F487492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 985 | 373 | 972 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100230058|Ga0070682_1002300581 |
| Length | 292 |
| Sequence | VRPPALTKTPARIVGLCSESKTEKPALSSRVCESVYTRSPVTEQKKNADTDFGYQRVPWNEKQRRVRGVFDSVAGNYDLMNDLMSGGAHRLWKEFTLSLTGLRPGQRALDVAGGTGDLTTGLAKQVGRTGKVILSDINAAMLGEGRDRLLDAGVVGNVSCVLANAEKLPFADAMFDCVTIGFGLRNVTDKPAALADMRRVLKPGGQLLVLEFSQPVIPLLKPLYDLYSFRVLPLIGKLVARDEDSYRYLAESIRMHPDQETLLGMLRDAGLEDCRYHNLSGGIVAVHRGYRY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 3 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 4 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 5 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 6 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 7 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 8 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 9 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 10 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 11 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 12 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 13 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 14 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 15 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 132 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 232 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 249 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 250 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 251 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 265 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 309 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 310 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 362 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 0.71 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.1 |
| Endosphere | 1.62 |
| Nodule | 0 |
| Rhizoplane | 3.96 |
| Rhizosphere | 88.22 |
| Stem | 0 |
| Stem Tuber | 0.61 |
| Unclassified | 5.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1816436 | 2162886007 | Bacteria | 5101 |
| 2 | rootH1_10014283 | 3300003323 | Bacteria | 28556 |
| 3 | rootH1_10028592 | 3300003316 | Bacteria | 2016 |
| 4 | rootH1_10028592 | 3300003323 | Bacteria | 35557 |
| 5 | Ga0065712_10305094 | 3300005290 | Bacteria | 853 |
| 6 | Ga0065715_10135706 | 3300005293 | Bacteria | 1934 |
| 7 | Ga0065707_10087670 | 3300005295 | Bacteria | 4933 |
| 8 | Ga0070676_10070031 | 3300005328 | Bacteria | 2103 |
| 9 | Ga0070690_100001308 | 3300005330 | Bacteria | 12943 |
| 10 | Ga0070690_100004513 | 3300005330 | Bacteria | 7741 |
| 11 | Ga0070670_100024081 | 3300005331 | Bacteria | 5237 |
| 12 | Ga0070670_100133139 | 3300005331 | Bacteria | 2147 |
| 13 | Ga0070670_100153902 | 3300005331 | Bacteria | 1991 |
| 14 | Ga0070677_10136475 | 3300005333 | Bacteria | 1126 |
| 15 | Ga0068869_100023174 | 3300005334 | Bacteria | 4285 |
| 16 | Ga0068869_100051345 | 3300005334 | Bacteria | 2992 |
| 17 | Ga0068869_100075759 | 3300005334 | Bacteria | 2500 |
| 18 | Ga0068869_100077983 | 3300005334 | Bacteria | 2466 |
| 19 | Ga0068869_100379856 | 3300005334 | Bacteria | 1158 |
| 20 | Ga0070666_10011341 | 3300005335 | Bacteria | 5592 |
| 21 | Ga0070666_10231698 | 3300005335 | Bacteria | 1304 |
| 22 | Ga0070680_100028196 | 3300005336 | Bacteria | 4502 |
| 23 | Ga0070680_100054620 | 3300005336 | Bacteria | 3262 |
| 24 | Ga0070680_100090221 | 3300005336 | Bacteria | 2537 |
| 25 | Ga0070680_100164337 | 3300005336 | Bacteria | 1866 |
| 26 | Ga0070682_100025164 | 3300005337 | Bacteria | 3550 |
| 27 | Ga0070682_100096994 | 3300005337 | Bacteria | 1939 |
| 28 | Ga0070682_100114136 | 3300005337 | Bacteria | 1805 |
| 29 | Ga0070682_100230058 | 3300005337 | Bacteria | 1325 |
| 30 | Ga0068868_100012735 | 3300005338 | Bacteria | 6152 |
| 31 | Ga0068868_100013212 | 3300005338 | Bacteria | 6048 |
| 32 | Ga0068868_100086997 | 3300005338 | Bacteria | 2513 |
| 33 | Ga0068868_100129898 | 3300005338 | Bacteria | 2061 |
| 34 | Ga0070689_100005729 | 3300005340 | Bacteria | 8518 |
| 35 | Ga0070689_100040184 | 3300005340 | Bacteria | 3585 |
| 36 | Ga0070689_100254524 | 3300005340 | Bacteria | 1450 |
| 37 | Ga0070691_10060331 | 3300005341 | Bacteria | 1823 |
| 38 | Ga0070691_10254984 | 3300005341 | Bacteria | 942 |
| 39 | Ga0070687_100413822 | 3300005343 | Bacteria | 887 |
| 40 | Ga0070661_100001052 | 3300005344 | Bacteria | 19527 |
| 41 | Ga0070692_10042220 | 3300005345 | Bacteria | 2341 |
| 42 | Ga0070668_100003202 | 3300005347 | Bacteria | 12061 |
| 43 | Ga0070668_100135714 | 3300005347 | Bacteria | 1979 |
| 44 | Ga0070669_100102022 | 3300005353 | Bacteria | 2166 |
| 45 | Ga0070669_100282176 | 3300005353 | Bacteria | 1331 |
| 46 | Ga0070675_100001328 | 3300005354 | Bacteria | 18093 |
| 47 | Ga0070675_100010064 | 3300005354 | Bacteria | 7375 |
| 48 | Ga0070675_100057626 | 3300005354 | Bacteria | 3203 |
| 49 | Ga0070675_100089294 | 3300005354 | Bacteria | 2580 |
| 50 | Ga0070675_100109518 | 3300005354 | Bacteria | 2334 |
| 51 | Ga0070675_100290096 | 3300005354 | Unclassified | 1440 |
| 52 | Ga0070675_100361165 | 3300005354 | Bacteria | 1289 |
| 53 | Ga0070671_100001010 | 3300005355 | Bacteria | 20683 |
| 54 | Ga0070671_100024020 | 3300005355 | Bacteria | 4989 |
| 55 | Ga0070671_100055516 | 3300005355 | Bacteria | 3295 |
| 56 | Ga0070671_100129961 | 3300005355 | Bacteria | 2121 |
| 57 | Ga0070671_100167304 | 3300005355 | Bacteria | 1859 |
| 58 | Ga0070671_100235776 | 3300005355 | Bacteria | 1553 |
| 59 | Ga0070674_100083269 | 3300005356 | Bacteria | 2290 |
| 60 | Ga0070673_100021022 | 3300005364 | Bacteria | 4721 |
| 61 | Ga0070673_100111056 | 3300005364 | Bacteria | 2274 |
| 62 | Ga0070673_100167918 | 3300005364 | Bacteria | 1871 |
| 63 | Ga0070673_100347779 | 3300005364 | Bacteria | 1315 |
| 64 | Ga0070673_100401894 | 3300005364 | Bacteria | 1225 |
| 65 | Ga0070688_100012489 | 3300005365 | Bacteria | 4761 |
| 66 | Ga0070688_100097922 | 3300005365 | Bacteria | 1929 |
| 67 | Ga0070659_100575380 | 3300005366 | Bacteria | 966 |
| 68 | Ga0070667_100000011 | 3300005367 | Bacteria | 269772 |
| 69 | Ga0070667_100027211 | 3300005367 | Bacteria | 4758 |
| 70 | Ga0070667_100035663 | 3300005367 | Bacteria | 4168 |
| 71 | Ga0070667_100304426 | 3300005367 | Bacteria | 1436 |
| 72 | Ga0070703_10045907 | 3300005406 | Bacteria | 1379 |
| 73 | Ga0070709_10037973 | 3300005434 | Bacteria | 2946 |
| 74 | Ga0070709_10165875 | 3300005434 | Bacteria | 1539 |
| 75 | Ga0070714_100004766 | 3300005435 | Bacteria | 10275 |
| 76 | Ga0070713_100000427 | 3300005436 | Bacteria | 26892 |
| 77 | Ga0070713_100006160 | 3300005436 | Bacteria | 8289 |
| 78 | Ga0070713_100186323 | 3300005436 | Bacteria | 1868 |
| 79 | Ga0070713_100257557 | 3300005436 | Bacteria | 1593 |
| 80 | Ga0070710_10048629 | 3300005437 | Bacteria | 2370 |
| 81 | Ga0070711_100173391 | 3300005439 | Bacteria | 1646 |
| 82 | Ga0070705_100015579 | 3300005440 | Bacteria | 3935 |
| 83 | Ga0070705_100022150 | 3300005440 | Bacteria | 3391 |
| 84 | Ga0070700_100009378 | 3300005441 | Bacteria | 5369 |
| 85 | Ga0070700_100027973 | 3300005441 | Bacteria | 3349 |
| 86 | Ga0070700_100056935 | 3300005441 | Bacteria | 2452 |
| 87 | Ga0070700_100106602 | 3300005441 | Bacteria | 1855 |
| 88 | Ga0070700_100163119 | 3300005441 | Bacteria | 1536 |
| 89 | Ga0070694_100022752 | 3300005444 | Bacteria | 4021 |
| 90 | Ga0070663_100078749 | 3300005455 | Bacteria | 2416 |
| 91 | Ga0070663_100172797 | 3300005455 | Bacteria | 1671 |
| 92 | Ga0070678_100014668 | 3300005456 | Bacteria | 4954 |
| 93 | Ga0070678_100045854 | 3300005456 | Bacteria | 3130 |
| 94 | Ga0070678_100376492 | 3300005456 | Bacteria | 1227 |
| 95 | Ga0070662_100010889 | 3300005457 | Bacteria | 5992 |
| 96 | Ga0070662_100181614 | 3300005457 | Bacteria | 1659 |
| 97 | Ga0070681_10001348 | 3300005458 | Bacteria | 21452 |
| 98 | Ga0070681_10002296 | 3300005458 | Bacteria | 17489 |
| 99 | Ga0070681_10008431 | 3300005458 | Bacteria | 10091 |
| 100 | Ga0070681_10010987 | 3300005458 | Bacteria | 8951 |
| 101 | Ga0070681_10023527 | 3300005458 | Bacteria | 6196 |
| 102 | Ga0070681_10033898 | 3300005458 | Bacteria | 5127 |
| 103 | Ga0070681_10150026 | 3300005458 | Bacteria | 2258 |
| 104 | Ga0070681_10189019 | 3300005458 | Bacteria | 1979 |
| 105 | Ga0068867_100053916 | 3300005459 | Bacteria | 2970 |
| 106 | Ga0070685_10151669 | 3300005466 | Bacteria | 1469 |
| 107 | Ga0070698_100596379 | 3300005471 | Bacteria | 1045 |
| 108 | Ga0070679_100004511 | 3300005530 | Bacteria | 12860 |
| 109 | Ga0070679_100033547 | 3300005530 | Bacteria | 5083 |
| 110 | Ga0070679_100038601 | 3300005530 | Bacteria | 4748 |
| 111 | Ga0070679_100211728 | 3300005530 | Bacteria | 1902 |
| 112 | Ga0070684_100000450 | 3300005535 | Bacteria | 28151 |
| 113 | Ga0070684_100032314 | 3300005535 | Bacteria | 4459 |
| 114 | Ga0068853_100167176 | 3300005539 | Bacteria | 1988 |
| 115 | Ga0068853_100235792 | 3300005539 | Bacteria | 1675 |
| 116 | Ga0068853_100340110 | 3300005539 | Bacteria | 1394 |
| 117 | Ga0068853_100374647 | 3300005539 | Bacteria | 1328 |
| 118 | Ga0068853_100552262 | 3300005539 | Bacteria | 1091 |
| 119 | Ga0070672_100191999 | 3300005543 | Bacteria | 1705 |
| 120 | Ga0070686_100001533 | 3300005544 | Bacteria | 12984 |
| 121 | Ga0070696_100024017 | 3300005546 | Bacteria | 4143 |
| 122 | Ga0070696_100160333 | 3300005546 | Bacteria | 1657 |
| 123 | Ga0070693_100120387 | 3300005547 | Bacteria | 1627 |
| 124 | Ga0070693_100358274 | 3300005547 | Bacteria | 1000 |
| 125 | Ga0070665_100006899 | 3300005548 | Bacteria | 11546 |
| 126 | Ga0070665_100013131 | 3300005548 | Bacteria | 8341 |
| 127 | Ga0070665_100014187 | 3300005548 | Bacteria | 8006 |
| 128 | Ga0070665_100074552 | 3300005548 | Bacteria | 3399 |
| 129 | Ga0070665_100091910 | 3300005548 | Bacteria | 3040 |
| 130 | Ga0068855_100010581 | 3300005563 | Bacteria | 11122 |
| 131 | Ga0068855_100018420 | 3300005563 | Bacteria | 8390 |
| 132 | Ga0068855_100020245 | 3300005563 | Bacteria | 7987 |
| 133 | Ga0068855_100493135 | 3300005563 | Bacteria | 1332 |
| 134 | Ga0070664_100004843 | 3300005564 | Bacteria | 10783 |
| 135 | Ga0070664_100005240 | 3300005564 | Bacteria | 10406 |
| 136 | Ga0070664_100729740 | 3300005564 | Bacteria | 924 |
| 137 | Ga0068857_100012480 | 3300005577 | Bacteria | 7400 |
| 138 | Ga0068857_100056428 | 3300005577 | Bacteria | 3485 |
| 139 | Ga0068857_100056677 | 3300005577 | Bacteria | 3478 |
| 140 | Ga0068857_100924288 | 3300005577 | Bacteria | 837 |
| 141 | Ga0068854_100154918 | 3300005578 | Bacteria | 1770 |
| 142 | Ga0068856_100031587 | 3300005614 | Bacteria | 5182 |
| 143 | Ga0068856_100104780 | 3300005614 | Bacteria | 2823 |
| 144 | Ga0068856_100349527 | 3300005614 | Bacteria | 1497 |
| 145 | Ga0068856_100654296 | 3300005614 | Bacteria | 1071 |
| 146 | Ga0070702_100000186 | 3300005615 | Bacteria | 20127 |
| 147 | Ga0070702_100102607 | 3300005615 | Bacteria | 1757 |
| 148 | Ga0068852_100061847 | 3300005616 | Bacteria | 3254 |
| 149 | Ga0068852_100066436 | 3300005616 | Bacteria | 3149 |
| 150 | Ga0068852_100871289 | 3300005616 | Bacteria | 917 |
| 151 | Ga0068859_100000220 | 3300005617 | Bacteria | 56619 |
| 152 | Ga0068859_100006805 | 3300005617 | Bacteria | 11615 |
| 153 | Ga0068859_100011239 | 3300005617 | Bacteria | 9006 |
| 154 | Ga0068859_100049603 | 3300005617 | Bacteria | 4216 |
| 155 | Ga0068859_100077159 | 3300005617 | Bacteria | 3373 |
| 156 | Ga0068859_100459611 | 3300005617 | Bacteria | 1369 |
| 157 | Ga0068859_100706688 | 3300005617 | Bacteria | 1099 |
| 158 | Ga0068859_100718589 | 3300005617 | Bacteria | 1089 |
| 159 | Ga0068864_100000569 | 3300005618 | Bacteria | 31341 |
| 160 | Ga0068864_100074541 | 3300005618 | Bacteria | 2961 |
| 161 | Ga0068866_10005217 | 3300005718 | Bacteria | 5353 |
| 162 | Ga0068866_10019334 | 3300005718 | Bacteria | 3099 |
| 163 | Ga0068861_100001278 | 3300005719 | Bacteria | 15719 |
| 164 | Ga0068861_100008511 | 3300005719 | Bacteria | 7063 |
| 165 | Ga0068861_100021265 | 3300005719 | Bacteria | 4662 |
| 166 | Ga0068861_100112345 | 3300005719 | Bacteria | 2184 |
| 167 | Ga0068861_100149688 | 3300005719 | Bacteria | 1914 |
| 168 | Ga0068861_100324468 | 3300005719 | Bacteria | 1342 |
| 169 | Ga0068861_100626615 | 3300005719 | Bacteria | 990 |
| 170 | Ga0068851_10234285 | 3300005834 | Bacteria | 1036 |
| 171 | Ga0068870_10010262 | 3300005840 | Bacteria | 4295 |
| 172 | Ga0068870_10017903 | 3300005840 | Bacteria | 3411 |
| 173 | Ga0068870_10048595 | 3300005840 | Bacteria | 2235 |
| 174 | Ga0068863_100001625 | 3300005841 | Bacteria | 22204 |
| 175 | Ga0068863_100003136 | 3300005841 | Bacteria | 16324 |
| 176 | Ga0068863_100013962 | 3300005841 | Bacteria | 7742 |
| 177 | Ga0068863_100026511 | 3300005841 | Bacteria | 5527 |
| 178 | Ga0068863_100113219 | 3300005841 | Bacteria | 2584 |
| 179 | Ga0068863_100335849 | 3300005841 | Bacteria | 1469 |
| 180 | Ga0068863_100600869 | 3300005841 | Bacteria | 1089 |
| 181 | Ga0068858_100005686 | 3300005842 | Bacteria | 12185 |
| 182 | Ga0068858_100007166 | 3300005842 | Bacteria | 10817 |
| 183 | Ga0068858_100011034 | 3300005842 | Bacteria | 8540 |
| 184 | Ga0068858_100014034 | 3300005842 | Bacteria | 7558 |
| 185 | Ga0068858_100018633 | 3300005842 | Bacteria | 6499 |
| 186 | Ga0068860_100000355 | 3300005843 | Bacteria | 61547 |
| 187 | Ga0068860_100013566 | 3300005843 | Bacteria | 7988 |
| 188 | Ga0068860_100014361 | 3300005843 | Bacteria | 7763 |
| 189 | Ga0068860_100022938 | 3300005843 | Bacteria | 6036 |
| 190 | Ga0068860_100090774 | 3300005843 | Bacteria | 2910 |
| 191 | Ga0068862_100001728 | 3300005844 | Bacteria | 19748 |
| 192 | Ga0068862_100005736 | 3300005844 | Bacteria | 10363 |
| 193 | Ga0068862_100007875 | 3300005844 | Bacteria | 8815 |
| 194 | Ga0068862_100022607 | 3300005844 | Bacteria | 5260 |
| 195 | Ga0068862_100088203 | 3300005844 | Bacteria | 2699 |
| 196 | Ga0068862_100264237 | 3300005844 | Bacteria | 1572 |
| 197 | Ga0068862_100393786 | 3300005844 | Bacteria | 1294 |
| 198 | Ga0068862_100705542 | 3300005844 | Bacteria | 978 |
| 199 | Ga0081455_10005137 | 3300005937 | Bacteria | 14426 |
| 200 | Ga0081539_10000055 | 3300005985 | Bacteria | 257359 |
| 201 | Ga0070715_10018578 | 3300006163 | Bacteria | 2652 |
| 202 | Ga0070712_100011174 | 3300006175 | Bacteria | 5684 |
| 203 | Ga0070712_100279500 | 3300006175 | Bacteria | 1344 |
| 204 | Ga0097621_100026403 | 3300006237 | Bacteria | 4555 |
| 205 | Ga0097621_100065622 | 3300006237 | Bacteria | 2988 |
| 206 | Ga0097621_100128650 | 3300006237 | Bacteria | 2153 |
| 207 | Ga0097621_100263335 | 3300006237 | Bacteria | 1513 |
| 208 | Ga0068871_100012023 | 3300006358 | Bacteria | 6370 |
| 209 | Ga0068871_100043589 | 3300006358 | Bacteria | 3604 |
| 210 | Ga0068871_100057094 | 3300006358 | Bacteria | 3175 |
| 211 | Ga0068871_100103006 | 3300006358 | Bacteria | 2393 |
| 212 | Ga0068871_100105179 | 3300006358 | Bacteria | 2368 |
| 213 | Ga0068871_100129192 | 3300006358 | Bacteria | 2141 |
| 214 | Ga0068871_100622714 | 3300006358 | Bacteria | 983 |
| 215 | Ga0075428_100005915 | 3300006844 | Bacteria | 13595 |
| 216 | Ga0075428_100006185 | 3300006844 | Bacteria | 13316 |
| 217 | Ga0075430_100002285 | 3300006846 | Bacteria | 15881 |
| 218 | Ga0075430_100134949 | 3300006846 | Bacteria | 2057 |
| 219 | Ga0075431_100000121 | 3300006847 | Bacteria | 50989 |
| 220 | Ga0075431_100099414 | 3300006847 | Bacteria | 3002 |
| 221 | Ga0075433_10003048 | 3300006852 | Bacteria | 12875 |
| 222 | Ga0075433_10323744 | 3300006852 | Bacteria | 1364 |
| 223 | Ga0075434_100000232 | 3300006871 | Bacteria | 38374 |
| 224 | Ga0075434_100187109 | 3300006871 | Bacteria | 2091 |
| 225 | Ga0075429_100002068 | 3300006880 | Bacteria | 16737 |
| 226 | Ga0075429_100008661 | 3300006880 | Bacteria | 8848 |
| 227 | Ga0075429_100102089 | 3300006880 | Bacteria | 2504 |
| 228 | Ga0068865_100008995 | 3300006881 | Bacteria | 6179 |
| 229 | Ga0068865_100049973 | 3300006881 | Bacteria | 2886 |
| 230 | Ga0068865_100105300 | 3300006881 | Bacteria | 2072 |
| 231 | Ga0068865_100133524 | 3300006881 | Bacteria | 1862 |
| 232 | Ga0068865_100174371 | 3300006881 | Bacteria | 1651 |
| 233 | Ga0068865_100395314 | 3300006881 | Bacteria | 1131 |
| 234 | Ga0075436_100067546 | 3300006914 | Bacteria | 2470 |
| 235 | Ga0097620_100000220 | 3300006931 | Bacteria | 56619 |
| 236 | Ga0097620_100006805 | 3300006931 | Bacteria | 11615 |
| 237 | Ga0097620_100011236 | 3300006931 | Bacteria | 9006 |
| 238 | Ga0097620_100049603 | 3300006931 | Bacteria | 4216 |
| 239 | Ga0097620_100077162 | 3300006931 | Bacteria | 3373 |
| 240 | Ga0097620_100220559 | 3300006931 | Bacteria | 1984 |
| 241 | Ga0097620_100459535 | 3300006931 | Bacteria | 1369 |
| 242 | Ga0097620_100706695 | 3300006931 | Bacteria | 1099 |
| 243 | Ga0075435_100106215 | 3300007076 | Bacteria | 2331 |
| 244 | Ga0099795_10001301 | 3300007788 | Bacteria | 5320 |
| 245 | Ga0105250_10009909 | 3300009092 | Bacteria | 3997 |
| 246 | Ga0105250_10041763 | 3300009092 | Bacteria | 1838 |
| 247 | Ga0105240_10003170 | 3300009093 | Bacteria | 25852 |
| 248 | Ga0105240_10046522 | 3300009093 | Bacteria | 5497 |
| 249 | Ga0105240_10056162 | 3300009093 | Bacteria | 4927 |
| 250 | Ga0105240_10082894 | 3300009093 | Bacteria | 3937 |
| 251 | Ga0105240_10084190 | 3300009093 | Bacteria | 3900 |
| 252 | Ga0105240_10108645 | 3300009093 | Bacteria | 3360 |
| 253 | Ga0105240_10235603 | 3300009093 | Bacteria | 2124 |
| 254 | Ga0105240_10277964 | 3300009093 | Bacteria | 1925 |
| 255 | Ga0105240_10316137 | 3300009093 | Bacteria | 1781 |
| 256 | Ga0105240_10355899 | 3300009093 | Bacteria | 1660 |
| 257 | Ga0105240_10433327 | 3300009093 | Bacteria | 1475 |
| 258 | Ga0105240_10464784 | 3300009093 | Bacteria | 1413 |
| 259 | Ga0111539_10000695 | 3300009094 | Bacteria | 43547 |
| 260 | Ga0111539_10008124 | 3300009094 | Bacteria | 13368 |
| 261 | Ga0111539_10021812 | 3300009094 | Bacteria | 7875 |
| 262 | Ga0111539_10043719 | 3300009094 | Bacteria | 5369 |
| 263 | Ga0111539_10105971 | 3300009094 | Bacteria | 3298 |
| 264 | Ga0111539_10213707 | 3300009094 | Bacteria | 2247 |
| 265 | Ga0111539_10590688 | 3300009094 | Bacteria | 1293 |
| 266 | Ga0105245_10011359 | 3300009098 | Bacteria | 7756 |
| 267 | Ga0105245_10027227 | 3300009098 | Bacteria | 5037 |
| 268 | Ga0105247_10002339 | 3300009101 | Bacteria | 12937 |
| 269 | Ga0105247_10008194 | 3300009101 | Bacteria | 6380 |
| 270 | Ga0105247_10016138 | 3300009101 | Bacteria | 4474 |
| 271 | Ga0105247_10027899 | 3300009101 | Bacteria | 3414 |
| 272 | Ga0105247_10364793 | 3300009101 | Bacteria | 1020 |
| 273 | Ga0114129_10000366 | 3300009147 | Bacteria | 52352 |
| 274 | Ga0114129_10006307 | 3300009147 | Bacteria | 16819 |
| 275 | Ga0105243_10055051 | 3300009148 | Bacteria | 3160 |
| 276 | Ga0105241_10016405 | 3300009174 | Bacteria | 5432 |
| 277 | Ga0105241_10047825 | 3300009174 | Bacteria | 3254 |
| 278 | Ga0105241_10226791 | 3300009174 | Bacteria | 1573 |
| 279 | Ga0105242_10000669 | 3300009176 | Bacteria | 26851 |
| 280 | Ga0105242_10029647 | 3300009176 | Bacteria | 4363 |
| 281 | Ga0105242_10055164 | 3300009176 | Bacteria | 3251 |
| 282 | Ga0105248_10012530 | 3300009177 | Bacteria | 9352 |
| 283 | Ga0105248_10099252 | 3300009177 | Bacteria | 3281 |
| 284 | Ga0105248_10196693 | 3300009177 | Bacteria | 2272 |
| 285 | Ga0105248_10215943 | 3300009177 | Bacteria | 2160 |
| 286 | Ga0105248_10229085 | 3300009177 | Bacteria | 2092 |
| 287 | Ga0105248_10486949 | 3300009177 | Bacteria | 1390 |
| 288 | Ga0105237_10004492 | 3300009545 | Bacteria | 16123 |
| 289 | Ga0105237_10075434 | 3300009545 | Bacteria | 3364 |
| 290 | Ga0105237_10102406 | 3300009545 | Bacteria | 2855 |
| 291 | Ga0105237_10135423 | 3300009545 | Bacteria | 2458 |
| 292 | Ga0105237_10374358 | 3300009545 | Bacteria | 1429 |
| 293 | Ga0105237_10438750 | 3300009545 | Bacteria | 1311 |
| 294 | Ga0105237_10473878 | 3300009545 | Bacteria | 1258 |
| 295 | Ga0105238_10010242 | 3300009551 | Bacteria | 9404 |
| 296 | Ga0105238_10018185 | 3300009551 | Bacteria | 7147 |
| 297 | Ga0105238_10117936 | 3300009551 | Bacteria | 2634 |
| 298 | Ga0105238_10351667 | 3300009551 | Bacteria | 1462 |
| 299 | Ga0105238_10858080 | 3300009551 | Bacteria | 925 |
| 300 | Ga0105249_10012724 | 3300009553 | Bacteria | 7416 |
| 301 | Ga0105249_10012849 | 3300009553 | Bacteria | 7389 |
| 302 | Ga0105249_10015074 | 3300009553 | Bacteria | 6839 |
| 303 | Ga0105249_10219512 | 3300009553 | Bacteria | 1870 |
| 304 | Ga0099796_10009844 | 3300010159 | Bacteria | 2604 |
| 305 | Ga0099796_10043866 | 3300010159 | Bacteria | 1525 |
| 306 | Ga0105239_10008633 | 3300010375 | Bacteria | 11550 |
| 307 | Ga0105239_10013474 | 3300010375 | Bacteria | 9081 |
| 308 | Ga0105246_10128221 | 3300011119 | Bacteria | 1891 |
| 309 | Ga0105246_10300188 | 3300011119 | Bacteria | 1296 |
| 310 | Ga0105246_10624837 | 3300011119 | Bacteria | 934 |
| 311 | Ga0157370_10005200 | 3300013104 | Bacteria | 14659 |
| 312 | Ga0157370_10119899 | 3300013104 | Bacteria | 2456 |
| 313 | Ga0157369_10002574 | 3300013105 | Bacteria | 21703 |
| 314 | Ga0157369_10036222 | 3300013105 | Bacteria | 5407 |
| 315 | Ga0157369_10878277 | 3300013105 | Bacteria | 920 |
| 316 | Ga0157374_10023611 | 3300013296 | Bacteria | 5503 |
| 317 | Ga0157374_10043408 | 3300013296 | Bacteria | 4154 |
| 318 | Ga0157374_10159841 | 3300013296 | Bacteria | 2194 |
| 319 | Ga0157378_10009323 | 3300013297 | Bacteria | 8547 |
| 320 | Ga0157378_10142981 | 3300013297 | Bacteria | 2223 |
| 321 | Ga0157378_10208980 | 3300013297 | Bacteria | 1850 |
| 322 | Ga0163162_10078807 | 3300013306 | Bacteria | 3360 |
| 323 | Ga0163162_10114585 | 3300013306 | Bacteria | 2795 |
| 324 | Ga0163162_10142186 | 3300013306 | Bacteria | 2514 |
| 325 | Ga0163162_10143304 | 3300013306 | Bacteria | 2504 |
| 326 | Ga0163162_10171019 | 3300013306 | Bacteria | 2297 |
| 327 | Ga0157372_10102320 | 3300013307 | Bacteria | 3272 |
| 328 | Ga0157375_10051051 | 3300013308 | Bacteria | 4059 |
| 329 | Ga0157375_10063389 | 3300013308 | Bacteria | 3677 |
| 330 | Ga0157375_10063559 | 3300013308 | Bacteria | 3673 |
| 331 | Ga0157375_10100055 | 3300013308 | Bacteria | 2979 |
| 332 | Ga0163163_10003280 | 3300014325 | Bacteria | 13721 |
| 333 | Ga0163163_10012103 | 3300014325 | Bacteria | 7851 |
| 334 | Ga0163163_10013204 | 3300014325 | Bacteria | 7550 |
| 335 | Ga0163163_10143759 | 3300014325 | Bacteria | 2428 |
| 336 | Ga0163163_10188507 | 3300014325 | Bacteria | 2111 |
| 337 | Ga0163163_10326054 | 3300014325 | Bacteria | 1590 |
| 338 | Ga0157380_10002098 | 3300014326 | Bacteria | 13365 |
| 339 | Ga0157380_10007215 | 3300014326 | Bacteria | 7877 |
| 340 | Ga0157380_10134578 | 3300014326 | Bacteria | 2114 |
| 341 | Ga0157380_10177910 | 3300014326 | Bacteria | 1866 |
| 342 | Ga0157380_10211066 | 3300014326 | Bacteria | 1730 |
| 343 | Ga0157380_10220861 | 3300014326 | Bacteria | 1695 |
| 344 | Ga0157380_10947564 | 3300014326 | Bacteria | 890 |
| 345 | Ga0157377_10003532 | 3300014745 | Bacteria | 7078 |
| 346 | Ga0157377_10318961 | 3300014745 | Bacteria | 1032 |
| 347 | Ga0157379_10000614 | 3300014968 | Bacteria | 28820 |
| 348 | Ga0157379_10001978 | 3300014968 | Bacteria | 16948 |
| 349 | Ga0157379_10010150 | 3300014968 | Bacteria | 8210 |
| 350 | Ga0157379_10024288 | 3300014968 | Bacteria | 5382 |
| 351 | Ga0157379_10164288 | 3300014968 | Bacteria | 2004 |
| 352 | Ga0157379_10177226 | 3300014968 | Bacteria | 1925 |
| 353 | Ga0157379_10202042 | 3300014968 | Bacteria | 1797 |
| 354 | Ga0157376_10047633 | 3300014969 | Bacteria | 3540 |
| 355 | Ga0157376_10086759 | 3300014969 | Bacteria | 2699 |
| 356 | Ga0157376_10155559 | 3300014969 | Bacteria | 2067 |
| 357 | Ga0157376_10196424 | 3300014969 | Bacteria | 1854 |
| 358 | Ga0157376_10426199 | 3300014969 | Bacteria | 1288 |
| 359 | Ga0157376_10520408 | 3300014969 | Bacteria | 1172 |
| 360 | Ga0163161_10045444 | 3300017792 | Bacteria | 3167 |
| 361 | Ga0163161_10519239 | 3300017792 | Bacteria | 972 |
| 362 | Ga0213874_10011572 | 3300021377 | Bacteria | 2239 |
| 363 | Ga0213871_10010517 | 3300021441 | Bacteria | 2100 |
| 364 | Ga0228598_1004895 | 3300024227 | Bacteria | 2819 |
| 365 | Ga0207682_10002678 | 3300025893 | Bacteria | 7935 |
| 366 | Ga0207682_10004866 | 3300025893 | Bacteria | 5543 |
| 367 | Ga0207682_10051169 | 3300025893 | Bacteria | 1710 |
| 368 | Ga0207682_10119262 | 3300025893 | Bacteria | 1169 |
| 369 | Ga0207692_10050767 | 3300025898 | Bacteria | 2099 |
| 370 | Ga0207642_10048092 | 3300025899 | Bacteria | 1910 |
| 371 | Ga0207642_10289511 | 3300025899 | Bacteria | 945 |
| 372 | Ga0207710_10001544 | 3300025900 | Bacteria | 11332 |
| 373 | Ga0207710_10079856 | 3300025900 | Bacteria | 1516 |
| 374 | Ga0207710_10177938 | 3300025900 | Bacteria | 1042 |
| 375 | Ga0207688_10039365 | 3300025901 | Bacteria | 2625 |
| 376 | Ga0207680_10003867 | 3300025903 | Bacteria | 7056 |
| 377 | Ga0207680_10032325 | 3300025903 | Bacteria | 2974 |
| 378 | Ga0207680_10103673 | 3300025903 | Bacteria | 1832 |
| 379 | Ga0207685_10001569 | 3300025905 | Bacteria | 4868 |
| 380 | Ga0207645_10006379 | 3300025907 | Bacteria | 8474 |
| 381 | Ga0207645_10037104 | 3300025907 | Bacteria | 3129 |
| 382 | Ga0207645_10080968 | 3300025907 | Bacteria | 2082 |
| 383 | Ga0207643_10025559 | 3300025908 | Bacteria | 3264 |
| 384 | Ga0207643_10027179 | 3300025908 | Bacteria | 3171 |
| 385 | Ga0207643_10030346 | 3300025908 | Bacteria | 3008 |
| 386 | Ga0207643_10051590 | 3300025908 | Bacteria | 2335 |
| 387 | Ga0207654_10032147 | 3300025911 | Bacteria | 2896 |
| 388 | Ga0207707_10002757 | 3300025912 | Bacteria | 15666 |
| 389 | Ga0207707_10004284 | 3300025912 | Bacteria | 12626 |
| 390 | Ga0207707_10012435 | 3300025912 | Bacteria | 7400 |
| 391 | Ga0207707_10039399 | 3300025912 | Bacteria | 4130 |
| 392 | Ga0207707_10051030 | 3300025912 | Bacteria | 3602 |
| 393 | Ga0207707_10280448 | 3300025912 | Bacteria | 1443 |
| 394 | Ga0207707_10337567 | 3300025912 | Bacteria | 1300 |
| 395 | Ga0207695_10004668 | 3300025913 | Bacteria | 18566 |
| 396 | Ga0207695_10026166 | 3300025913 | Bacteria | 6513 |
| 397 | Ga0207695_10067889 | 3300025913 | Bacteria | 3655 |
| 398 | Ga0207695_10078068 | 3300025913 | Bacteria | 3360 |
| 399 | Ga0207695_10393396 | 3300025913 | Bacteria | 1271 |
| 400 | Ga0207671_10006805 | 3300025914 | Bacteria | 10098 |
| 401 | Ga0207671_10047416 | 3300025914 | Bacteria | 3180 |
| 402 | Ga0207693_10000074 | 3300025915 | Bacteria | 88611 |
| 403 | Ga0207693_10089004 | 3300025915 | Bacteria | 2419 |
| 404 | Ga0207693_10272655 | 3300025915 | Bacteria | 1326 |
| 405 | Ga0207663_10122069 | 3300025916 | Bacteria | 1786 |
| 406 | Ga0207660_10007266 | 3300025917 | Bacteria | 7167 |
| 407 | Ga0207660_10011059 | 3300025917 | Bacteria | 5869 |
| 408 | Ga0207660_10011615 | 3300025917 | Bacteria | 5741 |
| 409 | Ga0207660_10026586 | 3300025917 | Bacteria | 3942 |
| 410 | Ga0207660_10149945 | 3300025917 | Bacteria | 1791 |
| 411 | Ga0207660_10382007 | 3300025917 | Bacteria | 1132 |
| 412 | Ga0207652_10014707 | 3300025921 | Bacteria | 6342 |
| 413 | Ga0207652_10026377 | 3300025921 | Bacteria | 4838 |
| 414 | Ga0207652_10149928 | 3300025921 | Bacteria | 2088 |
| 415 | Ga0207652_10179202 | 3300025921 | Bacteria | 1904 |
| 416 | Ga0207652_10190156 | 3300025921 | Bacteria | 1846 |
| 417 | Ga0207652_10201791 | 3300025921 | Bacteria | 1790 |
| 418 | Ga0207681_10089643 | 3300025923 | Bacteria | 2193 |
| 419 | Ga0207681_10089702 | 3300025923 | Bacteria | 2192 |
| 420 | Ga0207681_10115754 | 3300025923 | Bacteria | 1958 |
| 421 | Ga0207694_10033760 | 3300025924 | Bacteria | 3920 |
| 422 | Ga0207694_10462005 | 3300025924 | Bacteria | 1060 |
| 423 | Ga0207650_10009452 | 3300025925 | Bacteria | 6663 |
| 424 | Ga0207650_10078685 | 3300025925 | Bacteria | 2495 |
| 425 | Ga0207650_10559602 | 3300025925 | Bacteria | 959 |
| 426 | Ga0207659_10001788 | 3300025926 | Bacteria | 12706 |
| 427 | Ga0207659_10029326 | 3300025926 | Bacteria | 3749 |
| 428 | Ga0207659_10030149 | 3300025926 | Bacteria | 3703 |
| 429 | Ga0207659_10276815 | 3300025926 | Bacteria | 1371 |
| 430 | Ga0207687_10059344 | 3300025927 | Bacteria | 2695 |
| 431 | Ga0207700_10020950 | 3300025928 | Bacteria | 4453 |
| 432 | Ga0207700_10020981 | 3300025928 | Bacteria | 4450 |
| 433 | Ga0207700_10080399 | 3300025928 | Bacteria | 2541 |
| 434 | Ga0207664_10016012 | 3300025929 | Bacteria | 5461 |
| 435 | Ga0207644_10010652 | 3300025931 | Bacteria | 6061 |
| 436 | Ga0207644_10297609 | 3300025931 | Bacteria | 1299 |
| 437 | Ga0207644_10582584 | 3300025931 | Bacteria | 928 |
| 438 | Ga0207690_10015790 | 3300025932 | Bacteria | 4583 |
| 439 | Ga0207706_10002530 | 3300025933 | Bacteria | 17824 |
| 440 | Ga0207706_10234432 | 3300025933 | Bacteria | 1605 |
| 441 | Ga0207706_10269980 | 3300025933 | Bacteria | 1484 |
| 442 | Ga0207686_10019724 | 3300025934 | Bacteria | 3841 |
| 443 | Ga0207670_10007052 | 3300025936 | Bacteria | 6256 |
| 444 | Ga0207670_10013656 | 3300025936 | Bacteria | 4796 |
| 445 | Ga0207670_10196288 | 3300025936 | Bacteria | 1530 |
| 446 | Ga0207669_10056469 | 3300025937 | Bacteria | 2384 |
| 447 | Ga0207669_10363665 | 3300025937 | Bacteria | 1122 |
| 448 | Ga0207704_10057262 | 3300025938 | Bacteria | 2393 |
| 449 | Ga0207704_10082404 | 3300025938 | Bacteria | 2084 |
| 450 | Ga0207704_10195778 | 3300025938 | Bacteria | 1474 |
| 451 | Ga0207704_10391816 | 3300025938 | Bacteria | 1093 |
| 452 | Ga0207665_10079043 | 3300025939 | Bacteria | 2260 |
| 453 | Ga0207691_10006516 | 3300025940 | Bacteria | 11267 |
| 454 | Ga0207691_10020864 | 3300025940 | Bacteria | 6191 |
| 455 | Ga0207691_10032746 | 3300025940 | Bacteria | 4845 |
| 456 | Ga0207691_10035704 | 3300025940 | Bacteria | 4611 |
| 457 | Ga0207691_10049421 | 3300025940 | Bacteria | 3853 |
| 458 | Ga0207711_10001501 | 3300025941 | Bacteria | 21749 |
| 459 | Ga0207711_10093866 | 3300025941 | Bacteria | 2643 |
| 460 | Ga0207711_10152652 | 3300025941 | Bacteria | 2085 |
| 461 | Ga0207711_10174290 | 3300025941 | Bacteria | 1953 |
| 462 | Ga0207711_10365702 | 3300025941 | Bacteria | 1337 |
| 463 | Ga0207689_10011724 | 3300025942 | Bacteria | 7513 |
| 464 | Ga0207689_10031231 | 3300025942 | Bacteria | 4436 |
| 465 | Ga0207689_10038860 | 3300025942 | Bacteria | 3940 |
| 466 | Ga0207689_10055034 | 3300025942 | Bacteria | 3275 |
| 467 | Ga0207689_10123272 | 3300025942 | Bacteria | 2131 |
| 468 | Ga0207689_10207475 | 3300025942 | Bacteria | 1618 |
| 469 | Ga0207689_10222317 | 3300025942 | Bacteria | 1560 |
| 470 | Ga0207689_10315618 | 3300025942 | Bacteria | 1297 |
| 471 | Ga0207661_10052742 | 3300025944 | Bacteria | 3251 |
| 472 | Ga0207679_10012127 | 3300025945 | Bacteria | 5610 |
| 473 | Ga0207679_10532410 | 3300025945 | Bacteria | 1052 |
| 474 | Ga0207667_10041830 | 3300025949 | Bacteria | 4872 |
| 475 | Ga0207667_10044202 | 3300025949 | Bacteria | 4722 |
| 476 | Ga0207667_10507253 | 3300025949 | Bacteria | 1223 |
| 477 | Ga0207651_10003822 | 3300025960 | Bacteria | 7464 |
| 478 | Ga0207651_10205030 | 3300025960 | Bacteria | 1583 |
| 479 | Ga0207712_10311876 | 3300025961 | Bacteria | 1295 |
| 480 | Ga0207668_10431600 | 3300025972 | Bacteria | 1120 |
| 481 | Ga0207640_10128977 | 3300025981 | Bacteria | 1825 |
| 482 | Ga0207640_10463668 | 3300025981 | Bacteria | 1047 |
| 483 | Ga0207658_10000046 | 3300025986 | Bacteria | 130772 |
| 484 | Ga0207658_10009061 | 3300025986 | Bacteria | 6750 |
| 485 | Ga0207658_10070732 | 3300025986 | Bacteria | 2641 |
| 486 | Ga0207658_10077140 | 3300025986 | Bacteria | 2541 |
| 487 | Ga0207677_10020310 | 3300026023 | Bacteria | 4031 |
| 488 | Ga0207677_10027953 | 3300026023 | Bacteria | 3561 |
| 489 | Ga0207677_10223506 | 3300026023 | Bacteria | 1512 |
| 490 | Ga0207703_10003271 | 3300026035 | Bacteria | 13598 |
| 491 | Ga0207703_10006155 | 3300026035 | Bacteria | 9604 |
| 492 | Ga0207703_10013429 | 3300026035 | Bacteria | 6380 |
| 493 | Ga0207703_10056126 | 3300026035 | Bacteria | 3206 |
| 494 | Ga0207703_10390127 | 3300026035 | Bacteria | 1290 |
| 495 | Ga0207678_10103107 | 3300026067 | Bacteria | 2435 |
| 496 | Ga0207708_10073963 | 3300026075 | Bacteria | 2612 |
| 497 | Ga0207708_10074498 | 3300026075 | Bacteria | 2602 |
| 498 | Ga0207708_10091053 | 3300026075 | Bacteria | 2351 |
| 499 | Ga0207708_10196791 | 3300026075 | Bacteria | 1606 |
| 500 | Ga0207708_10251868 | 3300026075 | Bacteria | 1423 |
| 501 | Ga0207702_10365921 | 3300026078 | Bacteria | 1383 |
| 502 | Ga0207641_10001484 | 3300026088 | Bacteria | 23002 |
| 503 | Ga0207641_10004671 | 3300026088 | Bacteria | 11815 |
| 504 | Ga0207641_10030438 | 3300026088 | Bacteria | 4471 |
| 505 | Ga0207641_10145512 | 3300026088 | Bacteria | 2142 |
| 506 | Ga0207641_10867051 | 3300026088 | Bacteria | 895 |
| 507 | Ga0207648_10000935 | 3300026089 | Bacteria | 32936 |
| 508 | Ga0207648_10063248 | 3300026089 | Bacteria | 3226 |
| 509 | Ga0207648_10192047 | 3300026089 | Bacteria | 1810 |
| 510 | Ga0207676_10005840 | 3300026095 | Bacteria | 8697 |
| 511 | Ga0207676_10055024 | 3300026095 | Bacteria | 3121 |
| 512 | Ga0207676_10056652 | 3300026095 | Bacteria | 3083 |
| 513 | Ga0207676_10634145 | 3300026095 | Bacteria | 1030 |
| 514 | Ga0207674_10006902 | 3300026116 | Bacteria | 13309 |
| 515 | Ga0207674_10034124 | 3300026116 | Bacteria | 5322 |
| 516 | Ga0207674_10541492 | 3300026116 | Bacteria | 1125 |
| 517 | Ga0207674_10806391 | 3300026116 | Bacteria | 906 |
| 518 | Ga0207675_100003493 | 3300026118 | Bacteria | 15341 |
| 519 | Ga0207675_100003505 | 3300026118 | Bacteria | 15313 |
| 520 | Ga0207675_100006146 | 3300026118 | Bacteria | 11412 |
| 521 | Ga0207675_100013127 | 3300026118 | Bacteria | 7731 |
| 522 | Ga0207675_100022988 | 3300026118 | Bacteria | 5799 |
| 523 | Ga0207675_100131684 | 3300026118 | Bacteria | 2372 |
| 524 | Ga0207675_100565425 | 3300026118 | Bacteria | 1137 |
| 525 | Ga0207683_10011548 | 3300026121 | Bacteria | 7541 |
| 526 | Ga0207683_10024101 | 3300026121 | Bacteria | 5237 |
| 527 | Ga0207683_10044662 | 3300026121 | Bacteria | 3874 |
| 528 | Ga0207683_10069217 | 3300026121 | Bacteria | 3117 |
| 529 | Ga0207698_10385946 | 3300026142 | Bacteria | 1334 |
| 530 | Ga0207698_10542157 | 3300026142 | Bacteria | 1139 |
| 531 | Ga0207428_10006432 | 3300027907 | Bacteria | 10849 |
| 532 | Ga0207428_10020710 | 3300027907 | Bacteria | 5580 |
| 533 | Ga0207428_10033094 | 3300027907 | Bacteria | 4248 |
| 534 | Ga0207428_10076951 | 3300027907 | Bacteria | 2612 |
| 535 | Ga0207428_10146709 | 3300027907 | Bacteria | 1798 |
| 536 | Ga0268266_10004092 | 3300028379 | Bacteria | 14082 |
| 537 | Ga0268266_10017688 | 3300028379 | Bacteria | 6077 |
| 538 | Ga0268266_10039925 | 3300028379 | Bacteria | 3998 |
| 539 | Ga0268266_10079927 | 3300028379 | Bacteria | 2848 |
| 540 | Ga0268266_10147562 | 3300028379 | Bacteria | 2116 |
| 541 | Ga0268266_10298350 | 3300028379 | Bacteria | 1502 |
| 542 | Ga0268266_10605341 | 3300028379 | Bacteria | 1053 |
| 543 | Ga0268265_10006378 | 3300028380 | Bacteria | 7995 |
| 544 | Ga0268265_10007283 | 3300028380 | Bacteria | 7473 |
| 545 | Ga0268265_10013615 | 3300028380 | Bacteria | 5531 |
| 546 | Ga0268265_10033879 | 3300028380 | Bacteria | 3717 |
| 547 | Ga0268265_10054548 | 3300028380 | Bacteria | 3034 |
| 548 | Ga0268265_10063625 | 3300028380 | Bacteria | 2839 |
| 549 | Ga0268265_10066738 | 3300028380 | Bacteria | 2782 |
| 550 | Ga0268264_10000085 | 3300028381 | Bacteria | 240739 |
| 551 | Ga0268264_10011987 | 3300028381 | Bacteria | 7139 |
| 552 | Ga0268264_10014381 | 3300028381 | Bacteria | 6505 |
| 553 | Ga0268264_10014471 | 3300028381 | Bacteria | 6485 |
| 554 | Ga0268264_10063782 | 3300028381 | Bacteria | 3099 |
| 555 | Ga0268264_10123708 | 3300028381 | Bacteria | 2283 |
| 556 | Ga0268264_10203400 | 3300028381 | Bacteria | 1813 |
| 557 | Ga0265319_1047734 | 3300028563 | Bacteria | 1423 |
| 558 | Ga0265334_10001271 | 3300028573 | Bacteria | 12245 |
| 559 | Ga0265318_10001358 | 3300028577 | Bacteria | 14561 |
| 560 | Ga0265318_10098901 | 3300028577 | Bacteria | 1074 |
| 561 | Ga0265338_10007770 | 3300028800 | Bacteria | 13193 |
| 562 | Ga0265338_10010887 | 3300028800 | Bacteria | 10585 |
| 563 | Ga0265338_10027853 | 3300028800 | Bacteria | 5655 |
| 564 | Ga0307511_10001897 | 3300030521 | Bacteria | 21953 |
| 565 | Ga0307511_10118006 | 3300030521 | Bacteria | 1654 |
| 566 | Ga0265770_1000030 | 3300030878 | Bacteria | 14134 |
| 567 | Ga0265770_1032851 | 3300030878 | Bacteria | 877 |
| 568 | Ga0265760_10004641 | 3300031090 | Bacteria | 3934 |
| 569 | Ga0265330_10052615 | 3300031235 | Bacteria | 1783 |
| 570 | Ga0265332_10001772 | 3300031238 | Bacteria | 11647 |
| 571 | Ga0265320_10017891 | 3300031240 | Bacteria | 3918 |
| 572 | Ga0265325_10001428 | 3300031241 | Bacteria | 16803 |
| 573 | Ga0265329_10001256 | 3300031242 | Bacteria | 12399 |
| 574 | Ga0265340_10010370 | 3300031247 | Bacteria | 4985 |
| 575 | Ga0265340_10094566 | 3300031247 | Bacteria | 1394 |
| 576 | Ga0265339_10009587 | 3300031249 | Bacteria | 6069 |
| 577 | Ga0265331_10019248 | 3300031250 | Bacteria | 3527 |
| 578 | Ga0265331_10048701 | 3300031250 | Bacteria | 2036 |
| 579 | Ga0265331_10061162 | 3300031250 | Bacteria | 1778 |
| 580 | Ga0265327_10023520 | 3300031251 | Bacteria | 3648 |
| 581 | Ga0265316_10017357 | 3300031344 | Bacteria | 6226 |
| 582 | Ga0265316_10028963 | 3300031344 | Bacteria | 4560 |
| 583 | Ga0307513_10025018 | 3300031456 | Bacteria | 6929 |
| 584 | Ga0307513_10026003 | 3300031456 | Bacteria | 6760 |
| 585 | Ga0307513_10174506 | 3300031456 | Bacteria | 2022 |
| 586 | Ga0307509_10000008 | 3300031507 | Bacteria | 354271 |
| 587 | Ga0307509_10117099 | 3300031507 | Bacteria | 2652 |
| 588 | Ga0307509_10308512 | 3300031507 | Bacteria | 1326 |
| 589 | Ga0307408_100079655 | 3300031548 | Bacteria | 2445 |
| 590 | Ga0307408_100081595 | 3300031548 | Bacteria | 2418 |
| 591 | Ga0307408_100146368 | 3300031548 | Bacteria | 1860 |
| 592 | Ga0307408_100205798 | 3300031548 | Bacteria | 1596 |
| 593 | Ga0307408_100217869 | 3300031548 | Bacteria | 1556 |
| 594 | Ga0265313_10002857 | 3300031595 | Bacteria | 14491 |
| 595 | Ga0316575_10000129 | 3300031665 | Bacteria | 18869 |
| 596 | Ga0316575_10002479 | 3300031665 | Bacteria | 6209 |
| 597 | Ga0316575_10013355 | 3300031665 | Bacteria | 3067 |
| 598 | Ga0316575_10038185 | 3300031665 | Bacteria | 1894 |
| 599 | Ga0316575_10158891 | 3300031665 | Bacteria | 934 |
| 600 | Ga0316579_10000530 | 3300031691 | Bacteria | 12539 |
| 601 | Ga0265314_10009630 | 3300031711 | Bacteria | 8137 |
| 602 | Ga0265314_10157873 | 3300031711 | Bacteria | 1383 |
| 603 | Ga0265342_10007273 | 3300031712 | Bacteria | 8129 |
| 604 | Ga0316576_10002294 | 3300031727 | Bacteria | 10847 |
| 605 | Ga0316576_10053203 | 3300031727 | Bacteria | 2949 |
| 606 | Ga0316576_10086505 | 3300031727 | Bacteria | 2331 |
| 607 | Ga0316578_10001988 | 3300031728 | Bacteria | 8683 |
| 608 | Ga0316578_10010000 | 3300031728 | Bacteria | 4906 |
| 609 | Ga0316578_10034205 | 3300031728 | Bacteria | 2917 |
| 610 | Ga0307405_10053416 | 3300031731 | Bacteria | 2517 |
| 611 | Ga0307405_10237242 | 3300031731 | Bacteria | 1348 |
| 612 | Ga0316577_10000014 | 3300031733 | Bacteria | 37742 |
| 613 | Ga0316577_10152111 | 3300031733 | Bacteria | 1304 |
| 614 | Ga0307413_10001102 | 3300031824 | Bacteria | 9867 |
| 615 | Ga0307413_10009664 | 3300031824 | Bacteria | 4629 |
| 616 | Ga0307410_10033962 | 3300031852 | Bacteria | 3298 |
| 617 | Ga0307410_10103647 | 3300031852 | Bacteria | 2044 |
| 618 | Ga0307410_10398247 | 3300031852 | Bacteria | 1112 |
| 619 | Ga0307406_10098219 | 3300031901 | Bacteria | 1988 |
| 620 | Ga0307407_10007516 | 3300031903 | Bacteria | 4940 |
| 621 | Ga0307407_10064159 | 3300031903 | Bacteria | 2157 |
| 622 | Ga0307407_10190079 | 3300031903 | Bacteria | 1368 |
| 623 | Ga0307412_10064544 | 3300031911 | Bacteria | 2474 |
| 624 | Ga0307409_100032841 | 3300031995 | Bacteria | 3769 |
| 625 | Ga0307409_100051165 | 3300031995 | Bacteria | 3160 |
| 626 | Ga0307409_100098746 | 3300031995 | Bacteria | 2416 |
| 627 | Ga0307409_100100252 | 3300031995 | Bacteria | 2400 |
| 628 | Ga0307409_100806303 | 3300031995 | Bacteria | 947 |
| 629 | Ga0307416_100120523 | 3300032002 | Bacteria | 2336 |
| 630 | Ga0307416_100286755 | 3300032002 | Bacteria | 1627 |
| 631 | Ga0307416_100425348 | 3300032002 | Bacteria | 1374 |
| 632 | Ga0307416_101110218 | 3300032002 | Bacteria | 895 |
| 633 | Ga0307414_10162892 | 3300032004 | Bacteria | 1774 |
| 634 | Ga0307411_10000178 | 3300032005 | Bacteria | 20399 |
| 635 | Ga0307411_10003205 | 3300032005 | Bacteria | 7536 |
| 636 | Ga0307411_10107148 | 3300032005 | Bacteria | 1991 |
| 637 | Ga0307411_10131772 | 3300032005 | Bacteria | 1828 |
| 638 | Ga0307411_10154891 | 3300032005 | Bacteria | 1708 |
| 639 | Ga0307411_10204014 | 3300032005 | Bacteria | 1521 |
| 640 | Ga0307411_10306709 | 3300032005 | Bacteria | 1276 |
| 641 | Ga0307415_100012994 | 3300032126 | Bacteria | 4841 |
| 642 | Ga0307415_100093127 | 3300032126 | Bacteria | 2187 |
| 643 | Ga0307415_100394660 | 3300032126 | Bacteria | 1179 |
| 644 | Ga0316580_10000397 | 3300032139 | Bacteria | 9796 |
| 645 | Ga0316580_10001817 | 3300032139 | Bacteria | 5721 |
| 646 | Ga0316593_10007758 | 3300032168 | Bacteria | 2960 |
| 647 | Ga0316593_10052677 | 3300032168 | Bacteria | 1378 |
| 648 | Ga0316593_10056053 | 3300032168 | Bacteria | 1340 |
| 649 | Ga0316596_1009091 | 3300033541 | Bacteria | 2381 |
| 650 | Ga0373944_0057092 | 3300035089 | Bacteria | 1244 |
| 651 | Ga0373923_0014921 | 3300035111 | Bacteria | 2926 |
| 652 | Ga0373923_0079343 | 3300035111 | Bacteria | 1422 |
| 653 | Ga0373936_0044077 | 3300035113 | Bacteria | 1794 |
| 654 | Ga0373936_0046776 | 3300035113 | Bacteria | 1744 |
| 655 | Ga0373936_0109603 | 3300035113 | Bacteria | 1171 |
| 656 | Ga0373936_0113824 | 3300035113 | Bacteria | 1150 |
| 657 | Ga0373954_0142474 | 3300035118 | Bacteria | 1169 |
| 658 | Ga0373955_0038198 | 3300035172 | Bacteria | 2557 |
| 659 | Ga0316574_0010869 | 3300035398 | Bacteria | 5158 |
| 660 | Ga0316574_0018258 | 3300035398 | Bacteria | 4119 |
| 661 | Ga0316574_0020327 | 3300035398 | Bacteria | 3929 |
| 662 | Ga0316574_0031954 | 3300035398 | Bacteria | 3196 |
| 663 | Ga0316574_0103484 | 3300035398 | Bacteria | 1823 |
| 664 | Ga0316574_0233284 | 3300035398 | Bacteria | 1177 |
| 665 | Ga0373924_0140036 | 3300035410 | Bacteria | 1055 |
| 666 | Ga0373935_0206521 | 3300035692 | Bacteria | 1360 |
| 667 | Ga0373935_0245210 | 3300035692 | Bacteria | 1252 |
| 668 | Ga0373927_0012200 | 3300035695 | Bacteria | 5716 |
| 669 | Ga0373937_0056366 | 3300036401 | Bacteria | 3609 |
| 670 | Ga0373937_0169112 | 3300036401 | Bacteria | 2051 |
| 671 | Ga0316582_0000288 | 3300036647 | Bacteria | 17252 |
| 672 | Ga0316584_0005014 | 3300036712 | Bacteria | 8826 |
| 673 | Ga0316584_0007546 | 3300036712 | Bacteria | 7451 |
| 674 | Ga0316584_0011584 | 3300036712 | Bacteria | 6200 |
| 675 | Ga0316584_0062510 | 3300036712 | Bacteria | 2788 |
| 676 | Ga0316584_0065155 | 3300036712 | Bacteria | 2729 |
| 677 | Ga0316584_0210279 | 3300036712 | Bacteria | 1432 |
| 678 | Ga0373925_0192347 | 3300037068 | Bacteria | 1619 |
| 679 | Ga0395898_0006245 | 3300037466 | Bacteria | 12760 |
| 680 | Ga0395898_0042232 | 3300037466 | Bacteria | 4500 |
| 681 | Ga0400490_07444 | 3300038726 | Bacteria | 36081 |
| 682 | Ga0400490_30083 | 3300038726 | Bacteria | 21748 |
| 683 | Ga0400488_01697 | 3300038741 | Bacteria | 1056 |
| 684 | Ga0400488_59976 | 3300038741 | Bacteria | 11525 |
| 685 | Ga0400483_002831 | 3300039062 | Bacteria | 10002 |
| 686 | Ga0400483_022796 | 3300039062 | Bacteria | 1027 |
| 687 | Ga0400483_163859 | 3300039062 | Bacteria | 4367 |
| 688 | Ga0400483_190589 | 3300039062 | Bacteria | 4681 |
| 689 | Ga0400483_222691 | 3300039062 | Bacteria | 32176 |
| 690 | Ga0400483_284874 | 3300039062 | Bacteria | 8206 |
| 691 | Ga0400489_20593 | 3300039093 | Bacteria | 1628 |
| 692 | Ga0400489_88422 | 3300039093 | Bacteria | 1311 |
| 693 | Ga0400487_42418 | 3300039110 | Bacteria | 22363 |
| 694 | Ga0400487_64772 | 3300039110 | Bacteria | 8031 |
| 695 | Ga0436365_0033536 | 3300039437 | Bacteria | 4101 |
| 696 | Ga0436365_1504415 | 3300039437 | Bacteria | 3904 |
| 697 | Ga0436360_1079411 | 3300039438 | Bacteria | 12206 |
| 698 | Ga0436361_1075840 | 3300039447 | Bacteria | 1717 |
| 699 | Ga0436363_0167267 | 3300039450 | Bacteria | 7589 |
| 700 | Ga0436363_1431824 | 3300039450 | Bacteria | 9674 |
| 701 | Ga0436362_0261338 | 3300039453 | Bacteria | 1469 |
| 702 | Ga0451795_1205146 | 3300041456 | Bacteria | 1860 |
| 703 | Ga0451802_0026244 | 3300041460 | Bacteria | 4931 |
| 704 | Ga0451802_0139520 | 3300041460 | Bacteria | 2507 |
| 705 | Ga0451807_0214414 | 3300041486 | Bacteria | 2626 |
| 706 | Ga0451807_0614660 | 3300041486 | Bacteria | 3790 |
| 707 | Ga0451807_1381746 | 3300041486 | Bacteria | 1118 |
| 708 | Ga0451837_0547725 | 3300041494 | Bacteria | 3332 |
| 709 | Ga0451853_2107667 | 3300041512 | Bacteria | 2445 |
| 710 | Ga0439435_0041727 | 3300042436 | Bacteria | 1286 |
| 711 | Ga0439460_0003422 | 3300042461 | Bacteria | 3833 |
| 712 | Ga0450916_023519 | 3300042530 | Bacteria | 860 |
| 713 | Ga0451577_0007840 | 3300042876 | Bacteria | 10443 |
| 714 | Ga0451577_0016049 | 3300042876 | Bacteria | 6947 |
| 715 | Ga0451577_0037831 | 3300042876 | Bacteria | 4342 |
| 716 | Ga0451577_0126020 | 3300042876 | Bacteria | 2295 |
| 717 | Ga0453683_0009257 | 3300044673 | Bacteria | 6580 |
| 718 | Ga0453684_0066162 | 3300044712 | Bacteria | 4603 |
| 719 | Ga0453684_0640754 | 3300044712 | Bacteria | 1160 |
| 720 | Ga0466959_0084672 | 3300045049 | Bacteria | 2282 |
| 721 | Ga0466959_0090345 | 3300045049 | Bacteria | 2200 |
| 722 | Ga0451576_0051462 | 3300045051 | Bacteria | 4318 |
| 723 | Ga0451576_0059422 | 3300045051 | Bacteria | 3990 |
| 724 | Ga0451576_0120985 | 3300045051 | Bacteria | 2725 |
| 725 | Ga0495638_0007170 | 3300046460 | Bacteria | 8025 |
| 726 | Ga0495638_0014122 | 3300046460 | Bacteria | 5407 |
| 727 | Ga0495638_0028700 | 3300046460 | Bacteria | 3590 |
| 728 | Ga0495638_0049342 | 3300046460 | Bacteria | 2632 |
| 729 | Ga0495650_0068658 | 3300046471 | Bacteria | 1397 |
| 730 | Ga0495580_0060379 | 3300046472 | Bacteria | 2664 |
| 731 | Ga0495580_0129006 | 3300046472 | Bacteria | 1754 |
| 732 | Ga0495585_0056112 | 3300046492 | Bacteria | 2176 |
| 733 | Ga0495583_0015410 | 3300046506 | Bacteria | 4160 |
| 734 | Ga0495606_0037893 | 3300046507 | Bacteria | 3269 |
| 735 | Ga0495606_0124906 | 3300046507 | Bacteria | 1536 |
| 736 | Ga0495606_0173131 | 3300046507 | Bacteria | 1250 |
| 737 | Ga0495616_0003562 | 3300046513 | Bacteria | 9948 |
| 738 | Ga0495620_0037598 | 3300046515 | Bacteria | 2155 |
| 739 | Ga0495632_0045293 | 3300046519 | Bacteria | 2192 |
| 740 | Ga0495632_0139915 | 3300046519 | Bacteria | 1123 |
| 741 | Ga0495632_0143706 | 3300046519 | Bacteria | 1106 |
| 742 | Ga0495586_0060407 | 3300046535 | Bacteria | 2061 |
| 743 | Ga0495621_0033003 | 3300046539 | Bacteria | 1783 |
| 744 | Ga0495645_0044018 | 3300046543 | Bacteria | 3256 |
| 745 | Ga0495622_0188498 | 3300046557 | Bacteria | 923 |
| 746 | Ga0495668_0039100 | 3300046616 | Bacteria | 2649 |
| 747 | Ga0495611_0157629 | 3300046648 | Bacteria | 1060 |
| 748 | Ga0495625_0008480 | 3300046660 | Bacteria | 8770 |
| 749 | Ga0495625_0170265 | 3300046660 | Bacteria | 1455 |
| 750 | Ga0495625_0195111 | 3300046660 | Bacteria | 1339 |
| 751 | Ga0495623_0119439 | 3300046679 | Bacteria | 1588 |
| 752 | Ga0495658_0121921 | 3300046683 | Bacteria | 1577 |
| 753 | Ga0495671_0032043 | 3300046692 | Bacteria | 2685 |
| 754 | Ga0495649_0007172 | 3300046694 | Bacteria | 6844 |
| 755 | Ga0495649_0071403 | 3300046694 | Bacteria | 1861 |
| 756 | Ga0495589_0112642 | 3300046794 | Bacteria | 1313 |
| 757 | Ga0495604_0074559 | 3300047317 | Bacteria | 2557 |
| 758 | Ga0495675_0318708 | 3300047444 | Bacteria | 920 |
| 759 | Ga0495602_0018947 | 3300048088 | Bacteria | 6850 |
| 760 | Ga0496100_0100436 | 3300048903 | Bacteria | 1993 |
| 761 | Ga0496102_0002132 | 3300048905 | Bacteria | 17010 |
| 762 | Ga0496102_0007331 | 3300048905 | Bacteria | 9418 |
| 763 | Ga0496102_0019281 | 3300048905 | Bacteria | 6008 |
| 764 | Ga0496102_0192228 | 3300048905 | Bacteria | 1923 |
| 765 | Ga0496102_0351084 | 3300048905 | Bacteria | 1389 |
| 766 | Ga0496103_0022093 | 3300048906 | Bacteria | 3830 |
| 767 | Ga0496103_0028633 | 3300048906 | Bacteria | 3382 |
| 768 | Ga0496104_0001674 | 3300048907 | Bacteria | 19138 |
| 769 | Ga0496104_0033718 | 3300048907 | Bacteria | 4771 |
| 770 | Ga0496104_0408134 | 3300048907 | Bacteria | 1271 |
| 771 | Ga0496104_0420654 | 3300048907 | Bacteria | 1248 |
| 772 | Ga0496104_0743459 | 3300048907 | Bacteria | 888 |
| 773 | Ga0496105_0001265 | 3300048908 | Bacteria | 17664 |
| 774 | Ga0496105_0022232 | 3300048908 | Bacteria | 5136 |
| 775 | Ga0496105_0039326 | 3300048908 | Bacteria | 3898 |
| 776 | Ga0496106_0238634 | 3300048909 | Bacteria | 1452 |
| 777 | Ga0496106_0242529 | 3300048909 | Bacteria | 1440 |
| 778 | Ga0496106_0356169 | 3300048909 | Bacteria | 1176 |
| 779 | Ga0496108_0003024 | 3300048911 | Bacteria | 13523 |
| 780 | Ga0496109_0133376 | 3300048912 | Bacteria | 2319 |
| 781 | Ga0496109_0554249 | 3300048912 | Bacteria | 1084 |
| 782 | Ga0496110_0011165 | 3300048913 | Bacteria | 7341 |
| 783 | Ga0496110_0124971 | 3300048913 | Bacteria | 2320 |
| 784 | Ga0496112_0018514 | 3300048915 | Bacteria | 6558 |
| 785 | Ga0496112_0237277 | 3300048915 | Bacteria | 1777 |
| 786 | Ga0496112_0400428 | 3300048915 | Bacteria | 1312 |
| 787 | Ga0496113_0081375 | 3300048916 | Bacteria | 2482 |
| 788 | Ga0496114_0009790 | 3300048917 | Bacteria | 7615 |
| 789 | Ga0496115_0020318 | 3300048918 | Bacteria | 5122 |
| 790 | Ga0496115_0070140 | 3300048918 | Bacteria | 2840 |
| 791 | Ga0496115_0188594 | 3300048918 | Bacteria | 1704 |
| 792 | Ga0496116_0030355 | 3300048919 | Bacteria | 3885 |
| 793 | Ga0496117_0000251 | 3300048920 | Bacteria | 101431 |
| 794 | Ga0496117_0058137 | 3300048920 | Bacteria | 2680 |
| 795 | Ga0496118_0000026 | 3300048921 | Bacteria | 375725 |
| 796 | Ga0496118_0043701 | 3300048921 | Bacteria | 3518 |
| 797 | Ga0496118_0119690 | 3300048921 | Bacteria | 1721 |
| 798 | Ga0496119_0000965 | 3300048922 | Bacteria | 36888 |
| 799 | Ga0496119_0165542 | 3300048922 | Bacteria | 1171 |
| 800 | Ga0496120_0000025 | 3300048923 | Bacteria | 235805 |
| 801 | Ga0496120_0033037 | 3300048923 | Bacteria | 3112 |
| 802 | Ga0496121_0002537 | 3300048924 | Bacteria | 27677 |
| 803 | Ga0496121_0208310 | 3300048924 | Bacteria | 1387 |
| 804 | Ga0496124_0173387 | 3300048927 | Bacteria | 1667 |
| 805 | Ga0496124_0219032 | 3300048927 | Bacteria | 1433 |
| 806 | Ga0496125_0002047 | 3300048928 | Bacteria | 27258 |
| 807 | Ga0496125_0007828 | 3300048928 | Bacteria | 11295 |
| 808 | Ga0496125_0049803 | 3300048928 | Bacteria | 3476 |
| 809 | Ga0496126_0001746 | 3300048929 | Bacteria | 32210 |
| 810 | Ga0496126_0227116 | 3300048929 | Bacteria | 1565 |
| 811 | Ga0496126_0320581 | 3300048929 | Bacteria | 1274 |
| 812 | Ga0501031_0016819 | 3300049568 | Bacteria | 4749 |
| 813 | Ga0501031_0065908 | 3300049568 | Bacteria | 2359 |
| 814 | Ga0501032_0009038 | 3300049569 | Bacteria | 7240 |
| 815 | Ga0501032_0017498 | 3300049569 | Bacteria | 5033 |
| 816 | Ga0501032_0058180 | 3300049569 | Bacteria | 2595 |
| 817 | Ga0501032_0077625 | 3300049569 | Bacteria | 2211 |
| 818 | Ga0501032_0137838 | 3300049569 | Bacteria | 1608 |
| 819 | Ga0501033_0001962 | 3300049570 | Bacteria | 17908 |
| 820 | Ga0501033_0002169 | 3300049570 | Bacteria | 16958 |
| 821 | Ga0501034_0040621 | 3300049571 | Bacteria | 4708 |
| 822 | Ga0501036_0003359 | 3300049572 | Bacteria | 12785 |
| 823 | Ga0501036_0027084 | 3300049572 | Bacteria | 4843 |
| 824 | Ga0501036_0064478 | 3300049572 | Bacteria | 3101 |
| 825 | Ga0501036_0150021 | 3300049572 | Bacteria | 1966 |
| 826 | Ga0501036_0507558 | 3300049572 | Bacteria | 1003 |
| 827 | Ga0501037_0005208 | 3300049573 | Bacteria | 9456 |
| 828 | Ga0501037_0023752 | 3300049573 | Bacteria | 4532 |
| 829 | Ga0501037_0072023 | 3300049573 | Bacteria | 2514 |
| 830 | Ga0501038_0002190 | 3300049574 | Bacteria | 18169 |
| 831 | Ga0501038_0004629 | 3300049574 | Bacteria | 12802 |
| 832 | Ga0501038_0010561 | 3300049574 | Bacteria | 8443 |
| 833 | Ga0501038_0030814 | 3300049574 | Bacteria | 4741 |
| 834 | Ga0501038_0151767 | 3300049574 | Bacteria | 1888 |
| 835 | Ga0501039_0003734 | 3300049575 | Bacteria | 11439 |
| 836 | Ga0501039_0205764 | 3300049575 | Bacteria | 1547 |
| 837 | Ga0501039_0235206 | 3300049575 | Bacteria | 1440 |
| 838 | Ga0501039_0248810 | 3300049575 | Bacteria | 1398 |
| 839 | Ga0501040_0013141 | 3300049576 | Bacteria | 5444 |
| 840 | Ga0501040_0014625 | 3300049576 | Bacteria | 5175 |
| 841 | Ga0501040_0069385 | 3300049576 | Bacteria | 2431 |
| 842 | Ga0501040_0171642 | 3300049576 | Bacteria | 1535 |
| 843 | Ga0501040_0457553 | 3300049576 | Bacteria | 919 |
| 844 | Ga0501041_0001989 | 3300049577 | Bacteria | 11487 |
| 845 | Ga0501041_0014883 | 3300049577 | Bacteria | 4618 |
| 846 | Ga0501042_0011337 | 3300049578 | Bacteria | 6012 |
| 847 | Ga0501042_0037631 | 3300049578 | Bacteria | 3434 |
| 848 | Ga0501042_0038156 | 3300049578 | Bacteria | 3411 |
| 849 | Ga0501042_0502305 | 3300049578 | Bacteria | 881 |
| 850 | Ga0501043_0002998 | 3300049579 | Bacteria | 14066 |
| 851 | Ga0501043_0022588 | 3300049579 | Bacteria | 4931 |
| 852 | Ga0501043_0054629 | 3300049579 | Bacteria | 3137 |
| 853 | Ga0501043_0449519 | 3300049579 | Bacteria | 968 |
| 854 | Ga0501046_0003961 | 3300049580 | Bacteria | 13519 |
| 855 | Ga0501046_0006982 | 3300049580 | Bacteria | 9945 |
| 856 | Ga0501046_0009200 | 3300049580 | Bacteria | 8553 |
| 857 | Ga0501046_0015127 | 3300049580 | Bacteria | 6488 |
| 858 | Ga0501046_0029434 | 3300049580 | Bacteria | 4464 |
| 859 | Ga0501046_0106492 | 3300049580 | Bacteria | 2146 |
| 860 | Ga0501047_0002955 | 3300049581 | Bacteria | 16112 |
| 861 | Ga0501047_0439739 | 3300049581 | Bacteria | 1134 |
| 862 | Ga0501048_0015227 | 3300049582 | Bacteria | 5682 |
| 863 | Ga0501048_0020173 | 3300049582 | Bacteria | 4888 |
| 864 | Ga0501048_0074718 | 3300049582 | Bacteria | 2391 |
| 865 | Ga0501067_0001759 | 3300049583 | Bacteria | 11903 |
| 866 | Ga0501068_0030970 | 3300049584 | Bacteria | 3176 |
| 867 | Ga0501069_0347829 | 3300049585 | Bacteria | 873 |
| 868 | Ga0501070_0010882 | 3300049586 | Bacteria | 7685 |
| 869 | Ga0501070_0091062 | 3300049586 | Bacteria | 2524 |
| 870 | Ga0501070_0176934 | 3300049586 | Bacteria | 1756 |
| 871 | Ga0501071_0000326 | 3300049587 | Bacteria | 22944 |
| 872 | Ga0501071_0008282 | 3300049587 | Bacteria | 6866 |
| 873 | Ga0501071_0040467 | 3300049587 | Bacteria | 3335 |
| 874 | Ga0501071_0502765 | 3300049587 | Bacteria | 930 |
| 875 | Ga0501072_0024767 | 3300049588 | Bacteria | 4671 |
| 876 | Ga0501072_0030671 | 3300049588 | Bacteria | 4206 |
| 877 | Ga0501072_0055462 | 3300049588 | Bacteria | 3124 |
| 878 | Ga0501073_0006481 | 3300049589 | Bacteria | 8706 |
| 879 | Ga0501073_0006560 | 3300049589 | Bacteria | 8660 |
| 880 | Ga0501073_0217671 | 3300049589 | Bacteria | 1319 |
| 881 | Ga0501074_0000179 | 3300049590 | Bacteria | 34289 |
| 882 | Ga0501074_0002065 | 3300049590 | Bacteria | 13883 |
| 883 | Ga0501074_0006517 | 3300049590 | Bacteria | 8429 |
| 884 | Ga0501074_0041862 | 3300049590 | Bacteria | 3315 |
| 885 | Ga0501074_0184290 | 3300049590 | Bacteria | 1489 |
| 886 | Ga0501074_0343405 | 3300049590 | Bacteria | 1060 |
| 887 | Ga0501074_0365329 | 3300049590 | Bacteria | 1024 |
| 888 | Ga0501075_0000736 | 3300049591 | Bacteria | 20301 |
| 889 | Ga0501075_0024495 | 3300049591 | Bacteria | 4426 |
| 890 | Ga0501075_0180301 | 3300049591 | Bacteria | 1611 |
| 891 | Ga0501075_0219032 | 3300049591 | Bacteria | 1452 |
| 892 | Ga0501076_0003626 | 3300049592 | Bacteria | 10841 |
| 893 | Ga0501076_0025313 | 3300049592 | Bacteria | 4591 |
| 894 | Ga0501076_0025814 | 3300049592 | Bacteria | 4549 |
| 895 | Ga0501076_0773428 | 3300049592 | Bacteria | 792 |
| 896 | Ga0501077_0004986 | 3300049593 | Bacteria | 8047 |
| 897 | Ga0501077_0005531 | 3300049593 | Bacteria | 7692 |
| 898 | Ga0501077_0044263 | 3300049593 | Bacteria | 2828 |
| 899 | Ga0501079_0016308 | 3300049741 | Bacteria | 5677 |
| 900 | Ga0501079_0243772 | 3300049741 | Bacteria | 1404 |
| 901 | Ga0501080_0002453 | 3300049742 | Bacteria | 16220 |
| 902 | Ga0501080_0005900 | 3300049742 | Bacteria | 10970 |
| 903 | Ga0501080_0015622 | 3300049742 | Bacteria | 7001 |
| 904 | Ga0501080_0030776 | 3300049742 | Bacteria | 5001 |
| 905 | Ga0501080_0700140 | 3300049742 | Bacteria | 894 |
| 906 | Ga0501081_0000724 | 3300049743 | Bacteria | 19213 |
| 907 | Ga0501081_0065319 | 3300049743 | Bacteria | 2529 |
| 908 | Ga0501081_0107479 | 3300049743 | Bacteria | 1978 |
| 909 | Ga0501083_0079258 | 3300049744 | Bacteria | 2178 |
| 910 | Ga0501083_0302719 | 3300049744 | Bacteria | 1040 |
| 911 | Ga0501241_008547 | 3300049758 | Bacteria | 1868 |
| 912 | Ga0501035_0000299 | 3300049822 | Bacteria | 58451 |
| 913 | Ga0501035_0019486 | 3300049822 | Bacteria | 6237 |
| 914 | Ga0501035_0034004 | 3300049822 | Bacteria | 4633 |
| 915 | Ga0501035_0084431 | 3300049822 | Bacteria | 2800 |
| 916 | Ga0501035_0356021 | 3300049822 | Bacteria | 1224 |
| 917 | Ga0501044_0010933 | 3300049823 | Bacteria | 9852 |
| 918 | Ga0501044_0103449 | 3300049823 | Bacteria | 2862 |
| 919 | Ga0501045_0005410 | 3300049824 | Bacteria | 8838 |
| 920 | Ga0501045_0013952 | 3300049824 | Bacteria | 5686 |
| 921 | Ga0501045_0233452 | 3300049824 | Bacteria | 1369 |
| 922 | nmdc:mga05p37_143791_c1 | 3300050507 | Bacteria | 2921 |
| 923 | nmdc:mga05p37_22307_c1 | 3300050507 | Bacteria | 7678 |
| 924 | nmdc:mga05p37_5266_c1 | 3300050507 | Bacteria | 15180 |
| 925 | nmdc:mga09592_10130_c1 | 3300050508 | Bacteria | 7669 |
| 926 | nmdc:mga09592_17045_c1 | 3300050508 | Bacteria | 5947 |
| 927 | nmdc:mga09592_187631_c1 | 3300050508 | Bacteria | 1789 |
| 928 | nmdc:mga0qj67_1822_c1 | 3300050509 | Bacteria | 15088 |
| 929 | nmdc:mga06r32_3_c1 | 3300050510 | Bacteria | 164616 |
| 930 | nmdc:mga06r32_607748_c1 | 3300050510 | Bacteria | 1064 |
| 931 | nmdc:mga06r32_723_c1 | 3300050510 | Bacteria | 28939 |
| 932 | nmdc:mga06r32_7892_c1 | 3300050510 | Bacteria | 9565 |
| 933 | nmdc:mga08y16_1352_c2 | 3300050511 | Bacteria | 15858 |
| 934 | nmdc:mga08y16_1397_c1 | 3300050511 | Bacteria | 24180 |
| 935 | nmdc:mga08y16_2729_c1 | 3300050511 | Bacteria | 18112 |
| 936 | nmdc:mga08y16_35820_c1 | 3300050511 | Bacteria | 5212 |
| 937 | nmdc:mga08y16_54834_c1 | 3300050511 | Bacteria | 4166 |
| 938 | nmdc:mga0n895_15568_c1 | 3300050512 | Bacteria | 6941 |
| 939 | nmdc:mga0n895_275505_c1 | 3300050512 | Bacteria | 1706 |
| 940 | nmdc:mga0rr50_360360_c1 | 3300050513 | Bacteria | 1224 |
| 941 | nmdc:mga08x19_24598_c1 | 3300050514 | Bacteria | 3745 |
| 942 | nmdc:mga0a205_320010_c1 | 3300050515 | Bacteria | 1422 |
| 943 | nmdc:mga0a205_9569_c1 | 3300050515 | Bacteria | 8869 |
| 944 | Ga0495601_0439319 | 3300053077 | Bacteria | 844 |
| 945 | Ga0500647_0188966 | 3300053091 | Bacteria | 941 |
| 946 | Ga0500583_0055940 | 3300053092 | Bacteria | 1846 |
| 947 | Ga0500583_0115452 | 3300053092 | Bacteria | 1325 |
| 948 | Ga0500583_0116461 | 3300053092 | Bacteria | 1320 |
| 949 | Ga0500583_0252765 | 3300053092 | Bacteria | 870 |
| 950 | Ga0500641_0018669 | 3300053096 | Bacteria | 2612 |
| 951 | Ga0500641_0116737 | 3300053096 | Bacteria | 1149 |
| 952 | Ga0500556_0001203 | 3300053104 | Bacteria | 12175 |
| 953 | Ga0500556_0035434 | 3300053104 | Bacteria | 1724 |
| 954 | Ga0500591_041053 | 3300053115 | Bacteria | 2201 |
| 955 | Ga0500568_0136382 | 3300053139 | Bacteria | 911 |
| 956 | Ga0500604_0097051 | 3300053151 | Bacteria | 968 |
| 957 | Ga0500616_0081400 | 3300053153 | Bacteria | 1626 |
| 958 | Ga0500622_0006363 | 3300053156 | Bacteria | 6876 |
| 959 | Ga0500637_0011591 | 3300053178 | Bacteria | 4566 |
| 960 | Ga0500637_0340543 | 3300053178 | Bacteria | 802 |
| 961 | Ga0501084_0014553 | 3300054114 | Bacteria | 6522 |
| 962 | Ga0501084_0021657 | 3300054114 | Bacteria | 5359 |
| 963 | Ga0501084_0030134 | 3300054114 | Bacteria | 4537 |
| 964 | Ga0501084_0117273 | 3300054114 | Bacteria | 2238 |
| 965 | Ga0501082_0000377 | 3300060353 | Bacteria | 39485 |
| 966 | Ga0501082_0001181 | 3300060353 | Bacteria | 22960 |
| 967 | Ga0501082_0147505 | 3300060353 | Bacteria | 2042 |
| 968 | Ga0501082_0156122 | 3300060353 | Bacteria | 1983 |
| 969 | Ga0530510_0014851 | 3300061734 | Bacteria | 5499 |
| 970 | Ga0530510_0015136 | 3300061734 | Bacteria | 5448 |
| 971 | Ga0530510_0043536 | 3300061734 | Bacteria | 3243 |
| 972 | Ga0530510_0351846 | 3300061734 | Bacteria | 1107 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0103449 | Ga0501044_0103449_63_695 | 210 |
| 2 | 3300049822 | Ga0501035_0356021 | Ga0501035_0356021_548_1186 | 212 |
| 3 | 3300049576 | Ga0501040_0457553 | Ga0501040_0457553_41_751 | 236 |
| 4 | 3300049592 | Ga0501076_0773428 | Ga0501076_0773428_30_740 | 236 |
| 5 | 3300005334 | Ga0068869_100051345 | Ga0068869_1000513453 | 242 |
| 6 | 3300005338 | Ga0068868_100129898 | Ga0068868_1001298983 | 242 |
| 7 | 3300005364 | Ga0070673_100167918 | Ga0070673_1001679183 | 242 |
| 8 | 3300005455 | Ga0070663_100172797 | Ga0070663_1001727972 | 242 |
| 9 | 3300005539 | Ga0068853_100340110 | Ga0068853_1003401102 | 242 |
| 10 | 3300005563 | Ga0068855_100493135 | Ga0068855_1004931352 | 242 |
| 11 | 3300005844 | Ga0068862_100705542 | Ga0068862_1007055422 | 242 |
| 12 | 3300006852 | Ga0075433_10323744 | Ga0075433_103237442 | 242 |
| 13 | 3300009545 | Ga0105237_10438750 | Ga0105237_104387502 | 242 |
| 14 | 3300013105 | Ga0157369_10878277 | Ga0157369_108782772 | 242 |
| 15 | 3300025942 | Ga0207689_10055034 | Ga0207689_100550342 | 242 |
| 16 | 3300049568 | Ga0501031_0016819 | Ga0501031_0016819_2159_2890 | 242 |
| 17 | 3300049568 | Ga0501031_0065908 | Ga0501031_0065908_549_1280 | 242 |
| 18 | 3300049569 | Ga0501032_0009038 | Ga0501032_0009038_3159_3890 | 242 |
| 19 | 3300049569 | Ga0501032_0017498 | Ga0501032_0017498_3149_3880 | 242 |
| 20 | 3300049569 | Ga0501032_0058180 | Ga0501032_0058180_1277_2008 | 242 |
| 21 | 3300049570 | Ga0501033_0001962 | Ga0501033_0001962_3955_4686 | 242 |
| 22 | 3300049570 | Ga0501033_0002169 | Ga0501033_0002169_14189_14920 | 242 |
| 23 | 3300049571 | Ga0501034_0040621 | Ga0501034_0040621_3564_4295 | 242 |
| 24 | 3300049572 | Ga0501036_0027084 | Ga0501036_0027084_301_1032 | 242 |
| 25 | 3300049572 | Ga0501036_0150021 | Ga0501036_0150021_86_817 | 242 |
| 26 | 3300049573 | Ga0501037_0072023 | Ga0501037_0072023_1014_1745 | 242 |
| 27 | 3300049574 | Ga0501038_0010561 | Ga0501038_0010561_5667_6398 | 242 |
| 28 | 3300049574 | Ga0501038_0030814 | Ga0501038_0030814_354_1085 | 242 |
| 29 | 3300049575 | Ga0501039_0235206 | Ga0501039_0235206_610_1341 | 242 |
| 30 | 3300049576 | Ga0501040_0014625 | Ga0501040_0014625_3189_3920 | 242 |
| 31 | 3300049579 | Ga0501043_0002998 | Ga0501043_0002998_8760_9491 | 242 |
| 32 | 3300049579 | Ga0501043_0022588 | Ga0501043_0022588_851_1582 | 242 |
| 33 | 3300049580 | Ga0501046_0009200 | Ga0501046_0009200_3606_4337 | 242 |
| 34 | 3300049581 | Ga0501047_0002955 | Ga0501047_0002955_313_1044 | 242 |
| 35 | 3300049582 | Ga0501048_0020173 | Ga0501048_0020173_3350_4081 | 242 |
| 36 | 3300049822 | Ga0501035_0000299 | Ga0501035_0000299_33102_33833 | 242 |
| 37 | 3300049822 | Ga0501035_0034004 | Ga0501035_0034004_2647_3378 | 242 |
| 38 | 3300049822 | Ga0501035_0084431 | Ga0501035_0084431_137_868 | 242 |
| 39 | 3300049823 | Ga0501044_0010933 | Ga0501044_0010933_4905_5636 | 242 |
| 40 | 3300049824 | Ga0501045_0013952 | Ga0501045_0013952_295_1026 | 242 |
| 41 | 3300050515 | nmdc:mga0a205_320010_c1 | nmdc:mga0a205_320010_c1_351_1109 | 242 |
| 42 | 3300005841 | Ga0068863_100600869 | Ga0068863_1006008692 | 243 |
| 43 | 3300042436 | Ga0439435_0041727 | Ga0439435_0041727_219_956 | 243 |
| 44 | 3300042461 | Ga0439460_0003422 | Ga0439460_0003422_2980_3717 | 243 |
| 45 | 3300046539 | Ga0495621_0033003 | Ga0495621_0033003_169_906 | 243 |
| 46 | 3300005719 | Ga0068861_100626615 | Ga0068861_1006266151 | 244 |
| 47 | 3300041486 | Ga0451807_1381746 | Ga0451807_1381746_289_1029 | 244 |
| 48 | 3300049587 | Ga0501071_0502765 | Ga0501071_0502765_63_800 | 244 |
| 49 | 3300061734 | Ga0530510_0351846 | Ga0530510_0351846_27_764 | 244 |
| 50 | iso_pu_bacteria | 2952252522 | 2952253991 | 244 |
| 51 | 3300005577 | Ga0068857_100056428 | Ga0068857_1000564284 | 245 |
| 52 | 3300006852 | Ga0075433_10003048 | Ga0075433_100030484 | 245 |
| 53 | 3300006871 | Ga0075434_100000232 | Ga0075434_10000023220 | 245 |
| 54 | 3300006880 | Ga0075429_100102089 | Ga0075429_1001020892 | 245 |
| 55 | 3300007076 | Ga0075435_100106215 | Ga0075435_1001062151 | 245 |
| 56 | 3300009094 | Ga0111539_10008124 | Ga0111539_1000812410 | 245 |
| 57 | 3300014326 | Ga0157380_10007215 | Ga0157380_100072153 | 245 |
| 58 | 3300014326 | Ga0157380_10211066 | Ga0157380_102110662 | 245 |
| 59 | 3300025923 | Ga0207681_10115754 | Ga0207681_101157543 | 245 |
| 60 | 3300027907 | Ga0207428_10020710 | Ga0207428_100207104 | 245 |
| 61 | 3300048907 | Ga0496104_0743459 | Ga0496104_0743459_93_830 | 245 |
| 62 | 3300049583 | Ga0501067_0001759 | Ga0501067_0001759_5881_6621 | 245 |
| 63 | 3300049589 | Ga0501073_0006481 | Ga0501073_0006481_2482_3222 | 245 |
| 64 | 3300049590 | Ga0501074_0006517 | Ga0501074_0006517_7433_8173 | 245 |
| 65 | 3300049593 | Ga0501077_0004986 | Ga0501077_0004986_6135_6875 | 245 |
| 66 | 3300049741 | Ga0501079_0243772 | Ga0501079_0243772_375_1115 | 245 |
| 67 | 3300049742 | Ga0501080_0002453 | Ga0501080_0002453_9187_9927 | 245 |
| 68 | 3300050507 | nmdc:mga05p37_143791_c1 | nmdc:mga05p37_143791_c1_1529_2269 | 245 |
| 69 | 3300050511 | nmdc:mga08y16_1352_c2 | nmdc:mga08y16_1352_c2_2534_3274 | 245 |
| 70 | 3300050512 | nmdc:mga0n895_15568_c1 | nmdc:mga0n895_15568_c1_5203_5943 | 245 |
| 71 | 3300050513 | nmdc:mga0rr50_360360_c1 | nmdc:mga0rr50_360360_c1_455_1195 | 245 |
| 72 | 3300050515 | nmdc:mga0a205_9569_c1 | nmdc:mga0a205_9569_c1_446_1186 | 245 |
| 73 | 3300054114 | Ga0501084_0014553 | Ga0501084_0014553_4495_5235 | 245 |
| 74 | 3300060353 | Ga0501082_0001181 | Ga0501082_0001181_9065_9805 | 245 |
| 75 | iso_pu_bacteria | 2738541276 | 2738714500 | 245 |
| 76 | iso_pu_bacteria | 2894510363 | 2894512618 | 245 |
| 77 | 3300005336 | Ga0070680_100054620 | Ga0070680_1000546203 | 246 |
| 78 | 3300005338 | Ga0068868_100086997 | Ga0068868_1000869973 | 246 |
| 79 | 3300005354 | Ga0070675_100290096 | Ga0070675_1002900961 | 246 |
| 80 | 3300005355 | Ga0070671_100167304 | Ga0070671_1001673042 | 246 |
| 81 | 3300005435 | Ga0070714_100004766 | Ga0070714_1000047666 | 246 |
| 82 | 3300005436 | Ga0070713_100006160 | Ga0070713_1000061604 | 246 |
| 83 | 3300005458 | Ga0070681_10001348 | Ga0070681_1000134815 | 246 |
| 84 | 3300005539 | Ga0068853_100167176 | Ga0068853_1001671763 | 246 |
| 85 | 3300005563 | Ga0068855_100018420 | Ga0068855_1000184206 | 246 |
| 86 | 3300005577 | Ga0068857_100924288 | Ga0068857_1009242881 | 246 |
| 87 | 3300005614 | Ga0068856_100654296 | Ga0068856_1006542961 | 246 |
| 88 | 3300005616 | Ga0068852_100066436 | Ga0068852_1000664364 | 246 |
| 89 | 3300006175 | Ga0070712_100279500 | Ga0070712_1002795001 | 246 |
| 90 | 3300006358 | Ga0068871_100105179 | Ga0068871_1001051792 | 246 |
| 91 | 3300006847 | Ga0075431_100099414 | Ga0075431_1000994143 | 246 |
| 92 | 3300006914 | Ga0075436_100067546 | Ga0075436_1000675463 | 246 |
| 93 | 3300009093 | Ga0105240_10433327 | Ga0105240_104333272 | 246 |
| 94 | 3300009174 | Ga0105241_10016405 | Ga0105241_100164053 | 246 |
| 95 | 3300009545 | Ga0105237_10004492 | Ga0105237_100044923 | 246 |
| 96 | 3300010375 | Ga0105239_10008633 | Ga0105239_1000863310 | 246 |
| 97 | 3300011119 | Ga0105246_10128221 | Ga0105246_101282213 | 246 |
| 98 | 3300014969 | Ga0157376_10520408 | Ga0157376_105204082 | 246 |
| 99 | 3300021377 | Ga0213874_10011572 | Ga0213874_100115723 | 246 |
| 100 | 3300025911 | Ga0207654_10032147 | Ga0207654_100321473 | 246 |
| 101 | 3300025912 | Ga0207707_10051030 | Ga0207707_100510301 | 246 |
| 102 | 3300025914 | Ga0207671_10006805 | Ga0207671_100068053 | 246 |
| 103 | 3300025915 | Ga0207693_10089004 | Ga0207693_100890043 | 246 |
| 104 | 3300025917 | Ga0207660_10026586 | Ga0207660_100265864 | 246 |
| 105 | 3300025929 | Ga0207664_10016012 | Ga0207664_100160123 | 246 |
| 106 | 3300025932 | Ga0207690_10015790 | Ga0207690_100157904 | 246 |
| 107 | 3300025949 | Ga0207667_10044202 | Ga0207667_100442024 | 246 |
| 108 | 3300026116 | Ga0207674_10806391 | Ga0207674_108063911 | 246 |
| 109 | 3300036401 | Ga0373937_0169112 | Ga0373937_0169112_167_913 | 246 |
| 110 | 3300039110 | Ga0400487_64772 | Ga0400487_64772_4240_4980 | 246 |
| 111 | 3300039450 | Ga0436363_0167267 | Ga0436363_0167267_1435_2175 | 246 |
| 112 | 3300048907 | Ga0496104_0408134 | Ga0496104_0408134_422_1168 | 246 |
| 113 | 3300048909 | Ga0496106_0242529 | Ga0496106_0242529_103_843 | 246 |
| 114 | 3300050514 | nmdc:mga08x19_24598_c1 | nmdc:mga08x19_24598_c1_795_1535 | 246 |
| 115 | iso_pu_bacteria | 2537561728 | 2538427134 | 246 |
| 116 | iso_pu_bacteria | 2847085930 | 2847089590 | 246 |
| 117 | iso_pu_bacteria | 2854601825 | 2854604825 | 246 |
| 118 | iso_pu_bacteria | 2855195626 | 2855196508 | 246 |
| 119 | iso_pu_bacteria | 2858466076 | 2858467767 | 246 |
| 120 | iso_pu_bacteria | 2871272651 | 2871276620 | 246 |
| 121 | iso_pu_bacteria | 2871282230 | 2871283599 | 246 |
| 122 | iso_pu_bacteria | 2881714928 | 2881715686 | 246 |
| 123 | iso_pu_bacteria | 2900051742 | 2900055307 | 246 |
| 124 | iso_pu_bacteria | 2908669403 | 2908674542 | 246 |
| 125 | iso_pu_bacteria | 3000376612 | 3000376635 | 246 |
| 126 | 3300005336 | Ga0070680_100028196 | Ga0070680_1000281965 | 247 |
| 127 | 3300005336 | Ga0070680_100090221 | Ga0070680_1000902213 | 247 |
| 128 | 3300005336 | Ga0070680_100164337 | Ga0070680_1001643372 | 247 |
| 129 | 3300005436 | Ga0070713_100257557 | Ga0070713_1002575572 | 247 |
| 130 | 3300005458 | Ga0070681_10002296 | Ga0070681_100022964 | 247 |
| 131 | 3300005458 | Ga0070681_10023527 | Ga0070681_100235273 | 247 |
| 132 | 3300005458 | Ga0070681_10189019 | Ga0070681_101890193 | 247 |
| 133 | 3300005530 | Ga0070679_100004511 | Ga0070679_1000045114 | 247 |
| 134 | 3300005530 | Ga0070679_100033547 | Ga0070679_1000335473 | 247 |
| 135 | 3300005563 | Ga0068855_100010581 | Ga0068855_1000105813 | 247 |
| 136 | 3300005564 | Ga0070664_100729740 | Ga0070664_1007297401 | 247 |
| 137 | 3300005614 | Ga0068856_100104780 | Ga0068856_1001047802 | 247 |
| 138 | 3300006846 | Ga0075430_100002285 | Ga0075430_10000228516 | 247 |
| 139 | 3300009093 | Ga0105240_10003170 | Ga0105240_100031706 | 247 |
| 140 | 3300009093 | Ga0105240_10046522 | Ga0105240_100465224 | 247 |
| 141 | 3300009093 | Ga0105240_10464784 | Ga0105240_104647842 | 247 |
| 142 | 3300009551 | Ga0105238_10010242 | Ga0105238_100102428 | 247 |
| 143 | 3300009551 | Ga0105238_10018185 | Ga0105238_100181856 | 247 |
| 144 | 3300009551 | Ga0105238_10351667 | Ga0105238_103516672 | 247 |
| 145 | 3300011119 | Ga0105246_10624837 | Ga0105246_106248371 | 247 |
| 146 | 3300013104 | Ga0157370_10005200 | Ga0157370_1000520010 | 247 |
| 147 | 3300013105 | Ga0157369_10002574 | Ga0157369_1000257418 | 247 |
| 148 | 3300013307 | Ga0157372_10102320 | Ga0157372_101023203 | 247 |
| 149 | 3300014969 | Ga0157376_10426199 | Ga0157376_104261992 | 247 |
| 150 | 3300025912 | Ga0207707_10002757 | Ga0207707_100027576 | 247 |
| 151 | 3300025912 | Ga0207707_10012435 | Ga0207707_100124353 | 247 |
| 152 | 3300025912 | Ga0207707_10039399 | Ga0207707_100393992 | 247 |
| 153 | 3300025913 | Ga0207695_10004668 | Ga0207695_1000466812 | 247 |
| 154 | 3300025917 | Ga0207660_10011059 | Ga0207660_100110594 | 247 |
| 155 | 3300025917 | Ga0207660_10149945 | Ga0207660_101499451 | 247 |
| 156 | 3300025917 | Ga0207660_10382007 | Ga0207660_103820071 | 247 |
| 157 | 3300025921 | Ga0207652_10014707 | Ga0207652_100147076 | 247 |
| 158 | 3300025921 | Ga0207652_10026377 | Ga0207652_100263774 | 247 |
| 159 | 3300025921 | Ga0207652_10149928 | Ga0207652_101499281 | 247 |
| 160 | 3300025924 | Ga0207694_10033760 | Ga0207694_100337604 | 247 |
| 161 | 3300025928 | Ga0207700_10020950 | Ga0207700_100209505 | 247 |
| 162 | 3300025939 | Ga0207665_10079043 | Ga0207665_100790431 | 247 |
| 163 | 3300025942 | Ga0207689_10207475 | Ga0207689_102074752 | 247 |
| 164 | 3300025945 | Ga0207679_10532410 | Ga0207679_105324101 | 247 |
| 165 | 3300025949 | Ga0207667_10041830 | Ga0207667_100418303 | 247 |
| 166 | 3300025981 | Ga0207640_10463668 | Ga0207640_104636682 | 247 |
| 167 | 3300031344 | Ga0265316_10017357 | Ga0265316_100173573 | 247 |
| 168 | 3300031711 | Ga0265314_10157873 | Ga0265314_101578732 | 247 |
| 169 | 3300031911 | Ga0307412_10064544 | Ga0307412_100645441 | 247 |
| 170 | 3300035111 | Ga0373923_0079343 | Ga0373923_0079343_625_1371 | 247 |
| 171 | 3300035410 | Ga0373924_0140036 | Ga0373924_0140036_225_968 | 247 |
| 172 | 3300042530 | Ga0450916_023519 | Ga0450916_023519_24_767 | 247 |
| 173 | 3300048903 | Ga0496100_0100436 | Ga0496100_0100436_691_1437 | 247 |
| 174 | 3300048907 | Ga0496104_0001674 | Ga0496104_0001674_421_1167 | 247 |
| 175 | 3300048908 | Ga0496105_0039326 | Ga0496105_0039326_447_1193 | 247 |
| 176 | 3300048917 | Ga0496114_0009790 | Ga0496114_0009790_2790_3536 | 247 |
| 177 | 3300048918 | Ga0496115_0020318 | Ga0496115_0020318_1674_2420 | 247 |
| 178 | 3300049569 | Ga0501032_0137838 | Ga0501032_0137838_177_923 | 247 |
| 179 | 3300049573 | Ga0501037_0005208 | Ga0501037_0005208_459_1205 | 247 |
| 180 | 3300049573 | Ga0501037_0023752 | Ga0501037_0023752_222_968 | 247 |
| 181 | 3300049574 | Ga0501038_0004629 | Ga0501038_0004629_4493_5239 | 247 |
| 182 | 3300049578 | Ga0501042_0502305 | Ga0501042_0502305_94_840 | 247 |
| 183 | 3300049580 | Ga0501046_0003961 | Ga0501046_0003961_12153_12899 | 247 |
| 184 | 3300049586 | Ga0501070_0010882 | Ga0501070_0010882_1897_2643 | 247 |
| 185 | 3300049586 | Ga0501070_0091062 | Ga0501070_0091062_1763_2509 | 247 |
| 186 | 3300049586 | Ga0501070_0176934 | Ga0501070_0176934_65_811 | 247 |
| 187 | 3300049590 | Ga0501074_0000179 | Ga0501074_0000179_5907_6653 | 247 |
| 188 | 3300049590 | Ga0501074_0365329 | Ga0501074_0365329_34_780 | 247 |
| 189 | 3300049591 | Ga0501075_0219032 | Ga0501075_0219032_595_1341 | 247 |
| 190 | 3300049742 | Ga0501080_0015622 | Ga0501080_0015622_1867_2613 | 247 |
| 191 | 3300050508 | nmdc:mga09592_187631_c1 | nmdc:mga09592_187631_c1_916_1659 | 247 |
| 192 | 3300050509 | nmdc:mga0qj67_1822_c1 | nmdc:mga0qj67_1822_c1_12980_13723 | 247 |
| 193 | 3300050510 | nmdc:mga06r32_723_c1 | nmdc:mga06r32_723_c1_4499_5242 | 247 |
| 194 | 3300053077 | Ga0495601_0439319 | Ga0495601_0439319_78_824 | 247 |
| 195 | 3300053153 | Ga0500616_0081400 | Ga0500616_0081400_602_1348 | 247 |
| 196 | 3300003323 | rootH1_10014283 | rootH1_100142831 | 248 |
| 197 | 3300003323 | rootH1_10028592 | rootH1_100285923 | 248 |
| 198 | 3300005290 | Ga0065712_10305094 | Ga0065712_103050941 | 248 |
| 199 | 3300005293 | Ga0065715_10135706 | Ga0065715_101357062 | 248 |
| 200 | 3300005330 | Ga0070690_100001308 | Ga0070690_10000130810 | 248 |
| 201 | 3300005331 | Ga0070670_100024081 | Ga0070670_1000240813 | 248 |
| 202 | 3300005331 | Ga0070670_100153902 | Ga0070670_1001539023 | 248 |
| 203 | 3300005334 | Ga0068869_100023174 | Ga0068869_1000231742 | 248 |
| 204 | 3300005335 | Ga0070666_10011341 | Ga0070666_100113413 | 248 |
| 205 | 3300005337 | Ga0070682_100114136 | Ga0070682_1001141363 | 248 |
| 206 | 3300005338 | Ga0068868_100013212 | Ga0068868_1000132122 | 248 |
| 207 | 3300005340 | Ga0070689_100005729 | Ga0070689_1000057292 | 248 |
| 208 | 3300005341 | Ga0070691_10254984 | Ga0070691_102549841 | 248 |
| 209 | 3300005343 | Ga0070687_100413822 | Ga0070687_1004138221 | 248 |
| 210 | 3300005344 | Ga0070661_100001052 | Ga0070661_1000010529 | 248 |
| 211 | 3300005345 | Ga0070692_10042220 | Ga0070692_100422203 | 248 |
| 212 | 3300005347 | Ga0070668_100003202 | Ga0070668_1000032029 | 248 |
| 213 | 3300005353 | Ga0070669_100282176 | Ga0070669_1002821762 | 248 |
| 214 | 3300005354 | Ga0070675_100001328 | Ga0070675_1000013283 | 248 |
| 215 | 3300005355 | Ga0070671_100024020 | Ga0070671_1000240204 | 248 |
| 216 | 3300005355 | Ga0070671_100129961 | Ga0070671_1001299612 | 248 |
| 217 | 3300005364 | Ga0070673_100111056 | Ga0070673_1001110563 | 248 |
| 218 | 3300005364 | Ga0070673_100401894 | Ga0070673_1004018942 | 248 |
| 219 | 3300005365 | Ga0070688_100012489 | Ga0070688_1000124893 | 248 |
| 220 | 3300005367 | Ga0070667_100027211 | Ga0070667_1000272112 | 248 |
| 221 | 3300005406 | Ga0070703_10045907 | Ga0070703_100459072 | 248 |
| 222 | 3300005434 | Ga0070709_10037973 | Ga0070709_100379733 | 248 |
| 223 | 3300005436 | Ga0070713_100000427 | Ga0070713_1000004277 | 248 |
| 224 | 3300005437 | Ga0070710_10048629 | Ga0070710_100486293 | 248 |
| 225 | 3300005440 | Ga0070705_100022150 | Ga0070705_1000221503 | 248 |
| 226 | 3300005441 | Ga0070700_100009378 | Ga0070700_1000093783 | 248 |
| 227 | 3300005441 | Ga0070700_100056935 | Ga0070700_1000569353 | 248 |
| 228 | 3300005456 | Ga0070678_100045854 | Ga0070678_1000458543 | 248 |
| 229 | 3300005456 | Ga0070678_100376492 | Ga0070678_1003764922 | 248 |
| 230 | 3300005457 | Ga0070662_100010889 | Ga0070662_1000108894 | 248 |
| 231 | 3300005458 | Ga0070681_10150026 | Ga0070681_101500263 | 248 |
| 232 | 3300005459 | Ga0068867_100053916 | Ga0068867_1000539162 | 248 |
| 233 | 3300005535 | Ga0070684_100000450 | Ga0070684_10000045021 | 248 |
| 234 | 3300005539 | Ga0068853_100235792 | Ga0068853_1002357923 | 248 |
| 235 | 3300005539 | Ga0068853_100552262 | Ga0068853_1005522621 | 248 |
| 236 | 3300005544 | Ga0070686_100001533 | Ga0070686_1000015339 | 248 |
| 237 | 3300005546 | Ga0070696_100160333 | Ga0070696_1001603332 | 248 |
| 238 | 3300005547 | Ga0070693_100120387 | Ga0070693_1001203872 | 248 |
| 239 | 3300005547 | Ga0070693_100358274 | Ga0070693_1003582742 | 248 |
| 240 | 3300005548 | Ga0070665_100014187 | Ga0070665_1000141877 | 248 |
| 241 | 3300005548 | Ga0070665_100091910 | Ga0070665_1000919102 | 248 |
| 242 | 3300005564 | Ga0070664_100004843 | Ga0070664_1000048437 | 248 |
| 243 | 3300005577 | Ga0068857_100012480 | Ga0068857_1000124806 | 248 |
| 244 | 3300005577 | Ga0068857_100056677 | Ga0068857_1000566772 | 248 |
| 245 | 3300005578 | Ga0068854_100154918 | Ga0068854_1001549183 | 248 |
| 246 | 3300005614 | Ga0068856_100031587 | Ga0068856_1000315873 | 248 |
| 247 | 3300005615 | Ga0070702_100000186 | Ga0070702_10000018619 | 248 |
| 248 | 3300005617 | Ga0068859_100006805 | Ga0068859_1000068055 | 248 |
| 249 | 3300005618 | Ga0068864_100000569 | Ga0068864_10000056932 | 248 |
| 250 | 3300005718 | Ga0068866_10005217 | Ga0068866_100052173 | 248 |
| 251 | 3300005718 | Ga0068866_10019334 | Ga0068866_100193343 | 248 |
| 252 | 3300005719 | Ga0068861_100008511 | Ga0068861_1000085113 | 248 |
| 253 | 3300005719 | Ga0068861_100324468 | Ga0068861_1003244682 | 248 |
| 254 | 3300005840 | Ga0068870_10010262 | Ga0068870_100102624 | 248 |
| 255 | 3300005840 | Ga0068870_10017903 | Ga0068870_100179033 | 248 |
| 256 | 3300005841 | Ga0068863_100001625 | Ga0068863_10000162521 | 248 |
| 257 | 3300005841 | Ga0068863_100026511 | Ga0068863_1000265115 | 248 |
| 258 | 3300005842 | Ga0068858_100011034 | Ga0068858_1000110344 | 248 |
| 259 | 3300005842 | Ga0068858_100018633 | Ga0068858_1000186334 | 248 |
| 260 | 3300005843 | Ga0068860_100022938 | Ga0068860_1000229383 | 248 |
| 261 | 3300005843 | Ga0068860_100090774 | Ga0068860_1000907743 | 248 |
| 262 | 3300005844 | Ga0068862_100005736 | Ga0068862_1000057366 | 248 |
| 263 | 3300005844 | Ga0068862_100007875 | Ga0068862_1000078759 | 248 |
| 264 | 3300005844 | Ga0068862_100088203 | Ga0068862_1000882031 | 248 |
| 265 | 3300005985 | Ga0081539_10000055 | Ga0081539_1000005538 | 248 |
| 266 | 3300006163 | Ga0070715_10018578 | Ga0070715_100185783 | 248 |
| 267 | 3300006175 | Ga0070712_100011174 | Ga0070712_1000111742 | 248 |
| 268 | 3300006237 | Ga0097621_100026403 | Ga0097621_1000264033 | 248 |
| 269 | 3300006237 | Ga0097621_100128650 | Ga0097621_1001286503 | 248 |
| 270 | 3300006358 | Ga0068871_100012023 | Ga0068871_1000120234 | 248 |
| 271 | 3300006358 | Ga0068871_100057094 | Ga0068871_1000570943 | 248 |
| 272 | 3300006844 | Ga0075428_100005915 | Ga0075428_1000059157 | 248 |
| 273 | 3300006844 | Ga0075428_100006185 | Ga0075428_1000061853 | 248 |
| 274 | 3300006846 | Ga0075430_100134949 | Ga0075430_1001349492 | 248 |
| 275 | 3300006847 | Ga0075431_100000121 | Ga0075431_10000012146 | 248 |
| 276 | 3300006871 | Ga0075434_100187109 | Ga0075434_1001871094 | 248 |
| 277 | 3300006880 | Ga0075429_100002068 | Ga0075429_10000206811 | 248 |
| 278 | 3300006880 | Ga0075429_100008661 | Ga0075429_1000086619 | 248 |
| 279 | 3300006881 | Ga0068865_100105300 | Ga0068865_1001053002 | 248 |
| 280 | 3300006931 | Ga0097620_100006805 | Ga0097620_10000680511 | 248 |
| 281 | 3300009092 | Ga0105250_10041763 | Ga0105250_100417632 | 248 |
| 282 | 3300009093 | Ga0105240_10235603 | Ga0105240_102356032 | 248 |
| 283 | 3300009094 | Ga0111539_10000695 | Ga0111539_1000069525 | 248 |
| 284 | 3300009094 | Ga0111539_10021812 | Ga0111539_100218129 | 248 |
| 285 | 3300009094 | Ga0111539_10105971 | Ga0111539_101059713 | 248 |
| 286 | 3300009098 | Ga0105245_10011359 | Ga0105245_100113592 | 248 |
| 287 | 3300009101 | Ga0105247_10364793 | Ga0105247_103647931 | 248 |
| 288 | 3300009147 | Ga0114129_10000366 | Ga0114129_1000036636 | 248 |
| 289 | 3300009147 | Ga0114129_10006307 | Ga0114129_100063073 | 248 |
| 290 | 3300009148 | Ga0105243_10055051 | Ga0105243_100550513 | 248 |
| 291 | 3300009176 | Ga0105242_10000669 | Ga0105242_100006695 | 248 |
| 292 | 3300009177 | Ga0105248_10012530 | Ga0105248_100125306 | 248 |
| 293 | 3300009177 | Ga0105248_10099252 | Ga0105248_100992523 | 248 |
| 294 | 3300009545 | Ga0105237_10075434 | Ga0105237_100754343 | 248 |
| 295 | 3300009553 | Ga0105249_10012849 | Ga0105249_100128494 | 248 |
| 296 | 3300009553 | Ga0105249_10015074 | Ga0105249_100150745 | 248 |
| 297 | 3300010375 | Ga0105239_10013474 | Ga0105239_100134744 | 248 |
| 298 | 3300013296 | Ga0157374_10043408 | Ga0157374_100434084 | 248 |
| 299 | 3300013297 | Ga0157378_10009323 | Ga0157378_100093234 | 248 |
| 300 | 3300013306 | Ga0163162_10078807 | Ga0163162_100788072 | 248 |
| 301 | 3300013306 | Ga0163162_10171019 | Ga0163162_101710193 | 248 |
| 302 | 3300013308 | Ga0157375_10063389 | Ga0157375_100633894 | 248 |
| 303 | 3300013308 | Ga0157375_10100055 | Ga0157375_101000554 | 248 |
| 304 | 3300014325 | Ga0163163_10003280 | Ga0163163_1000328015 | 248 |
| 305 | 3300014325 | Ga0163163_10326054 | Ga0163163_103260542 | 248 |
| 306 | 3300014326 | Ga0157380_10947564 | Ga0157380_109475641 | 248 |
| 307 | 3300014745 | Ga0157377_10003532 | Ga0157377_100035321 | 248 |
| 308 | 3300014968 | Ga0157379_10010150 | Ga0157379_100101501 | 248 |
| 309 | 3300014968 | Ga0157379_10177226 | Ga0157379_101772263 | 248 |
| 310 | 3300014969 | Ga0157376_10155559 | Ga0157376_101555591 | 248 |
| 311 | 3300017792 | Ga0163161_10045444 | Ga0163161_100454443 | 248 |
| 312 | 3300025893 | Ga0207682_10119262 | Ga0207682_101192622 | 248 |
| 313 | 3300025898 | Ga0207692_10050767 | Ga0207692_100507672 | 248 |
| 314 | 3300025899 | Ga0207642_10048092 | Ga0207642_100480922 | 248 |
| 315 | 3300025900 | Ga0207710_10177938 | Ga0207710_101779381 | 248 |
| 316 | 3300025901 | Ga0207688_10039365 | Ga0207688_100393651 | 248 |
| 317 | 3300025903 | Ga0207680_10103673 | Ga0207680_101036732 | 248 |
| 318 | 3300025905 | Ga0207685_10001569 | Ga0207685_100015695 | 248 |
| 319 | 3300025907 | Ga0207645_10006379 | Ga0207645_100063796 | 248 |
| 320 | 3300025907 | Ga0207645_10037104 | Ga0207645_100371044 | 248 |
| 321 | 3300025908 | Ga0207643_10030346 | Ga0207643_100303463 | 248 |
| 322 | 3300025908 | Ga0207643_10051590 | Ga0207643_100515903 | 248 |
| 323 | 3300025913 | Ga0207695_10393396 | Ga0207695_103933962 | 248 |
| 324 | 3300025914 | Ga0207671_10047416 | Ga0207671_100474163 | 248 |
| 325 | 3300025915 | Ga0207693_10000074 | Ga0207693_100000745 | 248 |
| 326 | 3300025925 | Ga0207650_10009452 | Ga0207650_100094527 | 248 |
| 327 | 3300025925 | Ga0207650_10078685 | Ga0207650_100786853 | 248 |
| 328 | 3300025926 | Ga0207659_10001788 | Ga0207659_1000178812 | 248 |
| 329 | 3300025928 | Ga0207700_10020981 | Ga0207700_100209815 | 248 |
| 330 | 3300025931 | Ga0207644_10297609 | Ga0207644_102976092 | 248 |
| 331 | 3300025931 | Ga0207644_10582584 | Ga0207644_105825842 | 248 |
| 332 | 3300025933 | Ga0207706_10002530 | Ga0207706_100025306 | 248 |
| 333 | 3300025936 | Ga0207670_10013656 | Ga0207670_100136563 | 248 |
| 334 | 3300025937 | Ga0207669_10363665 | Ga0207669_103636652 | 248 |
| 335 | 3300025938 | Ga0207704_10391816 | Ga0207704_103918162 | 248 |
| 336 | 3300025940 | Ga0207691_10035704 | Ga0207691_100357044 | 248 |
| 337 | 3300025941 | Ga0207711_10174290 | Ga0207711_101742902 | 248 |
| 338 | 3300025941 | Ga0207711_10365702 | Ga0207711_103657022 | 248 |
| 339 | 3300025942 | Ga0207689_10011724 | Ga0207689_100117247 | 248 |
| 340 | 3300025942 | Ga0207689_10038860 | Ga0207689_100388604 | 248 |
| 341 | 3300025945 | Ga0207679_10012127 | Ga0207679_100121277 | 248 |
| 342 | 3300025960 | Ga0207651_10003822 | Ga0207651_100038224 | 248 |
| 343 | 3300025960 | Ga0207651_10205030 | Ga0207651_102050302 | 248 |
| 344 | 3300025972 | Ga0207668_10431600 | Ga0207668_104316002 | 248 |
| 345 | 3300025981 | Ga0207640_10128977 | Ga0207640_101289772 | 248 |
| 346 | 3300025986 | Ga0207658_10009061 | Ga0207658_100090612 | 248 |
| 347 | 3300026023 | Ga0207677_10020310 | Ga0207677_100203103 | 248 |
| 348 | 3300026035 | Ga0207703_10056126 | Ga0207703_100561263 | 248 |
| 349 | 3300026075 | Ga0207708_10073963 | Ga0207708_100739633 | 248 |
| 350 | 3300026075 | Ga0207708_10091053 | Ga0207708_100910532 | 248 |
| 351 | 3300026078 | Ga0207702_10365921 | Ga0207702_103659212 | 248 |
| 352 | 3300026088 | Ga0207641_10004671 | Ga0207641_1000467112 | 248 |
| 353 | 3300026088 | Ga0207641_10867051 | Ga0207641_108670511 | 248 |
| 354 | 3300026089 | Ga0207648_10000935 | Ga0207648_100009358 | 248 |
| 355 | 3300026095 | Ga0207676_10005840 | Ga0207676_100058403 | 248 |
| 356 | 3300026116 | Ga0207674_10006902 | Ga0207674_100069026 | 248 |
| 357 | 3300026116 | Ga0207674_10034124 | Ga0207674_100341246 | 248 |
| 358 | 3300026118 | Ga0207675_100003493 | Ga0207675_10000349312 | 248 |
| 359 | 3300026118 | Ga0207675_100013127 | Ga0207675_1000131276 | 248 |
| 360 | 3300026121 | Ga0207683_10011548 | Ga0207683_100115486 | 248 |
| 361 | 3300026121 | Ga0207683_10044662 | Ga0207683_100446624 | 248 |
| 362 | 3300027907 | Ga0207428_10006432 | Ga0207428_100064323 | 248 |
| 363 | 3300027907 | Ga0207428_10146709 | Ga0207428_101467093 | 248 |
| 364 | 3300028379 | Ga0268266_10079927 | Ga0268266_100799273 | 248 |
| 365 | 3300028379 | Ga0268266_10147562 | Ga0268266_101475621 | 248 |
| 366 | 3300028380 | Ga0268265_10006378 | Ga0268265_100063787 | 248 |
| 367 | 3300028380 | Ga0268265_10007283 | Ga0268265_100072833 | 248 |
| 368 | 3300028380 | Ga0268265_10054548 | Ga0268265_100545483 | 248 |
| 369 | 3300028381 | Ga0268264_10014381 | Ga0268264_100143817 | 248 |
| 370 | 3300028381 | Ga0268264_10014471 | Ga0268264_100144716 | 248 |
| 371 | 3300028800 | Ga0265338_10027853 | Ga0265338_100278533 | 248 |
| 372 | 3300031247 | Ga0265340_10094566 | Ga0265340_100945662 | 248 |
| 373 | 3300031250 | Ga0265331_10048701 | Ga0265331_100487012 | 248 |
| 374 | 3300031250 | Ga0265331_10061162 | Ga0265331_100611622 | 248 |
| 375 | 3300031251 | Ga0265327_10023520 | Ga0265327_100235203 | 248 |
| 376 | 3300031548 | Ga0307408_100079655 | Ga0307408_1000796553 | 248 |
| 377 | 3300031548 | Ga0307408_100081595 | Ga0307408_1000815953 | 248 |
| 378 | 3300031548 | Ga0307408_100205798 | Ga0307408_1002057982 | 248 |
| 379 | 3300031548 | Ga0307408_100217869 | Ga0307408_1002178692 | 248 |
| 380 | 3300031665 | Ga0316575_10000129 | Ga0316575_1000012911 | 248 |
| 381 | 3300031665 | Ga0316575_10038185 | Ga0316575_100381851 | 248 |
| 382 | 3300031691 | Ga0316579_10000530 | Ga0316579_100005304 | 248 |
| 383 | 3300031727 | Ga0316576_10086505 | Ga0316576_100865052 | 248 |
| 384 | 3300031728 | Ga0316578_10001988 | Ga0316578_100019883 | 248 |
| 385 | 3300031728 | Ga0316578_10034205 | Ga0316578_100342053 | 248 |
| 386 | 3300031733 | Ga0316577_10000014 | Ga0316577_1000001425 | 248 |
| 387 | 3300032002 | Ga0307416_101110218 | Ga0307416_1011102181 | 248 |
| 388 | 3300032005 | Ga0307411_10154891 | Ga0307411_101548912 | 248 |
| 389 | 3300032005 | Ga0307411_10204014 | Ga0307411_102040142 | 248 |
| 390 | 3300032139 | Ga0316580_10000397 | Ga0316580_1000039710 | 248 |
| 391 | 3300032168 | Ga0316593_10007758 | Ga0316593_100077581 | 248 |
| 392 | 3300032168 | Ga0316593_10052677 | Ga0316593_100526772 | 248 |
| 393 | 3300032168 | Ga0316593_10056053 | Ga0316593_100560532 | 248 |
| 394 | 3300033541 | Ga0316596_1009091 | Ga0316596_10090913 | 248 |
| 395 | 3300035113 | Ga0373936_0113824 | Ga0373936_0113824_339_1085 | 248 |
| 396 | 3300035118 | Ga0373954_0142474 | Ga0373954_0142474_65_811 | 248 |
| 397 | 3300035172 | Ga0373955_0038198 | Ga0373955_0038198_1243_1989 | 248 |
| 398 | 3300035398 | Ga0316574_0018258 | Ga0316574_0018258_491_1240 | 248 |
| 399 | 3300035398 | Ga0316574_0103484 | Ga0316574_0103484_837_1592 | 248 |
| 400 | 3300035692 | Ga0373935_0245210 | Ga0373935_0245210_305_1051 | 248 |
| 401 | 3300035695 | Ga0373927_0012200 | Ga0373927_0012200_2386_3132 | 248 |
| 402 | 3300036401 | Ga0373937_0056366 | Ga0373937_0056366_1243_1989 | 248 |
| 403 | 3300036647 | Ga0316582_0000288 | Ga0316582_0000288_10292_11041 | 248 |
| 404 | 3300036712 | Ga0316584_0007546 | Ga0316584_0007546_6212_6961 | 248 |
| 405 | 3300036712 | Ga0316584_0062510 | Ga0316584_0062510_1820_2566 | 248 |
| 406 | 3300036712 | Ga0316584_0065155 | Ga0316584_0065155_1339_2088 | 248 |
| 407 | 3300037068 | Ga0373925_0192347 | Ga0373925_0192347_677_1423 | 248 |
| 408 | 3300038726 | Ga0400490_07444 | Ga0400490_07444_34332_35081 | 248 |
| 409 | 3300038726 | Ga0400490_30083 | Ga0400490_30083_18646_19395 | 248 |
| 410 | 3300038741 | Ga0400488_01697 | Ga0400488_01697_297_1046 | 248 |
| 411 | 3300038741 | Ga0400488_59976 | Ga0400488_59976_8103_8867 | 248 |
| 412 | 3300039062 | Ga0400483_002831 | Ga0400483_002831_8455_9204 | 248 |
| 413 | 3300039062 | Ga0400483_163859 | Ga0400483_163859_1528_2277 | 248 |
| 414 | 3300039062 | Ga0400483_190589 | Ga0400483_190589_968_1717 | 248 |
| 415 | 3300039062 | Ga0400483_222691 | Ga0400483_222691_20700_21449 | 248 |
| 416 | 3300039062 | Ga0400483_284874 | Ga0400483_284874_4694_5443 | 248 |
| 417 | 3300039093 | Ga0400489_20593 | Ga0400489_20593_350_1099 | 248 |
| 418 | 3300039093 | Ga0400489_88422 | Ga0400489_88422_437_1186 | 248 |
| 419 | 3300039110 | Ga0400487_42418 | Ga0400487_42418_2634_3398 | 248 |
| 420 | 3300045051 | Ga0451576_0051462 | Ga0451576_0051462_848_1594 | 248 |
| 421 | 3300046472 | Ga0495580_0129006 | Ga0495580_0129006_430_1176 | 248 |
| 422 | 3300046648 | Ga0495611_0157629 | Ga0495611_0157629_20_769 | 248 |
| 423 | 3300046692 | Ga0495671_0032043 | Ga0495671_0032043_1506_2255 | 248 |
| 424 | 3300048905 | Ga0496102_0192228 | Ga0496102_0192228_675_1421 | 248 |
| 425 | 3300048906 | Ga0496103_0022093 | Ga0496103_0022093_236_982 | 248 |
| 426 | 3300048908 | Ga0496105_0022232 | Ga0496105_0022232_1025_1771 | 248 |
| 427 | 3300048909 | Ga0496106_0238634 | Ga0496106_0238634_497_1243 | 248 |
| 428 | 3300048909 | Ga0496106_0356169 | Ga0496106_0356169_402_1148 | 248 |
| 429 | 3300048912 | Ga0496109_0554249 | Ga0496109_0554249_56_802 | 248 |
| 430 | 3300048913 | Ga0496110_0124971 | Ga0496110_0124971_241_987 | 248 |
| 431 | 3300048915 | Ga0496112_0018514 | Ga0496112_0018514_44_790 | 248 |
| 432 | 3300048915 | Ga0496112_0400428 | Ga0496112_0400428_491_1237 | 248 |
| 433 | 3300048916 | Ga0496113_0081375 | Ga0496113_0081375_861_1607 | 248 |
| 434 | 3300048918 | Ga0496115_0070140 | Ga0496115_0070140_1617_2363 | 248 |
| 435 | 3300049758 | Ga0501241_008547 | Ga0501241_008547_557_1306 | 248 |
| 436 | 3300050507 | nmdc:mga05p37_22307_c1 | nmdc:mga05p37_22307_c1_3742_4488 | 248 |
| 437 | 3300050507 | nmdc:mga05p37_5266_c1 | nmdc:mga05p37_5266_c1_12816_13562 | 248 |
| 438 | 3300050508 | nmdc:mga09592_10130_c1 | nmdc:mga09592_10130_c1_1443_2189 | 248 |
| 439 | 3300050508 | nmdc:mga09592_17045_c1 | nmdc:mga09592_17045_c1_5078_5824 | 248 |
| 440 | 3300050510 | nmdc:mga06r32_3_c1 | nmdc:mga06r32_3_c1_149994_150740 | 248 |
| 441 | 3300050510 | nmdc:mga06r32_607748_c1 | nmdc:mga06r32_607748_c1_267_1013 | 248 |
| 442 | 3300050510 | nmdc:mga06r32_7892_c1 | nmdc:mga06r32_7892_c1_3742_4488 | 248 |
| 443 | 3300050511 | nmdc:mga08y16_1397_c1 | nmdc:mga08y16_1397_c1_1295_2041 | 248 |
| 444 | 3300050511 | nmdc:mga08y16_54834_c1 | nmdc:mga08y16_54834_c1_3218_3964 | 248 |
| 445 | 3300050512 | nmdc:mga0n895_275505_c1 | nmdc:mga0n895_275505_c1_549_1295 | 248 |
| 446 | 3300005331 | Ga0070670_100133139 | Ga0070670_1001331393 | 249 |
| 447 | 3300005334 | Ga0068869_100379856 | Ga0068869_1003798562 | 249 |
| 448 | 3300005335 | Ga0070666_10231698 | Ga0070666_102316981 | 249 |
| 449 | 3300005338 | Ga0068868_100012735 | Ga0068868_1000127354 | 249 |
| 450 | 3300005354 | Ga0070675_100361165 | Ga0070675_1003611652 | 249 |
| 451 | 3300005355 | Ga0070671_100001010 | Ga0070671_10000101012 | 249 |
| 452 | 3300005355 | Ga0070671_100055516 | Ga0070671_1000555163 | 249 |
| 453 | 3300005355 | Ga0070671_100235776 | Ga0070671_1002357762 | 249 |
| 454 | 3300005364 | Ga0070673_100347779 | Ga0070673_1003477792 | 249 |
| 455 | 3300005367 | Ga0070667_100000011 | Ga0070667_100000011222 | 249 |
| 456 | 3300005367 | Ga0070667_100035663 | Ga0070667_1000356632 | 249 |
| 457 | 3300005434 | Ga0070709_10165875 | Ga0070709_101658753 | 249 |
| 458 | 3300005436 | Ga0070713_100186323 | Ga0070713_1001863232 | 249 |
| 459 | 3300005441 | Ga0070700_100027973 | Ga0070700_1000279733 | 249 |
| 460 | 3300005455 | Ga0070663_100078749 | Ga0070663_1000787492 | 249 |
| 461 | 3300005458 | Ga0070681_10008431 | Ga0070681_100084318 | 249 |
| 462 | 3300005458 | Ga0070681_10010987 | Ga0070681_100109873 | 249 |
| 463 | 3300005458 | Ga0070681_10033898 | Ga0070681_100338986 | 249 |
| 464 | 3300005466 | Ga0070685_10151669 | Ga0070685_101516692 | 249 |
| 465 | 3300005530 | Ga0070679_100038601 | Ga0070679_1000386015 | 249 |
| 466 | 3300005530 | Ga0070679_100211728 | Ga0070679_1002117283 | 249 |
| 467 | 3300005535 | Ga0070684_100032314 | Ga0070684_1000323143 | 249 |
| 468 | 3300005548 | Ga0070665_100006899 | Ga0070665_1000068994 | 249 |
| 469 | 3300005548 | Ga0070665_100013131 | Ga0070665_1000131317 | 249 |
| 470 | 3300005563 | Ga0068855_100020245 | Ga0068855_1000202458 | 249 |
| 471 | 3300005564 | Ga0070664_100005240 | Ga0070664_1000052404 | 249 |
| 472 | 3300005614 | Ga0068856_100349527 | Ga0068856_1003495272 | 249 |
| 473 | 3300005616 | Ga0068852_100061847 | Ga0068852_1000618472 | 249 |
| 474 | 3300005616 | Ga0068852_100871289 | Ga0068852_1008712891 | 249 |
| 475 | 3300005617 | Ga0068859_100000220 | Ga0068859_10000022015 | 249 |
| 476 | 3300005617 | Ga0068859_100011239 | Ga0068859_1000112399 | 249 |
| 477 | 3300005617 | Ga0068859_100077159 | Ga0068859_1000771592 | 249 |
| 478 | 3300005617 | Ga0068859_100718589 | Ga0068859_1007185892 | 249 |
| 479 | 3300005719 | Ga0068861_100149688 | Ga0068861_1001496883 | 249 |
| 480 | 3300005834 | Ga0068851_10234285 | Ga0068851_102342852 | 249 |
| 481 | 3300005841 | Ga0068863_100003136 | Ga0068863_1000031364 | 249 |
| 482 | 3300005841 | Ga0068863_100013962 | Ga0068863_1000139623 | 249 |
| 483 | 3300005842 | Ga0068858_100005686 | Ga0068858_1000056868 | 249 |
| 484 | 3300005842 | Ga0068858_100007166 | Ga0068858_10000716610 | 249 |
| 485 | 3300005842 | Ga0068858_100014034 | Ga0068858_1000140347 | 249 |
| 486 | 3300005843 | Ga0068860_100000355 | Ga0068860_10000035510 | 249 |
| 487 | 3300005843 | Ga0068860_100013566 | Ga0068860_1000135664 | 249 |
| 488 | 3300005843 | Ga0068860_100014361 | Ga0068860_1000143614 | 249 |
| 489 | 3300005844 | Ga0068862_100022607 | Ga0068862_1000226074 | 249 |
| 490 | 3300005937 | Ga0081455_10005137 | Ga0081455_1000513710 | 249 |
| 491 | 3300006237 | Ga0097621_100065622 | Ga0097621_1000656224 | 249 |
| 492 | 3300006237 | Ga0097621_100263335 | Ga0097621_1002633352 | 249 |
| 493 | 3300006358 | Ga0068871_100043589 | Ga0068871_1000435894 | 249 |
| 494 | 3300006358 | Ga0068871_100129192 | Ga0068871_1001291921 | 249 |
| 495 | 3300006358 | Ga0068871_100622714 | Ga0068871_1006227141 | 249 |
| 496 | 3300006881 | Ga0068865_100008995 | Ga0068865_1000089954 | 249 |
| 497 | 3300006881 | Ga0068865_100174371 | Ga0068865_1001743713 | 249 |
| 498 | 3300006931 | Ga0097620_100000220 | Ga0097620_10000022015 | 249 |
| 499 | 3300006931 | Ga0097620_100011236 | Ga0097620_1000112369 | 249 |
| 500 | 3300006931 | Ga0097620_100077162 | Ga0097620_1000771624 | 249 |
| 501 | 3300007788 | Ga0099795_10001301 | Ga0099795_100013015 | 249 |
| 502 | 3300009092 | Ga0105250_10009909 | Ga0105250_100099091 | 249 |
| 503 | 3300009093 | Ga0105240_10056162 | Ga0105240_100561623 | 249 |
| 504 | 3300009093 | Ga0105240_10082894 | Ga0105240_100828944 | 249 |
| 505 | 3300009093 | Ga0105240_10084190 | Ga0105240_100841903 | 249 |
| 506 | 3300009093 | Ga0105240_10108645 | Ga0105240_101086453 | 249 |
| 507 | 3300009093 | Ga0105240_10277964 | Ga0105240_102779642 | 249 |
| 508 | 3300009093 | Ga0105240_10316137 | Ga0105240_103161371 | 249 |
| 509 | 3300009093 | Ga0105240_10355899 | Ga0105240_103558991 | 249 |
| 510 | 3300009098 | Ga0105245_10027227 | Ga0105245_100272274 | 249 |
| 511 | 3300009101 | Ga0105247_10002339 | Ga0105247_100023395 | 249 |
| 512 | 3300009101 | Ga0105247_10008194 | Ga0105247_100081945 | 249 |
| 513 | 3300009101 | Ga0105247_10016138 | Ga0105247_100161382 | 249 |
| 514 | 3300009101 | Ga0105247_10027899 | Ga0105247_100278993 | 249 |
| 515 | 3300009174 | Ga0105241_10047825 | Ga0105241_100478252 | 249 |
| 516 | 3300009174 | Ga0105241_10226791 | Ga0105241_102267911 | 249 |
| 517 | 3300009176 | Ga0105242_10055164 | Ga0105242_100551643 | 249 |
| 518 | 3300009177 | Ga0105248_10196693 | Ga0105248_101966931 | 249 |
| 519 | 3300009177 | Ga0105248_10215943 | Ga0105248_102159432 | 249 |
| 520 | 3300009177 | Ga0105248_10486949 | Ga0105248_104869492 | 249 |
| 521 | 3300009545 | Ga0105237_10102406 | Ga0105237_101024062 | 249 |
| 522 | 3300009545 | Ga0105237_10135423 | Ga0105237_101354232 | 249 |
| 523 | 3300009545 | Ga0105237_10374358 | Ga0105237_103743582 | 249 |
| 524 | 3300009545 | Ga0105237_10473878 | Ga0105237_104738781 | 249 |
| 525 | 3300009551 | Ga0105238_10117936 | Ga0105238_101179362 | 249 |
| 526 | 3300009551 | Ga0105238_10858080 | Ga0105238_108580801 | 249 |
| 527 | 3300009553 | Ga0105249_10012724 | Ga0105249_100127247 | 249 |
| 528 | 3300010159 | Ga0099796_10009844 | Ga0099796_100098441 | 249 |
| 529 | 3300010159 | Ga0099796_10043866 | Ga0099796_100438662 | 249 |
| 530 | 3300011119 | Ga0105246_10300188 | Ga0105246_103001882 | 249 |
| 531 | 3300013104 | Ga0157370_10119899 | Ga0157370_101198992 | 249 |
| 532 | 3300013105 | Ga0157369_10036222 | Ga0157369_100362223 | 249 |
| 533 | 3300013296 | Ga0157374_10023611 | Ga0157374_100236113 | 249 |
| 534 | 3300013296 | Ga0157374_10159841 | Ga0157374_101598412 | 249 |
| 535 | 3300013297 | Ga0157378_10142981 | Ga0157378_101429812 | 249 |
| 536 | 3300013306 | Ga0163162_10114585 | Ga0163162_101145854 | 249 |
| 537 | 3300013306 | Ga0163162_10142186 | Ga0163162_101421862 | 249 |
| 538 | 3300013306 | Ga0163162_10143304 | Ga0163162_101433042 | 249 |
| 539 | 3300013308 | Ga0157375_10051051 | Ga0157375_100510514 | 249 |
| 540 | 3300014325 | Ga0163163_10012103 | Ga0163163_100121031 | 249 |
| 541 | 3300014325 | Ga0163163_10013204 | Ga0163163_100132048 | 249 |
| 542 | 3300014325 | Ga0163163_10143759 | Ga0163163_101437592 | 249 |
| 543 | 3300014325 | Ga0163163_10188507 | Ga0163163_101885072 | 249 |
| 544 | 3300014968 | Ga0157379_10000614 | Ga0157379_1000061425 | 249 |
| 545 | 3300014968 | Ga0157379_10001978 | Ga0157379_100019786 | 249 |
| 546 | 3300014968 | Ga0157379_10164288 | Ga0157379_101642883 | 249 |
| 547 | 3300014968 | Ga0157379_10202042 | Ga0157379_102020421 | 249 |
| 548 | 3300014969 | Ga0157376_10047633 | Ga0157376_100476332 | 249 |
| 549 | 3300014969 | Ga0157376_10196424 | Ga0157376_101964241 | 249 |
| 550 | 3300021441 | Ga0213871_10010517 | Ga0213871_100105172 | 249 |
| 551 | 3300024227 | Ga0228598_1004895 | Ga0228598_10048953 | 249 |
| 552 | 3300025900 | Ga0207710_10001544 | Ga0207710_100015442 | 249 |
| 553 | 3300025900 | Ga0207710_10079856 | Ga0207710_100798561 | 249 |
| 554 | 3300025903 | Ga0207680_10003867 | Ga0207680_100038672 | 249 |
| 555 | 3300025903 | Ga0207680_10032325 | Ga0207680_100323253 | 249 |
| 556 | 3300025912 | Ga0207707_10004284 | Ga0207707_100042842 | 249 |
| 557 | 3300025912 | Ga0207707_10280448 | Ga0207707_102804482 | 249 |
| 558 | 3300025912 | Ga0207707_10337567 | Ga0207707_103375672 | 249 |
| 559 | 3300025913 | Ga0207695_10026166 | Ga0207695_100261666 | 249 |
| 560 | 3300025913 | Ga0207695_10067889 | Ga0207695_100678891 | 249 |
| 561 | 3300025913 | Ga0207695_10078068 | Ga0207695_100780682 | 249 |
| 562 | 3300025915 | Ga0207693_10272655 | Ga0207693_102726552 | 249 |
| 563 | 3300025917 | Ga0207660_10007266 | Ga0207660_100072664 | 249 |
| 564 | 3300025917 | Ga0207660_10011615 | Ga0207660_100116153 | 249 |
| 565 | 3300025921 | Ga0207652_10179202 | Ga0207652_101792021 | 249 |
| 566 | 3300025921 | Ga0207652_10190156 | Ga0207652_101901562 | 249 |
| 567 | 3300025921 | Ga0207652_10201791 | Ga0207652_102017912 | 249 |
| 568 | 3300025924 | Ga0207694_10462005 | Ga0207694_104620051 | 249 |
| 569 | 3300025926 | Ga0207659_10276815 | Ga0207659_102768152 | 249 |
| 570 | 3300025927 | Ga0207687_10059344 | Ga0207687_100593443 | 249 |
| 571 | 3300025928 | Ga0207700_10080399 | Ga0207700_100803992 | 249 |
| 572 | 3300025931 | Ga0207644_10010652 | Ga0207644_100106522 | 249 |
| 573 | 3300025938 | Ga0207704_10082404 | Ga0207704_100824044 | 249 |
| 574 | 3300025940 | Ga0207691_10049421 | Ga0207691_100494214 | 249 |
| 575 | 3300025941 | Ga0207711_10001501 | Ga0207711_1000150117 | 249 |
| 576 | 3300025941 | Ga0207711_10093866 | Ga0207711_100938662 | 249 |
| 577 | 3300025941 | Ga0207711_10152652 | Ga0207711_101526522 | 249 |
| 578 | 3300025944 | Ga0207661_10052742 | Ga0207661_100527422 | 249 |
| 579 | 3300025949 | Ga0207667_10507253 | Ga0207667_105072531 | 249 |
| 580 | 3300025961 | Ga0207712_10311876 | Ga0207712_103118761 | 249 |
| 581 | 3300025986 | Ga0207658_10000046 | Ga0207658_1000004680 | 249 |
| 582 | 3300025986 | Ga0207658_10077140 | Ga0207658_100771401 | 249 |
| 583 | 3300026023 | Ga0207677_10027953 | Ga0207677_100279533 | 249 |
| 584 | 3300026035 | Ga0207703_10003271 | Ga0207703_100032716 | 249 |
| 585 | 3300026035 | Ga0207703_10006155 | Ga0207703_100061557 | 249 |
| 586 | 3300026035 | Ga0207703_10013429 | Ga0207703_100134295 | 249 |
| 587 | 3300026088 | Ga0207641_10001484 | Ga0207641_100014847 | 249 |
| 588 | 3300026088 | Ga0207641_10030438 | Ga0207641_100304382 | 249 |
| 589 | 3300026088 | Ga0207641_10145512 | Ga0207641_101455122 | 249 |
| 590 | 3300026089 | Ga0207648_10192047 | Ga0207648_101920472 | 249 |
| 591 | 3300026095 | Ga0207676_10056652 | Ga0207676_100566522 | 249 |
| 592 | 3300026118 | Ga0207675_100003505 | Ga0207675_1000035054 | 249 |
| 593 | 3300026142 | Ga0207698_10385946 | Ga0207698_103859461 | 249 |
| 594 | 3300026142 | Ga0207698_10542157 | Ga0207698_105421571 | 249 |
| 595 | 3300028379 | Ga0268266_10004092 | Ga0268266_100040926 | 249 |
| 596 | 3300028379 | Ga0268266_10017688 | Ga0268266_100176884 | 249 |
| 597 | 3300028379 | Ga0268266_10039925 | Ga0268266_100399253 | 249 |
| 598 | 3300028380 | Ga0268265_10013615 | Ga0268265_100136153 | 249 |
| 599 | 3300028381 | Ga0268264_10000085 | Ga0268264_1000008555 | 249 |
| 600 | 3300028381 | Ga0268264_10011987 | Ga0268264_100119875 | 249 |
| 601 | 3300028381 | Ga0268264_10203400 | Ga0268264_102034003 | 249 |
| 602 | 3300028563 | Ga0265319_1047734 | Ga0265319_10477342 | 249 |
| 603 | 3300028573 | Ga0265334_10001271 | Ga0265334_1000127111 | 249 |
| 604 | 3300028577 | Ga0265318_10001358 | Ga0265318_100013586 | 249 |
| 605 | 3300028577 | Ga0265318_10098901 | Ga0265318_100989011 | 249 |
| 606 | 3300028800 | Ga0265338_10007770 | Ga0265338_100077704 | 249 |
| 607 | 3300028800 | Ga0265338_10010887 | Ga0265338_100108874 | 249 |
| 608 | 3300030521 | Ga0307511_10001897 | Ga0307511_1000189722 | 249 |
| 609 | 3300030521 | Ga0307511_10118006 | Ga0307511_101180061 | 249 |
| 610 | 3300030878 | Ga0265770_1000030 | Ga0265770_10000302 | 249 |
| 611 | 3300030878 | Ga0265770_1032851 | Ga0265770_10328511 | 249 |
| 612 | 3300031090 | Ga0265760_10004641 | Ga0265760_100046413 | 249 |
| 613 | 3300031235 | Ga0265330_10052615 | Ga0265330_100526151 | 249 |
| 614 | 3300031238 | Ga0265332_10001772 | Ga0265332_100017723 | 249 |
| 615 | 3300031240 | Ga0265320_10017891 | Ga0265320_100178914 | 249 |
| 616 | 3300031241 | Ga0265325_10001428 | Ga0265325_1000142813 | 249 |
| 617 | 3300031242 | Ga0265329_10001256 | Ga0265329_1000125610 | 249 |
| 618 | 3300031247 | Ga0265340_10010370 | Ga0265340_100103703 | 249 |
| 619 | 3300031249 | Ga0265339_10009587 | Ga0265339_100095873 | 249 |
| 620 | 3300031250 | Ga0265331_10019248 | Ga0265331_100192484 | 249 |
| 621 | 3300031344 | Ga0265316_10028963 | Ga0265316_100289632 | 249 |
| 622 | 3300031507 | Ga0307509_10000008 | Ga0307509_10000008203 | 249 |
| 623 | 3300031507 | Ga0307509_10308512 | Ga0307509_103085122 | 249 |
| 624 | 3300031595 | Ga0265313_10002857 | Ga0265313_100028576 | 249 |
| 625 | 3300031711 | Ga0265314_10009630 | Ga0265314_100096304 | 249 |
| 626 | 3300031712 | Ga0265342_10007273 | Ga0265342_1000727310 | 249 |
| 627 | 3300031903 | Ga0307407_10190079 | Ga0307407_101900792 | 249 |
| 628 | 3300031995 | Ga0307409_100032841 | Ga0307409_1000328414 | 249 |
| 629 | 3300031995 | Ga0307409_100806303 | Ga0307409_1008063031 | 249 |
| 630 | 3300032002 | Ga0307416_100120523 | Ga0307416_1001205233 | 249 |
| 631 | 3300035089 | Ga0373944_0057092 | Ga0373944_0057092_51_803 | 249 |
| 632 | 3300035111 | Ga0373923_0014921 | Ga0373923_0014921_543_1292 | 249 |
| 633 | 3300035113 | Ga0373936_0044077 | Ga0373936_0044077_838_1587 | 249 |
| 634 | 3300035113 | Ga0373936_0046776 | Ga0373936_0046776_767_1516 | 249 |
| 635 | 3300035398 | Ga0316574_0010869 | Ga0316574_0010869_3166_3918 | 249 |
| 636 | 3300035398 | Ga0316574_0031954 | Ga0316574_0031954_1456_2211 | 249 |
| 637 | 3300037466 | Ga0395898_0006245 | Ga0395898_0006245_796_1578 | 249 |
| 638 | 3300037466 | Ga0395898_0042232 | Ga0395898_0042232_183_932 | 249 |
| 639 | 3300039437 | Ga0436365_0033536 | Ga0436365_0033536_1200_1949 | 249 |
| 640 | 3300039438 | Ga0436360_1079411 | Ga0436360_1079411_8025_8777 | 249 |
| 641 | 3300039447 | Ga0436361_1075840 | Ga0436361_1075840_261_1013 | 249 |
| 642 | 3300039453 | Ga0436362_0261338 | Ga0436362_0261338_133_891 | 249 |
| 643 | 3300041460 | Ga0451802_0139520 | Ga0451802_0139520_1352_2107 | 249 |
| 644 | 3300041486 | Ga0451807_0214414 | Ga0451807_0214414_1383_2138 | 249 |
| 645 | 3300041494 | Ga0451837_0547725 | Ga0451837_0547725_209_964 | 249 |
| 646 | 3300041512 | Ga0451853_2107667 | Ga0451853_2107667_85_840 | 249 |
| 647 | 3300045049 | Ga0466959_0084672 | Ga0466959_0084672_1331_2080 | 249 |
| 648 | 3300045049 | Ga0466959_0090345 | Ga0466959_0090345_1202_1951 | 249 |
| 649 | 3300046471 | Ga0495650_0068658 | Ga0495650_0068658_451_1203 | 249 |
| 650 | 3300046472 | Ga0495580_0060379 | Ga0495580_0060379_52_801 | 249 |
| 651 | 3300046506 | Ga0495583_0015410 | Ga0495583_0015410_489_1238 | 249 |
| 652 | 3300046507 | Ga0495606_0037893 | Ga0495606_0037893_1106_1855 | 249 |
| 653 | 3300046507 | Ga0495606_0124906 | Ga0495606_0124906_218_979 | 249 |
| 654 | 3300046507 | Ga0495606_0173131 | Ga0495606_0173131_80_838 | 249 |
| 655 | 3300046513 | Ga0495616_0003562 | Ga0495616_0003562_6486_7241 | 249 |
| 656 | 3300046519 | Ga0495632_0045293 | Ga0495632_0045293_767_1516 | 249 |
| 657 | 3300046519 | Ga0495632_0139915 | Ga0495632_0139915_194_949 | 249 |
| 658 | 3300046543 | Ga0495645_0044018 | Ga0495645_0044018_40_789 | 249 |
| 659 | 3300046679 | Ga0495623_0119439 | Ga0495623_0119439_441_1190 | 249 |
| 660 | 3300046694 | Ga0495649_0071403 | Ga0495649_0071403_493_1242 | 249 |
| 661 | 3300047317 | Ga0495604_0074559 | Ga0495604_0074559_1681_2430 | 249 |
| 662 | 3300047444 | Ga0495675_0318708 | Ga0495675_0318708_133_888 | 249 |
| 663 | 3300048088 | Ga0495602_0018947 | Ga0495602_0018947_5676_6425 | 249 |
| 664 | 3300048905 | Ga0496102_0002132 | Ga0496102_0002132_10820_11569 | 249 |
| 665 | 3300048905 | Ga0496102_0007331 | Ga0496102_0007331_5020_5769 | 249 |
| 666 | 3300048905 | Ga0496102_0019281 | Ga0496102_0019281_4535_5284 | 249 |
| 667 | 3300048905 | Ga0496102_0351084 | Ga0496102_0351084_444_1199 | 249 |
| 668 | 3300048906 | Ga0496103_0028633 | Ga0496103_0028633_213_962 | 249 |
| 669 | 3300048907 | Ga0496104_0033718 | Ga0496104_0033718_2801_3556 | 249 |
| 670 | 3300048908 | Ga0496105_0001265 | Ga0496105_0001265_371_1126 | 249 |
| 671 | 3300048911 | Ga0496108_0003024 | Ga0496108_0003024_225_980 | 249 |
| 672 | 3300048912 | Ga0496109_0133376 | Ga0496109_0133376_283_1038 | 249 |
| 673 | 3300048913 | Ga0496110_0011165 | Ga0496110_0011165_6362_7117 | 249 |
| 674 | 3300048915 | Ga0496112_0237277 | Ga0496112_0237277_750_1499 | 249 |
| 675 | 3300048918 | Ga0496115_0188594 | Ga0496115_0188594_846_1595 | 249 |
| 676 | 3300048919 | Ga0496116_0030355 | Ga0496116_0030355_2840_3589 | 249 |
| 677 | 3300048920 | Ga0496117_0000251 | Ga0496117_0000251_37050_37799 | 249 |
| 678 | 3300048920 | Ga0496117_0058137 | Ga0496117_0058137_808_1557 | 249 |
| 679 | 3300048921 | Ga0496118_0000026 | Ga0496118_0000026_369845_370594 | 249 |
| 680 | 3300048921 | Ga0496118_0043701 | Ga0496118_0043701_2156_2905 | 249 |
| 681 | 3300048921 | Ga0496118_0119690 | Ga0496118_0119690_206_955 | 249 |
| 682 | 3300048922 | Ga0496119_0000965 | Ga0496119_0000965_25937_26686 | 249 |
| 683 | 3300048922 | Ga0496119_0165542 | Ga0496119_0165542_199_948 | 249 |
| 684 | 3300048923 | Ga0496120_0000025 | Ga0496120_0000025_5784_6533 | 249 |
| 685 | 3300048923 | Ga0496120_0033037 | Ga0496120_0033037_1688_2437 | 249 |
| 686 | 3300048924 | Ga0496121_0002537 | Ga0496121_0002537_13721_14470 | 249 |
| 687 | 3300048927 | Ga0496124_0173387 | Ga0496124_0173387_251_1000 | 249 |
| 688 | 3300048928 | Ga0496125_0002047 | Ga0496125_0002047_15083_15832 | 249 |
| 689 | 3300048928 | Ga0496125_0007828 | Ga0496125_0007828_2195_2944 | 249 |
| 690 | 3300048928 | Ga0496125_0049803 | Ga0496125_0049803_2700_3449 | 249 |
| 691 | 3300048929 | Ga0496126_0001746 | Ga0496126_0001746_14323_15072 | 249 |
| 692 | 3300048929 | Ga0496126_0227116 | Ga0496126_0227116_391_1140 | 249 |
| 693 | 3300048929 | Ga0496126_0320581 | Ga0496126_0320581_72_821 | 249 |
| 694 | 3300049590 | Ga0501074_0343405 | Ga0501074_0343405_34_789 | 249 |
| 695 | 3300053091 | Ga0500647_0188966 | Ga0500647_0188966_14_763 | 249 |
| 696 | 3300053092 | Ga0500583_0055940 | Ga0500583_0055940_943_1692 | 249 |
| 697 | 3300053092 | Ga0500583_0116461 | Ga0500583_0116461_308_1057 | 249 |
| 698 | 3300053096 | Ga0500641_0116737 | Ga0500641_0116737_116_877 | 249 |
| 699 | 3300053104 | Ga0500556_0001203 | Ga0500556_0001203_5251_6000 | 249 |
| 700 | 3300053104 | Ga0500556_0035434 | Ga0500556_0035434_256_1017 | 249 |
| 701 | 3300053115 | Ga0500591_041053 | Ga0500591_041053_1220_1969 | 249 |
| 702 | 3300053178 | Ga0500637_0340543 | Ga0500637_0340543_29_778 | 249 |
| 703 | 3300005328 | Ga0070676_10070031 | Ga0070676_100700313 | 250 |
| 704 | 3300005330 | Ga0070690_100004513 | Ga0070690_1000045135 | 250 |
| 705 | 3300005333 | Ga0070677_10136475 | Ga0070677_101364751 | 250 |
| 706 | 3300005334 | Ga0068869_100075759 | Ga0068869_1000757593 | 250 |
| 707 | 3300005334 | Ga0068869_100077983 | Ga0068869_1000779834 | 250 |
| 708 | 3300005337 | Ga0070682_100025164 | Ga0070682_1000251642 | 250 |
| 709 | 3300005337 | Ga0070682_100096994 | Ga0070682_1000969944 | 250 |
| 710 | 3300005337 | Ga0070682_100230058 | Ga0070682_1002300581 | 250 |
| 711 | 3300005340 | Ga0070689_100040184 | Ga0070689_1000401842 | 250 |
| 712 | 3300005340 | Ga0070689_100254524 | Ga0070689_1002545242 | 250 |
| 713 | 3300005341 | Ga0070691_10060331 | Ga0070691_100603311 | 250 |
| 714 | 3300005347 | Ga0070668_100135714 | Ga0070668_1001357142 | 250 |
| 715 | 3300005353 | Ga0070669_100102022 | Ga0070669_1001020223 | 250 |
| 716 | 3300005354 | Ga0070675_100010064 | Ga0070675_1000100645 | 250 |
| 717 | 3300005354 | Ga0070675_100057626 | Ga0070675_1000576264 | 250 |
| 718 | 3300005354 | Ga0070675_100089294 | Ga0070675_1000892942 | 250 |
| 719 | 3300005356 | Ga0070674_100083269 | Ga0070674_1000832693 | 250 |
| 720 | 3300005364 | Ga0070673_100021022 | Ga0070673_1000210223 | 250 |
| 721 | 3300005365 | Ga0070688_100097922 | Ga0070688_1000979222 | 250 |
| 722 | 3300005366 | Ga0070659_100575380 | Ga0070659_1005753801 | 250 |
| 723 | 3300005367 | Ga0070667_100304426 | Ga0070667_1003044261 | 250 |
| 724 | 3300005439 | Ga0070711_100173391 | Ga0070711_1001733912 | 250 |
| 725 | 3300005440 | Ga0070705_100015579 | Ga0070705_1000155794 | 250 |
| 726 | 3300005441 | Ga0070700_100106602 | Ga0070700_1001066023 | 250 |
| 727 | 3300005441 | Ga0070700_100163119 | Ga0070700_1001631192 | 250 |
| 728 | 3300005444 | Ga0070694_100022752 | Ga0070694_1000227521 | 250 |
| 729 | 3300005456 | Ga0070678_100014668 | Ga0070678_1000146683 | 250 |
| 730 | 3300005457 | Ga0070662_100181614 | Ga0070662_1001816142 | 250 |
| 731 | 3300005539 | Ga0068853_100374647 | Ga0068853_1003746472 | 250 |
| 732 | 3300005546 | Ga0070696_100024017 | Ga0070696_1000240172 | 250 |
| 733 | 3300005548 | Ga0070665_100074552 | Ga0070665_1000745524 | 250 |
| 734 | 3300005615 | Ga0070702_100102607 | Ga0070702_1001026073 | 250 |
| 735 | 3300005617 | Ga0068859_100049603 | Ga0068859_1000496035 | 250 |
| 736 | 3300005617 | Ga0068859_100459611 | Ga0068859_1004596113 | 250 |
| 737 | 3300005617 | Ga0068859_100706688 | Ga0068859_1007066881 | 250 |
| 738 | 3300005618 | Ga0068864_100074541 | Ga0068864_1000745414 | 250 |
| 739 | 3300005719 | Ga0068861_100021265 | Ga0068861_1000212654 | 250 |
| 740 | 3300005719 | Ga0068861_100112345 | Ga0068861_1001123453 | 250 |
| 741 | 3300005840 | Ga0068870_10048595 | Ga0068870_100485953 | 250 |
| 742 | 3300005841 | Ga0068863_100113219 | Ga0068863_1001132194 | 250 |
| 743 | 3300005841 | Ga0068863_100335849 | Ga0068863_1003358491 | 250 |
| 744 | 3300005844 | Ga0068862_100001728 | Ga0068862_10000172810 | 250 |
| 745 | 3300005844 | Ga0068862_100264237 | Ga0068862_1002642372 | 250 |
| 746 | 3300005844 | Ga0068862_100393786 | Ga0068862_1003937862 | 250 |
| 747 | 3300006358 | Ga0068871_100103006 | Ga0068871_1001030063 | 250 |
| 748 | 3300006881 | Ga0068865_100049973 | Ga0068865_1000499732 | 250 |
| 749 | 3300006881 | Ga0068865_100133524 | Ga0068865_1001335243 | 250 |
| 750 | 3300006881 | Ga0068865_100395314 | Ga0068865_1003953142 | 250 |
| 751 | 3300006931 | Ga0097620_100049603 | Ga0097620_1000496035 | 250 |
| 752 | 3300006931 | Ga0097620_100220559 | Ga0097620_1002205593 | 250 |
| 753 | 3300006931 | Ga0097620_100459535 | Ga0097620_1004595351 | 250 |
| 754 | 3300006931 | Ga0097620_100706695 | Ga0097620_1007066952 | 250 |
| 755 | 3300009094 | Ga0111539_10043719 | Ga0111539_100437194 | 250 |
| 756 | 3300009094 | Ga0111539_10590688 | Ga0111539_105906881 | 250 |
| 757 | 3300009176 | Ga0105242_10029647 | Ga0105242_100296473 | 250 |
| 758 | 3300009177 | Ga0105248_10229085 | Ga0105248_102290852 | 250 |
| 759 | 3300009553 | Ga0105249_10219512 | Ga0105249_102195123 | 250 |
| 760 | 3300013297 | Ga0157378_10208980 | Ga0157378_102089803 | 250 |
| 761 | 3300013308 | Ga0157375_10063559 | Ga0157375_100635593 | 250 |
| 762 | 3300014326 | Ga0157380_10134578 | Ga0157380_101345784 | 250 |
| 763 | 3300014326 | Ga0157380_10177910 | Ga0157380_101779104 | 250 |
| 764 | 3300014326 | Ga0157380_10220861 | Ga0157380_102208612 | 250 |
| 765 | 3300014968 | Ga0157379_10024288 | Ga0157379_100242884 | 250 |
| 766 | 3300014969 | Ga0157376_10086759 | Ga0157376_100867593 | 250 |
| 767 | 3300017792 | Ga0163161_10519239 | Ga0163161_105192391 | 250 |
| 768 | 3300025893 | Ga0207682_10002678 | Ga0207682_100026783 | 250 |
| 769 | 3300025893 | Ga0207682_10004866 | Ga0207682_100048663 | 250 |
| 770 | 3300025893 | Ga0207682_10051169 | Ga0207682_100511692 | 250 |
| 771 | 3300025899 | Ga0207642_10289511 | Ga0207642_102895111 | 250 |
| 772 | 3300025907 | Ga0207645_10080968 | Ga0207645_100809682 | 250 |
| 773 | 3300025908 | Ga0207643_10025559 | Ga0207643_100255593 | 250 |
| 774 | 3300025908 | Ga0207643_10027179 | Ga0207643_100271793 | 250 |
| 775 | 3300025916 | Ga0207663_10122069 | Ga0207663_101220693 | 250 |
| 776 | 3300025923 | Ga0207681_10089643 | Ga0207681_100896433 | 250 |
| 777 | 3300025923 | Ga0207681_10089702 | Ga0207681_100897023 | 250 |
| 778 | 3300025925 | Ga0207650_10559602 | Ga0207650_105596021 | 250 |
| 779 | 3300025926 | Ga0207659_10029326 | Ga0207659_100293263 | 250 |
| 780 | 3300025926 | Ga0207659_10030149 | Ga0207659_100301494 | 250 |
| 781 | 3300025933 | Ga0207706_10234432 | Ga0207706_102344322 | 250 |
| 782 | 3300025933 | Ga0207706_10269980 | Ga0207706_102699803 | 250 |
| 783 | 3300025934 | Ga0207686_10019724 | Ga0207686_100197243 | 250 |
| 784 | 3300025936 | Ga0207670_10007052 | Ga0207670_100070527 | 250 |
| 785 | 3300025936 | Ga0207670_10196288 | Ga0207670_101962882 | 250 |
| 786 | 3300025937 | Ga0207669_10056469 | Ga0207669_100564693 | 250 |
| 787 | 3300025938 | Ga0207704_10057262 | Ga0207704_100572624 | 250 |
| 788 | 3300025938 | Ga0207704_10195778 | Ga0207704_101957782 | 250 |
| 789 | 3300025940 | Ga0207691_10006516 | Ga0207691_100065168 | 250 |
| 790 | 3300025940 | Ga0207691_10020864 | Ga0207691_100208644 | 250 |
| 791 | 3300025940 | Ga0207691_10032746 | Ga0207691_100327463 | 250 |
| 792 | 3300025942 | Ga0207689_10031231 | Ga0207689_100312315 | 250 |
| 793 | 3300025942 | Ga0207689_10123272 | Ga0207689_101232723 | 250 |
| 794 | 3300025942 | Ga0207689_10222317 | Ga0207689_102223172 | 250 |
| 795 | 3300025942 | Ga0207689_10315618 | Ga0207689_103156182 | 250 |
| 796 | 3300025986 | Ga0207658_10070732 | Ga0207658_100707322 | 250 |
| 797 | 3300026023 | Ga0207677_10223506 | Ga0207677_102235062 | 250 |
| 798 | 3300026035 | Ga0207703_10390127 | Ga0207703_103901271 | 250 |
| 799 | 3300026067 | Ga0207678_10103107 | Ga0207678_101031073 | 250 |
| 800 | 3300026075 | Ga0207708_10074498 | Ga0207708_100744983 | 250 |
| 801 | 3300026075 | Ga0207708_10196791 | Ga0207708_101967913 | 250 |
| 802 | 3300026075 | Ga0207708_10251868 | Ga0207708_102518681 | 250 |
| 803 | 3300026089 | Ga0207648_10063248 | Ga0207648_100632481 | 250 |
| 804 | 3300026095 | Ga0207676_10055024 | Ga0207676_100550242 | 250 |
| 805 | 3300026095 | Ga0207676_10634145 | Ga0207676_106341451 | 250 |
| 806 | 3300026116 | Ga0207674_10541492 | Ga0207674_105414921 | 250 |
| 807 | 3300026118 | Ga0207675_100006146 | Ga0207675_1000061464 | 250 |
| 808 | 3300026118 | Ga0207675_100022988 | Ga0207675_1000229882 | 250 |
| 809 | 3300026118 | Ga0207675_100565425 | Ga0207675_1005654251 | 250 |
| 810 | 3300026121 | Ga0207683_10024101 | Ga0207683_100241013 | 250 |
| 811 | 3300026121 | Ga0207683_10069217 | Ga0207683_100692172 | 250 |
| 812 | 3300027907 | Ga0207428_10076951 | Ga0207428_100769514 | 250 |
| 813 | 3300028379 | Ga0268266_10298350 | Ga0268266_102983503 | 250 |
| 814 | 3300028379 | Ga0268266_10605341 | Ga0268266_106053412 | 250 |
| 815 | 3300028380 | Ga0268265_10033879 | Ga0268265_100338794 | 250 |
| 816 | 3300028380 | Ga0268265_10063625 | Ga0268265_100636253 | 250 |
| 817 | 3300028380 | Ga0268265_10066738 | Ga0268265_100667384 | 250 |
| 818 | 3300028381 | Ga0268264_10063782 | Ga0268264_100637824 | 250 |
| 819 | 3300028381 | Ga0268264_10123708 | Ga0268264_101237083 | 250 |
| 820 | 3300031456 | Ga0307513_10025018 | Ga0307513_100250181 | 250 |
| 821 | 3300031456 | Ga0307513_10026003 | Ga0307513_100260033 | 250 |
| 822 | 3300031507 | Ga0307509_10117099 | Ga0307509_101170994 | 250 |
| 823 | 3300031548 | Ga0307408_100146368 | Ga0307408_1001463682 | 250 |
| 824 | 3300031731 | Ga0307405_10053416 | Ga0307405_100534164 | 250 |
| 825 | 3300031824 | Ga0307413_10001102 | Ga0307413_100011028 | 250 |
| 826 | 3300031824 | Ga0307413_10009664 | Ga0307413_100096643 | 250 |
| 827 | 3300031852 | Ga0307410_10033962 | Ga0307410_100339621 | 250 |
| 828 | 3300031901 | Ga0307406_10098219 | Ga0307406_100982193 | 250 |
| 829 | 3300031903 | Ga0307407_10007516 | Ga0307407_100075163 | 250 |
| 830 | 3300031903 | Ga0307407_10064159 | Ga0307407_100641594 | 250 |
| 831 | 3300031995 | Ga0307409_100051165 | Ga0307409_1000511652 | 250 |
| 832 | 3300031995 | Ga0307409_100100252 | Ga0307409_1001002523 | 250 |
| 833 | 3300032005 | Ga0307411_10000178 | Ga0307411_100001787 | 250 |
| 834 | 3300032005 | Ga0307411_10003205 | Ga0307411_100032054 | 250 |
| 835 | 3300032126 | Ga0307415_100093127 | Ga0307415_1000931273 | 250 |
| 836 | 3300032126 | Ga0307415_100394660 | Ga0307415_1003946602 | 250 |
| 837 | 3300035692 | Ga0373935_0206521 | Ga0373935_0206521_264_1022 | 250 |
| 838 | 3300039437 | Ga0436365_1504415 | Ga0436365_1504415_1432_2184 | 250 |
| 839 | 3300039450 | Ga0436363_1431824 | Ga0436363_1431824_5746_6498 | 250 |
| 840 | 3300041456 | Ga0451795_1205146 | Ga0451795_1205146_888_1646 | 250 |
| 841 | 3300041460 | Ga0451802_0026244 | Ga0451802_0026244_1014_1772 | 250 |
| 842 | 3300046460 | Ga0495638_0007170 | Ga0495638_0007170_5680_6438 | 250 |
| 843 | 3300046460 | Ga0495638_0028700 | Ga0495638_0028700_130_888 | 250 |
| 844 | 3300046492 | Ga0495585_0056112 | Ga0495585_0056112_1354_2112 | 250 |
| 845 | 3300046515 | Ga0495620_0037598 | Ga0495620_0037598_417_1175 | 250 |
| 846 | 3300046519 | Ga0495632_0143706 | Ga0495632_0143706_235_993 | 250 |
| 847 | 3300046616 | Ga0495668_0039100 | Ga0495668_0039100_115_942 | 250 |
| 848 | 3300046660 | Ga0495625_0008480 | Ga0495625_0008480_6107_6865 | 250 |
| 849 | 3300046660 | Ga0495625_0195111 | Ga0495625_0195111_451_1209 | 250 |
| 850 | 3300046694 | Ga0495649_0007172 | Ga0495649_0007172_307_1065 | 250 |
| 851 | 3300046794 | Ga0495589_0112642 | Ga0495589_0112642_129_887 | 250 |
| 852 | 3300048907 | Ga0496104_0420654 | Ga0496104_0420654_270_1028 | 250 |
| 853 | 3300049587 | Ga0501071_0040467 | Ga0501071_0040467_829_1587 | 250 |
| 854 | 3300049589 | Ga0501073_0006560 | Ga0501073_0006560_77_835 | 250 |
| 855 | 3300049590 | Ga0501074_0002065 | Ga0501074_0002065_4756_5514 | 250 |
| 856 | 3300050511 | nmdc:mga08y16_35820_c1 | nmdc:mga08y16_35820_c1_1788_2546 | 250 |
| 857 | 3300053096 | Ga0500641_0018669 | Ga0500641_0018669_1577_2338 | 250 |
| 858 | 3300049572 | Ga0501036_0507558 | Ga0501036_0507558_141_905 | 251 |
| 859 | 3300049575 | Ga0501039_0205764 | Ga0501039_0205764_318_1082 | 251 |
| 860 | 3300049576 | Ga0501040_0171642 | Ga0501040_0171642_662_1426 | 251 |
| 861 | 3300049577 | Ga0501041_0014883 | Ga0501041_0014883_1038_1802 | 251 |
| 862 | 3300049578 | Ga0501042_0038156 | Ga0501042_0038156_332_1096 | 251 |
| 863 | 3300049579 | Ga0501043_0449519 | Ga0501043_0449519_90_854 | 251 |
| 864 | 3300049580 | Ga0501046_0106492 | Ga0501046_0106492_1250_2014 | 251 |
| 865 | 3300049590 | Ga0501074_0184290 | Ga0501074_0184290_130_894 | 251 |
| 866 | 3300049591 | Ga0501075_0024495 | Ga0501075_0024495_3370_4134 | 251 |
| 867 | 3300049592 | Ga0501076_0025313 | Ga0501076_0025313_3094_3858 | 251 |
| 868 | 3300049742 | Ga0501080_0700140 | Ga0501080_0700140_95_859 | 251 |
| 869 | 3300049744 | Ga0501083_0302719 | Ga0501083_0302719_228_992 | 251 |
| 870 | 3300054114 | Ga0501084_0021657 | Ga0501084_0021657_2265_3029 | 251 |
| 871 | 3300060353 | Ga0501082_0147505 | Ga0501082_0147505_499_1263 | 251 |
| 872 | 3300060353 | Ga0501082_0156122 | Ga0501082_0156122_916_1680 | 251 |
| 873 | 3300061734 | Ga0530510_0043536 | Ga0530510_0043536_2278_3042 | 251 |
| 874 | 3300005295 | Ga0065707_10087670 | Ga0065707_100876701 | 252 |
| 875 | 3300005471 | Ga0070698_100596379 | Ga0070698_1005963792 | 252 |
| 876 | 3300005719 | Ga0068861_100001278 | Ga0068861_1000012783 | 252 |
| 877 | 3300009094 | Ga0111539_10213707 | Ga0111539_102137072 | 252 |
| 878 | 3300014326 | Ga0157380_10002098 | Ga0157380_100020985 | 252 |
| 879 | 3300026118 | Ga0207675_100131684 | Ga0207675_1001316843 | 252 |
| 880 | 3300027907 | Ga0207428_10033094 | Ga0207428_100330942 | 252 |
| 881 | 3300031731 | Ga0307405_10237242 | Ga0307405_102372422 | 252 |
| 882 | 3300032002 | Ga0307416_100286755 | Ga0307416_1002867552 | 252 |
| 883 | 3300042876 | Ga0451577_0016049 | Ga0451577_0016049_1518_2276 | 252 |
| 884 | 3300045051 | Ga0451576_0120985 | Ga0451576_0120985_1306_2064 | 252 |
| 885 | 3300046460 | Ga0495638_0014122 | Ga0495638_0014122_2990_3751 | 252 |
| 886 | 3300046660 | Ga0495625_0170265 | Ga0495625_0170265_645_1403 | 252 |
| 887 | 3300048924 | Ga0496121_0208310 | Ga0496121_0208310_275_1036 | 252 |
| 888 | 3300050511 | nmdc:mga08y16_2729_c1 | nmdc:mga08y16_2729_c1_3144_3902 | 252 |
| 889 | 3300031665 | Ga0316575_10013355 | Ga0316575_100133553 | 253 |
| 890 | 3300031665 | Ga0316575_10158891 | Ga0316575_101588912 | 253 |
| 891 | 3300031727 | Ga0316576_10002294 | Ga0316576_100022944 | 253 |
| 892 | 3300031733 | Ga0316577_10152111 | Ga0316577_101521112 | 253 |
| 893 | 3300035113 | Ga0373936_0109603 | Ga0373936_0109603_152_916 | 253 |
| 894 | 3300035398 | Ga0316574_0233284 | Ga0316574_0233284_179_940 | 253 |
| 895 | 3300036712 | Ga0316584_0005014 | Ga0316584_0005014_4406_5167 | 253 |
| 896 | 3300039062 | Ga0400483_022796 | Ga0400483_022796_137_904 | 253 |
| 897 | 3300046535 | Ga0495586_0060407 | Ga0495586_0060407_883_1647 | 253 |
| 898 | 3300046557 | Ga0495622_0188498 | Ga0495622_0188498_49_813 | 253 |
| 899 | 3300046683 | Ga0495658_0121921 | Ga0495658_0121921_697_1461 | 253 |
| 900 | 3300053092 | Ga0500583_0115452 | Ga0500583_0115452_56_820 | 253 |
| 901 | 3300053178 | Ga0500637_0011591 | Ga0500637_0011591_39_803 | 253 |
| 902 | 3300041486 | Ga0451807_0614660 | Ga0451807_0614660_2092_2862 | 254 |
| 903 | 3300049569 | Ga0501032_0077625 | Ga0501032_0077625_826_1596 | 254 |
| 904 | 3300049572 | Ga0501036_0003359 | Ga0501036_0003359_2284_3054 | 254 |
| 905 | 3300049574 | Ga0501038_0002190 | Ga0501038_0002190_2181_2951 | 254 |
| 906 | 3300049574 | Ga0501038_0151767 | Ga0501038_0151767_989_1759 | 254 |
| 907 | 3300049575 | Ga0501039_0003734 | Ga0501039_0003734_6388_7158 | 254 |
| 908 | 3300049576 | Ga0501040_0013141 | Ga0501040_0013141_2519_3289 | 254 |
| 909 | 3300049576 | Ga0501040_0069385 | Ga0501040_0069385_1540_2310 | 254 |
| 910 | 3300049577 | Ga0501041_0001989 | Ga0501041_0001989_8804_9574 | 254 |
| 911 | 3300049578 | Ga0501042_0011337 | Ga0501042_0011337_2880_3650 | 254 |
| 912 | 3300049578 | Ga0501042_0037631 | Ga0501042_0037631_899_1669 | 254 |
| 913 | 3300049579 | Ga0501043_0054629 | Ga0501043_0054629_1293_2063 | 254 |
| 914 | 3300049580 | Ga0501046_0006982 | Ga0501046_0006982_5422_6192 | 254 |
| 915 | 3300049580 | Ga0501046_0015127 | Ga0501046_0015127_2993_3763 | 254 |
| 916 | 3300049582 | Ga0501048_0015227 | Ga0501048_0015227_1423_2193 | 254 |
| 917 | 3300049582 | Ga0501048_0074718 | Ga0501048_0074718_573_1343 | 254 |
| 918 | 3300049584 | Ga0501068_0030970 | Ga0501068_0030970_110_880 | 254 |
| 919 | 3300049585 | Ga0501069_0347829 | Ga0501069_0347829_41_811 | 254 |
| 920 | 3300049587 | Ga0501071_0000326 | Ga0501071_0000326_4300_5070 | 254 |
| 921 | 3300049587 | Ga0501071_0008282 | Ga0501071_0008282_2499_3269 | 254 |
| 922 | 3300049588 | Ga0501072_0024767 | Ga0501072_0024767_648_1418 | 254 |
| 923 | 3300049588 | Ga0501072_0030671 | Ga0501072_0030671_212_982 | 254 |
| 924 | 3300049589 | Ga0501073_0217671 | Ga0501073_0217671_253_1023 | 254 |
| 925 | 3300049590 | Ga0501074_0041862 | Ga0501074_0041862_1760_2530 | 254 |
| 926 | 3300049591 | Ga0501075_0000736 | Ga0501075_0000736_14306_15076 | 254 |
| 927 | 3300049591 | Ga0501075_0180301 | Ga0501075_0180301_534_1304 | 254 |
| 928 | 3300049592 | Ga0501076_0003626 | Ga0501076_0003626_8796_9566 | 254 |
| 929 | 3300049593 | Ga0501077_0005531 | Ga0501077_0005531_2402_3172 | 254 |
| 930 | 3300049593 | Ga0501077_0044263 | Ga0501077_0044263_1260_2030 | 254 |
| 931 | 3300049741 | Ga0501079_0016308 | Ga0501079_0016308_922_1692 | 254 |
| 932 | 3300049742 | Ga0501080_0005900 | Ga0501080_0005900_942_1712 | 254 |
| 933 | 3300049742 | Ga0501080_0030776 | Ga0501080_0030776_3335_4105 | 254 |
| 934 | 3300049743 | Ga0501081_0000724 | Ga0501081_0000724_4242_5012 | 254 |
| 935 | 3300049743 | Ga0501081_0107479 | Ga0501081_0107479_1017_1787 | 254 |
| 936 | 3300049744 | Ga0501083_0079258 | Ga0501083_0079258_557_1327 | 254 |
| 937 | 3300049822 | Ga0501035_0019486 | Ga0501035_0019486_3089_3859 | 254 |
| 938 | 3300049824 | Ga0501045_0005410 | Ga0501045_0005410_4273_5043 | 254 |
| 939 | 3300049824 | Ga0501045_0233452 | Ga0501045_0233452_225_995 | 254 |
| 940 | 3300054114 | Ga0501084_0030134 | Ga0501084_0030134_3441_4211 | 254 |
| 941 | 3300054114 | Ga0501084_0117273 | Ga0501084_0117273_1150_1920 | 254 |
| 942 | 3300060353 | Ga0501082_0000377 | Ga0501082_0000377_22307_23077 | 254 |
| 943 | 3300061734 | Ga0530510_0014851 | Ga0530510_0014851_2544_3314 | 254 |
| 944 | 3300061734 | Ga0530510_0015136 | Ga0530510_0015136_2523_3293 | 254 |
| 945 | 3300014745 | Ga0157377_10318961 | Ga0157377_103189612 | 255 |
| 946 | 3300031852 | Ga0307410_10398247 | Ga0307410_103982471 | 255 |
| 947 | 3300032002 | Ga0307416_100425348 | Ga0307416_1004253482 | 255 |
| 948 | 3300032005 | Ga0307411_10306709 | Ga0307411_103067092 | 255 |
| 949 | 3300042876 | Ga0451577_0007840 | Ga0451577_0007840_3978_4748 | 255 |
| 950 | 3300042876 | Ga0451577_0126020 | Ga0451577_0126020_203_973 | 255 |
| 951 | 3300048927 | Ga0496124_0219032 | Ga0496124_0219032_613_1383 | 255 |
| 952 | 3300049580 | Ga0501046_0029434 | Ga0501046_0029434_2470_3240 | 255 |
| 953 | 3300049581 | Ga0501047_0439739 | Ga0501047_0439739_341_1111 | 255 |
| 954 | 3300049743 | Ga0501081_0065319 | Ga0501081_0065319_671_1495 | 255 |
| 955 | 3300053092 | Ga0500583_0252765 | Ga0500583_0252765_59_826 | 255 |
| 956 | 3300053139 | Ga0500568_0136382 | Ga0500568_0136382_43_813 | 255 |
| 957 | 3300053151 | Ga0500604_0097051 | Ga0500604_0097051_79_849 | 255 |
| 958 | 3300053156 | Ga0500622_0006363 | Ga0500622_0006363_101_871 | 255 |
| 959 | 3300031456 | Ga0307513_10174506 | Ga0307513_101745062 | 257 |
| 960 | 3300035398 | Ga0316574_0020327 | Ga0316574_0020327_462_1241 | 257 |
| 961 | 3300036712 | Ga0316584_0210279 | Ga0316584_0210279_34_813 | 257 |
| 962 | 3300042876 | Ga0451577_0037831 | Ga0451577_0037831_1340_2116 | 257 |
| 963 | 3300044673 | Ga0453683_0009257 | Ga0453683_0009257_4883_5659 | 257 |
| 964 | 3300044712 | Ga0453684_0640754 | Ga0453684_0640754_348_1124 | 257 |
| 965 | 3300046460 | Ga0495638_0049342 | Ga0495638_0049342_818_1594 | 257 |
| 966 | 3300005354 | Ga0070675_100109518 | Ga0070675_1001095182 | 258 |
| 967 | 3300005543 | Ga0070672_100191999 | Ga0070672_1001919993 | 258 |
| 968 | 3300031665 | Ga0316575_10002479 | Ga0316575_100024797 | 258 |
| 969 | 3300031727 | Ga0316576_10053203 | Ga0316576_100532033 | 258 |
| 970 | 3300031728 | Ga0316578_10010000 | Ga0316578_100100005 | 258 |
| 971 | 3300031852 | Ga0307410_10103647 | Ga0307410_101036472 | 258 |
| 972 | 3300031995 | Ga0307409_100098746 | Ga0307409_1000987463 | 258 |
| 973 | 3300032005 | Ga0307411_10107148 | Ga0307411_101071483 | 258 |
| 974 | 3300032139 | Ga0316580_10001817 | Ga0316580_100018172 | 258 |
| 975 | 3300036712 | Ga0316584_0011584 | Ga0316584_0011584_1387_2178 | 258 |
| 976 | 3300049572 | Ga0501036_0064478 | Ga0501036_0064478_386_1165 | 258 |
| 977 | 3300049575 | Ga0501039_0248810 | Ga0501039_0248810_217_996 | 258 |
| 978 | 3300049588 | Ga0501072_0055462 | Ga0501072_0055462_578_1357 | 258 |
| 979 | 3300049592 | Ga0501076_0025814 | Ga0501076_0025814_2797_3576 | 258 |
| 980 | 2162886007 | SwRhRL2b_contig_1816436 | SwRhRL2b_0577.00003680 | 262 |
| 981 | 3300032004 | Ga0307414_10162892 | Ga0307414_101628922 | 262 |
| 982 | 3300032005 | Ga0307411_10131772 | Ga0307411_101317722 | 262 |
| 983 | 3300032126 | Ga0307415_100012994 | Ga0307415_1000129943 | 262 |
| 984 | 3300044712 | Ga0453684_0066162 | Ga0453684_0066162_3514_4302 | 262 |
| 985 | 3300045051 | Ga0451576_0059422 | Ga0451576_0059422_1577_2365 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9392 | 43 | 262 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8778 | 43 | 262 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.8599 | 63 | 262 |
| 4dcm-assembly1.cif.gz_A | crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli | 0.8409 | 64 | 262 |
| 1dl5-assembly1.cif.gz_A | protein-l-isoaspartate o-methyltransferase | 0.8381 | 62 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9912 | 43 | 262 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9823 | 43 | 262 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9714 | 43 | 262 | 3.40.50.150 |
| af_Q2FYG5_1_193_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9631 | 68 | 262 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9549 | 44 | 262 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2SF17-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9892 | 17 | 262 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A7V5PGH2-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9881 | 14 | 223 |
GO:0008425
GO:0009234 GO:0032259 |
| AF-A0A6A5KTX5-F1-model_v4 | deleted | 0.9868 | 13 | 261 |
|
| AF-A0A7V5PGH2-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9834 | 14 | 223 |
GO:0008425
GO:0009234 GO:0032259 |
| AF-A0A2V0NZW4-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.9782 | 19 | 262 |
GO:0008425
GO:0031314 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar