F487492

General Info

Members Datasets Scaffolds Average Seq Length
985 373 972 251

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100230058|Ga0070682_1002300581
Length 292
Sequence VRPPALTKTPARIVGLCSESKTEKPALSSRVCESVYTRSPVTEQKKNADTDFGYQRVPWNEKQRRVRGVFDSVAGNYDLMNDLMSGGAHRLWKEFTLSLTGLRPGQRALDVAGGTGDLTTGLAKQVGRTGKVILSDINAAMLGEGRDRLLDAGVVGNVSCVLANAEKLPFADAMFDCVTIGFGLRNVTDKPAALADMRRVLKPGGQLLVLEFSQPVIPLLKPLYDLYSFRVLPLIGKLVARDEDSYRYLAESIRMHPDQETLLGMLRDAGLEDCRYHNLSGGIVAVHRGYRY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
3 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
4 2847085930 Erwinia persicina B64 Isolate Bulb
5 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
6 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
7 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
8 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
9 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
10 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
11 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
12 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
13 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
14 2952252522 Salinicola sp. DM10 Isolate Unclassified
15 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
132 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
249 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
250 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
251 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
252 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
265 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
365 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.71
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.1
Endosphere 1.62
Nodule 0
Rhizoplane 3.96
Rhizosphere 88.22
Stem 0
Stem Tuber 0.61
Unclassified 5.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1816436 2162886007 Bacteria 5101
2 rootH1_10014283 3300003323 Bacteria 28556
3 rootH1_10028592 3300003316 Bacteria 2016
4 rootH1_10028592 3300003323 Bacteria 35557
5 Ga0065712_10305094 3300005290 Bacteria 853
6 Ga0065715_10135706 3300005293 Bacteria 1934
7 Ga0065707_10087670 3300005295 Bacteria 4933
8 Ga0070676_10070031 3300005328 Bacteria 2103
9 Ga0070690_100001308 3300005330 Bacteria 12943
10 Ga0070690_100004513 3300005330 Bacteria 7741
11 Ga0070670_100024081 3300005331 Bacteria 5237
12 Ga0070670_100133139 3300005331 Bacteria 2147
13 Ga0070670_100153902 3300005331 Bacteria 1991
14 Ga0070677_10136475 3300005333 Bacteria 1126
15 Ga0068869_100023174 3300005334 Bacteria 4285
16 Ga0068869_100051345 3300005334 Bacteria 2992
17 Ga0068869_100075759 3300005334 Bacteria 2500
18 Ga0068869_100077983 3300005334 Bacteria 2466
19 Ga0068869_100379856 3300005334 Bacteria 1158
20 Ga0070666_10011341 3300005335 Bacteria 5592
21 Ga0070666_10231698 3300005335 Bacteria 1304
22 Ga0070680_100028196 3300005336 Bacteria 4502
23 Ga0070680_100054620 3300005336 Bacteria 3262
24 Ga0070680_100090221 3300005336 Bacteria 2537
25 Ga0070680_100164337 3300005336 Bacteria 1866
26 Ga0070682_100025164 3300005337 Bacteria 3550
27 Ga0070682_100096994 3300005337 Bacteria 1939
28 Ga0070682_100114136 3300005337 Bacteria 1805
29 Ga0070682_100230058 3300005337 Bacteria 1325
30 Ga0068868_100012735 3300005338 Bacteria 6152
31 Ga0068868_100013212 3300005338 Bacteria 6048
32 Ga0068868_100086997 3300005338 Bacteria 2513
33 Ga0068868_100129898 3300005338 Bacteria 2061
34 Ga0070689_100005729 3300005340 Bacteria 8518
35 Ga0070689_100040184 3300005340 Bacteria 3585
36 Ga0070689_100254524 3300005340 Bacteria 1450
37 Ga0070691_10060331 3300005341 Bacteria 1823
38 Ga0070691_10254984 3300005341 Bacteria 942
39 Ga0070687_100413822 3300005343 Bacteria 887
40 Ga0070661_100001052 3300005344 Bacteria 19527
41 Ga0070692_10042220 3300005345 Bacteria 2341
42 Ga0070668_100003202 3300005347 Bacteria 12061
43 Ga0070668_100135714 3300005347 Bacteria 1979
44 Ga0070669_100102022 3300005353 Bacteria 2166
45 Ga0070669_100282176 3300005353 Bacteria 1331
46 Ga0070675_100001328 3300005354 Bacteria 18093
47 Ga0070675_100010064 3300005354 Bacteria 7375
48 Ga0070675_100057626 3300005354 Bacteria 3203
49 Ga0070675_100089294 3300005354 Bacteria 2580
50 Ga0070675_100109518 3300005354 Bacteria 2334
51 Ga0070675_100290096 3300005354 Unclassified 1440
52 Ga0070675_100361165 3300005354 Bacteria 1289
53 Ga0070671_100001010 3300005355 Bacteria 20683
54 Ga0070671_100024020 3300005355 Bacteria 4989
55 Ga0070671_100055516 3300005355 Bacteria 3295
56 Ga0070671_100129961 3300005355 Bacteria 2121
57 Ga0070671_100167304 3300005355 Bacteria 1859
58 Ga0070671_100235776 3300005355 Bacteria 1553
59 Ga0070674_100083269 3300005356 Bacteria 2290
60 Ga0070673_100021022 3300005364 Bacteria 4721
61 Ga0070673_100111056 3300005364 Bacteria 2274
62 Ga0070673_100167918 3300005364 Bacteria 1871
63 Ga0070673_100347779 3300005364 Bacteria 1315
64 Ga0070673_100401894 3300005364 Bacteria 1225
65 Ga0070688_100012489 3300005365 Bacteria 4761
66 Ga0070688_100097922 3300005365 Bacteria 1929
67 Ga0070659_100575380 3300005366 Bacteria 966
68 Ga0070667_100000011 3300005367 Bacteria 269772
69 Ga0070667_100027211 3300005367 Bacteria 4758
70 Ga0070667_100035663 3300005367 Bacteria 4168
71 Ga0070667_100304426 3300005367 Bacteria 1436
72 Ga0070703_10045907 3300005406 Bacteria 1379
73 Ga0070709_10037973 3300005434 Bacteria 2946
74 Ga0070709_10165875 3300005434 Bacteria 1539
75 Ga0070714_100004766 3300005435 Bacteria 10275
76 Ga0070713_100000427 3300005436 Bacteria 26892
77 Ga0070713_100006160 3300005436 Bacteria 8289
78 Ga0070713_100186323 3300005436 Bacteria 1868
79 Ga0070713_100257557 3300005436 Bacteria 1593
80 Ga0070710_10048629 3300005437 Bacteria 2370
81 Ga0070711_100173391 3300005439 Bacteria 1646
82 Ga0070705_100015579 3300005440 Bacteria 3935
83 Ga0070705_100022150 3300005440 Bacteria 3391
84 Ga0070700_100009378 3300005441 Bacteria 5369
85 Ga0070700_100027973 3300005441 Bacteria 3349
86 Ga0070700_100056935 3300005441 Bacteria 2452
87 Ga0070700_100106602 3300005441 Bacteria 1855
88 Ga0070700_100163119 3300005441 Bacteria 1536
89 Ga0070694_100022752 3300005444 Bacteria 4021
90 Ga0070663_100078749 3300005455 Bacteria 2416
91 Ga0070663_100172797 3300005455 Bacteria 1671
92 Ga0070678_100014668 3300005456 Bacteria 4954
93 Ga0070678_100045854 3300005456 Bacteria 3130
94 Ga0070678_100376492 3300005456 Bacteria 1227
95 Ga0070662_100010889 3300005457 Bacteria 5992
96 Ga0070662_100181614 3300005457 Bacteria 1659
97 Ga0070681_10001348 3300005458 Bacteria 21452
98 Ga0070681_10002296 3300005458 Bacteria 17489
99 Ga0070681_10008431 3300005458 Bacteria 10091
100 Ga0070681_10010987 3300005458 Bacteria 8951
101 Ga0070681_10023527 3300005458 Bacteria 6196
102 Ga0070681_10033898 3300005458 Bacteria 5127
103 Ga0070681_10150026 3300005458 Bacteria 2258
104 Ga0070681_10189019 3300005458 Bacteria 1979
105 Ga0068867_100053916 3300005459 Bacteria 2970
106 Ga0070685_10151669 3300005466 Bacteria 1469
107 Ga0070698_100596379 3300005471 Bacteria 1045
108 Ga0070679_100004511 3300005530 Bacteria 12860
109 Ga0070679_100033547 3300005530 Bacteria 5083
110 Ga0070679_100038601 3300005530 Bacteria 4748
111 Ga0070679_100211728 3300005530 Bacteria 1902
112 Ga0070684_100000450 3300005535 Bacteria 28151
113 Ga0070684_100032314 3300005535 Bacteria 4459
114 Ga0068853_100167176 3300005539 Bacteria 1988
115 Ga0068853_100235792 3300005539 Bacteria 1675
116 Ga0068853_100340110 3300005539 Bacteria 1394
117 Ga0068853_100374647 3300005539 Bacteria 1328
118 Ga0068853_100552262 3300005539 Bacteria 1091
119 Ga0070672_100191999 3300005543 Bacteria 1705
120 Ga0070686_100001533 3300005544 Bacteria 12984
121 Ga0070696_100024017 3300005546 Bacteria 4143
122 Ga0070696_100160333 3300005546 Bacteria 1657
123 Ga0070693_100120387 3300005547 Bacteria 1627
124 Ga0070693_100358274 3300005547 Bacteria 1000
125 Ga0070665_100006899 3300005548 Bacteria 11546
126 Ga0070665_100013131 3300005548 Bacteria 8341
127 Ga0070665_100014187 3300005548 Bacteria 8006
128 Ga0070665_100074552 3300005548 Bacteria 3399
129 Ga0070665_100091910 3300005548 Bacteria 3040
130 Ga0068855_100010581 3300005563 Bacteria 11122
131 Ga0068855_100018420 3300005563 Bacteria 8390
132 Ga0068855_100020245 3300005563 Bacteria 7987
133 Ga0068855_100493135 3300005563 Bacteria 1332
134 Ga0070664_100004843 3300005564 Bacteria 10783
135 Ga0070664_100005240 3300005564 Bacteria 10406
136 Ga0070664_100729740 3300005564 Bacteria 924
137 Ga0068857_100012480 3300005577 Bacteria 7400
138 Ga0068857_100056428 3300005577 Bacteria 3485
139 Ga0068857_100056677 3300005577 Bacteria 3478
140 Ga0068857_100924288 3300005577 Bacteria 837
141 Ga0068854_100154918 3300005578 Bacteria 1770
142 Ga0068856_100031587 3300005614 Bacteria 5182
143 Ga0068856_100104780 3300005614 Bacteria 2823
144 Ga0068856_100349527 3300005614 Bacteria 1497
145 Ga0068856_100654296 3300005614 Bacteria 1071
146 Ga0070702_100000186 3300005615 Bacteria 20127
147 Ga0070702_100102607 3300005615 Bacteria 1757
148 Ga0068852_100061847 3300005616 Bacteria 3254
149 Ga0068852_100066436 3300005616 Bacteria 3149
150 Ga0068852_100871289 3300005616 Bacteria 917
151 Ga0068859_100000220 3300005617 Bacteria 56619
152 Ga0068859_100006805 3300005617 Bacteria 11615
153 Ga0068859_100011239 3300005617 Bacteria 9006
154 Ga0068859_100049603 3300005617 Bacteria 4216
155 Ga0068859_100077159 3300005617 Bacteria 3373
156 Ga0068859_100459611 3300005617 Bacteria 1369
157 Ga0068859_100706688 3300005617 Bacteria 1099
158 Ga0068859_100718589 3300005617 Bacteria 1089
159 Ga0068864_100000569 3300005618 Bacteria 31341
160 Ga0068864_100074541 3300005618 Bacteria 2961
161 Ga0068866_10005217 3300005718 Bacteria 5353
162 Ga0068866_10019334 3300005718 Bacteria 3099
163 Ga0068861_100001278 3300005719 Bacteria 15719
164 Ga0068861_100008511 3300005719 Bacteria 7063
165 Ga0068861_100021265 3300005719 Bacteria 4662
166 Ga0068861_100112345 3300005719 Bacteria 2184
167 Ga0068861_100149688 3300005719 Bacteria 1914
168 Ga0068861_100324468 3300005719 Bacteria 1342
169 Ga0068861_100626615 3300005719 Bacteria 990
170 Ga0068851_10234285 3300005834 Bacteria 1036
171 Ga0068870_10010262 3300005840 Bacteria 4295
172 Ga0068870_10017903 3300005840 Bacteria 3411
173 Ga0068870_10048595 3300005840 Bacteria 2235
174 Ga0068863_100001625 3300005841 Bacteria 22204
175 Ga0068863_100003136 3300005841 Bacteria 16324
176 Ga0068863_100013962 3300005841 Bacteria 7742
177 Ga0068863_100026511 3300005841 Bacteria 5527
178 Ga0068863_100113219 3300005841 Bacteria 2584
179 Ga0068863_100335849 3300005841 Bacteria 1469
180 Ga0068863_100600869 3300005841 Bacteria 1089
181 Ga0068858_100005686 3300005842 Bacteria 12185
182 Ga0068858_100007166 3300005842 Bacteria 10817
183 Ga0068858_100011034 3300005842 Bacteria 8540
184 Ga0068858_100014034 3300005842 Bacteria 7558
185 Ga0068858_100018633 3300005842 Bacteria 6499
186 Ga0068860_100000355 3300005843 Bacteria 61547
187 Ga0068860_100013566 3300005843 Bacteria 7988
188 Ga0068860_100014361 3300005843 Bacteria 7763
189 Ga0068860_100022938 3300005843 Bacteria 6036
190 Ga0068860_100090774 3300005843 Bacteria 2910
191 Ga0068862_100001728 3300005844 Bacteria 19748
192 Ga0068862_100005736 3300005844 Bacteria 10363
193 Ga0068862_100007875 3300005844 Bacteria 8815
194 Ga0068862_100022607 3300005844 Bacteria 5260
195 Ga0068862_100088203 3300005844 Bacteria 2699
196 Ga0068862_100264237 3300005844 Bacteria 1572
197 Ga0068862_100393786 3300005844 Bacteria 1294
198 Ga0068862_100705542 3300005844 Bacteria 978
199 Ga0081455_10005137 3300005937 Bacteria 14426
200 Ga0081539_10000055 3300005985 Bacteria 257359
201 Ga0070715_10018578 3300006163 Bacteria 2652
202 Ga0070712_100011174 3300006175 Bacteria 5684
203 Ga0070712_100279500 3300006175 Bacteria 1344
204 Ga0097621_100026403 3300006237 Bacteria 4555
205 Ga0097621_100065622 3300006237 Bacteria 2988
206 Ga0097621_100128650 3300006237 Bacteria 2153
207 Ga0097621_100263335 3300006237 Bacteria 1513
208 Ga0068871_100012023 3300006358 Bacteria 6370
209 Ga0068871_100043589 3300006358 Bacteria 3604
210 Ga0068871_100057094 3300006358 Bacteria 3175
211 Ga0068871_100103006 3300006358 Bacteria 2393
212 Ga0068871_100105179 3300006358 Bacteria 2368
213 Ga0068871_100129192 3300006358 Bacteria 2141
214 Ga0068871_100622714 3300006358 Bacteria 983
215 Ga0075428_100005915 3300006844 Bacteria 13595
216 Ga0075428_100006185 3300006844 Bacteria 13316
217 Ga0075430_100002285 3300006846 Bacteria 15881
218 Ga0075430_100134949 3300006846 Bacteria 2057
219 Ga0075431_100000121 3300006847 Bacteria 50989
220 Ga0075431_100099414 3300006847 Bacteria 3002
221 Ga0075433_10003048 3300006852 Bacteria 12875
222 Ga0075433_10323744 3300006852 Bacteria 1364
223 Ga0075434_100000232 3300006871 Bacteria 38374
224 Ga0075434_100187109 3300006871 Bacteria 2091
225 Ga0075429_100002068 3300006880 Bacteria 16737
226 Ga0075429_100008661 3300006880 Bacteria 8848
227 Ga0075429_100102089 3300006880 Bacteria 2504
228 Ga0068865_100008995 3300006881 Bacteria 6179
229 Ga0068865_100049973 3300006881 Bacteria 2886
230 Ga0068865_100105300 3300006881 Bacteria 2072
231 Ga0068865_100133524 3300006881 Bacteria 1862
232 Ga0068865_100174371 3300006881 Bacteria 1651
233 Ga0068865_100395314 3300006881 Bacteria 1131
234 Ga0075436_100067546 3300006914 Bacteria 2470
235 Ga0097620_100000220 3300006931 Bacteria 56619
236 Ga0097620_100006805 3300006931 Bacteria 11615
237 Ga0097620_100011236 3300006931 Bacteria 9006
238 Ga0097620_100049603 3300006931 Bacteria 4216
239 Ga0097620_100077162 3300006931 Bacteria 3373
240 Ga0097620_100220559 3300006931 Bacteria 1984
241 Ga0097620_100459535 3300006931 Bacteria 1369
242 Ga0097620_100706695 3300006931 Bacteria 1099
243 Ga0075435_100106215 3300007076 Bacteria 2331
244 Ga0099795_10001301 3300007788 Bacteria 5320
245 Ga0105250_10009909 3300009092 Bacteria 3997
246 Ga0105250_10041763 3300009092 Bacteria 1838
247 Ga0105240_10003170 3300009093 Bacteria 25852
248 Ga0105240_10046522 3300009093 Bacteria 5497
249 Ga0105240_10056162 3300009093 Bacteria 4927
250 Ga0105240_10082894 3300009093 Bacteria 3937
251 Ga0105240_10084190 3300009093 Bacteria 3900
252 Ga0105240_10108645 3300009093 Bacteria 3360
253 Ga0105240_10235603 3300009093 Bacteria 2124
254 Ga0105240_10277964 3300009093 Bacteria 1925
255 Ga0105240_10316137 3300009093 Bacteria 1781
256 Ga0105240_10355899 3300009093 Bacteria 1660
257 Ga0105240_10433327 3300009093 Bacteria 1475
258 Ga0105240_10464784 3300009093 Bacteria 1413
259 Ga0111539_10000695 3300009094 Bacteria 43547
260 Ga0111539_10008124 3300009094 Bacteria 13368
261 Ga0111539_10021812 3300009094 Bacteria 7875
262 Ga0111539_10043719 3300009094 Bacteria 5369
263 Ga0111539_10105971 3300009094 Bacteria 3298
264 Ga0111539_10213707 3300009094 Bacteria 2247
265 Ga0111539_10590688 3300009094 Bacteria 1293
266 Ga0105245_10011359 3300009098 Bacteria 7756
267 Ga0105245_10027227 3300009098 Bacteria 5037
268 Ga0105247_10002339 3300009101 Bacteria 12937
269 Ga0105247_10008194 3300009101 Bacteria 6380
270 Ga0105247_10016138 3300009101 Bacteria 4474
271 Ga0105247_10027899 3300009101 Bacteria 3414
272 Ga0105247_10364793 3300009101 Bacteria 1020
273 Ga0114129_10000366 3300009147 Bacteria 52352
274 Ga0114129_10006307 3300009147 Bacteria 16819
275 Ga0105243_10055051 3300009148 Bacteria 3160
276 Ga0105241_10016405 3300009174 Bacteria 5432
277 Ga0105241_10047825 3300009174 Bacteria 3254
278 Ga0105241_10226791 3300009174 Bacteria 1573
279 Ga0105242_10000669 3300009176 Bacteria 26851
280 Ga0105242_10029647 3300009176 Bacteria 4363
281 Ga0105242_10055164 3300009176 Bacteria 3251
282 Ga0105248_10012530 3300009177 Bacteria 9352
283 Ga0105248_10099252 3300009177 Bacteria 3281
284 Ga0105248_10196693 3300009177 Bacteria 2272
285 Ga0105248_10215943 3300009177 Bacteria 2160
286 Ga0105248_10229085 3300009177 Bacteria 2092
287 Ga0105248_10486949 3300009177 Bacteria 1390
288 Ga0105237_10004492 3300009545 Bacteria 16123
289 Ga0105237_10075434 3300009545 Bacteria 3364
290 Ga0105237_10102406 3300009545 Bacteria 2855
291 Ga0105237_10135423 3300009545 Bacteria 2458
292 Ga0105237_10374358 3300009545 Bacteria 1429
293 Ga0105237_10438750 3300009545 Bacteria 1311
294 Ga0105237_10473878 3300009545 Bacteria 1258
295 Ga0105238_10010242 3300009551 Bacteria 9404
296 Ga0105238_10018185 3300009551 Bacteria 7147
297 Ga0105238_10117936 3300009551 Bacteria 2634
298 Ga0105238_10351667 3300009551 Bacteria 1462
299 Ga0105238_10858080 3300009551 Bacteria 925
300 Ga0105249_10012724 3300009553 Bacteria 7416
301 Ga0105249_10012849 3300009553 Bacteria 7389
302 Ga0105249_10015074 3300009553 Bacteria 6839
303 Ga0105249_10219512 3300009553 Bacteria 1870
304 Ga0099796_10009844 3300010159 Bacteria 2604
305 Ga0099796_10043866 3300010159 Bacteria 1525
306 Ga0105239_10008633 3300010375 Bacteria 11550
307 Ga0105239_10013474 3300010375 Bacteria 9081
308 Ga0105246_10128221 3300011119 Bacteria 1891
309 Ga0105246_10300188 3300011119 Bacteria 1296
310 Ga0105246_10624837 3300011119 Bacteria 934
311 Ga0157370_10005200 3300013104 Bacteria 14659
312 Ga0157370_10119899 3300013104 Bacteria 2456
313 Ga0157369_10002574 3300013105 Bacteria 21703
314 Ga0157369_10036222 3300013105 Bacteria 5407
315 Ga0157369_10878277 3300013105 Bacteria 920
316 Ga0157374_10023611 3300013296 Bacteria 5503
317 Ga0157374_10043408 3300013296 Bacteria 4154
318 Ga0157374_10159841 3300013296 Bacteria 2194
319 Ga0157378_10009323 3300013297 Bacteria 8547
320 Ga0157378_10142981 3300013297 Bacteria 2223
321 Ga0157378_10208980 3300013297 Bacteria 1850
322 Ga0163162_10078807 3300013306 Bacteria 3360
323 Ga0163162_10114585 3300013306 Bacteria 2795
324 Ga0163162_10142186 3300013306 Bacteria 2514
325 Ga0163162_10143304 3300013306 Bacteria 2504
326 Ga0163162_10171019 3300013306 Bacteria 2297
327 Ga0157372_10102320 3300013307 Bacteria 3272
328 Ga0157375_10051051 3300013308 Bacteria 4059
329 Ga0157375_10063389 3300013308 Bacteria 3677
330 Ga0157375_10063559 3300013308 Bacteria 3673
331 Ga0157375_10100055 3300013308 Bacteria 2979
332 Ga0163163_10003280 3300014325 Bacteria 13721
333 Ga0163163_10012103 3300014325 Bacteria 7851
334 Ga0163163_10013204 3300014325 Bacteria 7550
335 Ga0163163_10143759 3300014325 Bacteria 2428
336 Ga0163163_10188507 3300014325 Bacteria 2111
337 Ga0163163_10326054 3300014325 Bacteria 1590
338 Ga0157380_10002098 3300014326 Bacteria 13365
339 Ga0157380_10007215 3300014326 Bacteria 7877
340 Ga0157380_10134578 3300014326 Bacteria 2114
341 Ga0157380_10177910 3300014326 Bacteria 1866
342 Ga0157380_10211066 3300014326 Bacteria 1730
343 Ga0157380_10220861 3300014326 Bacteria 1695
344 Ga0157380_10947564 3300014326 Bacteria 890
345 Ga0157377_10003532 3300014745 Bacteria 7078
346 Ga0157377_10318961 3300014745 Bacteria 1032
347 Ga0157379_10000614 3300014968 Bacteria 28820
348 Ga0157379_10001978 3300014968 Bacteria 16948
349 Ga0157379_10010150 3300014968 Bacteria 8210
350 Ga0157379_10024288 3300014968 Bacteria 5382
351 Ga0157379_10164288 3300014968 Bacteria 2004
352 Ga0157379_10177226 3300014968 Bacteria 1925
353 Ga0157379_10202042 3300014968 Bacteria 1797
354 Ga0157376_10047633 3300014969 Bacteria 3540
355 Ga0157376_10086759 3300014969 Bacteria 2699
356 Ga0157376_10155559 3300014969 Bacteria 2067
357 Ga0157376_10196424 3300014969 Bacteria 1854
358 Ga0157376_10426199 3300014969 Bacteria 1288
359 Ga0157376_10520408 3300014969 Bacteria 1172
360 Ga0163161_10045444 3300017792 Bacteria 3167
361 Ga0163161_10519239 3300017792 Bacteria 972
362 Ga0213874_10011572 3300021377 Bacteria 2239
363 Ga0213871_10010517 3300021441 Bacteria 2100
364 Ga0228598_1004895 3300024227 Bacteria 2819
365 Ga0207682_10002678 3300025893 Bacteria 7935
366 Ga0207682_10004866 3300025893 Bacteria 5543
367 Ga0207682_10051169 3300025893 Bacteria 1710
368 Ga0207682_10119262 3300025893 Bacteria 1169
369 Ga0207692_10050767 3300025898 Bacteria 2099
370 Ga0207642_10048092 3300025899 Bacteria 1910
371 Ga0207642_10289511 3300025899 Bacteria 945
372 Ga0207710_10001544 3300025900 Bacteria 11332
373 Ga0207710_10079856 3300025900 Bacteria 1516
374 Ga0207710_10177938 3300025900 Bacteria 1042
375 Ga0207688_10039365 3300025901 Bacteria 2625
376 Ga0207680_10003867 3300025903 Bacteria 7056
377 Ga0207680_10032325 3300025903 Bacteria 2974
378 Ga0207680_10103673 3300025903 Bacteria 1832
379 Ga0207685_10001569 3300025905 Bacteria 4868
380 Ga0207645_10006379 3300025907 Bacteria 8474
381 Ga0207645_10037104 3300025907 Bacteria 3129
382 Ga0207645_10080968 3300025907 Bacteria 2082
383 Ga0207643_10025559 3300025908 Bacteria 3264
384 Ga0207643_10027179 3300025908 Bacteria 3171
385 Ga0207643_10030346 3300025908 Bacteria 3008
386 Ga0207643_10051590 3300025908 Bacteria 2335
387 Ga0207654_10032147 3300025911 Bacteria 2896
388 Ga0207707_10002757 3300025912 Bacteria 15666
389 Ga0207707_10004284 3300025912 Bacteria 12626
390 Ga0207707_10012435 3300025912 Bacteria 7400
391 Ga0207707_10039399 3300025912 Bacteria 4130
392 Ga0207707_10051030 3300025912 Bacteria 3602
393 Ga0207707_10280448 3300025912 Bacteria 1443
394 Ga0207707_10337567 3300025912 Bacteria 1300
395 Ga0207695_10004668 3300025913 Bacteria 18566
396 Ga0207695_10026166 3300025913 Bacteria 6513
397 Ga0207695_10067889 3300025913 Bacteria 3655
398 Ga0207695_10078068 3300025913 Bacteria 3360
399 Ga0207695_10393396 3300025913 Bacteria 1271
400 Ga0207671_10006805 3300025914 Bacteria 10098
401 Ga0207671_10047416 3300025914 Bacteria 3180
402 Ga0207693_10000074 3300025915 Bacteria 88611
403 Ga0207693_10089004 3300025915 Bacteria 2419
404 Ga0207693_10272655 3300025915 Bacteria 1326
405 Ga0207663_10122069 3300025916 Bacteria 1786
406 Ga0207660_10007266 3300025917 Bacteria 7167
407 Ga0207660_10011059 3300025917 Bacteria 5869
408 Ga0207660_10011615 3300025917 Bacteria 5741
409 Ga0207660_10026586 3300025917 Bacteria 3942
410 Ga0207660_10149945 3300025917 Bacteria 1791
411 Ga0207660_10382007 3300025917 Bacteria 1132
412 Ga0207652_10014707 3300025921 Bacteria 6342
413 Ga0207652_10026377 3300025921 Bacteria 4838
414 Ga0207652_10149928 3300025921 Bacteria 2088
415 Ga0207652_10179202 3300025921 Bacteria 1904
416 Ga0207652_10190156 3300025921 Bacteria 1846
417 Ga0207652_10201791 3300025921 Bacteria 1790
418 Ga0207681_10089643 3300025923 Bacteria 2193
419 Ga0207681_10089702 3300025923 Bacteria 2192
420 Ga0207681_10115754 3300025923 Bacteria 1958
421 Ga0207694_10033760 3300025924 Bacteria 3920
422 Ga0207694_10462005 3300025924 Bacteria 1060
423 Ga0207650_10009452 3300025925 Bacteria 6663
424 Ga0207650_10078685 3300025925 Bacteria 2495
425 Ga0207650_10559602 3300025925 Bacteria 959
426 Ga0207659_10001788 3300025926 Bacteria 12706
427 Ga0207659_10029326 3300025926 Bacteria 3749
428 Ga0207659_10030149 3300025926 Bacteria 3703
429 Ga0207659_10276815 3300025926 Bacteria 1371
430 Ga0207687_10059344 3300025927 Bacteria 2695
431 Ga0207700_10020950 3300025928 Bacteria 4453
432 Ga0207700_10020981 3300025928 Bacteria 4450
433 Ga0207700_10080399 3300025928 Bacteria 2541
434 Ga0207664_10016012 3300025929 Bacteria 5461
435 Ga0207644_10010652 3300025931 Bacteria 6061
436 Ga0207644_10297609 3300025931 Bacteria 1299
437 Ga0207644_10582584 3300025931 Bacteria 928
438 Ga0207690_10015790 3300025932 Bacteria 4583
439 Ga0207706_10002530 3300025933 Bacteria 17824
440 Ga0207706_10234432 3300025933 Bacteria 1605
441 Ga0207706_10269980 3300025933 Bacteria 1484
442 Ga0207686_10019724 3300025934 Bacteria 3841
443 Ga0207670_10007052 3300025936 Bacteria 6256
444 Ga0207670_10013656 3300025936 Bacteria 4796
445 Ga0207670_10196288 3300025936 Bacteria 1530
446 Ga0207669_10056469 3300025937 Bacteria 2384
447 Ga0207669_10363665 3300025937 Bacteria 1122
448 Ga0207704_10057262 3300025938 Bacteria 2393
449 Ga0207704_10082404 3300025938 Bacteria 2084
450 Ga0207704_10195778 3300025938 Bacteria 1474
451 Ga0207704_10391816 3300025938 Bacteria 1093
452 Ga0207665_10079043 3300025939 Bacteria 2260
453 Ga0207691_10006516 3300025940 Bacteria 11267
454 Ga0207691_10020864 3300025940 Bacteria 6191
455 Ga0207691_10032746 3300025940 Bacteria 4845
456 Ga0207691_10035704 3300025940 Bacteria 4611
457 Ga0207691_10049421 3300025940 Bacteria 3853
458 Ga0207711_10001501 3300025941 Bacteria 21749
459 Ga0207711_10093866 3300025941 Bacteria 2643
460 Ga0207711_10152652 3300025941 Bacteria 2085
461 Ga0207711_10174290 3300025941 Bacteria 1953
462 Ga0207711_10365702 3300025941 Bacteria 1337
463 Ga0207689_10011724 3300025942 Bacteria 7513
464 Ga0207689_10031231 3300025942 Bacteria 4436
465 Ga0207689_10038860 3300025942 Bacteria 3940
466 Ga0207689_10055034 3300025942 Bacteria 3275
467 Ga0207689_10123272 3300025942 Bacteria 2131
468 Ga0207689_10207475 3300025942 Bacteria 1618
469 Ga0207689_10222317 3300025942 Bacteria 1560
470 Ga0207689_10315618 3300025942 Bacteria 1297
471 Ga0207661_10052742 3300025944 Bacteria 3251
472 Ga0207679_10012127 3300025945 Bacteria 5610
473 Ga0207679_10532410 3300025945 Bacteria 1052
474 Ga0207667_10041830 3300025949 Bacteria 4872
475 Ga0207667_10044202 3300025949 Bacteria 4722
476 Ga0207667_10507253 3300025949 Bacteria 1223
477 Ga0207651_10003822 3300025960 Bacteria 7464
478 Ga0207651_10205030 3300025960 Bacteria 1583
479 Ga0207712_10311876 3300025961 Bacteria 1295
480 Ga0207668_10431600 3300025972 Bacteria 1120
481 Ga0207640_10128977 3300025981 Bacteria 1825
482 Ga0207640_10463668 3300025981 Bacteria 1047
483 Ga0207658_10000046 3300025986 Bacteria 130772
484 Ga0207658_10009061 3300025986 Bacteria 6750
485 Ga0207658_10070732 3300025986 Bacteria 2641
486 Ga0207658_10077140 3300025986 Bacteria 2541
487 Ga0207677_10020310 3300026023 Bacteria 4031
488 Ga0207677_10027953 3300026023 Bacteria 3561
489 Ga0207677_10223506 3300026023 Bacteria 1512
490 Ga0207703_10003271 3300026035 Bacteria 13598
491 Ga0207703_10006155 3300026035 Bacteria 9604
492 Ga0207703_10013429 3300026035 Bacteria 6380
493 Ga0207703_10056126 3300026035 Bacteria 3206
494 Ga0207703_10390127 3300026035 Bacteria 1290
495 Ga0207678_10103107 3300026067 Bacteria 2435
496 Ga0207708_10073963 3300026075 Bacteria 2612
497 Ga0207708_10074498 3300026075 Bacteria 2602
498 Ga0207708_10091053 3300026075 Bacteria 2351
499 Ga0207708_10196791 3300026075 Bacteria 1606
500 Ga0207708_10251868 3300026075 Bacteria 1423
501 Ga0207702_10365921 3300026078 Bacteria 1383
502 Ga0207641_10001484 3300026088 Bacteria 23002
503 Ga0207641_10004671 3300026088 Bacteria 11815
504 Ga0207641_10030438 3300026088 Bacteria 4471
505 Ga0207641_10145512 3300026088 Bacteria 2142
506 Ga0207641_10867051 3300026088 Bacteria 895
507 Ga0207648_10000935 3300026089 Bacteria 32936
508 Ga0207648_10063248 3300026089 Bacteria 3226
509 Ga0207648_10192047 3300026089 Bacteria 1810
510 Ga0207676_10005840 3300026095 Bacteria 8697
511 Ga0207676_10055024 3300026095 Bacteria 3121
512 Ga0207676_10056652 3300026095 Bacteria 3083
513 Ga0207676_10634145 3300026095 Bacteria 1030
514 Ga0207674_10006902 3300026116 Bacteria 13309
515 Ga0207674_10034124 3300026116 Bacteria 5322
516 Ga0207674_10541492 3300026116 Bacteria 1125
517 Ga0207674_10806391 3300026116 Bacteria 906
518 Ga0207675_100003493 3300026118 Bacteria 15341
519 Ga0207675_100003505 3300026118 Bacteria 15313
520 Ga0207675_100006146 3300026118 Bacteria 11412
521 Ga0207675_100013127 3300026118 Bacteria 7731
522 Ga0207675_100022988 3300026118 Bacteria 5799
523 Ga0207675_100131684 3300026118 Bacteria 2372
524 Ga0207675_100565425 3300026118 Bacteria 1137
525 Ga0207683_10011548 3300026121 Bacteria 7541
526 Ga0207683_10024101 3300026121 Bacteria 5237
527 Ga0207683_10044662 3300026121 Bacteria 3874
528 Ga0207683_10069217 3300026121 Bacteria 3117
529 Ga0207698_10385946 3300026142 Bacteria 1334
530 Ga0207698_10542157 3300026142 Bacteria 1139
531 Ga0207428_10006432 3300027907 Bacteria 10849
532 Ga0207428_10020710 3300027907 Bacteria 5580
533 Ga0207428_10033094 3300027907 Bacteria 4248
534 Ga0207428_10076951 3300027907 Bacteria 2612
535 Ga0207428_10146709 3300027907 Bacteria 1798
536 Ga0268266_10004092 3300028379 Bacteria 14082
537 Ga0268266_10017688 3300028379 Bacteria 6077
538 Ga0268266_10039925 3300028379 Bacteria 3998
539 Ga0268266_10079927 3300028379 Bacteria 2848
540 Ga0268266_10147562 3300028379 Bacteria 2116
541 Ga0268266_10298350 3300028379 Bacteria 1502
542 Ga0268266_10605341 3300028379 Bacteria 1053
543 Ga0268265_10006378 3300028380 Bacteria 7995
544 Ga0268265_10007283 3300028380 Bacteria 7473
545 Ga0268265_10013615 3300028380 Bacteria 5531
546 Ga0268265_10033879 3300028380 Bacteria 3717
547 Ga0268265_10054548 3300028380 Bacteria 3034
548 Ga0268265_10063625 3300028380 Bacteria 2839
549 Ga0268265_10066738 3300028380 Bacteria 2782
550 Ga0268264_10000085 3300028381 Bacteria 240739
551 Ga0268264_10011987 3300028381 Bacteria 7139
552 Ga0268264_10014381 3300028381 Bacteria 6505
553 Ga0268264_10014471 3300028381 Bacteria 6485
554 Ga0268264_10063782 3300028381 Bacteria 3099
555 Ga0268264_10123708 3300028381 Bacteria 2283
556 Ga0268264_10203400 3300028381 Bacteria 1813
557 Ga0265319_1047734 3300028563 Bacteria 1423
558 Ga0265334_10001271 3300028573 Bacteria 12245
559 Ga0265318_10001358 3300028577 Bacteria 14561
560 Ga0265318_10098901 3300028577 Bacteria 1074
561 Ga0265338_10007770 3300028800 Bacteria 13193
562 Ga0265338_10010887 3300028800 Bacteria 10585
563 Ga0265338_10027853 3300028800 Bacteria 5655
564 Ga0307511_10001897 3300030521 Bacteria 21953
565 Ga0307511_10118006 3300030521 Bacteria 1654
566 Ga0265770_1000030 3300030878 Bacteria 14134
567 Ga0265770_1032851 3300030878 Bacteria 877
568 Ga0265760_10004641 3300031090 Bacteria 3934
569 Ga0265330_10052615 3300031235 Bacteria 1783
570 Ga0265332_10001772 3300031238 Bacteria 11647
571 Ga0265320_10017891 3300031240 Bacteria 3918
572 Ga0265325_10001428 3300031241 Bacteria 16803
573 Ga0265329_10001256 3300031242 Bacteria 12399
574 Ga0265340_10010370 3300031247 Bacteria 4985
575 Ga0265340_10094566 3300031247 Bacteria 1394
576 Ga0265339_10009587 3300031249 Bacteria 6069
577 Ga0265331_10019248 3300031250 Bacteria 3527
578 Ga0265331_10048701 3300031250 Bacteria 2036
579 Ga0265331_10061162 3300031250 Bacteria 1778
580 Ga0265327_10023520 3300031251 Bacteria 3648
581 Ga0265316_10017357 3300031344 Bacteria 6226
582 Ga0265316_10028963 3300031344 Bacteria 4560
583 Ga0307513_10025018 3300031456 Bacteria 6929
584 Ga0307513_10026003 3300031456 Bacteria 6760
585 Ga0307513_10174506 3300031456 Bacteria 2022
586 Ga0307509_10000008 3300031507 Bacteria 354271
587 Ga0307509_10117099 3300031507 Bacteria 2652
588 Ga0307509_10308512 3300031507 Bacteria 1326
589 Ga0307408_100079655 3300031548 Bacteria 2445
590 Ga0307408_100081595 3300031548 Bacteria 2418
591 Ga0307408_100146368 3300031548 Bacteria 1860
592 Ga0307408_100205798 3300031548 Bacteria 1596
593 Ga0307408_100217869 3300031548 Bacteria 1556
594 Ga0265313_10002857 3300031595 Bacteria 14491
595 Ga0316575_10000129 3300031665 Bacteria 18869
596 Ga0316575_10002479 3300031665 Bacteria 6209
597 Ga0316575_10013355 3300031665 Bacteria 3067
598 Ga0316575_10038185 3300031665 Bacteria 1894
599 Ga0316575_10158891 3300031665 Bacteria 934
600 Ga0316579_10000530 3300031691 Bacteria 12539
601 Ga0265314_10009630 3300031711 Bacteria 8137
602 Ga0265314_10157873 3300031711 Bacteria 1383
603 Ga0265342_10007273 3300031712 Bacteria 8129
604 Ga0316576_10002294 3300031727 Bacteria 10847
605 Ga0316576_10053203 3300031727 Bacteria 2949
606 Ga0316576_10086505 3300031727 Bacteria 2331
607 Ga0316578_10001988 3300031728 Bacteria 8683
608 Ga0316578_10010000 3300031728 Bacteria 4906
609 Ga0316578_10034205 3300031728 Bacteria 2917
610 Ga0307405_10053416 3300031731 Bacteria 2517
611 Ga0307405_10237242 3300031731 Bacteria 1348
612 Ga0316577_10000014 3300031733 Bacteria 37742
613 Ga0316577_10152111 3300031733 Bacteria 1304
614 Ga0307413_10001102 3300031824 Bacteria 9867
615 Ga0307413_10009664 3300031824 Bacteria 4629
616 Ga0307410_10033962 3300031852 Bacteria 3298
617 Ga0307410_10103647 3300031852 Bacteria 2044
618 Ga0307410_10398247 3300031852 Bacteria 1112
619 Ga0307406_10098219 3300031901 Bacteria 1988
620 Ga0307407_10007516 3300031903 Bacteria 4940
621 Ga0307407_10064159 3300031903 Bacteria 2157
622 Ga0307407_10190079 3300031903 Bacteria 1368
623 Ga0307412_10064544 3300031911 Bacteria 2474
624 Ga0307409_100032841 3300031995 Bacteria 3769
625 Ga0307409_100051165 3300031995 Bacteria 3160
626 Ga0307409_100098746 3300031995 Bacteria 2416
627 Ga0307409_100100252 3300031995 Bacteria 2400
628 Ga0307409_100806303 3300031995 Bacteria 947
629 Ga0307416_100120523 3300032002 Bacteria 2336
630 Ga0307416_100286755 3300032002 Bacteria 1627
631 Ga0307416_100425348 3300032002 Bacteria 1374
632 Ga0307416_101110218 3300032002 Bacteria 895
633 Ga0307414_10162892 3300032004 Bacteria 1774
634 Ga0307411_10000178 3300032005 Bacteria 20399
635 Ga0307411_10003205 3300032005 Bacteria 7536
636 Ga0307411_10107148 3300032005 Bacteria 1991
637 Ga0307411_10131772 3300032005 Bacteria 1828
638 Ga0307411_10154891 3300032005 Bacteria 1708
639 Ga0307411_10204014 3300032005 Bacteria 1521
640 Ga0307411_10306709 3300032005 Bacteria 1276
641 Ga0307415_100012994 3300032126 Bacteria 4841
642 Ga0307415_100093127 3300032126 Bacteria 2187
643 Ga0307415_100394660 3300032126 Bacteria 1179
644 Ga0316580_10000397 3300032139 Bacteria 9796
645 Ga0316580_10001817 3300032139 Bacteria 5721
646 Ga0316593_10007758 3300032168 Bacteria 2960
647 Ga0316593_10052677 3300032168 Bacteria 1378
648 Ga0316593_10056053 3300032168 Bacteria 1340
649 Ga0316596_1009091 3300033541 Bacteria 2381
650 Ga0373944_0057092 3300035089 Bacteria 1244
651 Ga0373923_0014921 3300035111 Bacteria 2926
652 Ga0373923_0079343 3300035111 Bacteria 1422
653 Ga0373936_0044077 3300035113 Bacteria 1794
654 Ga0373936_0046776 3300035113 Bacteria 1744
655 Ga0373936_0109603 3300035113 Bacteria 1171
656 Ga0373936_0113824 3300035113 Bacteria 1150
657 Ga0373954_0142474 3300035118 Bacteria 1169
658 Ga0373955_0038198 3300035172 Bacteria 2557
659 Ga0316574_0010869 3300035398 Bacteria 5158
660 Ga0316574_0018258 3300035398 Bacteria 4119
661 Ga0316574_0020327 3300035398 Bacteria 3929
662 Ga0316574_0031954 3300035398 Bacteria 3196
663 Ga0316574_0103484 3300035398 Bacteria 1823
664 Ga0316574_0233284 3300035398 Bacteria 1177
665 Ga0373924_0140036 3300035410 Bacteria 1055
666 Ga0373935_0206521 3300035692 Bacteria 1360
667 Ga0373935_0245210 3300035692 Bacteria 1252
668 Ga0373927_0012200 3300035695 Bacteria 5716
669 Ga0373937_0056366 3300036401 Bacteria 3609
670 Ga0373937_0169112 3300036401 Bacteria 2051
671 Ga0316582_0000288 3300036647 Bacteria 17252
672 Ga0316584_0005014 3300036712 Bacteria 8826
673 Ga0316584_0007546 3300036712 Bacteria 7451
674 Ga0316584_0011584 3300036712 Bacteria 6200
675 Ga0316584_0062510 3300036712 Bacteria 2788
676 Ga0316584_0065155 3300036712 Bacteria 2729
677 Ga0316584_0210279 3300036712 Bacteria 1432
678 Ga0373925_0192347 3300037068 Bacteria 1619
679 Ga0395898_0006245 3300037466 Bacteria 12760
680 Ga0395898_0042232 3300037466 Bacteria 4500
681 Ga0400490_07444 3300038726 Bacteria 36081
682 Ga0400490_30083 3300038726 Bacteria 21748
683 Ga0400488_01697 3300038741 Bacteria 1056
684 Ga0400488_59976 3300038741 Bacteria 11525
685 Ga0400483_002831 3300039062 Bacteria 10002
686 Ga0400483_022796 3300039062 Bacteria 1027
687 Ga0400483_163859 3300039062 Bacteria 4367
688 Ga0400483_190589 3300039062 Bacteria 4681
689 Ga0400483_222691 3300039062 Bacteria 32176
690 Ga0400483_284874 3300039062 Bacteria 8206
691 Ga0400489_20593 3300039093 Bacteria 1628
692 Ga0400489_88422 3300039093 Bacteria 1311
693 Ga0400487_42418 3300039110 Bacteria 22363
694 Ga0400487_64772 3300039110 Bacteria 8031
695 Ga0436365_0033536 3300039437 Bacteria 4101
696 Ga0436365_1504415 3300039437 Bacteria 3904
697 Ga0436360_1079411 3300039438 Bacteria 12206
698 Ga0436361_1075840 3300039447 Bacteria 1717
699 Ga0436363_0167267 3300039450 Bacteria 7589
700 Ga0436363_1431824 3300039450 Bacteria 9674
701 Ga0436362_0261338 3300039453 Bacteria 1469
702 Ga0451795_1205146 3300041456 Bacteria 1860
703 Ga0451802_0026244 3300041460 Bacteria 4931
704 Ga0451802_0139520 3300041460 Bacteria 2507
705 Ga0451807_0214414 3300041486 Bacteria 2626
706 Ga0451807_0614660 3300041486 Bacteria 3790
707 Ga0451807_1381746 3300041486 Bacteria 1118
708 Ga0451837_0547725 3300041494 Bacteria 3332
709 Ga0451853_2107667 3300041512 Bacteria 2445
710 Ga0439435_0041727 3300042436 Bacteria 1286
711 Ga0439460_0003422 3300042461 Bacteria 3833
712 Ga0450916_023519 3300042530 Bacteria 860
713 Ga0451577_0007840 3300042876 Bacteria 10443
714 Ga0451577_0016049 3300042876 Bacteria 6947
715 Ga0451577_0037831 3300042876 Bacteria 4342
716 Ga0451577_0126020 3300042876 Bacteria 2295
717 Ga0453683_0009257 3300044673 Bacteria 6580
718 Ga0453684_0066162 3300044712 Bacteria 4603
719 Ga0453684_0640754 3300044712 Bacteria 1160
720 Ga0466959_0084672 3300045049 Bacteria 2282
721 Ga0466959_0090345 3300045049 Bacteria 2200
722 Ga0451576_0051462 3300045051 Bacteria 4318
723 Ga0451576_0059422 3300045051 Bacteria 3990
724 Ga0451576_0120985 3300045051 Bacteria 2725
725 Ga0495638_0007170 3300046460 Bacteria 8025
726 Ga0495638_0014122 3300046460 Bacteria 5407
727 Ga0495638_0028700 3300046460 Bacteria 3590
728 Ga0495638_0049342 3300046460 Bacteria 2632
729 Ga0495650_0068658 3300046471 Bacteria 1397
730 Ga0495580_0060379 3300046472 Bacteria 2664
731 Ga0495580_0129006 3300046472 Bacteria 1754
732 Ga0495585_0056112 3300046492 Bacteria 2176
733 Ga0495583_0015410 3300046506 Bacteria 4160
734 Ga0495606_0037893 3300046507 Bacteria 3269
735 Ga0495606_0124906 3300046507 Bacteria 1536
736 Ga0495606_0173131 3300046507 Bacteria 1250
737 Ga0495616_0003562 3300046513 Bacteria 9948
738 Ga0495620_0037598 3300046515 Bacteria 2155
739 Ga0495632_0045293 3300046519 Bacteria 2192
740 Ga0495632_0139915 3300046519 Bacteria 1123
741 Ga0495632_0143706 3300046519 Bacteria 1106
742 Ga0495586_0060407 3300046535 Bacteria 2061
743 Ga0495621_0033003 3300046539 Bacteria 1783
744 Ga0495645_0044018 3300046543 Bacteria 3256
745 Ga0495622_0188498 3300046557 Bacteria 923
746 Ga0495668_0039100 3300046616 Bacteria 2649
747 Ga0495611_0157629 3300046648 Bacteria 1060
748 Ga0495625_0008480 3300046660 Bacteria 8770
749 Ga0495625_0170265 3300046660 Bacteria 1455
750 Ga0495625_0195111 3300046660 Bacteria 1339
751 Ga0495623_0119439 3300046679 Bacteria 1588
752 Ga0495658_0121921 3300046683 Bacteria 1577
753 Ga0495671_0032043 3300046692 Bacteria 2685
754 Ga0495649_0007172 3300046694 Bacteria 6844
755 Ga0495649_0071403 3300046694 Bacteria 1861
756 Ga0495589_0112642 3300046794 Bacteria 1313
757 Ga0495604_0074559 3300047317 Bacteria 2557
758 Ga0495675_0318708 3300047444 Bacteria 920
759 Ga0495602_0018947 3300048088 Bacteria 6850
760 Ga0496100_0100436 3300048903 Bacteria 1993
761 Ga0496102_0002132 3300048905 Bacteria 17010
762 Ga0496102_0007331 3300048905 Bacteria 9418
763 Ga0496102_0019281 3300048905 Bacteria 6008
764 Ga0496102_0192228 3300048905 Bacteria 1923
765 Ga0496102_0351084 3300048905 Bacteria 1389
766 Ga0496103_0022093 3300048906 Bacteria 3830
767 Ga0496103_0028633 3300048906 Bacteria 3382
768 Ga0496104_0001674 3300048907 Bacteria 19138
769 Ga0496104_0033718 3300048907 Bacteria 4771
770 Ga0496104_0408134 3300048907 Bacteria 1271
771 Ga0496104_0420654 3300048907 Bacteria 1248
772 Ga0496104_0743459 3300048907 Bacteria 888
773 Ga0496105_0001265 3300048908 Bacteria 17664
774 Ga0496105_0022232 3300048908 Bacteria 5136
775 Ga0496105_0039326 3300048908 Bacteria 3898
776 Ga0496106_0238634 3300048909 Bacteria 1452
777 Ga0496106_0242529 3300048909 Bacteria 1440
778 Ga0496106_0356169 3300048909 Bacteria 1176
779 Ga0496108_0003024 3300048911 Bacteria 13523
780 Ga0496109_0133376 3300048912 Bacteria 2319
781 Ga0496109_0554249 3300048912 Bacteria 1084
782 Ga0496110_0011165 3300048913 Bacteria 7341
783 Ga0496110_0124971 3300048913 Bacteria 2320
784 Ga0496112_0018514 3300048915 Bacteria 6558
785 Ga0496112_0237277 3300048915 Bacteria 1777
786 Ga0496112_0400428 3300048915 Bacteria 1312
787 Ga0496113_0081375 3300048916 Bacteria 2482
788 Ga0496114_0009790 3300048917 Bacteria 7615
789 Ga0496115_0020318 3300048918 Bacteria 5122
790 Ga0496115_0070140 3300048918 Bacteria 2840
791 Ga0496115_0188594 3300048918 Bacteria 1704
792 Ga0496116_0030355 3300048919 Bacteria 3885
793 Ga0496117_0000251 3300048920 Bacteria 101431
794 Ga0496117_0058137 3300048920 Bacteria 2680
795 Ga0496118_0000026 3300048921 Bacteria 375725
796 Ga0496118_0043701 3300048921 Bacteria 3518
797 Ga0496118_0119690 3300048921 Bacteria 1721
798 Ga0496119_0000965 3300048922 Bacteria 36888
799 Ga0496119_0165542 3300048922 Bacteria 1171
800 Ga0496120_0000025 3300048923 Bacteria 235805
801 Ga0496120_0033037 3300048923 Bacteria 3112
802 Ga0496121_0002537 3300048924 Bacteria 27677
803 Ga0496121_0208310 3300048924 Bacteria 1387
804 Ga0496124_0173387 3300048927 Bacteria 1667
805 Ga0496124_0219032 3300048927 Bacteria 1433
806 Ga0496125_0002047 3300048928 Bacteria 27258
807 Ga0496125_0007828 3300048928 Bacteria 11295
808 Ga0496125_0049803 3300048928 Bacteria 3476
809 Ga0496126_0001746 3300048929 Bacteria 32210
810 Ga0496126_0227116 3300048929 Bacteria 1565
811 Ga0496126_0320581 3300048929 Bacteria 1274
812 Ga0501031_0016819 3300049568 Bacteria 4749
813 Ga0501031_0065908 3300049568 Bacteria 2359
814 Ga0501032_0009038 3300049569 Bacteria 7240
815 Ga0501032_0017498 3300049569 Bacteria 5033
816 Ga0501032_0058180 3300049569 Bacteria 2595
817 Ga0501032_0077625 3300049569 Bacteria 2211
818 Ga0501032_0137838 3300049569 Bacteria 1608
819 Ga0501033_0001962 3300049570 Bacteria 17908
820 Ga0501033_0002169 3300049570 Bacteria 16958
821 Ga0501034_0040621 3300049571 Bacteria 4708
822 Ga0501036_0003359 3300049572 Bacteria 12785
823 Ga0501036_0027084 3300049572 Bacteria 4843
824 Ga0501036_0064478 3300049572 Bacteria 3101
825 Ga0501036_0150021 3300049572 Bacteria 1966
826 Ga0501036_0507558 3300049572 Bacteria 1003
827 Ga0501037_0005208 3300049573 Bacteria 9456
828 Ga0501037_0023752 3300049573 Bacteria 4532
829 Ga0501037_0072023 3300049573 Bacteria 2514
830 Ga0501038_0002190 3300049574 Bacteria 18169
831 Ga0501038_0004629 3300049574 Bacteria 12802
832 Ga0501038_0010561 3300049574 Bacteria 8443
833 Ga0501038_0030814 3300049574 Bacteria 4741
834 Ga0501038_0151767 3300049574 Bacteria 1888
835 Ga0501039_0003734 3300049575 Bacteria 11439
836 Ga0501039_0205764 3300049575 Bacteria 1547
837 Ga0501039_0235206 3300049575 Bacteria 1440
838 Ga0501039_0248810 3300049575 Bacteria 1398
839 Ga0501040_0013141 3300049576 Bacteria 5444
840 Ga0501040_0014625 3300049576 Bacteria 5175
841 Ga0501040_0069385 3300049576 Bacteria 2431
842 Ga0501040_0171642 3300049576 Bacteria 1535
843 Ga0501040_0457553 3300049576 Bacteria 919
844 Ga0501041_0001989 3300049577 Bacteria 11487
845 Ga0501041_0014883 3300049577 Bacteria 4618
846 Ga0501042_0011337 3300049578 Bacteria 6012
847 Ga0501042_0037631 3300049578 Bacteria 3434
848 Ga0501042_0038156 3300049578 Bacteria 3411
849 Ga0501042_0502305 3300049578 Bacteria 881
850 Ga0501043_0002998 3300049579 Bacteria 14066
851 Ga0501043_0022588 3300049579 Bacteria 4931
852 Ga0501043_0054629 3300049579 Bacteria 3137
853 Ga0501043_0449519 3300049579 Bacteria 968
854 Ga0501046_0003961 3300049580 Bacteria 13519
855 Ga0501046_0006982 3300049580 Bacteria 9945
856 Ga0501046_0009200 3300049580 Bacteria 8553
857 Ga0501046_0015127 3300049580 Bacteria 6488
858 Ga0501046_0029434 3300049580 Bacteria 4464
859 Ga0501046_0106492 3300049580 Bacteria 2146
860 Ga0501047_0002955 3300049581 Bacteria 16112
861 Ga0501047_0439739 3300049581 Bacteria 1134
862 Ga0501048_0015227 3300049582 Bacteria 5682
863 Ga0501048_0020173 3300049582 Bacteria 4888
864 Ga0501048_0074718 3300049582 Bacteria 2391
865 Ga0501067_0001759 3300049583 Bacteria 11903
866 Ga0501068_0030970 3300049584 Bacteria 3176
867 Ga0501069_0347829 3300049585 Bacteria 873
868 Ga0501070_0010882 3300049586 Bacteria 7685
869 Ga0501070_0091062 3300049586 Bacteria 2524
870 Ga0501070_0176934 3300049586 Bacteria 1756
871 Ga0501071_0000326 3300049587 Bacteria 22944
872 Ga0501071_0008282 3300049587 Bacteria 6866
873 Ga0501071_0040467 3300049587 Bacteria 3335
874 Ga0501071_0502765 3300049587 Bacteria 930
875 Ga0501072_0024767 3300049588 Bacteria 4671
876 Ga0501072_0030671 3300049588 Bacteria 4206
877 Ga0501072_0055462 3300049588 Bacteria 3124
878 Ga0501073_0006481 3300049589 Bacteria 8706
879 Ga0501073_0006560 3300049589 Bacteria 8660
880 Ga0501073_0217671 3300049589 Bacteria 1319
881 Ga0501074_0000179 3300049590 Bacteria 34289
882 Ga0501074_0002065 3300049590 Bacteria 13883
883 Ga0501074_0006517 3300049590 Bacteria 8429
884 Ga0501074_0041862 3300049590 Bacteria 3315
885 Ga0501074_0184290 3300049590 Bacteria 1489
886 Ga0501074_0343405 3300049590 Bacteria 1060
887 Ga0501074_0365329 3300049590 Bacteria 1024
888 Ga0501075_0000736 3300049591 Bacteria 20301
889 Ga0501075_0024495 3300049591 Bacteria 4426
890 Ga0501075_0180301 3300049591 Bacteria 1611
891 Ga0501075_0219032 3300049591 Bacteria 1452
892 Ga0501076_0003626 3300049592 Bacteria 10841
893 Ga0501076_0025313 3300049592 Bacteria 4591
894 Ga0501076_0025814 3300049592 Bacteria 4549
895 Ga0501076_0773428 3300049592 Bacteria 792
896 Ga0501077_0004986 3300049593 Bacteria 8047
897 Ga0501077_0005531 3300049593 Bacteria 7692
898 Ga0501077_0044263 3300049593 Bacteria 2828
899 Ga0501079_0016308 3300049741 Bacteria 5677
900 Ga0501079_0243772 3300049741 Bacteria 1404
901 Ga0501080_0002453 3300049742 Bacteria 16220
902 Ga0501080_0005900 3300049742 Bacteria 10970
903 Ga0501080_0015622 3300049742 Bacteria 7001
904 Ga0501080_0030776 3300049742 Bacteria 5001
905 Ga0501080_0700140 3300049742 Bacteria 894
906 Ga0501081_0000724 3300049743 Bacteria 19213
907 Ga0501081_0065319 3300049743 Bacteria 2529
908 Ga0501081_0107479 3300049743 Bacteria 1978
909 Ga0501083_0079258 3300049744 Bacteria 2178
910 Ga0501083_0302719 3300049744 Bacteria 1040
911 Ga0501241_008547 3300049758 Bacteria 1868
912 Ga0501035_0000299 3300049822 Bacteria 58451
913 Ga0501035_0019486 3300049822 Bacteria 6237
914 Ga0501035_0034004 3300049822 Bacteria 4633
915 Ga0501035_0084431 3300049822 Bacteria 2800
916 Ga0501035_0356021 3300049822 Bacteria 1224
917 Ga0501044_0010933 3300049823 Bacteria 9852
918 Ga0501044_0103449 3300049823 Bacteria 2862
919 Ga0501045_0005410 3300049824 Bacteria 8838
920 Ga0501045_0013952 3300049824 Bacteria 5686
921 Ga0501045_0233452 3300049824 Bacteria 1369
922 nmdc:mga05p37_143791_c1 3300050507 Bacteria 2921
923 nmdc:mga05p37_22307_c1 3300050507 Bacteria 7678
924 nmdc:mga05p37_5266_c1 3300050507 Bacteria 15180
925 nmdc:mga09592_10130_c1 3300050508 Bacteria 7669
926 nmdc:mga09592_17045_c1 3300050508 Bacteria 5947
927 nmdc:mga09592_187631_c1 3300050508 Bacteria 1789
928 nmdc:mga0qj67_1822_c1 3300050509 Bacteria 15088
929 nmdc:mga06r32_3_c1 3300050510 Bacteria 164616
930 nmdc:mga06r32_607748_c1 3300050510 Bacteria 1064
931 nmdc:mga06r32_723_c1 3300050510 Bacteria 28939
932 nmdc:mga06r32_7892_c1 3300050510 Bacteria 9565
933 nmdc:mga08y16_1352_c2 3300050511 Bacteria 15858
934 nmdc:mga08y16_1397_c1 3300050511 Bacteria 24180
935 nmdc:mga08y16_2729_c1 3300050511 Bacteria 18112
936 nmdc:mga08y16_35820_c1 3300050511 Bacteria 5212
937 nmdc:mga08y16_54834_c1 3300050511 Bacteria 4166
938 nmdc:mga0n895_15568_c1 3300050512 Bacteria 6941
939 nmdc:mga0n895_275505_c1 3300050512 Bacteria 1706
940 nmdc:mga0rr50_360360_c1 3300050513 Bacteria 1224
941 nmdc:mga08x19_24598_c1 3300050514 Bacteria 3745
942 nmdc:mga0a205_320010_c1 3300050515 Bacteria 1422
943 nmdc:mga0a205_9569_c1 3300050515 Bacteria 8869
944 Ga0495601_0439319 3300053077 Bacteria 844
945 Ga0500647_0188966 3300053091 Bacteria 941
946 Ga0500583_0055940 3300053092 Bacteria 1846
947 Ga0500583_0115452 3300053092 Bacteria 1325
948 Ga0500583_0116461 3300053092 Bacteria 1320
949 Ga0500583_0252765 3300053092 Bacteria 870
950 Ga0500641_0018669 3300053096 Bacteria 2612
951 Ga0500641_0116737 3300053096 Bacteria 1149
952 Ga0500556_0001203 3300053104 Bacteria 12175
953 Ga0500556_0035434 3300053104 Bacteria 1724
954 Ga0500591_041053 3300053115 Bacteria 2201
955 Ga0500568_0136382 3300053139 Bacteria 911
956 Ga0500604_0097051 3300053151 Bacteria 968
957 Ga0500616_0081400 3300053153 Bacteria 1626
958 Ga0500622_0006363 3300053156 Bacteria 6876
959 Ga0500637_0011591 3300053178 Bacteria 4566
960 Ga0500637_0340543 3300053178 Bacteria 802
961 Ga0501084_0014553 3300054114 Bacteria 6522
962 Ga0501084_0021657 3300054114 Bacteria 5359
963 Ga0501084_0030134 3300054114 Bacteria 4537
964 Ga0501084_0117273 3300054114 Bacteria 2238
965 Ga0501082_0000377 3300060353 Bacteria 39485
966 Ga0501082_0001181 3300060353 Bacteria 22960
967 Ga0501082_0147505 3300060353 Bacteria 2042
968 Ga0501082_0156122 3300060353 Bacteria 1983
969 Ga0530510_0014851 3300061734 Bacteria 5499
970 Ga0530510_0015136 3300061734 Bacteria 5448
971 Ga0530510_0043536 3300061734 Bacteria 3243
972 Ga0530510_0351846 3300061734 Bacteria 1107

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0103449 Ga0501044_0103449_63_695 210
2 3300049822 Ga0501035_0356021 Ga0501035_0356021_548_1186 212
3 3300049576 Ga0501040_0457553 Ga0501040_0457553_41_751 236
4 3300049592 Ga0501076_0773428 Ga0501076_0773428_30_740 236
5 3300005334 Ga0068869_100051345 Ga0068869_1000513453 242
6 3300005338 Ga0068868_100129898 Ga0068868_1001298983 242
7 3300005364 Ga0070673_100167918 Ga0070673_1001679183 242
8 3300005455 Ga0070663_100172797 Ga0070663_1001727972 242
9 3300005539 Ga0068853_100340110 Ga0068853_1003401102 242
10 3300005563 Ga0068855_100493135 Ga0068855_1004931352 242
11 3300005844 Ga0068862_100705542 Ga0068862_1007055422 242
12 3300006852 Ga0075433_10323744 Ga0075433_103237442 242
13 3300009545 Ga0105237_10438750 Ga0105237_104387502 242
14 3300013105 Ga0157369_10878277 Ga0157369_108782772 242
15 3300025942 Ga0207689_10055034 Ga0207689_100550342 242
16 3300049568 Ga0501031_0016819 Ga0501031_0016819_2159_2890 242
17 3300049568 Ga0501031_0065908 Ga0501031_0065908_549_1280 242
18 3300049569 Ga0501032_0009038 Ga0501032_0009038_3159_3890 242
19 3300049569 Ga0501032_0017498 Ga0501032_0017498_3149_3880 242
20 3300049569 Ga0501032_0058180 Ga0501032_0058180_1277_2008 242
21 3300049570 Ga0501033_0001962 Ga0501033_0001962_3955_4686 242
22 3300049570 Ga0501033_0002169 Ga0501033_0002169_14189_14920 242
23 3300049571 Ga0501034_0040621 Ga0501034_0040621_3564_4295 242
24 3300049572 Ga0501036_0027084 Ga0501036_0027084_301_1032 242
25 3300049572 Ga0501036_0150021 Ga0501036_0150021_86_817 242
26 3300049573 Ga0501037_0072023 Ga0501037_0072023_1014_1745 242
27 3300049574 Ga0501038_0010561 Ga0501038_0010561_5667_6398 242
28 3300049574 Ga0501038_0030814 Ga0501038_0030814_354_1085 242
29 3300049575 Ga0501039_0235206 Ga0501039_0235206_610_1341 242
30 3300049576 Ga0501040_0014625 Ga0501040_0014625_3189_3920 242
31 3300049579 Ga0501043_0002998 Ga0501043_0002998_8760_9491 242
32 3300049579 Ga0501043_0022588 Ga0501043_0022588_851_1582 242
33 3300049580 Ga0501046_0009200 Ga0501046_0009200_3606_4337 242
34 3300049581 Ga0501047_0002955 Ga0501047_0002955_313_1044 242
35 3300049582 Ga0501048_0020173 Ga0501048_0020173_3350_4081 242
36 3300049822 Ga0501035_0000299 Ga0501035_0000299_33102_33833 242
37 3300049822 Ga0501035_0034004 Ga0501035_0034004_2647_3378 242
38 3300049822 Ga0501035_0084431 Ga0501035_0084431_137_868 242
39 3300049823 Ga0501044_0010933 Ga0501044_0010933_4905_5636 242
40 3300049824 Ga0501045_0013952 Ga0501045_0013952_295_1026 242
41 3300050515 nmdc:mga0a205_320010_c1 nmdc:mga0a205_320010_c1_351_1109 242
42 3300005841 Ga0068863_100600869 Ga0068863_1006008692 243
43 3300042436 Ga0439435_0041727 Ga0439435_0041727_219_956 243
44 3300042461 Ga0439460_0003422 Ga0439460_0003422_2980_3717 243
45 3300046539 Ga0495621_0033003 Ga0495621_0033003_169_906 243
46 3300005719 Ga0068861_100626615 Ga0068861_1006266151 244
47 3300041486 Ga0451807_1381746 Ga0451807_1381746_289_1029 244
48 3300049587 Ga0501071_0502765 Ga0501071_0502765_63_800 244
49 3300061734 Ga0530510_0351846 Ga0530510_0351846_27_764 244
50 iso_pu_bacteria 2952252522 2952253991 244
51 3300005577 Ga0068857_100056428 Ga0068857_1000564284 245
52 3300006852 Ga0075433_10003048 Ga0075433_100030484 245
53 3300006871 Ga0075434_100000232 Ga0075434_10000023220 245
54 3300006880 Ga0075429_100102089 Ga0075429_1001020892 245
55 3300007076 Ga0075435_100106215 Ga0075435_1001062151 245
56 3300009094 Ga0111539_10008124 Ga0111539_1000812410 245
57 3300014326 Ga0157380_10007215 Ga0157380_100072153 245
58 3300014326 Ga0157380_10211066 Ga0157380_102110662 245
59 3300025923 Ga0207681_10115754 Ga0207681_101157543 245
60 3300027907 Ga0207428_10020710 Ga0207428_100207104 245
61 3300048907 Ga0496104_0743459 Ga0496104_0743459_93_830 245
62 3300049583 Ga0501067_0001759 Ga0501067_0001759_5881_6621 245
63 3300049589 Ga0501073_0006481 Ga0501073_0006481_2482_3222 245
64 3300049590 Ga0501074_0006517 Ga0501074_0006517_7433_8173 245
65 3300049593 Ga0501077_0004986 Ga0501077_0004986_6135_6875 245
66 3300049741 Ga0501079_0243772 Ga0501079_0243772_375_1115 245
67 3300049742 Ga0501080_0002453 Ga0501080_0002453_9187_9927 245
68 3300050507 nmdc:mga05p37_143791_c1 nmdc:mga05p37_143791_c1_1529_2269 245
69 3300050511 nmdc:mga08y16_1352_c2 nmdc:mga08y16_1352_c2_2534_3274 245
70 3300050512 nmdc:mga0n895_15568_c1 nmdc:mga0n895_15568_c1_5203_5943 245
71 3300050513 nmdc:mga0rr50_360360_c1 nmdc:mga0rr50_360360_c1_455_1195 245
72 3300050515 nmdc:mga0a205_9569_c1 nmdc:mga0a205_9569_c1_446_1186 245
73 3300054114 Ga0501084_0014553 Ga0501084_0014553_4495_5235 245
74 3300060353 Ga0501082_0001181 Ga0501082_0001181_9065_9805 245
75 iso_pu_bacteria 2738541276 2738714500 245
76 iso_pu_bacteria 2894510363 2894512618 245
77 3300005336 Ga0070680_100054620 Ga0070680_1000546203 246
78 3300005338 Ga0068868_100086997 Ga0068868_1000869973 246
79 3300005354 Ga0070675_100290096 Ga0070675_1002900961 246
80 3300005355 Ga0070671_100167304 Ga0070671_1001673042 246
81 3300005435 Ga0070714_100004766 Ga0070714_1000047666 246
82 3300005436 Ga0070713_100006160 Ga0070713_1000061604 246
83 3300005458 Ga0070681_10001348 Ga0070681_1000134815 246
84 3300005539 Ga0068853_100167176 Ga0068853_1001671763 246
85 3300005563 Ga0068855_100018420 Ga0068855_1000184206 246
86 3300005577 Ga0068857_100924288 Ga0068857_1009242881 246
87 3300005614 Ga0068856_100654296 Ga0068856_1006542961 246
88 3300005616 Ga0068852_100066436 Ga0068852_1000664364 246
89 3300006175 Ga0070712_100279500 Ga0070712_1002795001 246
90 3300006358 Ga0068871_100105179 Ga0068871_1001051792 246
91 3300006847 Ga0075431_100099414 Ga0075431_1000994143 246
92 3300006914 Ga0075436_100067546 Ga0075436_1000675463 246
93 3300009093 Ga0105240_10433327 Ga0105240_104333272 246
94 3300009174 Ga0105241_10016405 Ga0105241_100164053 246
95 3300009545 Ga0105237_10004492 Ga0105237_100044923 246
96 3300010375 Ga0105239_10008633 Ga0105239_1000863310 246
97 3300011119 Ga0105246_10128221 Ga0105246_101282213 246
98 3300014969 Ga0157376_10520408 Ga0157376_105204082 246
99 3300021377 Ga0213874_10011572 Ga0213874_100115723 246
100 3300025911 Ga0207654_10032147 Ga0207654_100321473 246
101 3300025912 Ga0207707_10051030 Ga0207707_100510301 246
102 3300025914 Ga0207671_10006805 Ga0207671_100068053 246
103 3300025915 Ga0207693_10089004 Ga0207693_100890043 246
104 3300025917 Ga0207660_10026586 Ga0207660_100265864 246
105 3300025929 Ga0207664_10016012 Ga0207664_100160123 246
106 3300025932 Ga0207690_10015790 Ga0207690_100157904 246
107 3300025949 Ga0207667_10044202 Ga0207667_100442024 246
108 3300026116 Ga0207674_10806391 Ga0207674_108063911 246
109 3300036401 Ga0373937_0169112 Ga0373937_0169112_167_913 246
110 3300039110 Ga0400487_64772 Ga0400487_64772_4240_4980 246
111 3300039450 Ga0436363_0167267 Ga0436363_0167267_1435_2175 246
112 3300048907 Ga0496104_0408134 Ga0496104_0408134_422_1168 246
113 3300048909 Ga0496106_0242529 Ga0496106_0242529_103_843 246
114 3300050514 nmdc:mga08x19_24598_c1 nmdc:mga08x19_24598_c1_795_1535 246
115 iso_pu_bacteria 2537561728 2538427134 246
116 iso_pu_bacteria 2847085930 2847089590 246
117 iso_pu_bacteria 2854601825 2854604825 246
118 iso_pu_bacteria 2855195626 2855196508 246
119 iso_pu_bacteria 2858466076 2858467767 246
120 iso_pu_bacteria 2871272651 2871276620 246
121 iso_pu_bacteria 2871282230 2871283599 246
122 iso_pu_bacteria 2881714928 2881715686 246
123 iso_pu_bacteria 2900051742 2900055307 246
124 iso_pu_bacteria 2908669403 2908674542 246
125 iso_pu_bacteria 3000376612 3000376635 246
126 3300005336 Ga0070680_100028196 Ga0070680_1000281965 247
127 3300005336 Ga0070680_100090221 Ga0070680_1000902213 247
128 3300005336 Ga0070680_100164337 Ga0070680_1001643372 247
129 3300005436 Ga0070713_100257557 Ga0070713_1002575572 247
130 3300005458 Ga0070681_10002296 Ga0070681_100022964 247
131 3300005458 Ga0070681_10023527 Ga0070681_100235273 247
132 3300005458 Ga0070681_10189019 Ga0070681_101890193 247
133 3300005530 Ga0070679_100004511 Ga0070679_1000045114 247
134 3300005530 Ga0070679_100033547 Ga0070679_1000335473 247
135 3300005563 Ga0068855_100010581 Ga0068855_1000105813 247
136 3300005564 Ga0070664_100729740 Ga0070664_1007297401 247
137 3300005614 Ga0068856_100104780 Ga0068856_1001047802 247
138 3300006846 Ga0075430_100002285 Ga0075430_10000228516 247
139 3300009093 Ga0105240_10003170 Ga0105240_100031706 247
140 3300009093 Ga0105240_10046522 Ga0105240_100465224 247
141 3300009093 Ga0105240_10464784 Ga0105240_104647842 247
142 3300009551 Ga0105238_10010242 Ga0105238_100102428 247
143 3300009551 Ga0105238_10018185 Ga0105238_100181856 247
144 3300009551 Ga0105238_10351667 Ga0105238_103516672 247
145 3300011119 Ga0105246_10624837 Ga0105246_106248371 247
146 3300013104 Ga0157370_10005200 Ga0157370_1000520010 247
147 3300013105 Ga0157369_10002574 Ga0157369_1000257418 247
148 3300013307 Ga0157372_10102320 Ga0157372_101023203 247
149 3300014969 Ga0157376_10426199 Ga0157376_104261992 247
150 3300025912 Ga0207707_10002757 Ga0207707_100027576 247
151 3300025912 Ga0207707_10012435 Ga0207707_100124353 247
152 3300025912 Ga0207707_10039399 Ga0207707_100393992 247
153 3300025913 Ga0207695_10004668 Ga0207695_1000466812 247
154 3300025917 Ga0207660_10011059 Ga0207660_100110594 247
155 3300025917 Ga0207660_10149945 Ga0207660_101499451 247
156 3300025917 Ga0207660_10382007 Ga0207660_103820071 247
157 3300025921 Ga0207652_10014707 Ga0207652_100147076 247
158 3300025921 Ga0207652_10026377 Ga0207652_100263774 247
159 3300025921 Ga0207652_10149928 Ga0207652_101499281 247
160 3300025924 Ga0207694_10033760 Ga0207694_100337604 247
161 3300025928 Ga0207700_10020950 Ga0207700_100209505 247
162 3300025939 Ga0207665_10079043 Ga0207665_100790431 247
163 3300025942 Ga0207689_10207475 Ga0207689_102074752 247
164 3300025945 Ga0207679_10532410 Ga0207679_105324101 247
165 3300025949 Ga0207667_10041830 Ga0207667_100418303 247
166 3300025981 Ga0207640_10463668 Ga0207640_104636682 247
167 3300031344 Ga0265316_10017357 Ga0265316_100173573 247
168 3300031711 Ga0265314_10157873 Ga0265314_101578732 247
169 3300031911 Ga0307412_10064544 Ga0307412_100645441 247
170 3300035111 Ga0373923_0079343 Ga0373923_0079343_625_1371 247
171 3300035410 Ga0373924_0140036 Ga0373924_0140036_225_968 247
172 3300042530 Ga0450916_023519 Ga0450916_023519_24_767 247
173 3300048903 Ga0496100_0100436 Ga0496100_0100436_691_1437 247
174 3300048907 Ga0496104_0001674 Ga0496104_0001674_421_1167 247
175 3300048908 Ga0496105_0039326 Ga0496105_0039326_447_1193 247
176 3300048917 Ga0496114_0009790 Ga0496114_0009790_2790_3536 247
177 3300048918 Ga0496115_0020318 Ga0496115_0020318_1674_2420 247
178 3300049569 Ga0501032_0137838 Ga0501032_0137838_177_923 247
179 3300049573 Ga0501037_0005208 Ga0501037_0005208_459_1205 247
180 3300049573 Ga0501037_0023752 Ga0501037_0023752_222_968 247
181 3300049574 Ga0501038_0004629 Ga0501038_0004629_4493_5239 247
182 3300049578 Ga0501042_0502305 Ga0501042_0502305_94_840 247
183 3300049580 Ga0501046_0003961 Ga0501046_0003961_12153_12899 247
184 3300049586 Ga0501070_0010882 Ga0501070_0010882_1897_2643 247
185 3300049586 Ga0501070_0091062 Ga0501070_0091062_1763_2509 247
186 3300049586 Ga0501070_0176934 Ga0501070_0176934_65_811 247
187 3300049590 Ga0501074_0000179 Ga0501074_0000179_5907_6653 247
188 3300049590 Ga0501074_0365329 Ga0501074_0365329_34_780 247
189 3300049591 Ga0501075_0219032 Ga0501075_0219032_595_1341 247
190 3300049742 Ga0501080_0015622 Ga0501080_0015622_1867_2613 247
191 3300050508 nmdc:mga09592_187631_c1 nmdc:mga09592_187631_c1_916_1659 247
192 3300050509 nmdc:mga0qj67_1822_c1 nmdc:mga0qj67_1822_c1_12980_13723 247
193 3300050510 nmdc:mga06r32_723_c1 nmdc:mga06r32_723_c1_4499_5242 247
194 3300053077 Ga0495601_0439319 Ga0495601_0439319_78_824 247
195 3300053153 Ga0500616_0081400 Ga0500616_0081400_602_1348 247
196 3300003323 rootH1_10014283 rootH1_100142831 248
197 3300003323 rootH1_10028592 rootH1_100285923 248
198 3300005290 Ga0065712_10305094 Ga0065712_103050941 248
199 3300005293 Ga0065715_10135706 Ga0065715_101357062 248
200 3300005330 Ga0070690_100001308 Ga0070690_10000130810 248
201 3300005331 Ga0070670_100024081 Ga0070670_1000240813 248
202 3300005331 Ga0070670_100153902 Ga0070670_1001539023 248
203 3300005334 Ga0068869_100023174 Ga0068869_1000231742 248
204 3300005335 Ga0070666_10011341 Ga0070666_100113413 248
205 3300005337 Ga0070682_100114136 Ga0070682_1001141363 248
206 3300005338 Ga0068868_100013212 Ga0068868_1000132122 248
207 3300005340 Ga0070689_100005729 Ga0070689_1000057292 248
208 3300005341 Ga0070691_10254984 Ga0070691_102549841 248
209 3300005343 Ga0070687_100413822 Ga0070687_1004138221 248
210 3300005344 Ga0070661_100001052 Ga0070661_1000010529 248
211 3300005345 Ga0070692_10042220 Ga0070692_100422203 248
212 3300005347 Ga0070668_100003202 Ga0070668_1000032029 248
213 3300005353 Ga0070669_100282176 Ga0070669_1002821762 248
214 3300005354 Ga0070675_100001328 Ga0070675_1000013283 248
215 3300005355 Ga0070671_100024020 Ga0070671_1000240204 248
216 3300005355 Ga0070671_100129961 Ga0070671_1001299612 248
217 3300005364 Ga0070673_100111056 Ga0070673_1001110563 248
218 3300005364 Ga0070673_100401894 Ga0070673_1004018942 248
219 3300005365 Ga0070688_100012489 Ga0070688_1000124893 248
220 3300005367 Ga0070667_100027211 Ga0070667_1000272112 248
221 3300005406 Ga0070703_10045907 Ga0070703_100459072 248
222 3300005434 Ga0070709_10037973 Ga0070709_100379733 248
223 3300005436 Ga0070713_100000427 Ga0070713_1000004277 248
224 3300005437 Ga0070710_10048629 Ga0070710_100486293 248
225 3300005440 Ga0070705_100022150 Ga0070705_1000221503 248
226 3300005441 Ga0070700_100009378 Ga0070700_1000093783 248
227 3300005441 Ga0070700_100056935 Ga0070700_1000569353 248
228 3300005456 Ga0070678_100045854 Ga0070678_1000458543 248
229 3300005456 Ga0070678_100376492 Ga0070678_1003764922 248
230 3300005457 Ga0070662_100010889 Ga0070662_1000108894 248
231 3300005458 Ga0070681_10150026 Ga0070681_101500263 248
232 3300005459 Ga0068867_100053916 Ga0068867_1000539162 248
233 3300005535 Ga0070684_100000450 Ga0070684_10000045021 248
234 3300005539 Ga0068853_100235792 Ga0068853_1002357923 248
235 3300005539 Ga0068853_100552262 Ga0068853_1005522621 248
236 3300005544 Ga0070686_100001533 Ga0070686_1000015339 248
237 3300005546 Ga0070696_100160333 Ga0070696_1001603332 248
238 3300005547 Ga0070693_100120387 Ga0070693_1001203872 248
239 3300005547 Ga0070693_100358274 Ga0070693_1003582742 248
240 3300005548 Ga0070665_100014187 Ga0070665_1000141877 248
241 3300005548 Ga0070665_100091910 Ga0070665_1000919102 248
242 3300005564 Ga0070664_100004843 Ga0070664_1000048437 248
243 3300005577 Ga0068857_100012480 Ga0068857_1000124806 248
244 3300005577 Ga0068857_100056677 Ga0068857_1000566772 248
245 3300005578 Ga0068854_100154918 Ga0068854_1001549183 248
246 3300005614 Ga0068856_100031587 Ga0068856_1000315873 248
247 3300005615 Ga0070702_100000186 Ga0070702_10000018619 248
248 3300005617 Ga0068859_100006805 Ga0068859_1000068055 248
249 3300005618 Ga0068864_100000569 Ga0068864_10000056932 248
250 3300005718 Ga0068866_10005217 Ga0068866_100052173 248
251 3300005718 Ga0068866_10019334 Ga0068866_100193343 248
252 3300005719 Ga0068861_100008511 Ga0068861_1000085113 248
253 3300005719 Ga0068861_100324468 Ga0068861_1003244682 248
254 3300005840 Ga0068870_10010262 Ga0068870_100102624 248
255 3300005840 Ga0068870_10017903 Ga0068870_100179033 248
256 3300005841 Ga0068863_100001625 Ga0068863_10000162521 248
257 3300005841 Ga0068863_100026511 Ga0068863_1000265115 248
258 3300005842 Ga0068858_100011034 Ga0068858_1000110344 248
259 3300005842 Ga0068858_100018633 Ga0068858_1000186334 248
260 3300005843 Ga0068860_100022938 Ga0068860_1000229383 248
261 3300005843 Ga0068860_100090774 Ga0068860_1000907743 248
262 3300005844 Ga0068862_100005736 Ga0068862_1000057366 248
263 3300005844 Ga0068862_100007875 Ga0068862_1000078759 248
264 3300005844 Ga0068862_100088203 Ga0068862_1000882031 248
265 3300005985 Ga0081539_10000055 Ga0081539_1000005538 248
266 3300006163 Ga0070715_10018578 Ga0070715_100185783 248
267 3300006175 Ga0070712_100011174 Ga0070712_1000111742 248
268 3300006237 Ga0097621_100026403 Ga0097621_1000264033 248
269 3300006237 Ga0097621_100128650 Ga0097621_1001286503 248
270 3300006358 Ga0068871_100012023 Ga0068871_1000120234 248
271 3300006358 Ga0068871_100057094 Ga0068871_1000570943 248
272 3300006844 Ga0075428_100005915 Ga0075428_1000059157 248
273 3300006844 Ga0075428_100006185 Ga0075428_1000061853 248
274 3300006846 Ga0075430_100134949 Ga0075430_1001349492 248
275 3300006847 Ga0075431_100000121 Ga0075431_10000012146 248
276 3300006871 Ga0075434_100187109 Ga0075434_1001871094 248
277 3300006880 Ga0075429_100002068 Ga0075429_10000206811 248
278 3300006880 Ga0075429_100008661 Ga0075429_1000086619 248
279 3300006881 Ga0068865_100105300 Ga0068865_1001053002 248
280 3300006931 Ga0097620_100006805 Ga0097620_10000680511 248
281 3300009092 Ga0105250_10041763 Ga0105250_100417632 248
282 3300009093 Ga0105240_10235603 Ga0105240_102356032 248
283 3300009094 Ga0111539_10000695 Ga0111539_1000069525 248
284 3300009094 Ga0111539_10021812 Ga0111539_100218129 248
285 3300009094 Ga0111539_10105971 Ga0111539_101059713 248
286 3300009098 Ga0105245_10011359 Ga0105245_100113592 248
287 3300009101 Ga0105247_10364793 Ga0105247_103647931 248
288 3300009147 Ga0114129_10000366 Ga0114129_1000036636 248
289 3300009147 Ga0114129_10006307 Ga0114129_100063073 248
290 3300009148 Ga0105243_10055051 Ga0105243_100550513 248
291 3300009176 Ga0105242_10000669 Ga0105242_100006695 248
292 3300009177 Ga0105248_10012530 Ga0105248_100125306 248
293 3300009177 Ga0105248_10099252 Ga0105248_100992523 248
294 3300009545 Ga0105237_10075434 Ga0105237_100754343 248
295 3300009553 Ga0105249_10012849 Ga0105249_100128494 248
296 3300009553 Ga0105249_10015074 Ga0105249_100150745 248
297 3300010375 Ga0105239_10013474 Ga0105239_100134744 248
298 3300013296 Ga0157374_10043408 Ga0157374_100434084 248
299 3300013297 Ga0157378_10009323 Ga0157378_100093234 248
300 3300013306 Ga0163162_10078807 Ga0163162_100788072 248
301 3300013306 Ga0163162_10171019 Ga0163162_101710193 248
302 3300013308 Ga0157375_10063389 Ga0157375_100633894 248
303 3300013308 Ga0157375_10100055 Ga0157375_101000554 248
304 3300014325 Ga0163163_10003280 Ga0163163_1000328015 248
305 3300014325 Ga0163163_10326054 Ga0163163_103260542 248
306 3300014326 Ga0157380_10947564 Ga0157380_109475641 248
307 3300014745 Ga0157377_10003532 Ga0157377_100035321 248
308 3300014968 Ga0157379_10010150 Ga0157379_100101501 248
309 3300014968 Ga0157379_10177226 Ga0157379_101772263 248
310 3300014969 Ga0157376_10155559 Ga0157376_101555591 248
311 3300017792 Ga0163161_10045444 Ga0163161_100454443 248
312 3300025893 Ga0207682_10119262 Ga0207682_101192622 248
313 3300025898 Ga0207692_10050767 Ga0207692_100507672 248
314 3300025899 Ga0207642_10048092 Ga0207642_100480922 248
315 3300025900 Ga0207710_10177938 Ga0207710_101779381 248
316 3300025901 Ga0207688_10039365 Ga0207688_100393651 248
317 3300025903 Ga0207680_10103673 Ga0207680_101036732 248
318 3300025905 Ga0207685_10001569 Ga0207685_100015695 248
319 3300025907 Ga0207645_10006379 Ga0207645_100063796 248
320 3300025907 Ga0207645_10037104 Ga0207645_100371044 248
321 3300025908 Ga0207643_10030346 Ga0207643_100303463 248
322 3300025908 Ga0207643_10051590 Ga0207643_100515903 248
323 3300025913 Ga0207695_10393396 Ga0207695_103933962 248
324 3300025914 Ga0207671_10047416 Ga0207671_100474163 248
325 3300025915 Ga0207693_10000074 Ga0207693_100000745 248
326 3300025925 Ga0207650_10009452 Ga0207650_100094527 248
327 3300025925 Ga0207650_10078685 Ga0207650_100786853 248
328 3300025926 Ga0207659_10001788 Ga0207659_1000178812 248
329 3300025928 Ga0207700_10020981 Ga0207700_100209815 248
330 3300025931 Ga0207644_10297609 Ga0207644_102976092 248
331 3300025931 Ga0207644_10582584 Ga0207644_105825842 248
332 3300025933 Ga0207706_10002530 Ga0207706_100025306 248
333 3300025936 Ga0207670_10013656 Ga0207670_100136563 248
334 3300025937 Ga0207669_10363665 Ga0207669_103636652 248
335 3300025938 Ga0207704_10391816 Ga0207704_103918162 248
336 3300025940 Ga0207691_10035704 Ga0207691_100357044 248
337 3300025941 Ga0207711_10174290 Ga0207711_101742902 248
338 3300025941 Ga0207711_10365702 Ga0207711_103657022 248
339 3300025942 Ga0207689_10011724 Ga0207689_100117247 248
340 3300025942 Ga0207689_10038860 Ga0207689_100388604 248
341 3300025945 Ga0207679_10012127 Ga0207679_100121277 248
342 3300025960 Ga0207651_10003822 Ga0207651_100038224 248
343 3300025960 Ga0207651_10205030 Ga0207651_102050302 248
344 3300025972 Ga0207668_10431600 Ga0207668_104316002 248
345 3300025981 Ga0207640_10128977 Ga0207640_101289772 248
346 3300025986 Ga0207658_10009061 Ga0207658_100090612 248
347 3300026023 Ga0207677_10020310 Ga0207677_100203103 248
348 3300026035 Ga0207703_10056126 Ga0207703_100561263 248
349 3300026075 Ga0207708_10073963 Ga0207708_100739633 248
350 3300026075 Ga0207708_10091053 Ga0207708_100910532 248
351 3300026078 Ga0207702_10365921 Ga0207702_103659212 248
352 3300026088 Ga0207641_10004671 Ga0207641_1000467112 248
353 3300026088 Ga0207641_10867051 Ga0207641_108670511 248
354 3300026089 Ga0207648_10000935 Ga0207648_100009358 248
355 3300026095 Ga0207676_10005840 Ga0207676_100058403 248
356 3300026116 Ga0207674_10006902 Ga0207674_100069026 248
357 3300026116 Ga0207674_10034124 Ga0207674_100341246 248
358 3300026118 Ga0207675_100003493 Ga0207675_10000349312 248
359 3300026118 Ga0207675_100013127 Ga0207675_1000131276 248
360 3300026121 Ga0207683_10011548 Ga0207683_100115486 248
361 3300026121 Ga0207683_10044662 Ga0207683_100446624 248
362 3300027907 Ga0207428_10006432 Ga0207428_100064323 248
363 3300027907 Ga0207428_10146709 Ga0207428_101467093 248
364 3300028379 Ga0268266_10079927 Ga0268266_100799273 248
365 3300028379 Ga0268266_10147562 Ga0268266_101475621 248
366 3300028380 Ga0268265_10006378 Ga0268265_100063787 248
367 3300028380 Ga0268265_10007283 Ga0268265_100072833 248
368 3300028380 Ga0268265_10054548 Ga0268265_100545483 248
369 3300028381 Ga0268264_10014381 Ga0268264_100143817 248
370 3300028381 Ga0268264_10014471 Ga0268264_100144716 248
371 3300028800 Ga0265338_10027853 Ga0265338_100278533 248
372 3300031247 Ga0265340_10094566 Ga0265340_100945662 248
373 3300031250 Ga0265331_10048701 Ga0265331_100487012 248
374 3300031250 Ga0265331_10061162 Ga0265331_100611622 248
375 3300031251 Ga0265327_10023520 Ga0265327_100235203 248
376 3300031548 Ga0307408_100079655 Ga0307408_1000796553 248
377 3300031548 Ga0307408_100081595 Ga0307408_1000815953 248
378 3300031548 Ga0307408_100205798 Ga0307408_1002057982 248
379 3300031548 Ga0307408_100217869 Ga0307408_1002178692 248
380 3300031665 Ga0316575_10000129 Ga0316575_1000012911 248
381 3300031665 Ga0316575_10038185 Ga0316575_100381851 248
382 3300031691 Ga0316579_10000530 Ga0316579_100005304 248
383 3300031727 Ga0316576_10086505 Ga0316576_100865052 248
384 3300031728 Ga0316578_10001988 Ga0316578_100019883 248
385 3300031728 Ga0316578_10034205 Ga0316578_100342053 248
386 3300031733 Ga0316577_10000014 Ga0316577_1000001425 248
387 3300032002 Ga0307416_101110218 Ga0307416_1011102181 248
388 3300032005 Ga0307411_10154891 Ga0307411_101548912 248
389 3300032005 Ga0307411_10204014 Ga0307411_102040142 248
390 3300032139 Ga0316580_10000397 Ga0316580_1000039710 248
391 3300032168 Ga0316593_10007758 Ga0316593_100077581 248
392 3300032168 Ga0316593_10052677 Ga0316593_100526772 248
393 3300032168 Ga0316593_10056053 Ga0316593_100560532 248
394 3300033541 Ga0316596_1009091 Ga0316596_10090913 248
395 3300035113 Ga0373936_0113824 Ga0373936_0113824_339_1085 248
396 3300035118 Ga0373954_0142474 Ga0373954_0142474_65_811 248
397 3300035172 Ga0373955_0038198 Ga0373955_0038198_1243_1989 248
398 3300035398 Ga0316574_0018258 Ga0316574_0018258_491_1240 248
399 3300035398 Ga0316574_0103484 Ga0316574_0103484_837_1592 248
400 3300035692 Ga0373935_0245210 Ga0373935_0245210_305_1051 248
401 3300035695 Ga0373927_0012200 Ga0373927_0012200_2386_3132 248
402 3300036401 Ga0373937_0056366 Ga0373937_0056366_1243_1989 248
403 3300036647 Ga0316582_0000288 Ga0316582_0000288_10292_11041 248
404 3300036712 Ga0316584_0007546 Ga0316584_0007546_6212_6961 248
405 3300036712 Ga0316584_0062510 Ga0316584_0062510_1820_2566 248
406 3300036712 Ga0316584_0065155 Ga0316584_0065155_1339_2088 248
407 3300037068 Ga0373925_0192347 Ga0373925_0192347_677_1423 248
408 3300038726 Ga0400490_07444 Ga0400490_07444_34332_35081 248
409 3300038726 Ga0400490_30083 Ga0400490_30083_18646_19395 248
410 3300038741 Ga0400488_01697 Ga0400488_01697_297_1046 248
411 3300038741 Ga0400488_59976 Ga0400488_59976_8103_8867 248
412 3300039062 Ga0400483_002831 Ga0400483_002831_8455_9204 248
413 3300039062 Ga0400483_163859 Ga0400483_163859_1528_2277 248
414 3300039062 Ga0400483_190589 Ga0400483_190589_968_1717 248
415 3300039062 Ga0400483_222691 Ga0400483_222691_20700_21449 248
416 3300039062 Ga0400483_284874 Ga0400483_284874_4694_5443 248
417 3300039093 Ga0400489_20593 Ga0400489_20593_350_1099 248
418 3300039093 Ga0400489_88422 Ga0400489_88422_437_1186 248
419 3300039110 Ga0400487_42418 Ga0400487_42418_2634_3398 248
420 3300045051 Ga0451576_0051462 Ga0451576_0051462_848_1594 248
421 3300046472 Ga0495580_0129006 Ga0495580_0129006_430_1176 248
422 3300046648 Ga0495611_0157629 Ga0495611_0157629_20_769 248
423 3300046692 Ga0495671_0032043 Ga0495671_0032043_1506_2255 248
424 3300048905 Ga0496102_0192228 Ga0496102_0192228_675_1421 248
425 3300048906 Ga0496103_0022093 Ga0496103_0022093_236_982 248
426 3300048908 Ga0496105_0022232 Ga0496105_0022232_1025_1771 248
427 3300048909 Ga0496106_0238634 Ga0496106_0238634_497_1243 248
428 3300048909 Ga0496106_0356169 Ga0496106_0356169_402_1148 248
429 3300048912 Ga0496109_0554249 Ga0496109_0554249_56_802 248
430 3300048913 Ga0496110_0124971 Ga0496110_0124971_241_987 248
431 3300048915 Ga0496112_0018514 Ga0496112_0018514_44_790 248
432 3300048915 Ga0496112_0400428 Ga0496112_0400428_491_1237 248
433 3300048916 Ga0496113_0081375 Ga0496113_0081375_861_1607 248
434 3300048918 Ga0496115_0070140 Ga0496115_0070140_1617_2363 248
435 3300049758 Ga0501241_008547 Ga0501241_008547_557_1306 248
436 3300050507 nmdc:mga05p37_22307_c1 nmdc:mga05p37_22307_c1_3742_4488 248
437 3300050507 nmdc:mga05p37_5266_c1 nmdc:mga05p37_5266_c1_12816_13562 248
438 3300050508 nmdc:mga09592_10130_c1 nmdc:mga09592_10130_c1_1443_2189 248
439 3300050508 nmdc:mga09592_17045_c1 nmdc:mga09592_17045_c1_5078_5824 248
440 3300050510 nmdc:mga06r32_3_c1 nmdc:mga06r32_3_c1_149994_150740 248
441 3300050510 nmdc:mga06r32_607748_c1 nmdc:mga06r32_607748_c1_267_1013 248
442 3300050510 nmdc:mga06r32_7892_c1 nmdc:mga06r32_7892_c1_3742_4488 248
443 3300050511 nmdc:mga08y16_1397_c1 nmdc:mga08y16_1397_c1_1295_2041 248
444 3300050511 nmdc:mga08y16_54834_c1 nmdc:mga08y16_54834_c1_3218_3964 248
445 3300050512 nmdc:mga0n895_275505_c1 nmdc:mga0n895_275505_c1_549_1295 248
446 3300005331 Ga0070670_100133139 Ga0070670_1001331393 249
447 3300005334 Ga0068869_100379856 Ga0068869_1003798562 249
448 3300005335 Ga0070666_10231698 Ga0070666_102316981 249
449 3300005338 Ga0068868_100012735 Ga0068868_1000127354 249
450 3300005354 Ga0070675_100361165 Ga0070675_1003611652 249
451 3300005355 Ga0070671_100001010 Ga0070671_10000101012 249
452 3300005355 Ga0070671_100055516 Ga0070671_1000555163 249
453 3300005355 Ga0070671_100235776 Ga0070671_1002357762 249
454 3300005364 Ga0070673_100347779 Ga0070673_1003477792 249
455 3300005367 Ga0070667_100000011 Ga0070667_100000011222 249
456 3300005367 Ga0070667_100035663 Ga0070667_1000356632 249
457 3300005434 Ga0070709_10165875 Ga0070709_101658753 249
458 3300005436 Ga0070713_100186323 Ga0070713_1001863232 249
459 3300005441 Ga0070700_100027973 Ga0070700_1000279733 249
460 3300005455 Ga0070663_100078749 Ga0070663_1000787492 249
461 3300005458 Ga0070681_10008431 Ga0070681_100084318 249
462 3300005458 Ga0070681_10010987 Ga0070681_100109873 249
463 3300005458 Ga0070681_10033898 Ga0070681_100338986 249
464 3300005466 Ga0070685_10151669 Ga0070685_101516692 249
465 3300005530 Ga0070679_100038601 Ga0070679_1000386015 249
466 3300005530 Ga0070679_100211728 Ga0070679_1002117283 249
467 3300005535 Ga0070684_100032314 Ga0070684_1000323143 249
468 3300005548 Ga0070665_100006899 Ga0070665_1000068994 249
469 3300005548 Ga0070665_100013131 Ga0070665_1000131317 249
470 3300005563 Ga0068855_100020245 Ga0068855_1000202458 249
471 3300005564 Ga0070664_100005240 Ga0070664_1000052404 249
472 3300005614 Ga0068856_100349527 Ga0068856_1003495272 249
473 3300005616 Ga0068852_100061847 Ga0068852_1000618472 249
474 3300005616 Ga0068852_100871289 Ga0068852_1008712891 249
475 3300005617 Ga0068859_100000220 Ga0068859_10000022015 249
476 3300005617 Ga0068859_100011239 Ga0068859_1000112399 249
477 3300005617 Ga0068859_100077159 Ga0068859_1000771592 249
478 3300005617 Ga0068859_100718589 Ga0068859_1007185892 249
479 3300005719 Ga0068861_100149688 Ga0068861_1001496883 249
480 3300005834 Ga0068851_10234285 Ga0068851_102342852 249
481 3300005841 Ga0068863_100003136 Ga0068863_1000031364 249
482 3300005841 Ga0068863_100013962 Ga0068863_1000139623 249
483 3300005842 Ga0068858_100005686 Ga0068858_1000056868 249
484 3300005842 Ga0068858_100007166 Ga0068858_10000716610 249
485 3300005842 Ga0068858_100014034 Ga0068858_1000140347 249
486 3300005843 Ga0068860_100000355 Ga0068860_10000035510 249
487 3300005843 Ga0068860_100013566 Ga0068860_1000135664 249
488 3300005843 Ga0068860_100014361 Ga0068860_1000143614 249
489 3300005844 Ga0068862_100022607 Ga0068862_1000226074 249
490 3300005937 Ga0081455_10005137 Ga0081455_1000513710 249
491 3300006237 Ga0097621_100065622 Ga0097621_1000656224 249
492 3300006237 Ga0097621_100263335 Ga0097621_1002633352 249
493 3300006358 Ga0068871_100043589 Ga0068871_1000435894 249
494 3300006358 Ga0068871_100129192 Ga0068871_1001291921 249
495 3300006358 Ga0068871_100622714 Ga0068871_1006227141 249
496 3300006881 Ga0068865_100008995 Ga0068865_1000089954 249
497 3300006881 Ga0068865_100174371 Ga0068865_1001743713 249
498 3300006931 Ga0097620_100000220 Ga0097620_10000022015 249
499 3300006931 Ga0097620_100011236 Ga0097620_1000112369 249
500 3300006931 Ga0097620_100077162 Ga0097620_1000771624 249
501 3300007788 Ga0099795_10001301 Ga0099795_100013015 249
502 3300009092 Ga0105250_10009909 Ga0105250_100099091 249
503 3300009093 Ga0105240_10056162 Ga0105240_100561623 249
504 3300009093 Ga0105240_10082894 Ga0105240_100828944 249
505 3300009093 Ga0105240_10084190 Ga0105240_100841903 249
506 3300009093 Ga0105240_10108645 Ga0105240_101086453 249
507 3300009093 Ga0105240_10277964 Ga0105240_102779642 249
508 3300009093 Ga0105240_10316137 Ga0105240_103161371 249
509 3300009093 Ga0105240_10355899 Ga0105240_103558991 249
510 3300009098 Ga0105245_10027227 Ga0105245_100272274 249
511 3300009101 Ga0105247_10002339 Ga0105247_100023395 249
512 3300009101 Ga0105247_10008194 Ga0105247_100081945 249
513 3300009101 Ga0105247_10016138 Ga0105247_100161382 249
514 3300009101 Ga0105247_10027899 Ga0105247_100278993 249
515 3300009174 Ga0105241_10047825 Ga0105241_100478252 249
516 3300009174 Ga0105241_10226791 Ga0105241_102267911 249
517 3300009176 Ga0105242_10055164 Ga0105242_100551643 249
518 3300009177 Ga0105248_10196693 Ga0105248_101966931 249
519 3300009177 Ga0105248_10215943 Ga0105248_102159432 249
520 3300009177 Ga0105248_10486949 Ga0105248_104869492 249
521 3300009545 Ga0105237_10102406 Ga0105237_101024062 249
522 3300009545 Ga0105237_10135423 Ga0105237_101354232 249
523 3300009545 Ga0105237_10374358 Ga0105237_103743582 249
524 3300009545 Ga0105237_10473878 Ga0105237_104738781 249
525 3300009551 Ga0105238_10117936 Ga0105238_101179362 249
526 3300009551 Ga0105238_10858080 Ga0105238_108580801 249
527 3300009553 Ga0105249_10012724 Ga0105249_100127247 249
528 3300010159 Ga0099796_10009844 Ga0099796_100098441 249
529 3300010159 Ga0099796_10043866 Ga0099796_100438662 249
530 3300011119 Ga0105246_10300188 Ga0105246_103001882 249
531 3300013104 Ga0157370_10119899 Ga0157370_101198992 249
532 3300013105 Ga0157369_10036222 Ga0157369_100362223 249
533 3300013296 Ga0157374_10023611 Ga0157374_100236113 249
534 3300013296 Ga0157374_10159841 Ga0157374_101598412 249
535 3300013297 Ga0157378_10142981 Ga0157378_101429812 249
536 3300013306 Ga0163162_10114585 Ga0163162_101145854 249
537 3300013306 Ga0163162_10142186 Ga0163162_101421862 249
538 3300013306 Ga0163162_10143304 Ga0163162_101433042 249
539 3300013308 Ga0157375_10051051 Ga0157375_100510514 249
540 3300014325 Ga0163163_10012103 Ga0163163_100121031 249
541 3300014325 Ga0163163_10013204 Ga0163163_100132048 249
542 3300014325 Ga0163163_10143759 Ga0163163_101437592 249
543 3300014325 Ga0163163_10188507 Ga0163163_101885072 249
544 3300014968 Ga0157379_10000614 Ga0157379_1000061425 249
545 3300014968 Ga0157379_10001978 Ga0157379_100019786 249
546 3300014968 Ga0157379_10164288 Ga0157379_101642883 249
547 3300014968 Ga0157379_10202042 Ga0157379_102020421 249
548 3300014969 Ga0157376_10047633 Ga0157376_100476332 249
549 3300014969 Ga0157376_10196424 Ga0157376_101964241 249
550 3300021441 Ga0213871_10010517 Ga0213871_100105172 249
551 3300024227 Ga0228598_1004895 Ga0228598_10048953 249
552 3300025900 Ga0207710_10001544 Ga0207710_100015442 249
553 3300025900 Ga0207710_10079856 Ga0207710_100798561 249
554 3300025903 Ga0207680_10003867 Ga0207680_100038672 249
555 3300025903 Ga0207680_10032325 Ga0207680_100323253 249
556 3300025912 Ga0207707_10004284 Ga0207707_100042842 249
557 3300025912 Ga0207707_10280448 Ga0207707_102804482 249
558 3300025912 Ga0207707_10337567 Ga0207707_103375672 249
559 3300025913 Ga0207695_10026166 Ga0207695_100261666 249
560 3300025913 Ga0207695_10067889 Ga0207695_100678891 249
561 3300025913 Ga0207695_10078068 Ga0207695_100780682 249
562 3300025915 Ga0207693_10272655 Ga0207693_102726552 249
563 3300025917 Ga0207660_10007266 Ga0207660_100072664 249
564 3300025917 Ga0207660_10011615 Ga0207660_100116153 249
565 3300025921 Ga0207652_10179202 Ga0207652_101792021 249
566 3300025921 Ga0207652_10190156 Ga0207652_101901562 249
567 3300025921 Ga0207652_10201791 Ga0207652_102017912 249
568 3300025924 Ga0207694_10462005 Ga0207694_104620051 249
569 3300025926 Ga0207659_10276815 Ga0207659_102768152 249
570 3300025927 Ga0207687_10059344 Ga0207687_100593443 249
571 3300025928 Ga0207700_10080399 Ga0207700_100803992 249
572 3300025931 Ga0207644_10010652 Ga0207644_100106522 249
573 3300025938 Ga0207704_10082404 Ga0207704_100824044 249
574 3300025940 Ga0207691_10049421 Ga0207691_100494214 249
575 3300025941 Ga0207711_10001501 Ga0207711_1000150117 249
576 3300025941 Ga0207711_10093866 Ga0207711_100938662 249
577 3300025941 Ga0207711_10152652 Ga0207711_101526522 249
578 3300025944 Ga0207661_10052742 Ga0207661_100527422 249
579 3300025949 Ga0207667_10507253 Ga0207667_105072531 249
580 3300025961 Ga0207712_10311876 Ga0207712_103118761 249
581 3300025986 Ga0207658_10000046 Ga0207658_1000004680 249
582 3300025986 Ga0207658_10077140 Ga0207658_100771401 249
583 3300026023 Ga0207677_10027953 Ga0207677_100279533 249
584 3300026035 Ga0207703_10003271 Ga0207703_100032716 249
585 3300026035 Ga0207703_10006155 Ga0207703_100061557 249
586 3300026035 Ga0207703_10013429 Ga0207703_100134295 249
587 3300026088 Ga0207641_10001484 Ga0207641_100014847 249
588 3300026088 Ga0207641_10030438 Ga0207641_100304382 249
589 3300026088 Ga0207641_10145512 Ga0207641_101455122 249
590 3300026089 Ga0207648_10192047 Ga0207648_101920472 249
591 3300026095 Ga0207676_10056652 Ga0207676_100566522 249
592 3300026118 Ga0207675_100003505 Ga0207675_1000035054 249
593 3300026142 Ga0207698_10385946 Ga0207698_103859461 249
594 3300026142 Ga0207698_10542157 Ga0207698_105421571 249
595 3300028379 Ga0268266_10004092 Ga0268266_100040926 249
596 3300028379 Ga0268266_10017688 Ga0268266_100176884 249
597 3300028379 Ga0268266_10039925 Ga0268266_100399253 249
598 3300028380 Ga0268265_10013615 Ga0268265_100136153 249
599 3300028381 Ga0268264_10000085 Ga0268264_1000008555 249
600 3300028381 Ga0268264_10011987 Ga0268264_100119875 249
601 3300028381 Ga0268264_10203400 Ga0268264_102034003 249
602 3300028563 Ga0265319_1047734 Ga0265319_10477342 249
603 3300028573 Ga0265334_10001271 Ga0265334_1000127111 249
604 3300028577 Ga0265318_10001358 Ga0265318_100013586 249
605 3300028577 Ga0265318_10098901 Ga0265318_100989011 249
606 3300028800 Ga0265338_10007770 Ga0265338_100077704 249
607 3300028800 Ga0265338_10010887 Ga0265338_100108874 249
608 3300030521 Ga0307511_10001897 Ga0307511_1000189722 249
609 3300030521 Ga0307511_10118006 Ga0307511_101180061 249
610 3300030878 Ga0265770_1000030 Ga0265770_10000302 249
611 3300030878 Ga0265770_1032851 Ga0265770_10328511 249
612 3300031090 Ga0265760_10004641 Ga0265760_100046413 249
613 3300031235 Ga0265330_10052615 Ga0265330_100526151 249
614 3300031238 Ga0265332_10001772 Ga0265332_100017723 249
615 3300031240 Ga0265320_10017891 Ga0265320_100178914 249
616 3300031241 Ga0265325_10001428 Ga0265325_1000142813 249
617 3300031242 Ga0265329_10001256 Ga0265329_1000125610 249
618 3300031247 Ga0265340_10010370 Ga0265340_100103703 249
619 3300031249 Ga0265339_10009587 Ga0265339_100095873 249
620 3300031250 Ga0265331_10019248 Ga0265331_100192484 249
621 3300031344 Ga0265316_10028963 Ga0265316_100289632 249
622 3300031507 Ga0307509_10000008 Ga0307509_10000008203 249
623 3300031507 Ga0307509_10308512 Ga0307509_103085122 249
624 3300031595 Ga0265313_10002857 Ga0265313_100028576 249
625 3300031711 Ga0265314_10009630 Ga0265314_100096304 249
626 3300031712 Ga0265342_10007273 Ga0265342_1000727310 249
627 3300031903 Ga0307407_10190079 Ga0307407_101900792 249
628 3300031995 Ga0307409_100032841 Ga0307409_1000328414 249
629 3300031995 Ga0307409_100806303 Ga0307409_1008063031 249
630 3300032002 Ga0307416_100120523 Ga0307416_1001205233 249
631 3300035089 Ga0373944_0057092 Ga0373944_0057092_51_803 249
632 3300035111 Ga0373923_0014921 Ga0373923_0014921_543_1292 249
633 3300035113 Ga0373936_0044077 Ga0373936_0044077_838_1587 249
634 3300035113 Ga0373936_0046776 Ga0373936_0046776_767_1516 249
635 3300035398 Ga0316574_0010869 Ga0316574_0010869_3166_3918 249
636 3300035398 Ga0316574_0031954 Ga0316574_0031954_1456_2211 249
637 3300037466 Ga0395898_0006245 Ga0395898_0006245_796_1578 249
638 3300037466 Ga0395898_0042232 Ga0395898_0042232_183_932 249
639 3300039437 Ga0436365_0033536 Ga0436365_0033536_1200_1949 249
640 3300039438 Ga0436360_1079411 Ga0436360_1079411_8025_8777 249
641 3300039447 Ga0436361_1075840 Ga0436361_1075840_261_1013 249
642 3300039453 Ga0436362_0261338 Ga0436362_0261338_133_891 249
643 3300041460 Ga0451802_0139520 Ga0451802_0139520_1352_2107 249
644 3300041486 Ga0451807_0214414 Ga0451807_0214414_1383_2138 249
645 3300041494 Ga0451837_0547725 Ga0451837_0547725_209_964 249
646 3300041512 Ga0451853_2107667 Ga0451853_2107667_85_840 249
647 3300045049 Ga0466959_0084672 Ga0466959_0084672_1331_2080 249
648 3300045049 Ga0466959_0090345 Ga0466959_0090345_1202_1951 249
649 3300046471 Ga0495650_0068658 Ga0495650_0068658_451_1203 249
650 3300046472 Ga0495580_0060379 Ga0495580_0060379_52_801 249
651 3300046506 Ga0495583_0015410 Ga0495583_0015410_489_1238 249
652 3300046507 Ga0495606_0037893 Ga0495606_0037893_1106_1855 249
653 3300046507 Ga0495606_0124906 Ga0495606_0124906_218_979 249
654 3300046507 Ga0495606_0173131 Ga0495606_0173131_80_838 249
655 3300046513 Ga0495616_0003562 Ga0495616_0003562_6486_7241 249
656 3300046519 Ga0495632_0045293 Ga0495632_0045293_767_1516 249
657 3300046519 Ga0495632_0139915 Ga0495632_0139915_194_949 249
658 3300046543 Ga0495645_0044018 Ga0495645_0044018_40_789 249
659 3300046679 Ga0495623_0119439 Ga0495623_0119439_441_1190 249
660 3300046694 Ga0495649_0071403 Ga0495649_0071403_493_1242 249
661 3300047317 Ga0495604_0074559 Ga0495604_0074559_1681_2430 249
662 3300047444 Ga0495675_0318708 Ga0495675_0318708_133_888 249
663 3300048088 Ga0495602_0018947 Ga0495602_0018947_5676_6425 249
664 3300048905 Ga0496102_0002132 Ga0496102_0002132_10820_11569 249
665 3300048905 Ga0496102_0007331 Ga0496102_0007331_5020_5769 249
666 3300048905 Ga0496102_0019281 Ga0496102_0019281_4535_5284 249
667 3300048905 Ga0496102_0351084 Ga0496102_0351084_444_1199 249
668 3300048906 Ga0496103_0028633 Ga0496103_0028633_213_962 249
669 3300048907 Ga0496104_0033718 Ga0496104_0033718_2801_3556 249
670 3300048908 Ga0496105_0001265 Ga0496105_0001265_371_1126 249
671 3300048911 Ga0496108_0003024 Ga0496108_0003024_225_980 249
672 3300048912 Ga0496109_0133376 Ga0496109_0133376_283_1038 249
673 3300048913 Ga0496110_0011165 Ga0496110_0011165_6362_7117 249
674 3300048915 Ga0496112_0237277 Ga0496112_0237277_750_1499 249
675 3300048918 Ga0496115_0188594 Ga0496115_0188594_846_1595 249
676 3300048919 Ga0496116_0030355 Ga0496116_0030355_2840_3589 249
677 3300048920 Ga0496117_0000251 Ga0496117_0000251_37050_37799 249
678 3300048920 Ga0496117_0058137 Ga0496117_0058137_808_1557 249
679 3300048921 Ga0496118_0000026 Ga0496118_0000026_369845_370594 249
680 3300048921 Ga0496118_0043701 Ga0496118_0043701_2156_2905 249
681 3300048921 Ga0496118_0119690 Ga0496118_0119690_206_955 249
682 3300048922 Ga0496119_0000965 Ga0496119_0000965_25937_26686 249
683 3300048922 Ga0496119_0165542 Ga0496119_0165542_199_948 249
684 3300048923 Ga0496120_0000025 Ga0496120_0000025_5784_6533 249
685 3300048923 Ga0496120_0033037 Ga0496120_0033037_1688_2437 249
686 3300048924 Ga0496121_0002537 Ga0496121_0002537_13721_14470 249
687 3300048927 Ga0496124_0173387 Ga0496124_0173387_251_1000 249
688 3300048928 Ga0496125_0002047 Ga0496125_0002047_15083_15832 249
689 3300048928 Ga0496125_0007828 Ga0496125_0007828_2195_2944 249
690 3300048928 Ga0496125_0049803 Ga0496125_0049803_2700_3449 249
691 3300048929 Ga0496126_0001746 Ga0496126_0001746_14323_15072 249
692 3300048929 Ga0496126_0227116 Ga0496126_0227116_391_1140 249
693 3300048929 Ga0496126_0320581 Ga0496126_0320581_72_821 249
694 3300049590 Ga0501074_0343405 Ga0501074_0343405_34_789 249
695 3300053091 Ga0500647_0188966 Ga0500647_0188966_14_763 249
696 3300053092 Ga0500583_0055940 Ga0500583_0055940_943_1692 249
697 3300053092 Ga0500583_0116461 Ga0500583_0116461_308_1057 249
698 3300053096 Ga0500641_0116737 Ga0500641_0116737_116_877 249
699 3300053104 Ga0500556_0001203 Ga0500556_0001203_5251_6000 249
700 3300053104 Ga0500556_0035434 Ga0500556_0035434_256_1017 249
701 3300053115 Ga0500591_041053 Ga0500591_041053_1220_1969 249
702 3300053178 Ga0500637_0340543 Ga0500637_0340543_29_778 249
703 3300005328 Ga0070676_10070031 Ga0070676_100700313 250
704 3300005330 Ga0070690_100004513 Ga0070690_1000045135 250
705 3300005333 Ga0070677_10136475 Ga0070677_101364751 250
706 3300005334 Ga0068869_100075759 Ga0068869_1000757593 250
707 3300005334 Ga0068869_100077983 Ga0068869_1000779834 250
708 3300005337 Ga0070682_100025164 Ga0070682_1000251642 250
709 3300005337 Ga0070682_100096994 Ga0070682_1000969944 250
710 3300005337 Ga0070682_100230058 Ga0070682_1002300581 250
711 3300005340 Ga0070689_100040184 Ga0070689_1000401842 250
712 3300005340 Ga0070689_100254524 Ga0070689_1002545242 250
713 3300005341 Ga0070691_10060331 Ga0070691_100603311 250
714 3300005347 Ga0070668_100135714 Ga0070668_1001357142 250
715 3300005353 Ga0070669_100102022 Ga0070669_1001020223 250
716 3300005354 Ga0070675_100010064 Ga0070675_1000100645 250
717 3300005354 Ga0070675_100057626 Ga0070675_1000576264 250
718 3300005354 Ga0070675_100089294 Ga0070675_1000892942 250
719 3300005356 Ga0070674_100083269 Ga0070674_1000832693 250
720 3300005364 Ga0070673_100021022 Ga0070673_1000210223 250
721 3300005365 Ga0070688_100097922 Ga0070688_1000979222 250
722 3300005366 Ga0070659_100575380 Ga0070659_1005753801 250
723 3300005367 Ga0070667_100304426 Ga0070667_1003044261 250
724 3300005439 Ga0070711_100173391 Ga0070711_1001733912 250
725 3300005440 Ga0070705_100015579 Ga0070705_1000155794 250
726 3300005441 Ga0070700_100106602 Ga0070700_1001066023 250
727 3300005441 Ga0070700_100163119 Ga0070700_1001631192 250
728 3300005444 Ga0070694_100022752 Ga0070694_1000227521 250
729 3300005456 Ga0070678_100014668 Ga0070678_1000146683 250
730 3300005457 Ga0070662_100181614 Ga0070662_1001816142 250
731 3300005539 Ga0068853_100374647 Ga0068853_1003746472 250
732 3300005546 Ga0070696_100024017 Ga0070696_1000240172 250
733 3300005548 Ga0070665_100074552 Ga0070665_1000745524 250
734 3300005615 Ga0070702_100102607 Ga0070702_1001026073 250
735 3300005617 Ga0068859_100049603 Ga0068859_1000496035 250
736 3300005617 Ga0068859_100459611 Ga0068859_1004596113 250
737 3300005617 Ga0068859_100706688 Ga0068859_1007066881 250
738 3300005618 Ga0068864_100074541 Ga0068864_1000745414 250
739 3300005719 Ga0068861_100021265 Ga0068861_1000212654 250
740 3300005719 Ga0068861_100112345 Ga0068861_1001123453 250
741 3300005840 Ga0068870_10048595 Ga0068870_100485953 250
742 3300005841 Ga0068863_100113219 Ga0068863_1001132194 250
743 3300005841 Ga0068863_100335849 Ga0068863_1003358491 250
744 3300005844 Ga0068862_100001728 Ga0068862_10000172810 250
745 3300005844 Ga0068862_100264237 Ga0068862_1002642372 250
746 3300005844 Ga0068862_100393786 Ga0068862_1003937862 250
747 3300006358 Ga0068871_100103006 Ga0068871_1001030063 250
748 3300006881 Ga0068865_100049973 Ga0068865_1000499732 250
749 3300006881 Ga0068865_100133524 Ga0068865_1001335243 250
750 3300006881 Ga0068865_100395314 Ga0068865_1003953142 250
751 3300006931 Ga0097620_100049603 Ga0097620_1000496035 250
752 3300006931 Ga0097620_100220559 Ga0097620_1002205593 250
753 3300006931 Ga0097620_100459535 Ga0097620_1004595351 250
754 3300006931 Ga0097620_100706695 Ga0097620_1007066952 250
755 3300009094 Ga0111539_10043719 Ga0111539_100437194 250
756 3300009094 Ga0111539_10590688 Ga0111539_105906881 250
757 3300009176 Ga0105242_10029647 Ga0105242_100296473 250
758 3300009177 Ga0105248_10229085 Ga0105248_102290852 250
759 3300009553 Ga0105249_10219512 Ga0105249_102195123 250
760 3300013297 Ga0157378_10208980 Ga0157378_102089803 250
761 3300013308 Ga0157375_10063559 Ga0157375_100635593 250
762 3300014326 Ga0157380_10134578 Ga0157380_101345784 250
763 3300014326 Ga0157380_10177910 Ga0157380_101779104 250
764 3300014326 Ga0157380_10220861 Ga0157380_102208612 250
765 3300014968 Ga0157379_10024288 Ga0157379_100242884 250
766 3300014969 Ga0157376_10086759 Ga0157376_100867593 250
767 3300017792 Ga0163161_10519239 Ga0163161_105192391 250
768 3300025893 Ga0207682_10002678 Ga0207682_100026783 250
769 3300025893 Ga0207682_10004866 Ga0207682_100048663 250
770 3300025893 Ga0207682_10051169 Ga0207682_100511692 250
771 3300025899 Ga0207642_10289511 Ga0207642_102895111 250
772 3300025907 Ga0207645_10080968 Ga0207645_100809682 250
773 3300025908 Ga0207643_10025559 Ga0207643_100255593 250
774 3300025908 Ga0207643_10027179 Ga0207643_100271793 250
775 3300025916 Ga0207663_10122069 Ga0207663_101220693 250
776 3300025923 Ga0207681_10089643 Ga0207681_100896433 250
777 3300025923 Ga0207681_10089702 Ga0207681_100897023 250
778 3300025925 Ga0207650_10559602 Ga0207650_105596021 250
779 3300025926 Ga0207659_10029326 Ga0207659_100293263 250
780 3300025926 Ga0207659_10030149 Ga0207659_100301494 250
781 3300025933 Ga0207706_10234432 Ga0207706_102344322 250
782 3300025933 Ga0207706_10269980 Ga0207706_102699803 250
783 3300025934 Ga0207686_10019724 Ga0207686_100197243 250
784 3300025936 Ga0207670_10007052 Ga0207670_100070527 250
785 3300025936 Ga0207670_10196288 Ga0207670_101962882 250
786 3300025937 Ga0207669_10056469 Ga0207669_100564693 250
787 3300025938 Ga0207704_10057262 Ga0207704_100572624 250
788 3300025938 Ga0207704_10195778 Ga0207704_101957782 250
789 3300025940 Ga0207691_10006516 Ga0207691_100065168 250
790 3300025940 Ga0207691_10020864 Ga0207691_100208644 250
791 3300025940 Ga0207691_10032746 Ga0207691_100327463 250
792 3300025942 Ga0207689_10031231 Ga0207689_100312315 250
793 3300025942 Ga0207689_10123272 Ga0207689_101232723 250
794 3300025942 Ga0207689_10222317 Ga0207689_102223172 250
795 3300025942 Ga0207689_10315618 Ga0207689_103156182 250
796 3300025986 Ga0207658_10070732 Ga0207658_100707322 250
797 3300026023 Ga0207677_10223506 Ga0207677_102235062 250
798 3300026035 Ga0207703_10390127 Ga0207703_103901271 250
799 3300026067 Ga0207678_10103107 Ga0207678_101031073 250
800 3300026075 Ga0207708_10074498 Ga0207708_100744983 250
801 3300026075 Ga0207708_10196791 Ga0207708_101967913 250
802 3300026075 Ga0207708_10251868 Ga0207708_102518681 250
803 3300026089 Ga0207648_10063248 Ga0207648_100632481 250
804 3300026095 Ga0207676_10055024 Ga0207676_100550242 250
805 3300026095 Ga0207676_10634145 Ga0207676_106341451 250
806 3300026116 Ga0207674_10541492 Ga0207674_105414921 250
807 3300026118 Ga0207675_100006146 Ga0207675_1000061464 250
808 3300026118 Ga0207675_100022988 Ga0207675_1000229882 250
809 3300026118 Ga0207675_100565425 Ga0207675_1005654251 250
810 3300026121 Ga0207683_10024101 Ga0207683_100241013 250
811 3300026121 Ga0207683_10069217 Ga0207683_100692172 250
812 3300027907 Ga0207428_10076951 Ga0207428_100769514 250
813 3300028379 Ga0268266_10298350 Ga0268266_102983503 250
814 3300028379 Ga0268266_10605341 Ga0268266_106053412 250
815 3300028380 Ga0268265_10033879 Ga0268265_100338794 250
816 3300028380 Ga0268265_10063625 Ga0268265_100636253 250
817 3300028380 Ga0268265_10066738 Ga0268265_100667384 250
818 3300028381 Ga0268264_10063782 Ga0268264_100637824 250
819 3300028381 Ga0268264_10123708 Ga0268264_101237083 250
820 3300031456 Ga0307513_10025018 Ga0307513_100250181 250
821 3300031456 Ga0307513_10026003 Ga0307513_100260033 250
822 3300031507 Ga0307509_10117099 Ga0307509_101170994 250
823 3300031548 Ga0307408_100146368 Ga0307408_1001463682 250
824 3300031731 Ga0307405_10053416 Ga0307405_100534164 250
825 3300031824 Ga0307413_10001102 Ga0307413_100011028 250
826 3300031824 Ga0307413_10009664 Ga0307413_100096643 250
827 3300031852 Ga0307410_10033962 Ga0307410_100339621 250
828 3300031901 Ga0307406_10098219 Ga0307406_100982193 250
829 3300031903 Ga0307407_10007516 Ga0307407_100075163 250
830 3300031903 Ga0307407_10064159 Ga0307407_100641594 250
831 3300031995 Ga0307409_100051165 Ga0307409_1000511652 250
832 3300031995 Ga0307409_100100252 Ga0307409_1001002523 250
833 3300032005 Ga0307411_10000178 Ga0307411_100001787 250
834 3300032005 Ga0307411_10003205 Ga0307411_100032054 250
835 3300032126 Ga0307415_100093127 Ga0307415_1000931273 250
836 3300032126 Ga0307415_100394660 Ga0307415_1003946602 250
837 3300035692 Ga0373935_0206521 Ga0373935_0206521_264_1022 250
838 3300039437 Ga0436365_1504415 Ga0436365_1504415_1432_2184 250
839 3300039450 Ga0436363_1431824 Ga0436363_1431824_5746_6498 250
840 3300041456 Ga0451795_1205146 Ga0451795_1205146_888_1646 250
841 3300041460 Ga0451802_0026244 Ga0451802_0026244_1014_1772 250
842 3300046460 Ga0495638_0007170 Ga0495638_0007170_5680_6438 250
843 3300046460 Ga0495638_0028700 Ga0495638_0028700_130_888 250
844 3300046492 Ga0495585_0056112 Ga0495585_0056112_1354_2112 250
845 3300046515 Ga0495620_0037598 Ga0495620_0037598_417_1175 250
846 3300046519 Ga0495632_0143706 Ga0495632_0143706_235_993 250
847 3300046616 Ga0495668_0039100 Ga0495668_0039100_115_942 250
848 3300046660 Ga0495625_0008480 Ga0495625_0008480_6107_6865 250
849 3300046660 Ga0495625_0195111 Ga0495625_0195111_451_1209 250
850 3300046694 Ga0495649_0007172 Ga0495649_0007172_307_1065 250
851 3300046794 Ga0495589_0112642 Ga0495589_0112642_129_887 250
852 3300048907 Ga0496104_0420654 Ga0496104_0420654_270_1028 250
853 3300049587 Ga0501071_0040467 Ga0501071_0040467_829_1587 250
854 3300049589 Ga0501073_0006560 Ga0501073_0006560_77_835 250
855 3300049590 Ga0501074_0002065 Ga0501074_0002065_4756_5514 250
856 3300050511 nmdc:mga08y16_35820_c1 nmdc:mga08y16_35820_c1_1788_2546 250
857 3300053096 Ga0500641_0018669 Ga0500641_0018669_1577_2338 250
858 3300049572 Ga0501036_0507558 Ga0501036_0507558_141_905 251
859 3300049575 Ga0501039_0205764 Ga0501039_0205764_318_1082 251
860 3300049576 Ga0501040_0171642 Ga0501040_0171642_662_1426 251
861 3300049577 Ga0501041_0014883 Ga0501041_0014883_1038_1802 251
862 3300049578 Ga0501042_0038156 Ga0501042_0038156_332_1096 251
863 3300049579 Ga0501043_0449519 Ga0501043_0449519_90_854 251
864 3300049580 Ga0501046_0106492 Ga0501046_0106492_1250_2014 251
865 3300049590 Ga0501074_0184290 Ga0501074_0184290_130_894 251
866 3300049591 Ga0501075_0024495 Ga0501075_0024495_3370_4134 251
867 3300049592 Ga0501076_0025313 Ga0501076_0025313_3094_3858 251
868 3300049742 Ga0501080_0700140 Ga0501080_0700140_95_859 251
869 3300049744 Ga0501083_0302719 Ga0501083_0302719_228_992 251
870 3300054114 Ga0501084_0021657 Ga0501084_0021657_2265_3029 251
871 3300060353 Ga0501082_0147505 Ga0501082_0147505_499_1263 251
872 3300060353 Ga0501082_0156122 Ga0501082_0156122_916_1680 251
873 3300061734 Ga0530510_0043536 Ga0530510_0043536_2278_3042 251
874 3300005295 Ga0065707_10087670 Ga0065707_100876701 252
875 3300005471 Ga0070698_100596379 Ga0070698_1005963792 252
876 3300005719 Ga0068861_100001278 Ga0068861_1000012783 252
877 3300009094 Ga0111539_10213707 Ga0111539_102137072 252
878 3300014326 Ga0157380_10002098 Ga0157380_100020985 252
879 3300026118 Ga0207675_100131684 Ga0207675_1001316843 252
880 3300027907 Ga0207428_10033094 Ga0207428_100330942 252
881 3300031731 Ga0307405_10237242 Ga0307405_102372422 252
882 3300032002 Ga0307416_100286755 Ga0307416_1002867552 252
883 3300042876 Ga0451577_0016049 Ga0451577_0016049_1518_2276 252
884 3300045051 Ga0451576_0120985 Ga0451576_0120985_1306_2064 252
885 3300046460 Ga0495638_0014122 Ga0495638_0014122_2990_3751 252
886 3300046660 Ga0495625_0170265 Ga0495625_0170265_645_1403 252
887 3300048924 Ga0496121_0208310 Ga0496121_0208310_275_1036 252
888 3300050511 nmdc:mga08y16_2729_c1 nmdc:mga08y16_2729_c1_3144_3902 252
889 3300031665 Ga0316575_10013355 Ga0316575_100133553 253
890 3300031665 Ga0316575_10158891 Ga0316575_101588912 253
891 3300031727 Ga0316576_10002294 Ga0316576_100022944 253
892 3300031733 Ga0316577_10152111 Ga0316577_101521112 253
893 3300035113 Ga0373936_0109603 Ga0373936_0109603_152_916 253
894 3300035398 Ga0316574_0233284 Ga0316574_0233284_179_940 253
895 3300036712 Ga0316584_0005014 Ga0316584_0005014_4406_5167 253
896 3300039062 Ga0400483_022796 Ga0400483_022796_137_904 253
897 3300046535 Ga0495586_0060407 Ga0495586_0060407_883_1647 253
898 3300046557 Ga0495622_0188498 Ga0495622_0188498_49_813 253
899 3300046683 Ga0495658_0121921 Ga0495658_0121921_697_1461 253
900 3300053092 Ga0500583_0115452 Ga0500583_0115452_56_820 253
901 3300053178 Ga0500637_0011591 Ga0500637_0011591_39_803 253
902 3300041486 Ga0451807_0614660 Ga0451807_0614660_2092_2862 254
903 3300049569 Ga0501032_0077625 Ga0501032_0077625_826_1596 254
904 3300049572 Ga0501036_0003359 Ga0501036_0003359_2284_3054 254
905 3300049574 Ga0501038_0002190 Ga0501038_0002190_2181_2951 254
906 3300049574 Ga0501038_0151767 Ga0501038_0151767_989_1759 254
907 3300049575 Ga0501039_0003734 Ga0501039_0003734_6388_7158 254
908 3300049576 Ga0501040_0013141 Ga0501040_0013141_2519_3289 254
909 3300049576 Ga0501040_0069385 Ga0501040_0069385_1540_2310 254
910 3300049577 Ga0501041_0001989 Ga0501041_0001989_8804_9574 254
911 3300049578 Ga0501042_0011337 Ga0501042_0011337_2880_3650 254
912 3300049578 Ga0501042_0037631 Ga0501042_0037631_899_1669 254
913 3300049579 Ga0501043_0054629 Ga0501043_0054629_1293_2063 254
914 3300049580 Ga0501046_0006982 Ga0501046_0006982_5422_6192 254
915 3300049580 Ga0501046_0015127 Ga0501046_0015127_2993_3763 254
916 3300049582 Ga0501048_0015227 Ga0501048_0015227_1423_2193 254
917 3300049582 Ga0501048_0074718 Ga0501048_0074718_573_1343 254
918 3300049584 Ga0501068_0030970 Ga0501068_0030970_110_880 254
919 3300049585 Ga0501069_0347829 Ga0501069_0347829_41_811 254
920 3300049587 Ga0501071_0000326 Ga0501071_0000326_4300_5070 254
921 3300049587 Ga0501071_0008282 Ga0501071_0008282_2499_3269 254
922 3300049588 Ga0501072_0024767 Ga0501072_0024767_648_1418 254
923 3300049588 Ga0501072_0030671 Ga0501072_0030671_212_982 254
924 3300049589 Ga0501073_0217671 Ga0501073_0217671_253_1023 254
925 3300049590 Ga0501074_0041862 Ga0501074_0041862_1760_2530 254
926 3300049591 Ga0501075_0000736 Ga0501075_0000736_14306_15076 254
927 3300049591 Ga0501075_0180301 Ga0501075_0180301_534_1304 254
928 3300049592 Ga0501076_0003626 Ga0501076_0003626_8796_9566 254
929 3300049593 Ga0501077_0005531 Ga0501077_0005531_2402_3172 254
930 3300049593 Ga0501077_0044263 Ga0501077_0044263_1260_2030 254
931 3300049741 Ga0501079_0016308 Ga0501079_0016308_922_1692 254
932 3300049742 Ga0501080_0005900 Ga0501080_0005900_942_1712 254
933 3300049742 Ga0501080_0030776 Ga0501080_0030776_3335_4105 254
934 3300049743 Ga0501081_0000724 Ga0501081_0000724_4242_5012 254
935 3300049743 Ga0501081_0107479 Ga0501081_0107479_1017_1787 254
936 3300049744 Ga0501083_0079258 Ga0501083_0079258_557_1327 254
937 3300049822 Ga0501035_0019486 Ga0501035_0019486_3089_3859 254
938 3300049824 Ga0501045_0005410 Ga0501045_0005410_4273_5043 254
939 3300049824 Ga0501045_0233452 Ga0501045_0233452_225_995 254
940 3300054114 Ga0501084_0030134 Ga0501084_0030134_3441_4211 254
941 3300054114 Ga0501084_0117273 Ga0501084_0117273_1150_1920 254
942 3300060353 Ga0501082_0000377 Ga0501082_0000377_22307_23077 254
943 3300061734 Ga0530510_0014851 Ga0530510_0014851_2544_3314 254
944 3300061734 Ga0530510_0015136 Ga0530510_0015136_2523_3293 254
945 3300014745 Ga0157377_10318961 Ga0157377_103189612 255
946 3300031852 Ga0307410_10398247 Ga0307410_103982471 255
947 3300032002 Ga0307416_100425348 Ga0307416_1004253482 255
948 3300032005 Ga0307411_10306709 Ga0307411_103067092 255
949 3300042876 Ga0451577_0007840 Ga0451577_0007840_3978_4748 255
950 3300042876 Ga0451577_0126020 Ga0451577_0126020_203_973 255
951 3300048927 Ga0496124_0219032 Ga0496124_0219032_613_1383 255
952 3300049580 Ga0501046_0029434 Ga0501046_0029434_2470_3240 255
953 3300049581 Ga0501047_0439739 Ga0501047_0439739_341_1111 255
954 3300049743 Ga0501081_0065319 Ga0501081_0065319_671_1495 255
955 3300053092 Ga0500583_0252765 Ga0500583_0252765_59_826 255
956 3300053139 Ga0500568_0136382 Ga0500568_0136382_43_813 255
957 3300053151 Ga0500604_0097051 Ga0500604_0097051_79_849 255
958 3300053156 Ga0500622_0006363 Ga0500622_0006363_101_871 255
959 3300031456 Ga0307513_10174506 Ga0307513_101745062 257
960 3300035398 Ga0316574_0020327 Ga0316574_0020327_462_1241 257
961 3300036712 Ga0316584_0210279 Ga0316584_0210279_34_813 257
962 3300042876 Ga0451577_0037831 Ga0451577_0037831_1340_2116 257
963 3300044673 Ga0453683_0009257 Ga0453683_0009257_4883_5659 257
964 3300044712 Ga0453684_0640754 Ga0453684_0640754_348_1124 257
965 3300046460 Ga0495638_0049342 Ga0495638_0049342_818_1594 257
966 3300005354 Ga0070675_100109518 Ga0070675_1001095182 258
967 3300005543 Ga0070672_100191999 Ga0070672_1001919993 258
968 3300031665 Ga0316575_10002479 Ga0316575_100024797 258
969 3300031727 Ga0316576_10053203 Ga0316576_100532033 258
970 3300031728 Ga0316578_10010000 Ga0316578_100100005 258
971 3300031852 Ga0307410_10103647 Ga0307410_101036472 258
972 3300031995 Ga0307409_100098746 Ga0307409_1000987463 258
973 3300032005 Ga0307411_10107148 Ga0307411_101071483 258
974 3300032139 Ga0316580_10001817 Ga0316580_100018172 258
975 3300036712 Ga0316584_0011584 Ga0316584_0011584_1387_2178 258
976 3300049572 Ga0501036_0064478 Ga0501036_0064478_386_1165 258
977 3300049575 Ga0501039_0248810 Ga0501039_0248810_217_996 258
978 3300049588 Ga0501072_0055462 Ga0501072_0055462_578_1357 258
979 3300049592 Ga0501076_0025814 Ga0501076_0025814_2797_3576 258
980 2162886007 SwRhRL2b_contig_1816436 SwRhRL2b_0577.00003680 262
981 3300032004 Ga0307414_10162892 Ga0307414_101628922 262
982 3300032005 Ga0307411_10131772 Ga0307411_101317722 262
983 3300032126 Ga0307415_100012994 Ga0307415_1000129943 262
984 3300044712 Ga0453684_0066162 Ga0453684_0066162_3514_4302 262
985 3300045051 Ga0451576_0059422 Ga0451576_0059422_1577_2365 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

59

291

0.99

PF08241

Methyltransf_11

Methyltransferase domain

109

209

0.97

PF13649

Methyltransf_25

Methyltransferase domain

108

205

0.95

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

88

216

0.88

PF08242

Methyltransf_12

Methyltransferase domain

109

207

0.87

PF13489

Methyltransf_23

Methyltransferase domain

84

275

0.85

PF13847

Methyltransf_31

Methyltransferase domain

102

270

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9392 43 262
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8778 43 262
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8599 63 262
4dcm-assembly1.cif.gz_A crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli 0.8409 64 262
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8381 62 179
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9912 43 262 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9823 43 262 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9714 43 262 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9631 68 262 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9549 44 262 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9892 17 262 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9881 14 223 GO:0008425
GO:0009234
GO:0032259
AF-A0A6A5KTX5-F1-model_v4 deleted 0.9868 13 261
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9834 14 223 GO:0008425
GO:0009234
GO:0032259
AF-A0A2V0NZW4-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9782 19 262 GO:0008425
GO:0031314
GO:0032259

Feature Viewer

pLDDT pTM Quality
81.51 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map