916 Ga0207664_100439162 304
87 3300035111 Ga0373923_0054605 Ga0373923_0054605_368_1348 304
88 3300035117 Ga0373953_0002371 Ga0373953_0002371_4554_5534 304
89 3300035118 Ga0373954_0011861 Ga0373954_0011861_1795_2775 304
90 3300035172 Ga0373955_0020825 Ga0373955_0020825_1921_2901 304
91 3300046459 Ga0495629_0098022 Ga0495629_0098022_220_1200 304
92 3300046462 Ga0495651_0039355 Ga0495651_0039355_1999_2979 304
93 3300046463 Ga0495653_0030974 Ga0495653_0030974_1199_2179 304
94 3300046511 Ga0495608_0051601 Ga0495608_0051601_369_1349 304
95 3300046516 Ga0495628_0010505 Ga0495628_0010505_2031_3011 304
96 3300046529 Ga0495652_0025697 Ga0495652_0025697_1100_2080 304
97 3300046533 Ga0495640_0122210 Ga0495640_0122210_113_1093 304
98 3300046642 Ga0495634_0006589 Ga0495634_0006589_2560_3540 304
99 3300046663 Ga0495635_0025981 Ga0495635_0025981_2318_3298 304
100 3300046678 Ga0495599_0011248 Ga0495599_0011248_3412_4392 304
101 3300046679 Ga0495623_0019394 Ga0495623_0019394_249_1229 304
102 3300046809 Ga0495600_0034034 Ga0495600_0034034_1795_2775 304
103 3300047317 Ga0495604_0037402 Ga0495604_0037402_1177_2157 304
104 3300047319 Ga0495674_0039376 Ga0495674_0039376_2298_3278 304
105 3300047444 Ga0495675_0003169 Ga0495675_0003169_2812_3792 304
106 3300048088 Ga0495602_0028204 Ga0495602_0028204_1205_2185 304
107 3300053077 Ga0495601_0196507 Ga0495601_0196507_110_1090 304
108 3300053078 Ga0495612_0014435 Ga0495612_0014435_1962_2942 304
109 3300036401 Ga0373937_0300788 Ga0373937_0300788_17_958 305
110 3300046455 Ga0495603_0041753 Ga0495603_0041753_1621_2601 305
111 3300046460 Ga0495638_0051601 Ga0495638_0051601_179_1159 305
112 3300046475 Ga0495639_0041989 Ga0495639_0041989_1059_2039 305
113 3300046492 Ga0495585_0035860 Ga0495585_0035860_57_1037 305
114 3300046518 Ga0495631_0055303 Ga0495631_0055303_271_1251 305
115 3300046558 Ga0495633_0098374 Ga0495633_0098374_278_1258 305
116 3300046615 Ga0495656_0003938 Ga0495656_0003938_285_1265 305
117 3300046664 Ga0495659_0020954 Ga0495659_0020954_758_1738 305
118 3300046674 Ga0495588_0040661 Ga0495588_0040661_484_1464 305
119 3300046691 Ga0495670_0139870 Ga0495670_0139870_31_1011 305
120 3300047318 Ga0495636_0055830 Ga0495636_0055830_312_1292 305
121 3300047321 Ga0495676_0045100 Ga0495676_0045100_1409_2389 305
122 3300048090 Ga0495615_0009784 Ga0495615_0009784_31_1011 305
123 3300048924 Ga0496121_0024035 Ga0496121_0024035_4321_5292 305
124 3300048929 Ga0496126_0023465 Ga0496126_0023465_4001_4972 305
125 3300005338 Ga0068868_100017439 Ga0068868_1000174392 306
126 3300005347 Ga0070668_100088248 Ga0070668_1000882482 306
127 3300005347 Ga0070668_100129749 Ga0070668_1001297492 306
128 3300005355 Ga0070671_100172339 Ga0070671_1001723392 306
129 3300005444 Ga0070694_100109692 Ga0070694_1001096923 306
130 3300005455 Ga0070663_100030169 Ga0070663_1000301695 306
131 3300005455 Ga0070663_100176525 Ga0070663_1001765252 306
132 3300005535 Ga0070684_100052912 Ga0070684_1000529123 306
133 3300005539 Ga0068853_100180047 Ga0068853_1001800473 306
134 3300005548 Ga0070665_100128458 Ga0070665_1001284582 306
135 3300005564 Ga0070664_100138901 Ga0070664_1001389011 306
136 3300005614 Ga0068856_100247067 Ga0068856_1002470672 306
137 3300005618 Ga0068864_100055720 Ga0068864_1000557202 306
138 3300005618 Ga0068864_100347988 Ga0068864_1003479883 306
139 3300005718 Ga0068866_10269179 Ga0068866_102691791 306
140 3300005843 Ga0068860_100112266 Ga0068860_1001122664 306
141 3300005983 Ga0081540_1011691 Ga0081540_10116917 306
142 3300006038 Ga0075365_10126224 Ga0075365_101262242 306
143 3300006048 Ga0075363_100030237 Ga0075363_1000302372 306
144 3300006186 Ga0075369_10057758 Ga0075369_100577581 306
145 3300006358 Ga0068871_100237795 Ga0068871_1002377951 306
146 3300006871 Ga0075434_100502283 Ga0075434_1005022831 306
147 3300009098 Ga0105245_10047428 Ga0105245_100474283 306
148 3300009174 Ga0105241_10149265 Ga0105241_101492652 306
149 3300009176 Ga0105242_10223162 Ga0105242_102231622 306
150 3300009177 Ga0105248_10269055 Ga0105248_102690552 306
151 3300010375 Ga0105239_10118948 Ga0105239_101189482 306
152 3300010375 Ga0105239_10123251 Ga0105239_101232512 306
153 3300011119 Ga0105246_10055737 Ga0105246_100557373 306
154 3300011119 Ga0105246_10094231 Ga0105246_100942313 306
155 3300013306 Ga0163162_10134721 Ga0163162_101347212 306
156 3300013308 Ga0157375_10014475 Ga0157375_100144752 306
157 3300014325 Ga0163163_10272647 Ga0163163_102726471 306
158 3300014326 Ga0157380_10275534 Ga0157380_102755342 306
159 3300014745 Ga0157377_10121907 Ga0157377_101219072 306
160 3300025911 Ga0207654_10057116 Ga0207654_100571163 306
161 3300025919 Ga0207657_10189204 Ga0207657_101892042 306
162 3300025927 Ga0207687_10144393 Ga0207687_101443932 306
163 3300025927 Ga0207687_10159431 Ga0207687_101594311 306
164 3300025931 Ga0207644_10052228 Ga0207644_100522284 306
165 3300025931 Ga0207644_10214732 Ga0207644_102147322 306
166 3300025933 Ga0207706_10080388 Ga0207706_100803885 306
167 3300025941 Ga0207711_10220555 Ga0207711_102205552 306
168 3300025942 Ga0207689_10145962 Ga0207689_101459622 306
169 3300025942 Ga0207689_10325570 Ga0207689_103255702 306
170 3300025945 Ga0207679_10247549 Ga0207679_102475491 306
171 3300025949 Ga0207667_10153908 Ga0207667_101539081 306
172 3300025972 Ga0207668_10081435 Ga0207668_100814352 306
173 3300026023 Ga0207677_10013346 Ga0207677_100133461 306
174 3300026041 Ga0207639_10308097 Ga0207639_103080972 306
175 3300026067 Ga0207678_10052756 Ga0207678_100527565 306
176 3300026078 Ga0207702_10530611 Ga0207702_105306111 306
177 3300026095 Ga0207676_10158453 Ga0207676_101584532 306
178 3300026116 Ga0207674_10231467 Ga0207674_102314672 306
179 3300026121 Ga0207683_10061295 Ga0207683_100612951 306
180 3300026121 Ga0207683_10117340 Ga0207683_101173402 306
181 3300026121 Ga0207683_10248661 Ga0207683_102486611 306
182 3300032126 Ga0307415_100137369 Ga0307415_1001373692 306
183 3300046459 Ga0495629_0230143 Ga0495629_0230143_54_1076 306
184 3300048904 Ga0496101_0117688 Ga0496101_0117688_353_1375 306
185 3300048905 Ga0496102_0001803 Ga0496102_0001803_346_1368 306
186 3300048905 Ga0496102_0093012 Ga0496102_0093012_781_1761 306
187 3300048908 Ga0496105_0026604 Ga0496105_0026604_2066_3034 306
188 3300048909 Ga0496106_0158620 Ga0496106_0158620_311_1291 306
189 3300048910 Ga0496107_0054072 Ga0496107_0054072_250_1218 306
190 3300048910 Ga0496107_0149029 Ga0496107_0149029_380_1360 306
191 3300048910 Ga0496107_0366972 Ga0496107_0366972_34_1014 306
192 3300048911 Ga0496108_0029193 Ga0496108_0029193_1434_2402 306
193 3300048912 Ga0496109_0022102 Ga0496109_0022102_3829_4809 306
194 3300048913 Ga0496110_0013612 Ga0496110_0013612_1086_2054 306
195 3300048913 Ga0496110_0337332 Ga0496110_0337332_115_1095 306
196 3300048914 Ga0496111_0117296 Ga0496111_0117296_784_1764 306
197 3300048915 Ga0496112_0097212 Ga0496112_0097212_1432_2412 306
198 3300048916 Ga0496113_0141387 Ga0496113_0141387_503_1483 306
199 3300048916 Ga0496113_0156802 Ga0496113_0156802_144_1112 306
200 3300048917 Ga0496114_0040283 Ga0496114_0040283_130_1161 306
201 3300048918 Ga0496115_0008944 Ga0496115_0008944_5530_6561 306
202 3300048921 Ga0496118_0186683 Ga0496118_0186683_86_1066 306
203 3300050490 nmdc:mga03n38_46701_c1 nmdc:mga03n38_46701_c1_445_1425 306
204 3300050496 nmdc:mga07m45_245287_c1 nmdc:mga07m45_245287_c1_26_1006 307
205 3300005367 Ga0070667_100249256 Ga0070667_1002492562 308
206 3300005471 Ga0070698_100270947 Ga0070698_1002709472 308
207 3300005718 Ga0068866_10166041 Ga0068866_101660412 308
208 3300006173 Ga0070716_100145980 Ga0070716_1001459802 308
209 3300025916 Ga0207663_10058429 Ga0207663_100584292 308
210 3300025939 Ga0207665_10105429 Ga0207665_101054293 308
211 3300048904 Ga0496101_0206518 Ga0496101_0206518_348_1325 308
212 3300048905 Ga0496102_0124592 Ga0496102_0124592_336_1313 308
213 3300048918 Ga0496115_0194441 Ga0496115_0194441_610_1587 308
214 3300005329 Ga0070683_100044264 Ga0070683_1000442642 309
215 3300005455 Ga0070663_100005737 Ga0070663_1000057376 309
216 3300005548 Ga0070665_100277819 Ga0070665_1002778192 309
217 3300005981 Ga0081538_10042376 Ga0081538_100423762 309
218 3300005985 Ga0081539_10114377 Ga0081539_101143772 309
219 3300006038 Ga0075365_10176074 Ga0075365_101760742 309
220 3300006175 Ga0070712_100161689 Ga0070712_1001616893 309
221 3300025915 Ga0207693_10022773 Ga0207693_100227732 309
222 3300025944 Ga0207661_10001179 Ga0207661_100011794 309
223 3300025945 Ga0207679_10265154 Ga0207679_102651541 309
224 3300026067 Ga0207678_10068056 Ga0207678_100680562 309
225 3300032002 Ga0307416_100731718 Ga0307416_1007317181 309
226 3300037466 Ga0395898_0173338 Ga0395898_0173338_609_1589 309
227 3300046460 Ga0495638_0009712 Ga0495638_0009712_5615_6595 309
228 3300046462 Ga0495651_0044737 Ga0495651_0044737_183_1160 309
229 3300046491 Ga0495584_0091861 Ga0495584_0091861_202_1182 309
230 3300046506 Ga0495583_0042472 Ga0495583_0042472_1083_2063 309
231 3300046507 Ga0495606_0153692 Ga0495606_0153692_150_1130 309
232 3300046513 Ga0495616_0016900 Ga0495616_0016900_1457_2437 309
233 3300046515 Ga0495620_0040570 Ga0495620_0040570_527_1507 309
234 3300046530 Ga0495654_0032538 Ga0495654_0032538_1342_2322 309
235 3300046810 Ga0495660_0090475 Ga0495660_0090475_55_1035 309
236 3300047472 Ga0495686_0056518 Ga0495686_0056518_653_1633 309
237 3300048919 Ga0496116_0143726 Ga0496116_0143726_196_1176 309
238 3300048923 Ga0496120_0024597 Ga0496120_0024597_2411_3391 309
239 3300048925 Ga0496122_0068887 Ga0496122_0068887_264_1244 309
240 3300048926 Ga0496123_0015148 Ga0496123_0015148_3890_4870 309
241 3300048927 Ga0496124_0304529 Ga0496124_0304529_138_1118 309
242 3300048928 Ga0496125_0006320 Ga0496125_0006320_4896_5876 309
243 3300048929 Ga0496126_0072836 Ga0496126_0072836_1534_2514 309
244 3300049824 Ga0501045_0134990 Ga0501045_0134990_814_1794 309
245 3300053087 Ga0500643_007421 Ga0500643_007421_1405_2385 309
246 3300053096 Ga0500641_0019753 Ga0500641_0019753_942_1922 309
247 3300053098 Ga0500650_0008217 Ga0500650_0008217_247_1227 309
248 3300053104 Ga0500556_0000006 Ga0500556_0000006_446041_447021 309
249 3300053139 Ga0500568_0002722 Ga0500568_0002722_6935_7915 309
250 3300053151 Ga0500604_0009029 Ga0500604_0009029_857_1837 309
251 3300053156 Ga0500622_0004710 Ga0500622_0004710_6929_7909 309
252 iso_pu_bacteria 2904690495 2904690626 309
253 iso_pu_bacteria 2908756301 2908756384 309
254 3300045976 Ga0466967_0044378 Ga0466967_0044378_419_1399 310
255 3300046522 Ga0495643_0014351 Ga0495643_0014351_699_1679 310
256 3300046557 Ga0495622_0010378 Ga0495622_0010378_181_1161 310
257 3300047472 Ga0495686_0148132 Ga0495686_0148132_183_1163 310
258 3300053094 Ga0500566_0003804 Ga0500566_0003804_1120_2100 310
259 3300053119 Ga0500595_015694 Ga0500595_015694_1747_2727 310
260 3300053122 Ga0500608_002047 Ga0500608_002047_3328_4308 310
261 3300053130 Ga0500642_0000004 Ga0500642_0000004_6982_7962 310
262 3300053136 Ga0500559_0000106 Ga0500559_0000106_1203_2183 310
263 3300053177 Ga0500636_0005964 Ga0500636_0005964_4320_5300 310
264 3300005334 Ga0068869_100179485 Ga0068869_1001794851 311
265 3300005355 Ga0070671_100182917 Ga0070671_1001829172 311
266 3300005471 Ga0070698_100338567 Ga0070698_1003385671 311
267 3300005617 Ga0068859_100177940 Ga0068859_1001779403 311
268 3300005937 Ga0081455_10134664 Ga0081455_101346642 311
269 3300006038 Ga0075365_10066556 Ga0075365_100665562 311
270 3300006051 Ga0075364_10005413 Ga0075364_100054138 311
271 3300006178 Ga0075367_10041093 Ga0075367_100410933 311
272 3300006931 Ga0097620_100177946 Ga0097620_1001779463 311
273 3300009176 Ga0105242_10306837 Ga0105242_103068372 311
274 3300025885 Ga0207653_10037315 Ga0207653_100373152 311
275 3300025898 Ga0207692_10146904 Ga0207692_101469041 311
276 3300025931 Ga0207644_10218990 Ga0207644_102189902 311
277 3300025942 Ga0207689_10203379 Ga0207689_102033792 311
278 3300035116 Ga0373945_0048748 Ga0373945_0048748_457_1434 311
279 3300035695 Ga0373927_0022428 Ga0373927_0022428_285_1262 311
280 3300035725 Ga0373947_0046047 Ga0373947_0046047_56_1033 311
281 3300047321 Ga0495676_0149290 Ga0495676_0149290_642_1619 311
282 3300048922 Ga0496119_0105608 Ga0496119_0105608_104_1084 311
283 3300048923 Ga0496120_0036759 Ga0496120_0036759_358_1338 311
284 3300049568 Ga0501031_0026397 Ga0501031_0026397_1504_2484 311
285 3300049570 Ga0501033_0035144 Ga0501033_0035144_174_1154 311
286 3300049571 Ga0501034_0149927 Ga0501034_0149927_586_1566 311
287 3300049573 Ga0501037_0029576 Ga0501037_0029576_951_1931 311
288 3300049582 Ga0501048_0057296 Ga0501048_0057296_937_1917 311
289 3300049586 Ga0501070_0109604 Ga0501070_0109604_1151_2131 311
290 3300049587 Ga0501071_0032121 Ga0501071_0032121_1667_2647 311
291 3300049589 Ga0501073_0075704 Ga0501073_0075704_738_1718 311
292 3300049742 Ga0501080_0103274 Ga0501080_0103274_772_1752 311
293 3300049824 Ga0501045_0191489 Ga0501045_0191489_198_1178 311
294 3300050491 nmdc:mga00v17_4589_c1 nmdc:mga00v17_4589_c1_980_1960 311
295 3300050492 nmdc:mga0yw44_12452_c1 nmdc:mga0yw44_12452_c1_2677_3657 311
296 3300003354 JGI25160J50197_1020957 JGI25160J50197_10209572 312
297 3300005262 Ga0065165_1027884 Ga0065165_10278842 312
298 3300005331 Ga0070670_100200985 Ga0070670_1002009853 312
299 3300005347 Ga0070668_100194289 Ga0070668_1001942891 312
300 3300005353 Ga0070669_100405920 Ga0070669_1004059201 312
301 3300005366 Ga0070659_100444061 Ga0070659_1004440611 312
302 3300005367 Ga0070667_100305633 Ga0070667_1003056331 312
303 3300005548 Ga0070665_100442234 Ga0070665_1004422342 312
304 3300005983 Ga0081540_1033318 Ga0081540_10333182 312
305 3300005983 Ga0081540_1065822 Ga0081540_10658222 312
306 3300006038 Ga0075365_10171066 Ga0075365_101710662 312
307 3300006358 Ga0068871_100226482 Ga0068871_1002264822 312
308 3300006942 Ga0099824_1035261 Ga0099824_10352612 312
309 3300006943 Ga0099822_1048339 Ga0099822_10483391 312
310 3300009098 Ga0105245_10476191 Ga0105245_104761911 312
311 3300009545 Ga0105237_10155584 Ga0105237_101555842 312
312 3300009551 Ga0105238_10012034 Ga0105238_1001203410 312
313 3300009551 Ga0105238_10259535 Ga0105238_102595352 312
314 3300025913 Ga0207695_10349839 Ga0207695_103498391 312
315 3300025914 Ga0207671_10187877 Ga0207671_101878772 312
316 3300025924 Ga0207694_10018472 Ga0207694_100184722 312
317 3300025986 Ga0207658_10147266 Ga0207658_101472662 312
318 3300026067 Ga0207678_10190307 Ga0207678_101903072 312
319 3300026075 Ga0207708_10294888 Ga0207708_102948881 312
320 3300027296 Ga0209389_1045303 Ga0209389_10453032 312
321 3300027357 Ga0209589_1000032 Ga0209589_100003298 312
322 3300028379 Ga0268266_10159216 Ga0268266_101592161 312
323 3300028794 Ga0307515_10216473 Ga0307515_102164731 312
324 3300031730 Ga0307516_10029494 Ga0307516_100294942 312
325 3300031730 Ga0307516_10150815 Ga0307516_101508153 312
326 3300031731 Ga0307405_10122141 Ga0307405_101221412 312
327 3300031995 Ga0307409_100188945 Ga0307409_1001889451 312
328 3300032004 Ga0307414_10274834 Ga0307414_102748342 312
329 3300041413 Ga0439465_0068274 Ga0439465_0068274_179_1159 312
330 3300046460 Ga0495638_0166544 Ga0495638_0166544_65_1045 312
331 3300046507 Ga0495606_0117167 Ga0495606_0117167_14_976 312
332 3300047321 Ga0495676_0033669 Ga0495676_0033669_2589_3551 312
333 3300048908 Ga0496105_0254621 Ga0496105_0254621_334_1314 312
334 3300048917 Ga0496114_0096292 Ga0496114_0096292_1135_2112 312
335 3300048924 Ga0496121_0153967 Ga0496121_0153967_581_1570 312
336 3300048929 Ga0496126_0182386 Ga0496126_0182386_258_1256 312
337 3300053092 Ga0500583_0055049 Ga0500583_0055049_596_1576 312
338 3300053119 Ga0500595_029480 Ga0500595_029480_505_1485 312
339 3300003215 JGI25153J46596_10034898 JGI25153J46596_100348981 313
340 3300003659 JGI25404J52841_10010710 JGI25404J52841_100107101 313
341 3300005339 Ga0070660_100118721 Ga0070660_1001187212 313
342 3300005983 Ga0081540_1014715 Ga0081540_10147156 313
343 3300005983 Ga0081540_1024510 Ga0081540_10245102 313
344 3300005983 Ga0081540_1060263 Ga0081540_10602632 313
345 3300006038 Ga0075365_10284016 Ga0075365_102840161 313
346 3300025904 Ga0207647_10022688 Ga0207647_100226882 313
347 3300025919 Ga0207657_10030642 Ga0207657_100306422 313
348 3300031711 Ga0265314_10003979 Ga0265314_1000397911 313
349 3300035086 Ga0373934_0014023 Ga0373934_0014023_933_1913 313
350 3300035111 Ga0373923_0036024 Ga0373923_0036024_764_1744 313
351 3300035117 Ga0373953_0017348 Ga0373953_0017348_1022_2002 313
352 3300035118 Ga0373954_0000485 Ga0373954_0000485_1099_2079 313
353 3300035119 Ga0373956_0002322 Ga0373956_0002322_1800_2780 313
354 3300035120 Ga0373957_0002098 Ga0373957_0002098_4571_5551 313
355 3300035172 Ga0373955_0001048 Ga0373955_0001048_1353_2333 313
356 3300035724 Ga0373933_0006053 Ga0373933_0006053_3255_4235 313
357 3300036401 Ga0373937_0012128 Ga0373937_0012128_679_1659 313
358 3300038443 Ga0395901_0181332 Ga0395901_0181332_722_1702 313
359 3300046454 Ga0495592_0000993 Ga0495592_0000993_18560_19540 313
360 3300046459 Ga0495629_0000337 Ga0495629_0000337_18382_19362 313
361 3300046462 Ga0495651_0003587 Ga0495651_0003587_5018_5998 313
362 3300046463 Ga0495653_0010108 Ga0495653_0010108_835_1815 313
363 3300046511 Ga0495608_0001320 Ga0495608_0001320_12449_13429 313
364 3300046514 Ga0495618_0004991 Ga0495618_0004991_6332_7312 313
365 3300046516 Ga0495628_0016528 Ga0495628_0016528_2101_3081 313
366 3300046529 Ga0495652_0001922 Ga0495652_0001922_19010_19990 313
367 3300046536 Ga0495587_0003825 Ga0495587_0003825_6035_7015 313
368 3300046543 Ga0495645_0121085 Ga0495645_0121085_748_1728 313
369 3300046559 Ga0495667_0000270 Ga0495667_0000270_6035_7015 313
370 3300046642 Ga0495634_0015449 Ga0495634_0015449_15_995 313
371 3300046675 Ga0495657_0007029 Ga0495657_0007029_1842_2822 313
372 3300046678 Ga0495599_0000635 Ga0495599_0000635_1789_2769 313
373 3300046679 Ga0495623_0026008 Ga0495623_0026008_1842_2822 313
374 3300046680 Ga0495646_0002988 Ga0495646_0002988_9111_10091 313
375 3300046689 Ga0495613_0077391 Ga0495613_0077391_621_1601 313
376 3300046809 Ga0495600_0000400 Ga0495600_0000400_1252_2232 313
377 3300047317 Ga0495604_0001388 Ga0495604_0001388_16759_17739 313
378 3300047319 Ga0495674_0118784 Ga0495674_0118784_203_1183 313
379 3300047322 Ga0495680_0002455 Ga0495680_0002455_1842_2822 313
380 3300047444 Ga0495675_0002361 Ga0495675_0002361_2108_3088 313
381 3300047470 Ga0495681_0081924 Ga0495681_0081924_282_1262 313
382 3300047471 Ga0495684_0000766 Ga0495684_0000766_20656_21636 313
383 3300047673 Ga0495593_0000120 Ga0495593_0000120_1482_2462 313
384 3300048929 Ga0496126_0087116 Ga0496126_0087116_189_1160 313
385 3300048929 Ga0496126_0104032 Ga0496126_0104032_275_1243 313
386 3300049571 Ga0501034_0349274 Ga0501034_0349274_257_1237 313
387 3300049823 Ga0501044_0204729 Ga0501044_0204729_178_1158 313
388 3300050492 nmdc:mga0yw44_131120_c1 nmdc:mga0yw44_131120_c1_133_1113 313
389 3300050496 nmdc:mga07m45_46313_c1 nmdc:mga07m45_46313_c1_414_1394 313
390 3300050512 nmdc:mga0n895_126914_c1 nmdc:mga0n895_126914_c1_451_1431 313
391 3300053077 Ga0495601_0019393 Ga0495601_0019393_2274_3254 313
392 3300053084 Ga0495595_0005744 Ga0495595_0005744_2048_3028 313
393 3300053085 Ga0495619_0004552 Ga0495619_0004552_6035_7015 313
394 3300053145 Ga0500586_000522 Ga0500586_000522_3509_4489 313
395 3300053723 Ga0500567_076007 Ga0500567_076007_272_1252 313
396 iso_pu_bacteria 8056689827 8056695295 313
397 3300003354 JGI25160J50197_1031796 JGI25160J50197_10317962 314
398 3300007788 Ga0099795_10018310 Ga0099795_100183101 314
399 3300007788 Ga0099795_10022791 Ga0099795_100227911 314
400 3300025230 Ga0209563_103943 Ga0209563_1039432 314
401 3300025253 Ga0209677_103578 Ga0209677_1035782 314
402 3300025302 Ga0207426_1021037 Ga0207426_10210373 314
403 3300025949 Ga0207667_10363491 Ga0207667_103634911 314
404 3300028786 Ga0307517_10000563 Ga0307517_1000056337 314
405 3300028794 Ga0307515_10008720 Ga0307515_1000872016 314
406 3300041512 Ga0451853_0973839 Ga0451853_0973839_135_1106 314
407 3300046455 Ga0495603_0189697 Ga0495603_0189697_95_1075 314
408 3300046477 Ga0495664_0006563 Ga0495664_0006563_4823_5791 314
409 3300048928 Ga0496125_0103548 Ga0496125_0103548_22_1002 314
410 3300053077 Ga0495601_0034162 Ga0495601_0034162_762_1730 314
411 3300053078 Ga0495612_0070345 Ga0495612_0070345_154_1122 314
412 iso_pu_bacteria 2513237104 2513719810 314
413 iso_pu_bacteria 2513237141 2513888653 314
414 iso_pu_bacteria 2517093001 2517102104 314
415 iso_pu_bacteria 2602042107 2603858401 314
416 iso_pu_bacteria 2791355196 2793064908 314
417 iso_pu_bacteria 2791355199 2793079245 314
418 iso_pu_bacteria 2841957949 2841965740 314
419 iso_pu_bacteria 2842038055 2842043621 314
420 iso_pu_bacteria 2842045827 2842052389 314
421 iso_pu_bacteria 2857524615 2857526502 314
422 iso_pu_bacteria 2874620515 2874624669 314
423 iso_pu_bacteria 2876808645 2876813398 314
424 iso_pu_bacteria 2879110137 2879113051 314
425 iso_pu_bacteria 2885366525 2885371157 314
426 iso_pu_bacteria 2885409591 2885410513 314
427 iso_pu_bacteria 2888388044 2888390793 314
428 iso_pu_bacteria 2889033259 2889035629 314
429 iso_pu_bacteria 2893066018 2893067248 314
430 iso_pu_bacteria 2904666416 2904670376 314
431 iso_pu_bacteria 2919073203 2919073683 314
432 iso_pu_bacteria 8006926726 8006928528 314
433 iso_pu_bacteria 8006984368 8006990805 314
434 iso_pu_bacteria 8016583857 8016586504 314
435 3300005353 Ga0070669_100141779 Ga0070669_1001417792 315
436 3300005455 Ga0070663_100105313 Ga0070663_1001053132 315
437 3300005548 Ga0070665_100019142 Ga0070665_1000191428 315
438 3300005618 Ga0068864_100325057 Ga0068864_1003250572 315
439 3300005842 Ga0068858_100195042 Ga0068858_1001950423 315
440 3300005937 Ga0081455_10050463 Ga0081455_100504632 315
441 3300006042 Ga0075368_10021396 Ga0075368_100213963 315
442 3300006048 Ga0075363_100005325 Ga0075363_1000053257 315
443 3300006051 Ga0075364_10098288 Ga0075364_100982882 315
444 3300006178 Ga0075367_10015170 Ga0075367_100151705 315
445 3300006186 Ga0075369_10056747 Ga0075369_100567472 315
446 3300006195 Ga0075366_10085515 Ga0075366_100855152 315
447 3300006353 Ga0075370_10163340 Ga0075370_101633402 315
448 3300009545 Ga0105237_10427826 Ga0105237_104278261 315
449 3300014968 Ga0157379_10451192 Ga0157379_104511921 315
450 3300025297 Ga0209758_1002431 Ga0209758_10024312 315
451 3300025914 Ga0207671_10049421 Ga0207671_100494212 315
452 3300025914 Ga0207671_10066601 Ga0207671_100666011 315
453 3300026067 Ga0207678_10209987 Ga0207678_102099872 315
454 3300026095 Ga0207676_10317651 Ga0207676_103176512 315
455 3300027866 Ga0209813_10052997 Ga0209813_100529971 315
456 3300028379 Ga0268266_10002812 Ga0268266_1000281215 315
457 3300028794 Ga0307515_10306556 Ga0307515_103065561 315
458 3300031249 Ga0265339_10004403 Ga0265339_100044034 315
459 3300031249 Ga0265339_10031070 Ga0265339_100310703 315
460 3300031250 Ga0265331_10140112 Ga0265331_101401121 315
461 3300031507 Ga0307509_10146627 Ga0307509_101466272 315
462 3300031711 Ga0265314_10039691 Ga0265314_100396911 315
463 3300031730 Ga0307516_10008798 Ga0307516_1000879812 315
464 3300031730 Ga0307516_10072493 Ga0307516_100724932 315
465 3300033179 Ga0307507_10127820 Ga0307507_101278202 315
466 3300035170 Ga0373943_0041100 Ga0373943_0041100_935_1915 315
467 3300035724 Ga0373933_0000118 Ga0373933_0000118_7642_8628 315
468 3300035725 Ga0373947_0009689 Ga0373947_0009689_4509_5489 315
469 3300035725 Ga0373947_0021326 Ga0373947_0021326_467_1507 315
470 3300037068 Ga0373925_0106535 Ga0373925_0106535_714_1754 315
471 3300039450 Ga0436363_1514070 Ga0436363_1514070_131_1102 315
472 3300046455 Ga0495603_0003332 Ga0495603_0003332_1916_2896 315
473 3300046457 Ga0495590_0033206 Ga0495590_0033206_447_1427 315
474 3300046557 Ga0495622_0090200 Ga0495622_0090200_24_1064 315
475 3300047469 Ga0495673_0018066 Ga0495673_0018066_1892_2872 315
476 3300048904 Ga0496101_0086361 Ga0496101_0086361_914_1894 315
477 3300048909 Ga0496106_0014676 Ga0496106_0014676_284_1351 315
478 3300048909 Ga0496106_0238368 Ga0496106_0238368_143_1123 315
479 3300048909 Ga0496106_0299069 Ga0496106_0299069_203_1183 315
480 3300048911 Ga0496108_0190547 Ga0496108_0190547_703_1683 315
481 3300048912 Ga0496109_0437752 Ga0496109_0437752_244_1224 315
482 3300048913 Ga0496110_0104648 Ga0496110_0104648_296_1276 315
483 3300048916 Ga0496113_0090147 Ga0496113_0090147_871_1851 315
484 3300048920 Ga0496117_0045804 Ga0496117_0045804_1249_2316 315
485 3300048921 Ga0496118_0024960 Ga0496118_0024960_823_1890 315
486 3300048922 Ga0496119_0078447 Ga0496119_0078447_536_1507 315
487 3300048924 Ga0496121_0000423 Ga0496121_0000423_23220_24287 315
488 3300048924 Ga0496121_0047595 Ga0496121_0047595_2069_3112 315
489 3300048927 Ga0496124_0001593 Ga0496124_0001593_257_1324 315
490 3300048928 Ga0496125_0022131 Ga0496125_0022131_4083_5150 315
491 3300048929 Ga0496126_0024069 Ga0496126_0024069_4377_5444 315
492 3300048929 Ga0496126_0119044 Ga0496126_0119044_351_1331 315
493 3300049572 Ga0501036_0349503 Ga0501036_0349503_154_1134 315
494 3300050491 nmdc:mga00v17_69330_c2 nmdc:mga00v17_69330_c2_369_1349 315
495 3300050493 nmdc:mga0k408_110834_c1 nmdc:mga0k408_110834_c1_338_1318 315
496 3300050494 nmdc:mga06z11_46459_c1 nmdc:mga06z11_46459_c1_753_1733 315
497 3300050495 nmdc:mga04h51_28933_c1 nmdc:mga04h51_28933_c1_428_1408 315
498 3300050496 nmdc:mga07m45_4675_c1 nmdc:mga07m45_4675_c1_4615_5595 315
499 3300053080 Ga0500635_0098286 Ga0500635_0098286_23_1063 315
500 3300053091 Ga0500647_0084833 Ga0500647_0084833_448_1488 315
501 3300053094 Ga0500566_0020729 Ga0500566_0020729_1212_2252 315
502 3300053119 Ga0500595_033463 Ga0500595_033463_23_1063 315
503 3300053140 Ga0500573_0099806 Ga0500573_0099806_578_1549 315
504 3300053142 Ga0500577_0000027 Ga0500577_0000027_25465_26436 315
505 3300053150 Ga0500603_038289 Ga0500603_038289_147_1187 315
506 3300053733 Ga0500552_001030 Ga0500552_001030_583_1623 315
507 3300053735 Ga0500596_007751 Ga0500596_007751_547_1587 315
508 3300001990 JGI24737J22298_10003455 JGI24737J22298_100034556 316
509 3300005327 Ga0070658_10023727 Ga0070658_100237272 316
510 3300005329 Ga0070683_100030491 Ga0070683_1000304915 316
511 3300005336 Ga0070680_100081192 Ga0070680_1000811922 316
512 3300005337 Ga0070682_100202985 Ga0070682_1002029851 316
513 3300005339 Ga0070660_100403070 Ga0070660_1004030701 316
514 3300005344 Ga0070661_100146714 Ga0070661_1001467142 316
515 3300005457 Ga0070662_100152209 Ga0070662_1001522091 316
516 3300005468 Ga0070707_100117076 Ga0070707_1001170763 316
517 3300005530 Ga0070679_100334017 Ga0070679_1003340171 316
518 3300005535 Ga0070684_100003879 Ga0070684_1000038792 316
519 3300005539 Ga0068853_100012905 Ga0068853_1000129052 316
520 3300005539 Ga0068853_100029373 Ga0068853_1000293735 316
521 3300005563 Ga0068855_100057419 Ga0068855_1000574193 316
522 3300005577 Ga0068857_100040874 Ga0068857_1000408745 316
523 3300005578 Ga0068854_100096044 Ga0068854_1000960443 316
524 3300005614 Ga0068856_100074933 Ga0068856_1000749334 316
525 3300009093 Ga0105240_10096404 Ga0105240_100964042 316
526 3300009545 Ga0105237_10005399 Ga0105237_1000539913 316
527 3300009545 Ga0105237_10056521 Ga0105237_100565215 316
528 3300009551 Ga0105238_10046561 Ga0105238_100465612 316
529 3300009551 Ga0105238_10090291 Ga0105238_100902912 316
530 3300010375 Ga0105239_10089479 Ga0105239_100894792 316
531 3300010375 Ga0105239_10095047 Ga0105239_100950474 316
532 3300013105 Ga0157369_10010838 Ga0157369_1001083811 316
533 3300013296 Ga0157374_10242658 Ga0157374_102426582 316
534 3300025295 Ga0209564_1000494 Ga0209564_100049430 316
535 3300025321 Ga0207656_10034381 Ga0207656_100343811 316
536 3300025904 Ga0207647_10005928 Ga0207647_100059282 316
537 3300025912 Ga0207707_10006420 Ga0207707_100064205 316
538 3300025913 Ga0207695_10069546 Ga0207695_100695464 316
539 3300025914 Ga0207671_10068734 Ga0207671_100687342 316
540 3300025914 Ga0207671_10072485 Ga0207671_100724853 316
541 3300025917 Ga0207660_10006956 Ga0207660_100069568 316
542 3300025917 Ga0207660_10180179 Ga0207660_101801793 316
543 3300025919 Ga0207657_10004312 Ga0207657_1000431213 316
544 3300025921 Ga0207652_10010962 Ga0207652_100109628 316
545 3300025921 Ga0207652_10275043 Ga0207652_102750432 316
546 3300025924 Ga0207694_10062964 Ga0207694_100629643 316
547 3300025932 Ga0207690_10296022 Ga0207690_102960222 316
548 3300025944 Ga0207661_10039390 Ga0207661_100393903 316
549 3300025949 Ga0207667_10004673 Ga0207667_100046732 316
550 3300025949 Ga0207667_10010892 Ga0207667_100108925 316
551 3300025981 Ga0207640_10021376 Ga0207640_100213764 316
552 3300026041 Ga0207639_10019626 Ga0207639_100196265 316
553 3300026041 Ga0207639_10021327 Ga0207639_100213272 316
554 3300026078 Ga0207702_10052064 Ga0207702_100520644 316
555 3300026116 Ga0207674_10021710 Ga0207674_100217107 316
556 3300026116 Ga0207674_10035034 Ga0207674_100350346 316
557 3300031616 Ga0307508_10197490 Ga0307508_101974902 316
558 3300035086 Ga0373934_0017026 Ga0373934_0017026_322_1296 316
559 3300035695 Ga0373927_0003498 Ga0373927_0003498_1128_2108 316
560 3300035725 Ga0373947_0133742 Ga0373947_0133742_395_1375 316
561 3300039438 Ga0436360_0293778 Ga0436360_0293778_1974_2954 316
562 3300039447 Ga0436361_1023898 Ga0436361_1023898_1517_2497 316
563 3300039453 Ga0436362_1162178 Ga0436362_1162178_1310_2290 316
564 3300046477 Ga0495664_0238881 Ga0495664_0238881_87_1067 316
565 3300046517 Ga0495630_0079856 Ga0495630_0079856_1348_2322 316
566 3300048905 Ga0496102_0191935 Ga0496102_0191935_389_1366 316
567 3300048912 Ga0496109_0059949 Ga0496109_0059949_57_1037 316
568 3300048915 Ga0496112_0000015 Ga0496112_0000015_205191_206171 316
569 3300048925 Ga0496122_0043747 Ga0496122_0043747_1295_2269 316
570 3300048926 Ga0496123_0038344 Ga0496123_0038344_2083_3057 316
571 3300049568 Ga0501031_0203827 Ga0501031_0203827_107_1153 316
572 3300049570 Ga0501033_0166711 Ga0501033_0166711_121_1167 316
573 3300049572 Ga0501036_0051626 Ga0501036_0051626_810_1856 316
574 3300049579 Ga0501043_0042774 Ga0501043_0042774_1989_3035 316
575 3300049580 Ga0501046_0078270 Ga0501046_0078270_1217_2263 316
576 3300049581 Ga0501047_0084929 Ga0501047_0084929_1505_2551 316
577 3300049586 Ga0501070_0099502 Ga0501070_0099502_1308_2288 316
578 3300049822 Ga0501035_0054458 Ga0501035_0054458_1863_2909 316
579 3300053093 Ga0500651_0227913 Ga0500651_0227913_49_1029 316
580 3300053142 Ga0500577_0041005 Ga0500577_0041005_590_1570 316
581 3300005336 Ga0070680_100018066 Ga0070680_1000180666 317
582 3300005338 Ga0068868_100123391 Ga0068868_1001233913 317
583 3300005435 Ga0070714_100089955 Ga0070714_1000899554 317
584 3300005436 Ga0070713_100035723 Ga0070713_1000357232 317
585 3300005436 Ga0070713_100046936 Ga0070713_1000469364 317
586 3300005458 Ga0070681_10065324 Ga0070681_100653244 317
587 3300005468 Ga0070707_100074049 Ga0070707_1000740493 317
588 3300005530 Ga0070679_100243743 Ga0070679_1002437432 317
589 3300005614 Ga0068856_100231152 Ga0068856_1002311522 317
590 3300006028 Ga0070717_10001080 Ga0070717_1000108014 317
591 3300013104 Ga0157370_10148044 Ga0157370_101480442 317
592 3300013105 Ga0157369_10206061 Ga0157369_102060612 317
593 3300014326 Ga0157380_10309704 Ga0157380_103097041 317
594 3300025253 Ga0209677_102065 Ga0209677_1020654 317
595 3300025904 Ga0207647_10112955 Ga0207647_101129552 317
596 3300025906 Ga0207699_10177335 Ga0207699_101773351 317
597 3300025912 Ga0207707_10174435 Ga0207707_101744351 317
598 3300025917 Ga0207660_10107988 Ga0207660_101079883 317
599 3300025921 Ga0207652_10103551 Ga0207652_101035512 317
600 3300025922 Ga0207646_10062005 Ga0207646_100620053 317
601 3300025928 Ga0207700_10027465 Ga0207700_100274652 317
602 3300025928 Ga0207700_10053782 Ga0207700_100537822 317
603 3300025928 Ga0207700_10302826 Ga0207700_103028262 317
604 3300025929 Ga0207664_10239471 Ga0207664_102394712 317
605 3300025949 Ga0207667_10047542 Ga0207667_100475422 317
606 3300031250 Ga0265331_10124615 Ga0265331_101246151 317
607 3300031344 Ga0265316_10045955 Ga0265316_100459554 317
608 3300031711 Ga0265314_10056041 Ga0265314_100560413 317
609 3300035112 Ga0373932_0020184 Ga0373932_0020184_479_1459 317
610 3300037418 Ga0395900_0139445 Ga0395900_0139445_230_1207 317
611 3300039437 Ga0436365_0361268 Ga0436365_0361268_412_1389 317
612 3300045049 Ga0466959_0195472 Ga0466959_0195472_155_1132 317
613 3300046615 Ga0495656_0139055 Ga0495656_0139055_158_1138 317
614 3300047472 Ga0495686_0140171 Ga0495686_0140171_314_1291 317
615 3300048088 Ga0495602_0142965 Ga0495602_0142965_552_1529 317
616 3300048909 Ga0496106_0006879 Ga0496106_0006879_121_1098 317
617 3300048911 Ga0496108_0000489 Ga0496108_0000489_20098_21075 317
618 3300048912 Ga0496109_0002105 Ga0496109_0002105_687_1664 317
619 3300048913 Ga0496110_0065232 Ga0496110_0065232_1108_2085 317
620 3300048914 Ga0496111_0135324 Ga0496111_0135324_191_1168 317
621 3300048915 Ga0496112_0001918 Ga0496112_0001918_9648_10625 317
622 3300048915 Ga0496112_0002702 Ga0496112_0002702_715_1695 317
623 3300048919 Ga0496116_0122458 Ga0496116_0122458_190_1167 317
624 3300048924 Ga0496121_0007421 Ga0496121_0007421_9635_10615 317
625 3300048924 Ga0496121_0025033 Ga0496121_0025033_863_1921 317
626 3300048928 Ga0496125_0000136 Ga0496125_0000136_67899_68876 317
627 3300048928 Ga0496125_0005117 Ga0496125_0005117_10839_11816 317
628 3300048929 Ga0496126_0038548 Ga0496126_0038548_2798_3775 317
629 3300048929 Ga0496126_0068807 Ga0496126_0068807_1916_2893 317
630 3300049569 Ga0501032_0010560 Ga0501032_0010560_5212_6189 317
631 3300049569 Ga0501032_0095074 Ga0501032_0095074_228_1211 317
632 3300049569 Ga0501032_0291089 Ga0501032_0291089_42_1019 317
633 3300049570 Ga0501033_0049938 Ga0501033_0049938_1168_2151 317
634 3300049571 Ga0501034_0015387 Ga0501034_0015387_4383_5366 317
635 3300049571 Ga0501034_0098131 Ga0501034_0098131_439_1416 317
636 3300049571 Ga0501034_0150221 Ga0501034_0150221_216_1199 317
637 3300049572 Ga0501036_0157941 Ga0501036_0157941_611_1588 317
638 3300049573 Ga0501037_0056096 Ga0501037_0056096_1372_2349 317
639 3300049574 Ga0501038_0031073 Ga0501038_0031073_646_1623 317
640 3300049574 Ga0501038_0044142 Ga0501038_0044142_2598_3575 317
641 3300049574 Ga0501038_0279885 Ga0501038_0279885_249_1232 317
642 3300049576 Ga0501040_0065785 Ga0501040_0065785_1133_2110 317
643 3300049578 Ga0501042_0008575 Ga0501042_0008575_5515_6498 317
644 3300049579 Ga0501043_0100630 Ga0501043_0100630_820_1803 317
645 3300049579 Ga0501043_0205655 Ga0501043_0205655_489_1466 317
646 3300049581 Ga0501047_0136951 Ga0501047_0136951_11_994 317
647 3300049582 Ga0501048_0045118 Ga0501048_0045118_1804_2781 317
648 3300049583 Ga0501067_0053201 Ga0501067_0053201_288_1271 317
649 3300049585 Ga0501069_0025024 Ga0501069_0025024_903_1880 317
650 3300049590 Ga0501074_0005077 Ga0501074_0005077_4331_5314 317
651 3300049591 Ga0501075_0382022 Ga0501075_0382022_50_1033 317
652 3300049741 Ga0501079_0009435 Ga0501079_0009435_767_1750 317
653 3300049744 Ga0501083_0018549 Ga0501083_0018549_2265_3248 317
654 3300049822 Ga0501035_0057786 Ga0501035_0057786_2047_3024 317
655 3300049822 Ga0501035_0121456 Ga0501035_0121456_529_1506 317
656 3300049823 Ga0501044_0037590 Ga0501044_0037590_1804_2781 317
657 3300053177 Ga0500636_0016050 Ga0500636_0016050_3274_4251 317
658 3300054114 Ga0501084_0021758 Ga0501084_0021758_3508_4491 317
659 3300060353 Ga0501082_0139935 Ga0501082_0139935_1107_2090 317
660 3300001979 JGI24740J21852_10005816 JGI24740J21852_100058162 318
661 3300003203 JGI25406J46586_10001837 JGI25406J46586_100018378 318
662 3300003203 JGI25406J46586_10005215 JGI25406J46586_100052152 318
663 3300003320 rootH2_10095142 rootH2_100951421 318
664 3300005262 Ga0065165_1032286 Ga0065165_10322861 318
665 3300005331 Ga0070670_100136854 Ga0070670_1001368542 318
666 3300005340 Ga0070689_100271375 Ga0070689_1002713751 318
667 3300005347 Ga0070668_100154825 Ga0070668_1001548251 318
668 3300005353 Ga0070669_100207161 Ga0070669_1002071612 318
669 3300005356 Ga0070674_100156801 Ga0070674_1001568011 318
670 3300005364 Ga0070673_100279431 Ga0070673_1002794311 318
671 3300005366 Ga0070659_100187887 Ga0070659_1001878872 318
672 3300005367 Ga0070667_100085231 Ga0070667_1000852311 318
673 3300005434 Ga0070709_10008846 Ga0070709_100088466 318
674 3300005435 Ga0070714_100006113 Ga0070714_1000061131 318
675 3300005435 Ga0070714_100013348 Ga0070714_1000133485 318
676 3300005436 Ga0070713_100033309 Ga0070713_1000333091 318
677 3300005436 Ga0070713_100091253 Ga0070713_1000912531 318
678 3300005437 Ga0070710_10000629 Ga0070710_1000062912 318
679 3300005437 Ga0070710_10002613 Ga0070710_100026137 318
680 3300005439 Ga0070711_100007337 Ga0070711_1000073374 318
681 3300005439 Ga0070711_100007770 Ga0070711_1000077703 318
682 3300005439 Ga0070711_100091165 Ga0070711_1000911652 318
683 3300005441 Ga0070700_100101950 Ga0070700_1001019502 318
684 3300005455 Ga0070663_100082650 Ga0070663_1000826502 318
685 3300005455 Ga0070663_100121391 Ga0070663_1001213911 318
686 3300005455 Ga0070663_100223453 Ga0070663_1002234531 318
687 3300005456 Ga0070678_100179341 Ga0070678_1001793412 318
688 3300005456 Ga0070678_100270236 Ga0070678_1002702361 318
689 3300005457 Ga0070662_100349043 Ga0070662_1003490431 318
690 3300005458 Ga0070681_10138275 Ga0070681_101382753 318
691 3300005458 Ga0070681_10286788 Ga0070681_102867881 318
692 3300005466 Ga0070685_10140521 Ga0070685_101405212 318
693 3300005530 Ga0070679_100111200 Ga0070679_1001112003 318
694 3300005535 Ga0070684_100335350 Ga0070684_1003353501 318
695 3300005539 Ga0068853_100001617 Ga0068853_1000016176 318
696 3300005539 Ga0068853_100126841 Ga0068853_1001268413 318
697 3300005544 Ga0070686_100088905 Ga0070686_1000889053 318
698 3300005563 Ga0068855_100090885 Ga0068855_1000908852 318
699 3300005563 Ga0068855_100188548 Ga0068855_1001885482 318
700 3300005577 Ga0068857_100088196 Ga0068857_1000881963 318
701 3300005578 Ga0068854_100026066 Ga0068854_1000260662 318
702 3300005614 Ga0068856_100197610 Ga0068856_1001976102 318
703 3300005615 Ga0070702_100042184 Ga0070702_1000421844 318
704 3300005616 Ga0068852_100020357 Ga0068852_1000203572 318
705 3300005617 Ga0068859_100378331 Ga0068859_1003783312 318
706 3300005618 Ga0068864_100094342 Ga0068864_1000943421 318
707 3300005718 Ga0068866_10062985 Ga0068866_100629851 318
708 3300005719 Ga0068861_100169819 Ga0068861_1001698192 318
709 3300005719 Ga0068861_100185350 Ga0068861_1001853502 318
710 3300005719 Ga0068861_100352524 Ga0068861_1003525242 318
711 3300005834 Ga0068851_10004728 Ga0068851_100047282 318
712 3300005841 Ga0068863_100415836 Ga0068863_1004158361 318
713 3300005841 Ga0068863_100609846 Ga0068863_1006098461 318
714 3300005843 Ga0068860_100001803 Ga0068860_10000180313 318
715 3300005844 Ga0068862_100273969 Ga0068862_1002739692 318
716 3300005937 Ga0081455_10049478 Ga0081455_100494782 318
717 3300005983 Ga0081540_1035887 Ga0081540_10358872 318
718 3300005985 Ga0081539_10000064 Ga0081539_10000064159 318
719 3300006163 Ga0070715_10088356 Ga0070715_100883561 318
720 3300006173 Ga0070716_100000664 Ga0070716_10000066411 318
721 3300006173 Ga0070716_100000748 Ga0070716_1000007483 318
722 3300006173 Ga0070716_100068077 Ga0070716_1000680772 318
723 3300006175 Ga0070712_100006771 Ga0070712_1000067716 318
724 3300006175 Ga0070712_100022828 Ga0070712_1000228281 318
725 3300006175 Ga0070712_100061362 Ga0070712_1000613622 318
726 3300006871 Ga0075434_100028847 Ga0075434_1000288473 318
727 3300006881 Ga0068865_100076637 Ga0068865_1000766374 318
728 3300006931 Ga0097620_100378367 Ga0097620_1003783672 318
729 3300007076 Ga0075435_100130333 Ga0075435_1001303333 318
730 3300009093 Ga0105240_10001754 Ga0105240_100017549 318
731 3300009094 Ga0111539_10170198 Ga0111539_101701982 318
732 3300009101 Ga0105247_10110443 Ga0105247_101104432 318
733 3300009148 Ga0105243_10088250 Ga0105243_100882502 318
734 3300009174 Ga0105241_10002619 Ga0105241_1000261914 318
735 3300009176 Ga0105242_10216101 Ga0105242_102161012 318
736 3300009177 Ga0105248_10305134 Ga0105248_103051342 318
737 3300009177 Ga0105248_10385848 Ga0105248_103858481 318
738 3300009551 Ga0105238_10001086 Ga0105238_100010866 318
739 3300009551 Ga0105238_10041846 Ga0105238_100418466 318
740 3300010375 Ga0105239_10087195 Ga0105239_100871951 318
741 3300010375 Ga0105239_10201621 Ga0105239_102016212 318
742 3300010375 Ga0105239_10582780 Ga0105239_105827801 318
743 3300013104 Ga0157370_10179694 Ga0157370_101796941 318
744 3300013296 Ga0157374_10232416 Ga0157374_102324162 318
745 3300013306 Ga0163162_10091446 Ga0163162_100914462 318
746 3300013306 Ga0163162_10314595 Ga0163162_103145952 318
747 3300013307 Ga0157372_10244664 Ga0157372_102446641 318
748 3300013308 Ga0157375_10459482 Ga0157375_104594822 318
749 3300014325 Ga0163163_10151405 Ga0163163_101514052 318
750 3300014326 Ga0157380_10464666 Ga0157380_104646662 318
751 3300014968 Ga0157379_10149877 Ga0157379_101498772 318
752 3300014968 Ga0157379_10183167 Ga0157379_101831672 318
753 3300017792 Ga0163161_10271152 Ga0163161_102711522 318
754 3300021384 Ga0213876_10001803 Ga0213876_100018034 318
755 3300021384 Ga0213876_10140647 Ga0213876_101406472 318
756 3300025272 Ga0209455_1002169 Ga0209455_10021692 318
757 3300025272 Ga0209455_1005163 Ga0209455_10051633 318
758 3300025297 Ga0209758_1007289 Ga0209758_10072894 318
759 3300025297 Ga0209758_1020122 Ga0209758_10201225 318
760 3300025297 Ga0209758_1043810 Ga0209758_10438102 318
761 3300025302 Ga0207426_1000628 Ga0207426_100062839 318
762 3300025321 Ga0207656_10003723 Ga0207656_100037236 318
763 3300025898 Ga0207692_10000489 Ga0207692_100004898 318
764 3300025898 Ga0207692_10001833 Ga0207692_100018337 318
765 3300025901 Ga0207688_10094818 Ga0207688_100948182 318
766 3300025901 Ga0207688_10119321 Ga0207688_101193212 318
767 3300025905 Ga0207685_10017251 Ga0207685_100172513 318
768 3300025906 Ga0207699_10004893 Ga0207699_100048936 318
769 3300025907 Ga0207645_10054999 Ga0207645_100549991 318
770 3300025911 Ga0207654_10000175 Ga0207654_1000017516 318
771 3300025911 Ga0207654_10114889 Ga0207654_101148892 318
772 3300025911 Ga0207654_10275673 Ga0207654_102756731 318
773 3300025913 Ga0207695_10009236 Ga0207695_100092361 318
774 3300025914 Ga0207671_10117218 Ga0207671_101172182 318
775 3300025915 Ga0207693_10011033 Ga0207693_100110332 318
776 3300025915 Ga0207693_10011474 Ga0207693_100114743 318
777 3300025915 Ga0207693_10015141 Ga0207693_100151413 318
778 3300025916 Ga0207663_10062979 Ga0207663_100629792 318
779 3300025916 Ga0207663_10116758 Ga0207663_101167583 318
780 3300025916 Ga0207663_10396334 Ga0207663_103963341 318
781 3300025918 Ga0207662_10162946 Ga0207662_101629461 318
782 3300025919 Ga0207657_10181769 Ga0207657_101817692 318
783 3300025923 Ga0207681_10341544 Ga0207681_103415441 318
784 3300025924 Ga0207694_10000226 Ga0207694_1000022630 318
785 3300025924 Ga0207694_10086361 Ga0207694_100863613 318
786 3300025925 Ga0207650_10090200 Ga0207650_100902002 318
787 3300025926 Ga0207659_10350710 Ga0207659_103507101 318
788 3300025928 Ga0207700_10147668 Ga0207700_101476681 318
789 3300025928 Ga0207700_10249354 Ga0207700_102493542 318
790 3300025929 Ga0207664_10004352 Ga0207664_1000435211 318
791 3300025929 Ga0207664_10042658 Ga0207664_100426583 318
792 3300025933 Ga0207706_10239310 Ga0207706_102393101 318
793 3300025934 Ga0207686_10243828 Ga0207686_102438282 318
794 3300025935 Ga0207709_10189716 Ga0207709_101897161 318
795 3300025936 Ga0207670_10103182 Ga0207670_101031823 318
796 3300025939 Ga0207665_10000235 Ga0207665_1000023521 318
797 3300025939 Ga0207665_10001984 Ga0207665_1000198412 318
798 3300025939 Ga0207665_10167723 Ga0207665_101677232 318
799 3300025940 Ga0207691_10089157 Ga0207691_100891572 318
800 3300025941 Ga0207711_10254365 Ga0207711_102543652 318
801 3300025949 Ga0207667_10004170 Ga0207667_1000417010 318
802 3300025949 Ga0207667_10186840 Ga0207667_101868404 318
803 3300025972 Ga0207668_10115575 Ga0207668_101155752 318
804 3300025981 Ga0207640_10004452 Ga0207640_100044529 318
805 3300026035 Ga0207703_10138291 Ga0207703_101382912 318
806 3300026041 Ga0207639_10006164 Ga0207639_100061642 318
807 3300026041 Ga0207639_10104816 Ga0207639_101048162 318
808 3300026067 Ga0207678_10060689 Ga0207678_100606892 318
809 3300026067 Ga0207678_10121258 Ga0207678_101212582 318
810 3300026067 Ga0207678_10169969 Ga0207678_101699691 318
811 3300026067 Ga0207678_10204927 Ga0207678_102049272 318
812 3300026067 Ga0207678_10259286 Ga0207678_102592862 318
813 3300026075 Ga0207708_10175218 Ga0207708_101752182 318
814 3300026078 Ga0207702_10000004 Ga0207702_10000004331 318
815 3300026088 Ga0207641_10127533 Ga0207641_101275333 318
816 3300026088 Ga0207641_10251432 Ga0207641_102514322 318
817 3300026088 Ga0207641_10569331 Ga0207641_105693311 318
818 3300026089 Ga0207648_10286296 Ga0207648_102862961 318
819 3300026089 Ga0207648_10351005 Ga0207648_103510052 318
820 3300026116 Ga0207674_10008354 Ga0207674_100083542 318
821 3300026116 Ga0207674_10388239 Ga0207674_103882391 318
822 3300026118 Ga0207675_100199827 Ga0207675_1001998272 318
823 3300026121 Ga0207683_10227305 Ga0207683_102273052 318
824 3300026142 Ga0207698_10025144 Ga0207698_100251441 318
825 3300026142 Ga0207698_10297811 Ga0207698_102978112 318
826 3300028379 Ga0268266_10029434 Ga0268266_100294342 318
827 3300028380 Ga0268265_10175233 Ga0268265_101752332 318
828 3300028380 Ga0268265_10219803 Ga0268265_102198032 318
829 3300028380 Ga0268265_10266720 Ga0268265_102667202 318
830 3300028381 Ga0268264_10000157 Ga0268264_1000015726 318
831 3300028556 Ga0265337_1016358 Ga0265337_10163581 318
832 3300028577 Ga0265318_10012173 Ga0265318_100121732 318
833 3300028653 Ga0265323_10001778 Ga0265323_100017783 318
834 3300028666 Ga0265336_10000235 Ga0265336_1000023530 318
835 3300028800 Ga0265338_10005155 Ga0265338_1000515513 318
836 3300031235 Ga0265330_10028933 Ga0265330_100289332 318
837 3300031235 Ga0265330_10031347 Ga0265330_100313473 318
838 3300031235 Ga0265330_10038596 Ga0265330_100385963 318
839 3300031241 Ga0265325_10013306 Ga0265325_100133066 318
840 3300031247 Ga0265340_10018279 Ga0265340_100182793 318
841 3300033180 Ga0307510_10016268 Ga0307510_100162687 318
842 3300035085 Ga0373929_0011781 Ga0373929_0011781_379_1359 318
843 3300035111 Ga0373923_0059945 Ga0373923_0059945_174_1154 318
844 3300035111 Ga0373923_0097735 Ga0373923_0097735_244_1224 318
845 3300035116 Ga0373945_0004476 Ga0373945_0004476_413_1393 318
846 3300035116 Ga0373945_0014361 Ga0373945_0014361_1457_2437 318
847 3300035171 Ga0373946_0006060 Ga0373946_0006060_2922_3902 318
848 3300035171 Ga0373946_0026634 Ga0373946_0026634_376_1356 318
849 3300035172 Ga0373955_0029460 Ga0373955_0029460_1481_2461 318
850 3300035410 Ga0373924_0010097 Ga0373924_0010097_1491_2471 318
851 3300035691 Ga0373931_0001548 Ga0373931_0001548_820_1800 318
852 3300035692 Ga0373935_0053046 Ga0373935_0053046_68_1048 318
853 3300035695 Ga0373927_0062796 Ga0373927_0062796_429_1409 318
854 3300035695 Ga0373927_0101520 Ga0373927_0101520_492_1472 318
855 3300035724 Ga0373933_0097317 Ga0373933_0097317_702_1682 318
856 3300035725 Ga0373947_0004053 Ga0373947_0004053_417_1397 318
857 3300035725 Ga0373947_0041568 Ga0373947_0041568_1073_2053 318
858 3300037068 Ga0373925_0033366 Ga0373925_0033366_663_1643 318
859 3300037068 Ga0373925_0249118 Ga0373925_0249118_151_1131 318
860 3300037312 Ga0395899_0021904 Ga0395899_0021904_361_1341 318
861 3300037418 Ga0395900_0166459 Ga0395900_0166459_789_1769 318
862 3300037471 Ga0395905_0108510 Ga0395905_0108510_635_1615 318
863 3300038443 Ga0395901_0306555 Ga0395901_0306555_478_1458 318
864 3300038443 Ga0395901_0431503 Ga0395901_0431503_303_1328 318
865 3300039437 Ga0436365_0517722 Ga0436365_0517722_3942_4922 318
866 3300044694 Ga0466963_0044606 Ga0466963_0044606_701_1681 318
867 3300045976 Ga0466967_0131367 Ga0466967_0131367_955_1935 318
868 3300046454 Ga0495592_0024966 Ga0495592_0024966_754_1734 318
869 3300046455 Ga0495603_0000826 Ga0495603_0000826_2926_3906 318
870 3300046455 Ga0495603_0011755 Ga0495603_0011755_123_1103 318
871 3300046455 Ga0495603_0038493 Ga0495603_0038493_1160_2140 318
872 3300046459 Ga0495629_0000587 Ga0495629_0000587_2877_3857 318
873 3300046459 Ga0495629_0046968 Ga0495629_0046968_1830_2810 318
874 3300046461 Ga0495641_0003504 Ga0495641_0003504_2811_3791 318
875 3300046462 Ga0495651_0088120 Ga0495651_0088120_81_1061 318
876 3300046463 Ga0495653_0081954 Ga0495653_0081954_214_1194 318
877 3300046472 Ga0495580_0025540 Ga0495580_0025540_1214_2194 318
878 3300046473 Ga0495582_0000018 Ga0495582_0000018_84686_85666 318
879 3300046473 Ga0495582_0057510 Ga0495582_0057510_562_1542 318
880 3300046475 Ga0495639_0000272 Ga0495639_0000272_16727_17707 318
881 3300046476 Ga0495662_0002085 Ga0495662_0002085_3267_4247 318
882 3300046476 Ga0495662_0013233 Ga0495662_0013233_2230_3210 318
883 3300046477 Ga0495664_0020862 Ga0495664_0020862_619_1599 318
884 3300046477 Ga0495664_0071543 Ga0495664_0071543_163_1143 318
885 3300046499 Ga0495594_0000155 Ga0495594_0000155_28783_29763 318
886 3300046499 Ga0495594_0075554 Ga0495594_0075554_261_1241 318
887 3300046507 Ga0495606_0000676 Ga0495606_0000676_9869_10849 318
888 3300046513 Ga0495616_0025703 Ga0495616_0025703_751_1731 318
889 3300046516 Ga0495628_0064930 Ga0495628_0064930_923_1903 318
890 3300046517 Ga0495630_0018269 Ga0495630_0018269_2190_3170 318
891 3300046524 Ga0495648_0001519 Ga0495648_0001519_7921_8901 318
892 3300046526 Ga0495666_0151344 Ga0495666_0151344_22_1002 318
893 3300046529 Ga0495652_0047147 Ga0495652_0047147_437_1417 318
894 3300046531 Ga0495665_0009932 Ga0495665_0009932_2826_3806 318
895 3300046533 Ga0495640_0020760 Ga0495640_0020760_621_1601 318
896 3300046533 Ga0495640_0038318 Ga0495640_0038318_350_1330 318
897 3300046557 Ga0495622_0006549 Ga0495622_0006549_3892_4872 318
898 3300046558 Ga0495633_0137069 Ga0495633_0137069_77_1057 318
899 3300046559 Ga0495667_0083208 Ga0495667_0083208_177_1157 318
900 3300046615 Ga0495656_0023834 Ga0495656_0023834_593_1573 318
901 3300046642 Ga0495634_0005445 Ga0495634_0005445_7356_8336 318
902 3300046642 Ga0495634_0034758 Ga0495634_0034758_903_1883 318
903 3300046663 Ga0495635_0017934 Ga0495635_0017934_2921_3901 318
904 3300046665 Ga0495661_0125050 Ga0495661_0125050_62_1042 318
905 3300046674 Ga0495588_0024462 Ga0495588_0024462_1673_2653 318
906 3300046680 Ga0495646_0026378 Ga0495646_0026378_82_1062 318
907 3300046680 Ga0495646_0100179 Ga0495646_0100179_105_1085 318
908 3300046681 Ga0495647_0000364 Ga0495647_0000364_8869_9849 318
909 3300046683 Ga0495658_0001654 Ga0495658_0001654_5074_6054 318
910 3300046683 Ga0495658_0085375 Ga0495658_0085375_142_1122 318
911 3300046684 Ga0495669_0039055 Ga0495669_0039055_685_1665 318
912 3300046689 Ga0495613_0114019 Ga0495613_0114019_63_1043 318
913 3300046690 Ga0495624_0001316 Ga0495624_0001316_15614_16594 318
914 3300046794 Ga0495589_0076920 Ga0495589_0076920_217_1197 318
915 3300047315 Ga0495581_0001084 Ga0495581_0001084_10895_11875 318
916 3300047317 Ga0495604_0213363 Ga0495604_0213363_62_1042 318
917 3300047318 Ga0495636_0163128 Ga0495636_0163128_12_992 318
918 3300047319 Ga0495674_0003842 Ga0495674_0003842_10739_11719 318
919 3300047319 Ga0495674_0035096 Ga0495674_0035096_907_1887 318
920 3300047320 Ga0495672_0013378 Ga0495672_0013378_1095_2075 318
921 3300047323 Ga0495683_0122973 Ga0495683_0122973_98_1078 318
922 3300047445 Ga0495677_0060857 Ga0495677_0060857_210_1190 318
923 3300047470 Ga0495681_0038298 Ga0495681_0038298_20_1000 318
924 3300047471 Ga0495684_0049392 Ga0495684_0049392_817_1896 318
925 3300047471 Ga0495684_0067312 Ga0495684_0067312_718_1698 318
926 3300047673 Ga0495593_0000419 Ga0495593_0000419_2926_3906 318
927 3300048090 Ga0495615_0012694 Ga0495615_0012694_611_1591 318
928 3300048903 Ga0496100_0187894 Ga0496100_0187894_25_1005 318
929 3300048904 Ga0496101_0047737 Ga0496101_0047737_1299_2279 318
930 3300048905 Ga0496102_0242013 Ga0496102_0242013_386_1366 318
931 3300048905 Ga0496102_0359249 Ga0496102_0359249_144_1124 318
932 3300048906 Ga0496103_0090204 Ga0496103_0090204_684_1664 318
933 3300048906 Ga0496103_0150626 Ga0496103_0150626_91_1071 318
934 3300048907 Ga0496104_0003129 Ga0496104_0003129_12869_13849 318
935 3300048909 Ga0496106_0005088 Ga0496106_0005088_6023_7003 318
936 3300048911 Ga0496108_0120168 Ga0496108_0120168_440_1420 318
937 3300048912 Ga0496109_0054089 Ga0496109_0054089_1698_2678 318
938 3300048912 Ga0496109_0182720 Ga0496109_0182720_248_1228 318
939 3300048912 Ga0496109_0392401 Ga0496109_0392401_36_1016 318
940 3300048913 Ga0496110_0003310 Ga0496110_0003310_6455_7435 318
941 3300048913 Ga0496110_0120601 Ga0496110_0120601_943_1923 318
942 3300048913 Ga0496110_0146047 Ga0496110_0146047_142_1122 318
943 3300048914 Ga0496111_0038120 Ga0496111_0038120_149_1129 318
944 3300048915 Ga0496112_0038437 Ga0496112_0038437_16_996 318
945 3300048916 Ga0496113_0013883 Ga0496113_0013883_1010_1990 318
946 3300048916 Ga0496113_0024191 Ga0496113_0024191_708_1688 318
947 3300048918 Ga0496115_0150684 Ga0496115_0150684_391_1371 318
948 3300048922 Ga0496119_0074108 Ga0496119_0074108_836_1816 318
949 3300048922 Ga0496119_0133008 Ga0496119_0133008_269_1249 318
950 3300048924 Ga0496121_0000786 Ga0496121_0000786_54226_55206 318
951 3300048924 Ga0496121_0075538 Ga0496121_0075538_481_1461 318
952 3300048924 Ga0496121_0082258 Ga0496121_0082258_1485_2498 318
953 3300048924 Ga0496121_0111142 Ga0496121_0111142_167_1147 318
954 3300048927 Ga0496124_0201352 Ga0496124_0201352_385_1410 318
955 3300049823 Ga0501044_0084757 Ga0501044_0084757_549_1595 318
956 3300050511 nmdc:mga08y16_173922_c1 nmdc:mga08y16_173922_c1_997_1977 318
957 3300050513 nmdc:mga0rr50_82438_c1 nmdc:mga0rr50_82438_c1_1371_2378 318
958 3300053088 Ga0500644_0096081 Ga0500644_0096081_29_1009 318
959 3300053094 Ga0500566_0001223 Ga0500566_0001223_7906_8886 318
960 3300053094 Ga0500566_0010050 Ga0500566_0010050_1370_2350 318
961 3300053094 Ga0500566_0076480 Ga0500566_0076480_346_1326 318
962 3300053102 Ga0500554_002687 Ga0500554_002687_2252_3232 318
963 3300053102 Ga0500554_012553 Ga0500554_012553_1137_2117 318
964 3300053111 Ga0500572_000415 Ga0500572_000415_3087_4067 318
965 3300053111 Ga0500572_014670 Ga0500572_014670_480_1460 318
966 3300053118 Ga0500594_0032330 Ga0500594_0032330_301_1281 318
967 3300053119 Ga0500595_009735 Ga0500595_009735_2336_3316 318
968 3300053119 Ga0500595_018065 Ga0500595_018065_1194_2174 318
969 3300053122 Ga0500608_012388 Ga0500608_012388_995_1975 318
970 3300053133 Ga0500655_026347 Ga0500655_026347_102_1082 318
971 3300053136 Ga0500559_0001060 Ga0500559_0001060_780_1760 318
972 3300053139 Ga0500568_0014183 Ga0500568_0014183_1468_2448 318
973 3300053150 Ga0500603_001404 Ga0500603_001404_1418_2398 318
974 3300053150 Ga0500603_006415 Ga0500603_006415_240_1220 318
975 3300053153 Ga0500616_0000038 Ga0500616_0000038_13096_14076 318
976 3300053156 Ga0500622_0046249 Ga0500622_0046249_1015_1995 318
977 3300053159 Ga0500630_030914 Ga0500630_030914_1420_2400 318
978 3300053161 Ga0500634_0096205 Ga0500634_0096205_216_1196 318
979 3300053162 Ga0500638_013381 Ga0500638_013381_2055_3035 318
980 3300053162 Ga0500638_031306 Ga0500638_031306_261_1241 318
981 3300053163 Ga0500639_013822 Ga0500639_013822_2868_3848 318
982 3300053163 Ga0500639_033760 Ga0500639_033760_25_1005 318
983 3300053178 Ga0500637_0004377 Ga0500637_0004377_1873_2853 318
984 3300053178 Ga0500637_0020058 Ga0500637_0020058_1866_2846 318
985 3300053735 Ga0500596_000930 Ga0500596_000930_396_1376 318
986 3300055283 Ga0500661_005155 Ga0500661_005155_688_1668 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

106

252

0.98

PF00574

CLP_protease

Clp protease

64

143

0.78

PF01972

SDH_sah

Serine dehydrogenase proteinase

62

226

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uyv-assembly1.cif.gz_A-2 acetyl-coa carboxylase carboxyltransferase domain l1705i/v1967i mutant 0.8707 61 136
1uyv-assembly2.cif.gz_B acetyl-coa carboxylase carboxyltransferase domain l1705i/v1967i mutant 0.8602 61 136
4g2r-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis 0.8567 61 137
4g2r-assembly1.cif.gz_B crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis 0.8561 61 136
6tzv-assembly3.cif.gz_E crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis 0.8517 61 134
ID Description Score Start End Superfamily
af_Q9C9C0_371_523_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.916 44 143 3.90.226.10
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8399 61 136 3.90.226.10
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.821 44 259 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.805 43 264 3.90.226.10
af_P9WPC3_1_214_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7992 48 238 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A536G5J8-F1-model_v4 S49 family peptidase 0.9228 40 143 GO:0006508
GO:0008236
AF-A0A350XYH0-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.8407 48 235 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A3D0WUJ5-F1-model_v4 Signal peptide peptidase SppA 0.8391 32 137 GO:0006465
GO:0008236
GO:0016020
AF-A0A6L5DFQ3-F1-model_v4 deleted 0.8265 44 263
AF-A0A353BVJ5-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.8115 45 236 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117

Feature Viewer

pLDDT pTM Quality
71.72 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map