F487482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 984 | 453 | 1968 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0242858|Ga0495629_0242858_45_512 |
| Length | 155 |
| Sequence | MPVIGATQRFSTLANPGGTDMRLPRMLTPRTVVRAHCDLPCGVYDPAQARIEAESVKAICVKLQGNSDPDFRTRALIIKEQRSELVKHHLWVLWTDYFKPPHFEKYPQLHGLFNEATKLAGGGNGTKSSSDPAVADQLLAKIEEISKIFWETKQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 102 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 103 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 104 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 218 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 219 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 220 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 221 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 242 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 243 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 244 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 245 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 247 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 281 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 282 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 283 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 284 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 285 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 301 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 302 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 405 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 409 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 411 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 412 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 413 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 429 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 430 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 431 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 432 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 433 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 434 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 435 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 436 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 437 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 438 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 439 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 440 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 441 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 442 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 443 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 444 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 445 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 446 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 447 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 448 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 449 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 450 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 451 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 452 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 453 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.72 |
| Metatranscriptomes | 8.43 |
| Isolates | 2.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0.51 |
| Rhizoplane | 6.71 |
| Rhizosphere | 84.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495629_0242858 | 3300046459 | Bacteria | 1240 |
| 2 | JGI24740J21852_10095534 | 3300001979 | Bacteria | 762 |
| 3 | JGI24739J22299_10246418 | 3300001989 | Bacteria | 523 |
| 4 | JGI24034J26672_10100481 | 3300002239 | Bacteria | 545 |
| 5 | JGI25406J46586_10118020 | 3300003203 | Bacteria | 782 |
| 6 | JGI25404J52841_10055524 | 3300003659 | Bacteria | 831 |
| 7 | JGI25404J52841_10091508 | 3300003659 | Bacteria | 636 |
| 8 | Ga0058859_11820616 | 3300004798 | Bacteria | 666 |
| 9 | Ga0058863_10036897 | 3300004799 | Bacteria | 908 |
| 10 | Ga0058861_11876488 | 3300004800 | Bacteria | 580 |
| 11 | Ga0058861_12020820 | 3300004800 | Bacteria | 702 |
| 12 | Ga0058860_12150652 | 3300004801 | Bacteria | 540 |
| 13 | Ga0058862_10018238 | 3300004803 | Bacteria | 514 |
| 14 | Ga0058862_10095433 | 3300004803 | Bacteria | 623 |
| 15 | Ga0070658_10002809 | 3300005327 | Bacteria | 14469 |
| 16 | Ga0070658_10090810 | 3300005327 | Bacteria | 2517 |
| 17 | Ga0070658_10815776 | 3300005327 | Bacteria | 811 |
| 18 | Ga0070683_100564453 | 3300005329 | Bacteria | 1088 |
| 19 | Ga0070683_100896386 | 3300005329 | Bacteria | 851 |
| 20 | Ga0070683_101057001 | 3300005329 | Bacteria | 780 |
| 21 | Ga0070670_100426773 | 3300005331 | Bacteria | 1172 |
| 22 | Ga0070670_100909930 | 3300005331 | Bacteria | 798 |
| 23 | Ga0070666_10007271 | 3300005335 | Bacteria | 6826 |
| 24 | Ga0070680_100528082 | 3300005336 | Bacteria | 1011 |
| 25 | Ga0070680_100601343 | 3300005336 | Bacteria | 944 |
| 26 | Ga0070682_100226671 | 3300005337 | Bacteria | 1334 |
| 27 | Ga0070682_100552065 | 3300005337 | Bacteria | 902 |
| 28 | Ga0070682_100858159 | 3300005337 | Bacteria | 742 |
| 29 | Ga0070682_101194187 | 3300005337 | Bacteria | 642 |
| 30 | Ga0070660_100180596 | 3300005339 | Bacteria | 1708 |
| 31 | Ga0070660_100218869 | 3300005339 | Bacteria | 1547 |
| 32 | Ga0070689_100130370 | 3300005340 | Bacteria | 2016 |
| 33 | Ga0070691_10549264 | 3300005341 | Bacteria | 675 |
| 34 | Ga0070661_100044193 | 3300005344 | Bacteria | 3255 |
| 35 | Ga0070661_100078363 | 3300005344 | Bacteria | 2437 |
| 36 | Ga0070661_100636516 | 3300005344 | Bacteria | 865 |
| 37 | Ga0070661_101108623 | 3300005344 | Bacteria | 660 |
| 38 | Ga0070692_10051650 | 3300005345 | Bacteria | 2139 |
| 39 | Ga0070668_100008173 | 3300005347 | Bacteria | 7770 |
| 40 | Ga0070668_100033438 | 3300005347 | Bacteria | 3916 |
| 41 | Ga0070668_100241440 | 3300005347 | Bacteria | 1496 |
| 42 | Ga0070675_100655065 | 3300005354 | Bacteria | 954 |
| 43 | Ga0070671_100252094 | 3300005355 | Bacteria | 1499 |
| 44 | Ga0070671_100558062 | 3300005355 | Bacteria | 988 |
| 45 | Ga0070671_100568077 | 3300005355 | Bacteria | 979 |
| 46 | Ga0070688_100180778 | 3300005365 | Bacteria | 1463 |
| 47 | Ga0070659_100037634 | 3300005366 | Bacteria | 3773 |
| 48 | Ga0070667_100087343 | 3300005367 | Bacteria | 2677 |
| 49 | Ga0070667_100185405 | 3300005367 | Bacteria | 1841 |
| 50 | Ga0070667_100369800 | 3300005367 | Bacteria | 1300 |
| 51 | Ga0070709_10034833 | 3300005434 | Bacteria | 3056 |
| 52 | Ga0070709_10147201 | 3300005434 | Bacteria | 1624 |
| 53 | Ga0070709_10248843 | 3300005434 | Bacteria | 1279 |
| 54 | Ga0070709_10761140 | 3300005434 | Bacteria | 757 |
| 55 | Ga0070714_100000753 | 3300005435 | Bacteria | 22949 |
| 56 | Ga0070714_100008171 | 3300005435 | Bacteria | 8158 |
| 57 | Ga0070714_100017153 | 3300005435 | Bacteria | 5863 |
| 58 | Ga0070714_100067024 | 3300005435 | Bacteria | 3094 |
| 59 | Ga0070714_100558441 | 3300005435 | Bacteria | 1096 |
| 60 | Ga0070714_100586640 | 3300005435 | Bacteria | 1069 |
| 61 | Ga0070713_100044135 | 3300005436 | Bacteria | 3647 |
| 62 | Ga0070713_100191400 | 3300005436 | Bacteria | 1843 |
| 63 | Ga0070713_100652198 | 3300005436 | Bacteria | 1002 |
| 64 | Ga0070713_100786403 | 3300005436 | Bacteria | 912 |
| 65 | Ga0070713_101184371 | 3300005436 | Bacteria | 739 |
| 66 | Ga0070713_101255665 | 3300005436 | Bacteria | 717 |
| 67 | Ga0070713_102065715 | 3300005436 | Bacteria | 552 |
| 68 | Ga0070710_10129766 | 3300005437 | Bacteria | 1535 |
| 69 | Ga0070710_10613715 | 3300005437 | Bacteria | 758 |
| 70 | Ga0070710_10620803 | 3300005437 | Bacteria | 755 |
| 71 | Ga0070710_10707653 | 3300005437 | Bacteria | 711 |
| 72 | Ga0070711_100028645 | 3300005439 | Bacteria | 3667 |
| 73 | Ga0070711_100133748 | 3300005439 | Bacteria | 1850 |
| 74 | Ga0070711_100258732 | 3300005439 | Bacteria | 1368 |
| 75 | Ga0070711_100612060 | 3300005439 | Bacteria | 910 |
| 76 | Ga0070711_100894559 | 3300005439 | Bacteria | 757 |
| 77 | Ga0070711_101708129 | 3300005439 | Bacteria | 551 |
| 78 | Ga0070705_100832150 | 3300005440 | Bacteria | 737 |
| 79 | Ga0070705_101223244 | 3300005440 | Bacteria | 620 |
| 80 | Ga0070700_100320578 | 3300005441 | Bacteria | 1138 |
| 81 | Ga0070694_100407694 | 3300005444 | Bacteria | 1065 |
| 82 | Ga0070663_100014425 | 3300005455 | Bacteria | 5071 |
| 83 | Ga0070663_100024443 | 3300005455 | Bacteria | 4067 |
| 84 | Ga0070663_101012715 | 3300005455 | Bacteria | 723 |
| 85 | Ga0070678_100334708 | 3300005456 | Bacteria | 1297 |
| 86 | Ga0070678_100395146 | 3300005456 | Bacteria | 1200 |
| 87 | Ga0070678_100605162 | 3300005456 | Bacteria | 979 |
| 88 | Ga0070662_100143834 | 3300005457 | Bacteria | 1851 |
| 89 | Ga0070681_10162855 | 3300005458 | Bacteria | 2154 |
| 90 | Ga0070681_10419746 | 3300005458 | Bacteria | 1250 |
| 91 | Ga0070681_10451585 | 3300005458 | Bacteria | 1197 |
| 92 | Ga0070681_10517477 | 3300005458 | Bacteria | 1106 |
| 93 | Ga0070681_11297241 | 3300005458 | Bacteria | 651 |
| 94 | Ga0070706_100066339 | 3300005467 | Bacteria | 3339 |
| 95 | Ga0070706_100121380 | 3300005467 | Bacteria | 2436 |
| 96 | Ga0070707_100076694 | 3300005468 | Bacteria | 3224 |
| 97 | Ga0070707_100085908 | 3300005468 | Bacteria | 3042 |
| 98 | Ga0070707_100275834 | 3300005468 | Bacteria | 1634 |
| 99 | Ga0070698_100005079 | 3300005471 | Bacteria | 14410 |
| 100 | Ga0070698_100087099 | 3300005471 | Bacteria | 3109 |
| 101 | Ga0070698_100740993 | 3300005471 | Bacteria | 925 |
| 102 | Ga0070698_101064854 | 3300005471 | Bacteria | 757 |
| 103 | Ga0070699_100976339 | 3300005518 | Bacteria | 776 |
| 104 | Ga0070699_101051772 | 3300005518 | Bacteria | 747 |
| 105 | Ga0070679_100047394 | 3300005530 | Bacteria | 4283 |
| 106 | Ga0070679_100052945 | 3300005530 | Bacteria | 4040 |
| 107 | Ga0070679_100172479 | 3300005530 | Bacteria | 2136 |
| 108 | Ga0070679_100434645 | 3300005530 | Bacteria | 1257 |
| 109 | Ga0070679_101301257 | 3300005530 | Bacteria | 673 |
| 110 | Ga0070684_100184680 | 3300005535 | Bacteria | 1896 |
| 111 | Ga0070684_100246432 | 3300005535 | Bacteria | 1633 |
| 112 | Ga0070684_100323587 | 3300005535 | Bacteria | 1416 |
| 113 | Ga0070684_100550520 | 3300005535 | Bacteria | 1071 |
| 114 | Ga0070684_100662553 | 3300005535 | Bacteria | 972 |
| 115 | Ga0070697_101728792 | 3300005536 | Bacteria | 560 |
| 116 | Ga0070697_101873390 | 3300005536 | Bacteria | 537 |
| 117 | Ga0068853_100567015 | 3300005539 | Bacteria | 1076 |
| 118 | Ga0070686_100018630 | 3300005544 | Bacteria | 4080 |
| 119 | Ga0070696_100082410 | 3300005546 | Bacteria | 2280 |
| 120 | Ga0070696_101847818 | 3300005546 | Bacteria | 523 |
| 121 | Ga0070665_100518403 | 3300005548 | Bacteria | 1204 |
| 122 | Ga0070665_100813066 | 3300005548 | Bacteria | 948 |
| 123 | Ga0068855_100643143 | 3300005563 | Bacteria | 1140 |
| 124 | Ga0070664_100044889 | 3300005564 | Bacteria | 3732 |
| 125 | Ga0070664_100356882 | 3300005564 | Bacteria | 1331 |
| 126 | Ga0068857_100050339 | 3300005577 | Bacteria | 3696 |
| 127 | Ga0068857_100102046 | 3300005577 | Bacteria | 2574 |
| 128 | Ga0068857_100889640 | 3300005577 | Bacteria | 853 |
| 129 | Ga0068857_100936935 | 3300005577 | Bacteria | 832 |
| 130 | Ga0068857_101757970 | 3300005577 | Bacteria | 607 |
| 131 | Ga0068854_100068940 | 3300005578 | Bacteria | 2580 |
| 132 | Ga0068854_100937952 | 3300005578 | Bacteria | 763 |
| 133 | Ga0068856_100313462 | 3300005614 | Bacteria | 1586 |
| 134 | Ga0068856_100673899 | 3300005614 | Bacteria | 1055 |
| 135 | Ga0068856_100730096 | 3300005614 | Bacteria | 1011 |
| 136 | Ga0068856_100953678 | 3300005614 | Bacteria | 876 |
| 137 | Ga0068852_101108801 | 3300005616 | Bacteria | 812 |
| 138 | Ga0068852_101406450 | 3300005616 | Bacteria | 720 |
| 139 | Ga0068852_101520825 | 3300005616 | Bacteria | 692 |
| 140 | Ga0068864_100014862 | 3300005618 | Bacteria | 6468 |
| 141 | Ga0068864_100048803 | 3300005618 | Bacteria | 3640 |
| 142 | Ga0068864_101489333 | 3300005618 | Bacteria | 680 |
| 143 | Ga0068866_10971195 | 3300005718 | Bacteria | 602 |
| 144 | Ga0068861_100579844 | 3300005719 | Bacteria | 1026 |
| 145 | Ga0068861_100611453 | 3300005719 | Bacteria | 1002 |
| 146 | Ga0068851_10245611 | 3300005834 | Bacteria | 1014 |
| 147 | Ga0068851_10415622 | 3300005834 | Bacteria | 793 |
| 148 | Ga0068870_10323452 | 3300005840 | Bacteria | 981 |
| 149 | Ga0068863_100112067 | 3300005841 | Bacteria | 2598 |
| 150 | Ga0068863_100180153 | 3300005841 | Bacteria | 2028 |
| 151 | Ga0068863_100521399 | 3300005841 | Bacteria | 1172 |
| 152 | Ga0068858_100068410 | 3300005842 | Bacteria | 3291 |
| 153 | Ga0068858_100985802 | 3300005842 | Bacteria | 825 |
| 154 | Ga0068860_100264090 | 3300005843 | Bacteria | 1678 |
| 155 | Ga0068860_100747225 | 3300005843 | Bacteria | 990 |
| 156 | Ga0068862_100058307 | 3300005844 | Bacteria | 3312 |
| 157 | Ga0068862_100302063 | 3300005844 | Bacteria | 1473 |
| 158 | Ga0081455_10127209 | 3300005937 | Bacteria | 1997 |
| 159 | Ga0081455_10350544 | 3300005937 | Bacteria | 1041 |
| 160 | Ga0081540_1000607 | 3300005983 | Bacteria | 34146 |
| 161 | Ga0081540_1006932 | 3300005983 | Bacteria | 8167 |
| 162 | Ga0081540_1007264 | 3300005983 | Bacteria | 7933 |
| 163 | Ga0081540_1011440 | 3300005983 | Bacteria | 5929 |
| 164 | Ga0081540_1090579 | 3300005983 | Bacteria | 1346 |
| 165 | Ga0081540_1187352 | 3300005983 | Bacteria | 767 |
| 166 | Ga0081540_1248110 | 3300005983 | Bacteria | 622 |
| 167 | Ga0081539_10000367 | 3300005985 | Bacteria | 98630 |
| 168 | Ga0081539_10004494 | 3300005985 | Bacteria | 15344 |
| 169 | Ga0081539_10004919 | 3300005985 | Bacteria | 14234 |
| 170 | Ga0081539_10011051 | 3300005985 | Bacteria | 7216 |
| 171 | Ga0070717_10103636 | 3300006028 | Bacteria | 2419 |
| 172 | Ga0070717_10160733 | 3300006028 | Bacteria | 1948 |
| 173 | Ga0070717_10164931 | 3300006028 | Bacteria | 1924 |
| 174 | Ga0070717_10796549 | 3300006028 | Bacteria | 860 |
| 175 | Ga0070717_11343370 | 3300006028 | Bacteria | 649 |
| 176 | Ga0075365_10040154 | 3300006038 | Bacteria | 3051 |
| 177 | Ga0075364_10413538 | 3300006051 | Bacteria | 920 |
| 178 | Ga0075432_10230818 | 3300006058 | Bacteria | 744 |
| 179 | Ga0070715_10084966 | 3300006163 | Bacteria | 1444 |
| 180 | Ga0070715_10105393 | 3300006163 | Bacteria | 1322 |
| 181 | Ga0070715_10123664 | 3300006163 | Bacteria | 1236 |
| 182 | Ga0070715_10201849 | 3300006163 | Bacteria | 1011 |
| 183 | Ga0070716_100002471 | 3300006173 | Bacteria | 8534 |
| 184 | Ga0070716_100043547 | 3300006173 | Bacteria | 2510 |
| 185 | Ga0070716_100062145 | 3300006173 | Bacteria | 2164 |
| 186 | Ga0070716_100252866 | 3300006173 | Bacteria | 1201 |
| 187 | Ga0070716_100539372 | 3300006173 | Bacteria | 868 |
| 188 | Ga0070712_100083106 | 3300006175 | Bacteria | 2324 |
| 189 | Ga0070712_100301821 | 3300006175 | Bacteria | 1296 |
| 190 | Ga0070712_100357028 | 3300006175 | Bacteria | 1197 |
| 191 | Ga0070712_101017488 | 3300006175 | Bacteria | 717 |
| 192 | Ga0070712_101284837 | 3300006175 | Bacteria | 637 |
| 193 | Ga0070712_101759587 | 3300006175 | Bacteria | 543 |
| 194 | Ga0075367_10180800 | 3300006178 | Bacteria | 1315 |
| 195 | Ga0097621_100691399 | 3300006237 | Bacteria | 938 |
| 196 | Ga0068871_101285604 | 3300006358 | Bacteria | 688 |
| 197 | Ga0075428_100065541 | 3300006844 | Bacteria | 3977 |
| 198 | Ga0075428_100284917 | 3300006844 | Bacteria | 1778 |
| 199 | Ga0075428_100507992 | 3300006844 | Bacteria | 1289 |
| 200 | Ga0075428_100567630 | 3300006844 | Bacteria | 1213 |
| 201 | Ga0075431_100040901 | 3300006847 | Bacteria | 4779 |
| 202 | Ga0075431_100216866 | 3300006847 | Bacteria | 1953 |
| 203 | Ga0075431_100301099 | 3300006847 | Bacteria | 1620 |
| 204 | Ga0075431_100409743 | 3300006847 | Bacteria | 1356 |
| 205 | Ga0075431_100871578 | 3300006847 | Bacteria | 871 |
| 206 | Ga0075433_10005443 | 3300006852 | Bacteria | 10005 |
| 207 | Ga0075433_10260593 | 3300006852 | Bacteria | 1537 |
| 208 | Ga0075434_100051405 | 3300006871 | Bacteria | 4096 |
| 209 | Ga0075434_100453657 | 3300006871 | Bacteria | 1303 |
| 210 | Ga0075434_100582083 | 3300006871 | Bacteria | 1138 |
| 211 | Ga0075434_100791751 | 3300006871 | Bacteria | 964 |
| 212 | Ga0075429_100371752 | 3300006880 | Bacteria | 1251 |
| 213 | Ga0068865_100023726 | 3300006881 | Bacteria | 4020 |
| 214 | Ga0075436_100025943 | 3300006914 | Bacteria | 4034 |
| 215 | Ga0075436_100383482 | 3300006914 | Bacteria | 1016 |
| 216 | Ga0075435_100707242 | 3300007076 | Bacteria | 876 |
| 217 | Ga0105251_10071437 | 3300009011 | Bacteria | 1615 |
| 218 | Ga0105251_10155197 | 3300009011 | Bacteria | 1033 |
| 219 | Ga0105244_10295526 | 3300009036 | Bacteria | 750 |
| 220 | Ga0105250_10037099 | 3300009092 | Bacteria | 1956 |
| 221 | Ga0105240_10291918 | 3300009093 | Bacteria | 1869 |
| 222 | Ga0105240_10765289 | 3300009093 | Bacteria | 1049 |
| 223 | Ga0111539_10482804 | 3300009094 | Bacteria | 1443 |
| 224 | Ga0105245_10168892 | 3300009098 | Bacteria | 2081 |
| 225 | Ga0105245_10516459 | 3300009098 | Bacteria | 1212 |
| 226 | Ga0105245_10765479 | 3300009098 | Bacteria | 1002 |
| 227 | Ga0105247_10316782 | 3300009101 | Bacteria | 1087 |
| 228 | Ga0105247_10549544 | 3300009101 | Bacteria | 849 |
| 229 | Ga0114129_10108046 | 3300009147 | Bacteria | 3842 |
| 230 | Ga0114129_10193989 | 3300009147 | Bacteria | 2756 |
| 231 | Ga0114129_10303555 | 3300009147 | Bacteria | 2127 |
| 232 | Ga0114129_10376770 | 3300009147 | Bacteria | 1875 |
| 233 | Ga0114129_13400088 | 3300009147 | Bacteria | 512 |
| 234 | Ga0105243_11243506 | 3300009148 | Bacteria | 759 |
| 235 | Ga0105243_11355323 | 3300009148 | Bacteria | 730 |
| 236 | Ga0105243_11780974 | 3300009148 | Bacteria | 646 |
| 237 | Ga0105241_10883017 | 3300009174 | Bacteria | 829 |
| 238 | Ga0105242_10428936 | 3300009176 | Bacteria | 1241 |
| 239 | Ga0105242_11571396 | 3300009176 | Bacteria | 691 |
| 240 | Ga0105242_13034902 | 3300009176 | Bacteria | 520 |
| 241 | Ga0105248_10049688 | 3300009177 | Bacteria | 4704 |
| 242 | Ga0105248_10526018 | 3300009177 | Bacteria | 1334 |
| 243 | Ga0105248_11358877 | 3300009177 | Bacteria | 804 |
| 244 | Ga0105239_10099887 | 3300010375 | Bacteria | 3209 |
| 245 | Ga0105239_10422685 | 3300010375 | Bacteria | 1510 |
| 246 | Ga0105239_10527787 | 3300010375 | Bacteria | 1343 |
| 247 | Ga0157340_1007745 | 3300012473 | Bacteria | 704 |
| 248 | Ga0157337_1027361 | 3300012483 | Bacteria | 564 |
| 249 | Ga0157323_1003421 | 3300012495 | Bacteria | 956 |
| 250 | Ga0157339_1057686 | 3300012505 | Bacteria | 531 |
| 251 | Ga0157371_10058304 | 3300013102 | Bacteria | 2739 |
| 252 | Ga0157371_10172674 | 3300013102 | Bacteria | 1545 |
| 253 | Ga0157369_10008899 | 3300013105 | Bacteria | 11502 |
| 254 | Ga0157369_10021008 | 3300013105 | Bacteria | 7299 |
| 255 | Ga0157369_10022064 | 3300013105 | Bacteria | 7114 |
| 256 | Ga0157369_11456328 | 3300013105 | Bacteria | 697 |
| 257 | Ga0157374_10842653 | 3300013296 | Bacteria | 933 |
| 258 | Ga0163162_10047239 | 3300013306 | Bacteria | 4314 |
| 259 | Ga0163162_10402358 | 3300013306 | Bacteria | 1502 |
| 260 | Ga0163162_11032191 | 3300013306 | Bacteria | 930 |
| 261 | Ga0163162_11131053 | 3300013306 | Bacteria | 888 |
| 262 | Ga0157372_10172952 | 3300013307 | Bacteria | 2499 |
| 263 | Ga0157372_10269641 | 3300013307 | Bacteria | 1977 |
| 264 | Ga0157372_10855343 | 3300013307 | Bacteria | 1056 |
| 265 | Ga0157372_11130575 | 3300013307 | Bacteria | 906 |
| 266 | Ga0157375_10013964 | 3300013308 | Bacteria | 7159 |
| 267 | Ga0157375_10188673 | 3300013308 | Bacteria | 2216 |
| 268 | Ga0157375_10338188 | 3300013308 | Bacteria | 1671 |
| 269 | Ga0157375_10688432 | 3300013308 | Bacteria | 1177 |
| 270 | Ga0163163_10053614 | 3300014325 | Bacteria | 3981 |
| 271 | Ga0163163_10123189 | 3300014325 | Bacteria | 2628 |
| 272 | Ga0163163_10525975 | 3300014325 | Bacteria | 1245 |
| 273 | Ga0163163_10883459 | 3300014325 | Bacteria | 957 |
| 274 | Ga0157380_10076143 | 3300014326 | Bacteria | 2730 |
| 275 | Ga0182008_10092340 | 3300014497 | Bacteria | 1493 |
| 276 | Ga0157377_10022617 | 3300014745 | Bacteria | 3322 |
| 277 | Ga0157379_10107226 | 3300014968 | Bacteria | 2508 |
| 278 | Ga0157379_10614617 | 3300014968 | Bacteria | 1015 |
| 279 | Ga0157376_11045231 | 3300014969 | Bacteria | 841 |
| 280 | Ga0182005_1151693 | 3300015265 | Bacteria | 675 |
| 281 | Ga0163161_10346937 | 3300017792 | Bacteria | 1179 |
| 282 | Ga0184594_126852 | 3300019181 | Bacteria | 500 |
| 283 | Ga0197907_10194637 | 3300020069 | Bacteria | 899 |
| 284 | Ga0197907_10765725 | 3300020069 | Bacteria | 2167 |
| 285 | Ga0197907_11163380 | 3300020069 | Bacteria | 3466 |
| 286 | Ga0197907_11282396 | 3300020069 | Bacteria | 702 |
| 287 | Ga0206356_11216319 | 3300020070 | Bacteria | 1867 |
| 288 | Ga0206356_11275235 | 3300020070 | Bacteria | 638 |
| 289 | Ga0206356_11308114 | 3300020070 | Bacteria | 4987 |
| 290 | Ga0206349_1229811 | 3300020075 | Bacteria | 2064 |
| 291 | Ga0206349_1400002 | 3300020075 | Bacteria | 1121 |
| 292 | Ga0206349_1568890 | 3300020075 | Bacteria | 566 |
| 293 | Ga0206355_1481324 | 3300020076 | Bacteria | 860 |
| 294 | Ga0206355_1661015 | 3300020076 | Bacteria | 1013 |
| 295 | Ga0206351_10471509 | 3300020077 | Bacteria | 935 |
| 296 | Ga0206351_10629504 | 3300020077 | Bacteria | 1955 |
| 297 | Ga0206352_10306540 | 3300020078 | Bacteria | 1276 |
| 298 | Ga0206352_10876827 | 3300020078 | Bacteria | 554 |
| 299 | Ga0206352_11293270 | 3300020078 | Bacteria | 543 |
| 300 | Ga0206350_10176573 | 3300020080 | Bacteria | 810 |
| 301 | Ga0206350_10229569 | 3300020080 | Bacteria | 550 |
| 302 | Ga0206350_10689443 | 3300020080 | Bacteria | 1962 |
| 303 | Ga0206350_11074900 | 3300020080 | Bacteria | 654 |
| 304 | Ga0206350_11609588 | 3300020080 | Bacteria | 1748 |
| 305 | Ga0206354_10064564 | 3300020081 | Bacteria | 2686 |
| 306 | Ga0206354_10391073 | 3300020081 | Bacteria | 1751 |
| 307 | Ga0206354_11549948 | 3300020081 | Bacteria | 637 |
| 308 | Ga0206353_10851551 | 3300020082 | Bacteria | 735 |
| 309 | Ga0206353_11229849 | 3300020082 | Bacteria | 2097 |
| 310 | Ga0206353_11327800 | 3300020082 | Bacteria | 4483 |
| 311 | Ga0154015_1265672 | 3300020610 | Bacteria | 827 |
| 312 | Ga0154015_1563874 | 3300020610 | Bacteria | 660 |
| 313 | Ga0213874_10048215 | 3300021377 | Bacteria | 1299 |
| 314 | Ga0213876_10000552 | 3300021384 | Bacteria | 28013 |
| 315 | Ga0213875_10001581 | 3300021388 | Bacteria | 14507 |
| 316 | Ga0224712_10003059 | 3300022467 | Bacteria | 4267 |
| 317 | Ga0224712_10011091 | 3300022467 | Bacteria | 2781 |
| 318 | Ga0224712_10095488 | 3300022467 | Bacteria | 1252 |
| 319 | Ga0224712_10204536 | 3300022467 | Bacteria | 898 |
| 320 | Ga0224712_10213198 | 3300022467 | Bacteria | 881 |
| 321 | Ga0224712_10313819 | 3300022467 | Bacteria | 735 |
| 322 | Ga0224712_10506093 | 3300022467 | Bacteria | 584 |
| 323 | Ga0224712_10649205 | 3300022467 | Bacteria | 517 |
| 324 | Ga0207656_10622745 | 3300025321 | Bacteria | 551 |
| 325 | Ga0207692_10005854 | 3300025898 | Bacteria | 4954 |
| 326 | Ga0207692_10021609 | 3300025898 | Bacteria | 2947 |
| 327 | Ga0207692_10131224 | 3300025898 | Bacteria | 1415 |
| 328 | Ga0207710_10486349 | 3300025900 | Bacteria | 640 |
| 329 | Ga0207680_10299896 | 3300025903 | Bacteria | 1120 |
| 330 | Ga0207647_10126140 | 3300025904 | Bacteria | 1506 |
| 331 | Ga0207685_10244282 | 3300025905 | Bacteria | 865 |
| 332 | Ga0207685_10611323 | 3300025905 | Bacteria | 586 |
| 333 | Ga0207699_10002617 | 3300025906 | Bacteria | 8501 |
| 334 | Ga0207699_10004556 | 3300025906 | Bacteria | 6623 |
| 335 | Ga0207699_10014348 | 3300025906 | Bacteria | 4081 |
| 336 | Ga0207699_10167591 | 3300025906 | Bacteria | 1467 |
| 337 | Ga0207699_10173758 | 3300025906 | Bacteria | 1443 |
| 338 | Ga0207699_10205630 | 3300025906 | Bacteria | 1336 |
| 339 | Ga0207643_10396507 | 3300025908 | Bacteria | 872 |
| 340 | Ga0207705_10022712 | 3300025909 | Bacteria | 4474 |
| 341 | Ga0207705_10661768 | 3300025909 | Bacteria | 812 |
| 342 | Ga0207684_10074214 | 3300025910 | Bacteria | 2890 |
| 343 | Ga0207684_10592394 | 3300025910 | Bacteria | 947 |
| 344 | Ga0207654_10502077 | 3300025911 | Bacteria | 857 |
| 345 | Ga0207707_10197330 | 3300025912 | Bacteria | 1755 |
| 346 | Ga0207671_10104410 | 3300025914 | Bacteria | 2150 |
| 347 | Ga0207693_10064332 | 3300025915 | Bacteria | 2873 |
| 348 | Ga0207693_10064916 | 3300025915 | Bacteria | 2859 |
| 349 | Ga0207693_10910147 | 3300025915 | Bacteria | 675 |
| 350 | Ga0207693_10917682 | 3300025915 | Bacteria | 671 |
| 351 | Ga0207693_10984149 | 3300025915 | Bacteria | 645 |
| 352 | Ga0207663_10002762 | 3300025916 | Bacteria | 8464 |
| 353 | Ga0207663_10002815 | 3300025916 | Bacteria | 8394 |
| 354 | Ga0207663_10331530 | 3300025916 | Bacteria | 1146 |
| 355 | Ga0207663_10370087 | 3300025916 | Bacteria | 1089 |
| 356 | Ga0207663_10421812 | 3300025916 | Bacteria | 1024 |
| 357 | Ga0207660_10047885 | 3300025917 | Bacteria | 3024 |
| 358 | Ga0207660_10325024 | 3300025917 | Bacteria | 1229 |
| 359 | Ga0207660_10767296 | 3300025917 | Bacteria | 787 |
| 360 | Ga0207660_10779106 | 3300025917 | Bacteria | 780 |
| 361 | Ga0207662_10652212 | 3300025918 | Bacteria | 735 |
| 362 | Ga0207657_10021306 | 3300025919 | Bacteria | 6103 |
| 363 | Ga0207657_10238203 | 3300025919 | Bacteria | 1453 |
| 364 | Ga0207649_10177331 | 3300025920 | Bacteria | 1489 |
| 365 | Ga0207652_10242328 | 3300025921 | Bacteria | 1625 |
| 366 | Ga0207652_10244642 | 3300025921 | Bacteria | 1617 |
| 367 | Ga0207652_10380956 | 3300025921 | Bacteria | 1273 |
| 368 | Ga0207652_10701356 | 3300025921 | Bacteria | 903 |
| 369 | Ga0207646_10072295 | 3300025922 | Bacteria | 3081 |
| 370 | Ga0207646_10197155 | 3300025922 | Bacteria | 1818 |
| 371 | Ga0207646_10689784 | 3300025922 | Bacteria | 913 |
| 372 | Ga0207681_10359844 | 3300025923 | Bacteria | 1167 |
| 373 | Ga0207694_11336145 | 3300025924 | Bacteria | 606 |
| 374 | Ga0207650_10914644 | 3300025925 | Bacteria | 745 |
| 375 | Ga0207687_10103645 | 3300025927 | Bacteria | 2098 |
| 376 | Ga0207687_10107691 | 3300025927 | Bacteria | 2063 |
| 377 | Ga0207687_11799135 | 3300025927 | Bacteria | 524 |
| 378 | Ga0207700_10019183 | 3300025928 | Bacteria | 4615 |
| 379 | Ga0207700_10054441 | 3300025928 | Bacteria | 3003 |
| 380 | Ga0207700_10527843 | 3300025928 | Bacteria | 1046 |
| 381 | Ga0207700_10559670 | 3300025928 | Bacteria | 1015 |
| 382 | Ga0207700_10672628 | 3300025928 | Bacteria | 923 |
| 383 | Ga0207700_10981029 | 3300025928 | Bacteria | 756 |
| 384 | Ga0207664_10000609 | 3300025929 | Bacteria | 24792 |
| 385 | Ga0207664_10000754 | 3300025929 | Bacteria | 22024 |
| 386 | Ga0207664_10005800 | 3300025929 | Bacteria | 8444 |
| 387 | Ga0207664_10013300 | 3300025929 | Bacteria | 5903 |
| 388 | Ga0207664_10071485 | 3300025929 | Bacteria | 2795 |
| 389 | Ga0207664_10113090 | 3300025929 | Bacteria | 2260 |
| 390 | Ga0207664_10144549 | 3300025929 | Bacteria | 2016 |
| 391 | Ga0207664_10288141 | 3300025929 | Bacteria | 1442 |
| 392 | Ga0207664_11076556 | 3300025929 | Bacteria | 719 |
| 393 | Ga0207664_11201490 | 3300025929 | Bacteria | 676 |
| 394 | Ga0207664_11758380 | 3300025929 | Bacteria | 542 |
| 395 | Ga0207644_11078306 | 3300025931 | Bacteria | 675 |
| 396 | Ga0207690_10067049 | 3300025932 | Bacteria | 2461 |
| 397 | Ga0207690_10129153 | 3300025932 | Bacteria | 1847 |
| 398 | Ga0207690_11025439 | 3300025932 | Bacteria | 687 |
| 399 | Ga0207706_11070777 | 3300025933 | Bacteria | 675 |
| 400 | Ga0207686_10186143 | 3300025934 | Bacteria | 1476 |
| 401 | Ga0207665_10002957 | 3300025939 | Bacteria | 11387 |
| 402 | Ga0207665_10003780 | 3300025939 | Bacteria | 10114 |
| 403 | Ga0207665_10017977 | 3300025939 | Bacteria | 4648 |
| 404 | Ga0207665_10086975 | 3300025939 | Bacteria | 2160 |
| 405 | Ga0207665_10985737 | 3300025939 | Bacteria | 670 |
| 406 | Ga0207711_10062502 | 3300025941 | Bacteria | 3211 |
| 407 | Ga0207711_10870110 | 3300025941 | Bacteria | 838 |
| 408 | Ga0207711_10976259 | 3300025941 | Bacteria | 786 |
| 409 | Ga0207711_11183351 | 3300025941 | Bacteria | 706 |
| 410 | Ga0207661_10115196 | 3300025944 | Bacteria | 2280 |
| 411 | Ga0207661_10144822 | 3300025944 | Bacteria | 2048 |
| 412 | Ga0207661_10329575 | 3300025944 | Bacteria | 1374 |
| 413 | Ga0207661_10820705 | 3300025944 | Bacteria | 856 |
| 414 | Ga0207661_12072932 | 3300025944 | Bacteria | 515 |
| 415 | Ga0207679_10187178 | 3300025945 | Bacteria | 1718 |
| 416 | Ga0207679_10789724 | 3300025945 | Bacteria | 865 |
| 417 | Ga0207679_11125916 | 3300025945 | Bacteria | 720 |
| 418 | Ga0207667_10456156 | 3300025949 | Bacteria | 1299 |
| 419 | Ga0207668_10009004 | 3300025972 | Bacteria | 5968 |
| 420 | Ga0207668_10024098 | 3300025972 | Bacteria | 3923 |
| 421 | Ga0207640_10738495 | 3300025981 | Bacteria | 847 |
| 422 | Ga0207640_11348802 | 3300025981 | Bacteria | 638 |
| 423 | Ga0207658_10055142 | 3300025986 | Bacteria | 2944 |
| 424 | Ga0207658_10721796 | 3300025986 | Bacteria | 901 |
| 425 | Ga0207677_10326452 | 3300026023 | Bacteria | 1277 |
| 426 | Ga0207677_10402885 | 3300026023 | Bacteria | 1161 |
| 427 | Ga0207677_11408329 | 3300026023 | Bacteria | 642 |
| 428 | Ga0207703_10166155 | 3300026035 | Bacteria | 1937 |
| 429 | Ga0207703_10204638 | 3300026035 | Bacteria | 1756 |
| 430 | Ga0207678_10012834 | 3300026067 | Bacteria | 7355 |
| 431 | Ga0207678_10014366 | 3300026067 | Bacteria | 6963 |
| 432 | Ga0207678_10858502 | 3300026067 | Bacteria | 802 |
| 433 | Ga0207702_10030884 | 3300026078 | Bacteria | 4464 |
| 434 | Ga0207702_10098854 | 3300026078 | Bacteria | 2571 |
| 435 | Ga0207702_10338725 | 3300026078 | Bacteria | 1436 |
| 436 | Ga0207702_11733908 | 3300026078 | Bacteria | 617 |
| 437 | Ga0207641_10013004 | 3300026088 | Bacteria | 6827 |
| 438 | Ga0207641_10110957 | 3300026088 | Bacteria | 2431 |
| 439 | Ga0207641_10178100 | 3300026088 | Bacteria | 1945 |
| 440 | Ga0207641_10232316 | 3300026088 | Bacteria | 1715 |
| 441 | Ga0207676_10062278 | 3300026095 | Bacteria | 2958 |
| 442 | Ga0207676_10248755 | 3300026095 | Bacteria | 1599 |
| 443 | Ga0207676_11786009 | 3300026095 | Bacteria | 613 |
| 444 | Ga0207674_10012377 | 3300026116 | Bacteria | 9536 |
| 445 | Ga0207674_10072418 | 3300026116 | Bacteria | 3462 |
| 446 | Ga0207674_10162070 | 3300026116 | Bacteria | 2191 |
| 447 | Ga0207674_10326170 | 3300026116 | Bacteria | 1485 |
| 448 | Ga0207674_10617135 | 3300026116 | Bacteria | 1047 |
| 449 | Ga0207675_100184724 | 3300026118 | Bacteria | 1998 |
| 450 | Ga0207675_100314455 | 3300026118 | Bacteria | 1528 |
| 451 | Ga0207683_10015971 | 3300026121 | Bacteria | 6389 |
| 452 | Ga0207683_10096786 | 3300026121 | Bacteria | 2632 |
| 453 | Ga0207683_10409692 | 3300026121 | Bacteria | 1248 |
| 454 | Ga0207698_10111400 | 3300026142 | Bacteria | 2294 |
| 455 | Ga0207698_10279255 | 3300026142 | Bacteria | 1544 |
| 456 | Ga0207698_10691197 | 3300026142 | Bacteria | 1014 |
| 457 | Ga0207698_11670937 | 3300026142 | Bacteria | 652 |
| 458 | Ga0207428_10217676 | 3300027907 | Bacteria | 1433 |
| 459 | Ga0207428_10237935 | 3300027907 | Bacteria | 1361 |
| 460 | Ga0268266_10287483 | 3300028379 | Bacteria | 1530 |
| 461 | Ga0268266_10313310 | 3300028379 | Bacteria | 1467 |
| 462 | Ga0268266_10380354 | 3300028379 | Bacteria | 1331 |
| 463 | Ga0268266_10641698 | 3300028379 | Bacteria | 1021 |
| 464 | Ga0268266_11200851 | 3300028379 | Bacteria | 733 |
| 465 | Ga0268265_10045861 | 3300028380 | Bacteria | 3265 |
| 466 | Ga0268265_10112804 | 3300028380 | Bacteria | 2223 |
| 467 | Ga0268265_10437030 | 3300028380 | Bacteria | 1219 |
| 468 | Ga0268264_10112282 | 3300028381 | Bacteria | 2389 |
| 469 | Ga0268264_10390341 | 3300028381 | Bacteria | 1335 |
| 470 | Ga0268264_10681248 | 3300028381 | Bacteria | 1020 |
| 471 | Ga0265337_1000047 | 3300028556 | Bacteria | 53962 |
| 472 | Ga0265326_10001418 | 3300028558 | Bacteria | 8437 |
| 473 | Ga0265319_1001012 | 3300028563 | Bacteria | 17563 |
| 474 | Ga0265334_10000196 | 3300028573 | Bacteria | 34888 |
| 475 | Ga0265318_10030188 | 3300028577 | Bacteria | 2109 |
| 476 | Ga0265323_10007189 | 3300028653 | Bacteria | 4642 |
| 477 | Ga0265322_10046531 | 3300028654 | Bacteria | 1233 |
| 478 | Ga0265336_10003247 | 3300028666 | Bacteria | 6443 |
| 479 | Ga0307515_10000065 | 3300028794 | Bacteria | 244497 |
| 480 | Ga0265338_10000315 | 3300028800 | Bacteria | 87685 |
| 481 | Ga0265338_10004007 | 3300028800 | Bacteria | 20224 |
| 482 | Ga0265324_10001017 | 3300029957 | Bacteria | 17233 |
| 483 | Ga0307512_10037074 | 3300030522 | Bacteria | 4124 |
| 484 | Ga0265767_116348 | 3300030836 | Bacteria | 539 |
| 485 | Ga0265767_119098 | 3300030836 | Bacteria | 511 |
| 486 | Ga0265766_1019937 | 3300030863 | Bacteria | 547 |
| 487 | Ga0265777_112814 | 3300030877 | Bacteria | 635 |
| 488 | Ga0265765_1040137 | 3300030879 | Bacteria | 620 |
| 489 | Ga0265768_110707 | 3300030963 | Bacteria | 592 |
| 490 | Ga0265332_10000555 | 3300031238 | Bacteria | 25185 |
| 491 | Ga0265320_10001096 | 3300031240 | Bacteria | 19985 |
| 492 | Ga0265325_10004303 | 3300031241 | Bacteria | 9021 |
| 493 | Ga0265340_10000227 | 3300031247 | Bacteria | 28794 |
| 494 | Ga0265339_10040123 | 3300031249 | Bacteria | 2603 |
| 495 | Ga0265316_10009276 | 3300031344 | Bacteria | 9063 |
| 496 | Ga0307513_10068018 | 3300031456 | Bacteria | 3733 |
| 497 | Ga0307513_10179558 | 3300031456 | Bacteria | 1982 |
| 498 | Ga0307509_10049017 | 3300031507 | Bacteria | 4532 |
| 499 | Ga0307509_10127111 | 3300031507 | Bacteria | 2513 |
| 500 | Ga0307408_100016145 | 3300031548 | Bacteria | 4979 |
| 501 | Ga0307408_100040618 | 3300031548 | Bacteria | 3295 |
| 502 | Ga0307408_100073547 | 3300031548 | Bacteria | 2534 |
| 503 | Ga0310117_123185 | 3300031592 | Bacteria | 615 |
| 504 | Ga0265313_10040705 | 3300031595 | Bacteria | 2295 |
| 505 | Ga0310103_138803 | 3300031614 | Bacteria | 552 |
| 506 | Ga0310103_140500 | 3300031614 | Bacteria | 536 |
| 507 | Ga0307508_10000654 | 3300031616 | Bacteria | 41574 |
| 508 | Ga0307508_10090733 | 3300031616 | Bacteria | 2643 |
| 509 | Ga0307508_10225322 | 3300031616 | Bacteria | 1474 |
| 510 | Ga0307508_10237078 | 3300031616 | Bacteria | 1422 |
| 511 | Ga0307508_10681243 | 3300031616 | Bacteria | 636 |
| 512 | Ga0310108_120659 | 3300031633 | Bacteria | 605 |
| 513 | Ga0310115_125776 | 3300031635 | Bacteria | 563 |
| 514 | Ga0310111_138010 | 3300031667 | Bacteria | 543 |
| 515 | Ga0310101_124840 | 3300031690 | Bacteria | 560 |
| 516 | Ga0316579_10006505 | 3300031691 | Bacteria | 4770 |
| 517 | Ga0265314_10004449 | 3300031711 | Bacteria | 13011 |
| 518 | Ga0265342_10000413 | 3300031712 | Bacteria | 46857 |
| 519 | Ga0316576_10040310 | 3300031727 | Bacteria | 3356 |
| 520 | Ga0316578_10010080 | 3300031728 | Bacteria | 4889 |
| 521 | Ga0316578_10107884 | 3300031728 | Bacteria | 1671 |
| 522 | Ga0307516_10001866 | 3300031730 | Bacteria | 28881 |
| 523 | Ga0307516_10004273 | 3300031730 | Bacteria | 17755 |
| 524 | Ga0307516_10042382 | 3300031730 | Bacteria | 4515 |
| 525 | Ga0307516_10172871 | 3300031730 | Bacteria | 1899 |
| 526 | Ga0307405_10228486 | 3300031731 | Bacteria | 1370 |
| 527 | Ga0307405_11104007 | 3300031731 | Bacteria | 682 |
| 528 | Ga0316577_10007915 | 3300031733 | Bacteria | 5676 |
| 529 | Ga0316045_125342 | 3300031815 | Bacteria | 539 |
| 530 | Ga0307413_10375949 | 3300031824 | Bacteria | 1105 |
| 531 | Ga0307413_11374518 | 3300031824 | Bacteria | 620 |
| 532 | Ga0307410_10051690 | 3300031852 | Bacteria | 2771 |
| 533 | Ga0307410_10162451 | 3300031852 | Bacteria | 1675 |
| 534 | Ga0307410_11375079 | 3300031852 | Bacteria | 619 |
| 535 | Ga0307410_11506944 | 3300031852 | Bacteria | 592 |
| 536 | Ga0326468_10000007 | 3300031889 | Bacteria | 13984 |
| 537 | Ga0307406_10009183 | 3300031901 | Bacteria | 5539 |
| 538 | Ga0307406_10029598 | 3300031901 | Bacteria | 3317 |
| 539 | Ga0307406_10040842 | 3300031901 | Bacteria | 2887 |
| 540 | Ga0307406_10114874 | 3300031901 | Bacteria | 1860 |
| 541 | Ga0307406_10697601 | 3300031901 | Bacteria | 847 |
| 542 | Ga0307406_11095428 | 3300031901 | Bacteria | 687 |
| 543 | Ga0307407_10013293 | 3300031903 | Bacteria | 3990 |
| 544 | Ga0307407_10157597 | 3300031903 | Bacteria | 1482 |
| 545 | Ga0307407_11626462 | 3300031903 | Bacteria | 513 |
| 546 | Ga0307412_10081909 | 3300031911 | Bacteria | 2233 |
| 547 | Ga0307412_10386700 | 3300031911 | Bacteria | 1135 |
| 548 | Ga0307412_10908420 | 3300031911 | Bacteria | 772 |
| 549 | Ga0307409_100007834 | 3300031995 | Bacteria | 6428 |
| 550 | Ga0307409_100014580 | 3300031995 | Bacteria | 5120 |
| 551 | Ga0307409_100095946 | 3300031995 | Bacteria | 2445 |
| 552 | Ga0307409_100602917 | 3300031995 | Bacteria | 1085 |
| 553 | Ga0307409_100766213 | 3300031995 | Bacteria | 970 |
| 554 | Ga0307409_101563880 | 3300031995 | Bacteria | 687 |
| 555 | Ga0307409_102336611 | 3300031995 | Bacteria | 564 |
| 556 | Ga0307416_100000153 | 3300032002 | Bacteria | 40170 |
| 557 | Ga0307416_100110990 | 3300032002 | Bacteria | 2416 |
| 558 | Ga0307416_100204144 | 3300032002 | Bacteria | 1878 |
| 559 | Ga0307416_100600756 | 3300032002 | Bacteria | 1180 |
| 560 | Ga0307416_101254732 | 3300032002 | Bacteria | 847 |
| 561 | Ga0307414_11587295 | 3300032004 | Bacteria | 610 |
| 562 | Ga0307411_11760899 | 3300032005 | Bacteria | 574 |
| 563 | Ga0307415_100000016 | 3300032126 | Bacteria | 78647 |
| 564 | Ga0307415_100014325 | 3300032126 | Bacteria | 4659 |
| 565 | Ga0307415_100015415 | 3300032126 | Bacteria | 4526 |
| 566 | Ga0307415_100104857 | 3300032126 | Bacteria | 2084 |
| 567 | Ga0307415_100221541 | 3300032126 | Bacteria | 1517 |
| 568 | Ga0307415_100322131 | 3300032126 | Bacteria | 1289 |
| 569 | Ga0307415_100495974 | 3300032126 | Bacteria | 1066 |
| 570 | Ga0307415_100567308 | 3300032126 | Bacteria | 1004 |
| 571 | Ga0307415_102381778 | 3300032126 | Bacteria | 520 |
| 572 | Ga0307415_102402908 | 3300032126 | Bacteria | 518 |
| 573 | Ga0316583_10050026 | 3300032133 | Bacteria | 1471 |
| 574 | Ga0316585_10007045 | 3300032137 | Bacteria | 3228 |
| 575 | Ga0316580_10002770 | 3300032139 | Bacteria | 4885 |
| 576 | Ga0307507_10078450 | 3300033179 | Bacteria | 2928 |
| 577 | Ga0307507_10155305 | 3300033179 | Bacteria | 1708 |
| 578 | Ga0316592_1081285 | 3300033524 | Bacteria | 737 |
| 579 | Ga0316214_1003005 | 3300033545 | Bacteria | 2103 |
| 580 | Ga0316214_1010118 | 3300033545 | Bacteria | 1277 |
| 581 | Ga0373930_0054146 | 3300034816 | Bacteria | 882 |
| 582 | Ga0373930_0070418 | 3300034816 | Bacteria | 794 |
| 583 | Ga0373958_0024134 | 3300034819 | Bacteria | 1148 |
| 584 | Ga0373938_0051347 | 3300034957 | Bacteria | 943 |
| 585 | Ga0373938_0093903 | 3300034957 | Bacteria | 746 |
| 586 | Ga0373938_0163848 | 3300034957 | Bacteria | 598 |
| 587 | Ga0373928_0026565 | 3300035084 | Bacteria | 1255 |
| 588 | Ga0373928_0059459 | 3300035084 | Bacteria | 921 |
| 589 | Ga0373934_0002313 | 3300035086 | Bacteria | 7011 |
| 590 | Ga0373934_0012780 | 3300035086 | Bacteria | 3172 |
| 591 | Ga0373940_0069912 | 3300035088 | Bacteria | 1020 |
| 592 | Ga0373949_0018066 | 3300035090 | Bacteria | 1595 |
| 593 | Ga0373951_0000058 | 3300035091 | Bacteria | 45018 |
| 594 | Ga0373951_0076130 | 3300035091 | Bacteria | 862 |
| 595 | Ga0373952_0006985 | 3300035092 | Bacteria | 2103 |
| 596 | Ga0373952_0128694 | 3300035092 | Bacteria | 693 |
| 597 | Ga0373923_0076659 | 3300035111 | Bacteria | 1444 |
| 598 | Ga0373932_0042822 | 3300035112 | Bacteria | 1314 |
| 599 | Ga0373932_0081842 | 3300035112 | Bacteria | 1021 |
| 600 | Ga0373936_0076071 | 3300035113 | Bacteria | 1391 |
| 601 | Ga0373941_0006048 | 3300035115 | Bacteria | 2892 |
| 602 | Ga0373941_0298258 | 3300035115 | Bacteria | 642 |
| 603 | Ga0373953_0002141 | 3300035117 | Bacteria | 5910 |
| 604 | Ga0373953_0002719 | 3300035117 | Bacteria | 5367 |
| 605 | Ga0373953_0009856 | 3300035117 | Bacteria | 3307 |
| 606 | Ga0373954_0013578 | 3300035118 | Bacteria | 3631 |
| 607 | Ga0373954_0045720 | 3300035118 | Bacteria | 2046 |
| 608 | Ga0373954_0069882 | 3300035118 | Bacteria | 1667 |
| 609 | Ga0373956_0002214 | 3300035119 | Bacteria | 8016 |
| 610 | Ga0373956_0015881 | 3300035119 | Bacteria | 3158 |
| 611 | Ga0373956_0028371 | 3300035119 | Bacteria | 2435 |
| 612 | Ga0373956_0102192 | 3300035119 | Bacteria | 1330 |
| 613 | Ga0373957_0010168 | 3300035120 | Bacteria | 3102 |
| 614 | Ga0373957_0021416 | 3300035120 | Bacteria | 2294 |
| 615 | Ga0373957_0072794 | 3300035120 | Bacteria | 1346 |
| 616 | Ga0373960_0224231 | 3300035121 | Bacteria | 673 |
| 617 | Ga0373943_0394578 | 3300035170 | Bacteria | 798 |
| 618 | Ga0373943_0600104 | 3300035170 | Bacteria | 648 |
| 619 | Ga0373946_0283612 | 3300035171 | Bacteria | 815 |
| 620 | Ga0373955_0001688 | 3300035172 | Bacteria | 9439 |
| 621 | Ga0373955_0016336 | 3300035172 | Bacteria | 3650 |
| 622 | Ga0373955_0265192 | 3300035172 | Bacteria | 1031 |
| 623 | Ga0373942_0001457 | 3300035207 | Bacteria | 6074 |
| 624 | Ga0373942_0056274 | 3300035207 | Bacteria | 1116 |
| 625 | Ga0373961_0057536 | 3300035241 | Bacteria | 1170 |
| 626 | Ga0373962_0015104 | 3300035242 | Bacteria | 1975 |
| 627 | Ga0316574_0042391 | 3300035398 | Bacteria | 2807 |
| 628 | Ga0316574_0137141 | 3300035398 | Bacteria | 1575 |
| 629 | Ga0373924_0000850 | 3300035410 | Bacteria | 9595 |
| 630 | Ga0373924_0013089 | 3300035410 | Bacteria | 3113 |
| 631 | Ga0373924_0064082 | 3300035410 | Bacteria | 1542 |
| 632 | Ga0373931_0062088 | 3300035691 | Bacteria | 2016 |
| 633 | Ga0373931_0113884 | 3300035691 | Bacteria | 1538 |
| 634 | Ga0373931_0906833 | 3300035691 | Bacteria | 592 |
| 635 | Ga0373935_0601357 | 3300035692 | Bacteria | 804 |
| 636 | Ga0373927_0044884 | 3300035695 | Bacteria | 2859 |
| 637 | Ga0373933_0003558 | 3300035724 | Bacteria | 8659 |
| 638 | Ga0373933_0004461 | 3300035724 | Bacteria | 7674 |
| 639 | Ga0373933_0154314 | 3300035724 | Bacteria | 1455 |
| 640 | Ga0373933_0165272 | 3300035724 | Bacteria | 1406 |
| 641 | Ga0373933_0538786 | 3300035724 | Bacteria | 766 |
| 642 | Ga0373947_0013352 | 3300035725 | Bacteria | 4706 |
| 643 | Ga0373947_0361151 | 3300035725 | Bacteria | 975 |
| 644 | Ga0373947_0901942 | 3300035725 | Bacteria | 603 |
| 645 | Ga0373947_1038671 | 3300035725 | Bacteria | 559 |
| 646 | Ga0373937_0002840 | 3300036401 | Bacteria | 14476 |
| 647 | Ga0373937_0006712 | 3300036401 | Bacteria | 9927 |
| 648 | Ga0373937_0008793 | 3300036401 | Bacteria | 8760 |
| 649 | Ga0373937_1193256 | 3300036401 | Bacteria | 709 |
| 650 | Ga0265778_047462 | 3300036457 | Bacteria | 582 |
| 651 | Ga0265778_060909 | 3300036457 | Bacteria | 528 |
| 652 | Ga0310112_048477 | 3300036458 | Bacteria | 576 |
| 653 | Ga0372808_002007 | 3300036459 | Bacteria | 2260 |
| 654 | Ga0372808_023732 | 3300036459 | Bacteria | 880 |
| 655 | Ga0310109_047700 | 3300036534 | Bacteria | 553 |
| 656 | Ga0310110_046997 | 3300036535 | Bacteria | 524 |
| 657 | Ga0316582_0002094 | 3300036647 | Bacteria | 9203 |
| 658 | Ga0316582_0086167 | 3300036647 | Bacteria | 2059 |
| 659 | Ga0316584_0103230 | 3300036712 | Bacteria | 2134 |
| 660 | Ga0373925_0000259 | 3300037068 | Bacteria | 55034 |
| 661 | Ga0395899_0013079 | 3300037312 | Bacteria | 6347 |
| 662 | Ga0395900_0004313 | 3300037418 | Bacteria | 15078 |
| 663 | Ga0395898_0013021 | 3300037466 | Bacteria | 8572 |
| 664 | Ga0436364_0148488 | 3300037853 | Bacteria | 795 |
| 665 | Ga0436364_0393888 | 3300037853 | Bacteria | 62164 |
| 666 | Ga0436364_1328267 | 3300037853 | Bacteria | 1058 |
| 667 | Ga0395901_0004087 | 3300038443 | Bacteria | 14704 |
| 668 | Ga0242420_142503 | 3300038996 | Bacteria | 534 |
| 669 | Ga0436365_0484881 | 3300039437 | Bacteria | 603 |
| 670 | Ga0436365_1781586 | 3300039437 | Bacteria | 55120 |
| 671 | Ga0436361_0131965 | 3300039447 | Bacteria | 944 |
| 672 | Ga0436361_0144445 | 3300039447 | Bacteria | 726 |
| 673 | Ga0436361_0462313 | 3300039447 | Bacteria | 670 |
| 674 | Ga0436363_0274219 | 3300039450 | Bacteria | 2324 |
| 675 | Ga0436363_1262988 | 3300039450 | Bacteria | 726 |
| 676 | Ga0436362_0771186 | 3300039453 | Bacteria | 680 |
| 677 | Ga0436362_0827173 | 3300039453 | Bacteria | 645 |
| 678 | Ga0436362_1265637 | 3300039453 | Bacteria | 1549 |
| 679 | Ga0451793_0349235 | 3300041452 | Bacteria | 806 |
| 680 | Ga0451845_0407979 | 3300041501 | Bacteria | 1119 |
| 681 | Ga0439448_0008690 | 3300042005 | Bacteria | 2975 |
| 682 | Ga0439449_0027379 | 3300042007 | Bacteria | 2127 |
| 683 | Ga0439451_091413 | 3300042009 | Bacteria | 613 |
| 684 | Ga0439459_0058102 | 3300042438 | Bacteria | 867 |
| 685 | Ga0439459_0243171 | 3300042438 | Bacteria | 506 |
| 686 | Ga0466969_0003943 | 3300044656 | Bacteria | 7878 |
| 687 | Ga0466966_0017589 | 3300044684 | Bacteria | 4723 |
| 688 | Ga0466966_0294957 | 3300044684 | Bacteria | 975 |
| 689 | Ga0466961_0016526 | 3300044693 | Bacteria | 4741 |
| 690 | Ga0466963_0212599 | 3300044694 | Bacteria | 1354 |
| 691 | Ga0466963_0365436 | 3300044694 | Bacteria | 1016 |
| 692 | Ga0466971_0001960 | 3300044719 | Bacteria | 8714 |
| 693 | Ga0466968_0725123 | 3300044735 | Bacteria | 509 |
| 694 | Ga0466970_0077403 | 3300044765 | Bacteria | 1793 |
| 695 | Ga0466957_0021253 | 3300044842 | Bacteria | 3823 |
| 696 | Ga0466957_0363918 | 3300044842 | Bacteria | 983 |
| 697 | Ga0466959_0002842 | 3300045049 | Bacteria | 11156 |
| 698 | Ga0466958_0010153 | 3300045836 | Bacteria | 5264 |
| 699 | Ga0466958_0150010 | 3300045836 | Bacteria | 1470 |
| 700 | Ga0466967_0313547 | 3300045976 | Bacteria | 1511 |
| 701 | Ga0495592_0003303 | 3300046454 | Bacteria | 11554 |
| 702 | Ga0495592_0091089 | 3300046454 | Bacteria | 2187 |
| 703 | Ga0495592_0118246 | 3300046454 | Bacteria | 1867 |
| 704 | Ga0495603_0065707 | 3300046455 | Bacteria | 2138 |
| 705 | Ga0495629_0027761 | 3300046459 | Bacteria | 4020 |
| 706 | Ga0495629_0343624 | 3300046459 | Bacteria | 1018 |
| 707 | Ga0495629_0402265 | 3300046459 | Bacteria | 930 |
| 708 | Ga0495651_0005196 | 3300046462 | Bacteria | 9927 |
| 709 | Ga0495651_0006896 | 3300046462 | Bacteria | 8681 |
| 710 | Ga0495651_0030795 | 3300046462 | Bacteria | 4183 |
| 711 | Ga0495651_0098721 | 3300046462 | Bacteria | 2178 |
| 712 | Ga0495651_0799824 | 3300046462 | Bacteria | 582 |
| 713 | Ga0495653_0058922 | 3300046463 | Bacteria | 2917 |
| 714 | Ga0495653_0088258 | 3300046463 | Bacteria | 2275 |
| 715 | Ga0495653_0145208 | 3300046463 | Bacteria | 1663 |
| 716 | Ga0495653_0831247 | 3300046463 | Bacteria | 553 |
| 717 | Ga0495582_0093889 | 3300046473 | Bacteria | 1674 |
| 718 | Ga0495582_0177180 | 3300046473 | Bacteria | 1214 |
| 719 | Ga0495662_0039942 | 3300046476 | Bacteria | 2266 |
| 720 | Ga0495664_0011128 | 3300046477 | Bacteria | 5063 |
| 721 | Ga0495664_0636507 | 3300046477 | Bacteria | 632 |
| 722 | Ga0495594_0003940 | 3300046499 | Bacteria | 7640 |
| 723 | Ga0495594_0153812 | 3300046499 | Bacteria | 1306 |
| 724 | Ga0495608_0006283 | 3300046511 | Bacteria | 8426 |
| 725 | Ga0495608_0014958 | 3300046511 | Bacteria | 5385 |
| 726 | Ga0495608_0052276 | 3300046511 | Bacteria | 2705 |
| 727 | Ga0495608_0062362 | 3300046511 | Bacteria | 2449 |
| 728 | Ga0495608_0906656 | 3300046511 | Bacteria | 516 |
| 729 | Ga0495618_0063654 | 3300046514 | Bacteria | 2342 |
| 730 | Ga0495618_0197589 | 3300046514 | Bacteria | 1273 |
| 731 | Ga0495618_0223383 | 3300046514 | Bacteria | 1187 |
| 732 | Ga0495628_0007458 | 3300046516 | Bacteria | 9464 |
| 733 | Ga0495628_0091144 | 3300046516 | Bacteria | 2359 |
| 734 | Ga0495628_0360637 | 3300046516 | Bacteria | 1067 |
| 735 | Ga0495630_0025766 | 3300046517 | Bacteria | 4349 |
| 736 | Ga0495630_1170410 | 3300046517 | Bacteria | 582 |
| 737 | Ga0495666_0287224 | 3300046526 | Bacteria | 745 |
| 738 | Ga0495652_0007781 | 3300046529 | Bacteria | 9844 |
| 739 | Ga0495652_0012322 | 3300046529 | Bacteria | 7719 |
| 740 | Ga0495652_0040882 | 3300046529 | Bacteria | 4006 |
| 741 | Ga0495652_0077597 | 3300046529 | Bacteria | 2752 |
| 742 | Ga0495652_0292570 | 3300046529 | Bacteria | 1187 |
| 743 | Ga0495665_0045394 | 3300046531 | Bacteria | 2334 |
| 744 | Ga0495640_0033402 | 3300046533 | Bacteria | 3654 |
| 745 | Ga0495640_0935220 | 3300046533 | Bacteria | 512 |
| 746 | Ga0495586_0069962 | 3300046535 | Bacteria | 1916 |
| 747 | Ga0495587_0002870 | 3300046536 | Bacteria | 11535 |
| 748 | Ga0495587_0031351 | 3300046536 | Bacteria | 3219 |
| 749 | Ga0495587_0162104 | 3300046536 | Bacteria | 1272 |
| 750 | Ga0495645_0045259 | 3300046543 | Bacteria | 3210 |
| 751 | Ga0495667_0002881 | 3300046559 | Bacteria | 11526 |
| 752 | Ga0495667_0012959 | 3300046559 | Bacteria | 5653 |
| 753 | Ga0495667_0043121 | 3300046559 | Bacteria | 2990 |
| 754 | Ga0495667_0364126 | 3300046559 | Bacteria | 913 |
| 755 | Ga0495634_0018519 | 3300046642 | Bacteria | 4957 |
| 756 | Ga0495634_0063405 | 3300046642 | Bacteria | 2453 |
| 757 | Ga0495634_0372157 | 3300046642 | Bacteria | 852 |
| 758 | Ga0495625_0000630 | 3300046660 | Bacteria | 50920 |
| 759 | Ga0495635_0023369 | 3300046663 | Bacteria | 4308 |
| 760 | Ga0495635_0039963 | 3300046663 | Bacteria | 3243 |
| 761 | Ga0495635_0706178 | 3300046663 | Bacteria | 653 |
| 762 | Ga0495588_0012157 | 3300046674 | Bacteria | 4059 |
| 763 | Ga0495657_0005656 | 3300046675 | Bacteria | 9862 |
| 764 | Ga0495657_0043768 | 3300046675 | Bacteria | 3050 |
| 765 | Ga0495657_0546587 | 3300046675 | Bacteria | 673 |
| 766 | Ga0495599_0002291 | 3300046678 | Bacteria | 11128 |
| 767 | Ga0495599_0041129 | 3300046678 | Bacteria | 2903 |
| 768 | Ga0495599_0048487 | 3300046678 | Bacteria | 2662 |
| 769 | Ga0495623_0002822 | 3300046679 | Bacteria | 11458 |
| 770 | Ga0495623_0128831 | 3300046679 | Bacteria | 1517 |
| 771 | Ga0495623_0242468 | 3300046679 | Bacteria | 1017 |
| 772 | Ga0495646_0051431 | 3300046680 | Bacteria | 2493 |
| 773 | Ga0495646_0107747 | 3300046680 | Bacteria | 1589 |
| 774 | Ga0495646_0207492 | 3300046680 | Bacteria | 1064 |
| 775 | Ga0495658_0024540 | 3300046683 | Bacteria | 3212 |
| 776 | Ga0495613_0022530 | 3300046689 | Bacteria | 4691 |
| 777 | Ga0495600_0039423 | 3300046809 | Bacteria | 3076 |
| 778 | Ga0495600_0046447 | 3300046809 | Bacteria | 2833 |
| 779 | Ga0495600_0326484 | 3300046809 | Bacteria | 964 |
| 780 | Ga0495581_0004394 | 3300047315 | Bacteria | 8146 |
| 781 | Ga0495604_0005098 | 3300047317 | Bacteria | 10401 |
| 782 | Ga0495604_0027755 | 3300047317 | Bacteria | 4502 |
| 783 | Ga0495604_0044166 | 3300047317 | Bacteria | 3484 |
| 784 | Ga0495604_0079543 | 3300047317 | Bacteria | 2458 |
| 785 | Ga0495674_0053599 | 3300047319 | Bacteria | 3544 |
| 786 | Ga0495674_0497345 | 3300047319 | Bacteria | 975 |
| 787 | Ga0495674_0765014 | 3300047319 | Bacteria | 754 |
| 788 | Ga0495676_0007337 | 3300047321 | Bacteria | 10118 |
| 789 | Ga0495676_0454571 | 3300047321 | Bacteria | 844 |
| 790 | Ga0495680_0002413 | 3300047322 | Bacteria | 19130 |
| 791 | Ga0495680_0008567 | 3300047322 | Bacteria | 9284 |
| 792 | Ga0495680_0036223 | 3300047322 | Bacteria | 3963 |
| 793 | Ga0495680_0089116 | 3300047322 | Bacteria | 2316 |
| 794 | Ga0495680_0203693 | 3300047322 | Bacteria | 1418 |
| 795 | Ga0495683_0032795 | 3300047323 | Bacteria | 2645 |
| 796 | Ga0495675_0002519 | 3300047444 | Bacteria | 10971 |
| 797 | Ga0495675_0083658 | 3300047444 | Bacteria | 2008 |
| 798 | Ga0495593_0352130 | 3300047673 | Bacteria | 736 |
| 799 | Ga0495602_0009822 | 3300048088 | Bacteria | 9930 |
| 800 | Ga0495602_0173440 | 3300048088 | Bacteria | 1671 |
| 801 | Ga0495602_0225974 | 3300048088 | Bacteria | 1409 |
| 802 | Ga0495614_0003635 | 3300048089 | Bacteria | 6914 |
| 803 | Ga0495614_0628910 | 3300048089 | Bacteria | 517 |
| 804 | Ga0495626_0000147 | 3300048091 | Bacteria | 87994 |
| 805 | Ga0496100_0064659 | 3300048903 | Bacteria | 2421 |
| 806 | Ga0496100_0461722 | 3300048903 | Bacteria | 975 |
| 807 | Ga0496100_0730076 | 3300048903 | Bacteria | 774 |
| 808 | Ga0496100_1272202 | 3300048903 | Bacteria | 580 |
| 809 | Ga0496101_0036103 | 3300048904 | Bacteria | 3499 |
| 810 | Ga0496101_0881813 | 3300048904 | Bacteria | 705 |
| 811 | Ga0496101_1576236 | 3300048904 | Bacteria | 510 |
| 812 | Ga0496102_0376758 | 3300048905 | Bacteria | 1336 |
| 813 | Ga0496103_0027693 | 3300048906 | Bacteria | 3436 |
| 814 | Ga0496103_0029992 | 3300048906 | Bacteria | 3307 |
| 815 | Ga0496104_0034337 | 3300048907 | Bacteria | 4729 |
| 816 | Ga0496104_0066155 | 3300048907 | Bacteria | 3431 |
| 817 | Ga0496104_0113655 | 3300048907 | Bacteria | 2596 |
| 818 | Ga0496104_0317356 | 3300048907 | Bacteria | 1471 |
| 819 | Ga0496104_0545737 | 3300048907 | Bacteria | 1070 |
| 820 | Ga0496104_0750366 | 3300048907 | Bacteria | 883 |
| 821 | Ga0496104_1691081 | 3300048907 | Bacteria | 535 |
| 822 | Ga0496105_0046887 | 3300048908 | Bacteria | 3567 |
| 823 | Ga0496105_0051063 | 3300048908 | Bacteria | 3417 |
| 824 | Ga0496105_0073559 | 3300048908 | Bacteria | 2823 |
| 825 | Ga0496105_0083585 | 3300048908 | Bacteria | 2636 |
| 826 | Ga0496105_0524294 | 3300048908 | Bacteria | 928 |
| 827 | Ga0496106_0071907 | 3300048909 | Bacteria | 2644 |
| 828 | Ga0496106_0570817 | 3300048909 | Bacteria | 907 |
| 829 | Ga0496106_1113245 | 3300048909 | Bacteria | 618 |
| 830 | Ga0496107_0354164 | 3300048910 | Bacteria | 1092 |
| 831 | Ga0496107_0648600 | 3300048910 | Bacteria | 778 |
| 832 | Ga0496108_0000010 | 3300048911 | Bacteria | 273269 |
| 833 | Ga0496108_0033047 | 3300048911 | Bacteria | 4298 |
| 834 | Ga0496108_0524379 | 3300048911 | Bacteria | 1034 |
| 835 | Ga0496108_0595441 | 3300048911 | Bacteria | 963 |
| 836 | Ga0496108_0773989 | 3300048911 | Bacteria | 829 |
| 837 | Ga0496108_1194741 | 3300048911 | Bacteria | 643 |
| 838 | Ga0496108_1320367 | 3300048911 | Bacteria | 606 |
| 839 | Ga0496108_1796062 | 3300048911 | Bacteria | 502 |
| 840 | Ga0496109_0005429 | 3300048912 | Bacteria | 10661 |
| 841 | Ga0496109_0029223 | 3300048912 | Bacteria | 4936 |
| 842 | Ga0496109_0317123 | 3300048912 | Bacteria | 1471 |
| 843 | Ga0496109_0762454 | 3300048912 | Bacteria | 905 |
| 844 | Ga0496109_2072080 | 3300048912 | Bacteria | 501 |
| 845 | Ga0496110_0003656 | 3300048913 | Bacteria | 11830 |
| 846 | Ga0496110_0023767 | 3300048913 | Bacteria | 5216 |
| 847 | Ga0496110_0058180 | 3300048913 | Bacteria | 3404 |
| 848 | Ga0496110_0068560 | 3300048913 | Bacteria | 3139 |
| 849 | Ga0496110_0769609 | 3300048913 | Bacteria | 866 |
| 850 | Ga0496111_0019322 | 3300048914 | Bacteria | 4730 |
| 851 | Ga0496111_0025321 | 3300048914 | Bacteria | 4187 |
| 852 | Ga0496112_0005145 | 3300048915 | Bacteria | 11246 |
| 853 | Ga0496112_0058741 | 3300048915 | Bacteria | 3788 |
| 854 | Ga0496112_0063031 | 3300048915 | Bacteria | 3657 |
| 855 | Ga0496112_0129711 | 3300048915 | Bacteria | 2492 |
| 856 | Ga0496112_0138317 | 3300048915 | Bacteria | 2405 |
| 857 | Ga0496112_0194323 | 3300048915 | Bacteria | 1990 |
| 858 | Ga0496112_0276584 | 3300048915 | Bacteria | 1626 |
| 859 | Ga0496112_0953032 | 3300048915 | Bacteria | 779 |
| 860 | Ga0496112_1762841 | 3300048915 | Bacteria | 531 |
| 861 | Ga0496113_0066592 | 3300048916 | Bacteria | 2728 |
| 862 | Ga0496113_0122024 | 3300048916 | Bacteria | 2038 |
| 863 | Ga0496113_0341336 | 3300048916 | Bacteria | 1201 |
| 864 | Ga0496113_0386311 | 3300048916 | Bacteria | 1124 |
| 865 | Ga0496114_0511171 | 3300048917 | Bacteria | 1062 |
| 866 | Ga0496114_0613768 | 3300048917 | Bacteria | 958 |
| 867 | Ga0496115_0087104 | 3300048918 | Bacteria | 2548 |
| 868 | Ga0496115_0195462 | 3300048918 | Bacteria | 1671 |
| 869 | Ga0496115_0689837 | 3300048918 | Bacteria | 804 |
| 870 | Ga0496126_0147087 | 3300048929 | Bacteria | 2022 |
| 871 | Ga0496126_0206748 | 3300048929 | Bacteria | 1654 |
| 872 | Ga0496126_0594395 | 3300048929 | Bacteria | 873 |
| 873 | Ga0501031_0498669 | 3300049568 | Bacteria | 785 |
| 874 | Ga0501032_0067015 | 3300049569 | Bacteria | 2399 |
| 875 | Ga0501032_0151997 | 3300049569 | Bacteria | 1522 |
| 876 | Ga0501034_0005678 | 3300049571 | Bacteria | 13574 |
| 877 | Ga0501036_0001066 | 3300049572 | Bacteria | 20756 |
| 878 | Ga0501037_0155252 | 3300049573 | Bacteria | 1634 |
| 879 | Ga0501037_0832568 | 3300049573 | Bacteria | 608 |
| 880 | Ga0501038_0082635 | 3300049574 | Bacteria | 2705 |
| 881 | Ga0501042_0039046 | 3300049578 | Bacteria | 3373 |
| 882 | Ga0501043_0018519 | 3300049579 | Bacteria | 5463 |
| 883 | Ga0501047_0014517 | 3300049581 | Bacteria | 7491 |
| 884 | Ga0501047_0081462 | 3300049581 | Bacteria | 3111 |
| 885 | Ga0501048_0013899 | 3300049582 | Bacteria | 5969 |
| 886 | Ga0501070_0164318 | 3300049586 | Bacteria | 1829 |
| 887 | Ga0501073_0870898 | 3300049589 | Bacteria | 620 |
| 888 | Ga0501074_0027099 | 3300049590 | Bacteria | 4153 |
| 889 | Ga0501074_0618995 | 3300049590 | Bacteria | 765 |
| 890 | Ga0501225_0150698 | 3300049705 | Bacteria | 709 |
| 891 | Ga0501080_0014313 | 3300049742 | Bacteria | 7305 |
| 892 | Ga0501080_0327615 | 3300049742 | Bacteria | 1386 |
| 893 | Ga0501044_0012884 | 3300049823 | Bacteria | 9051 |
| 894 | nmdc:mga00v17_444185_c1 | 3300050491 | Bacteria | 842 |
| 895 | nmdc:mga07m45_580018_c1 | 3300050496 | Bacteria | 648 |
| 896 | nmdc:mga05p37_1073173_c1 | 3300050507 | Bacteria | 847 |
| 897 | nmdc:mga05p37_1094655_c1 | 3300050507 | Bacteria | 835 |
| 898 | nmdc:mga05p37_171513_c1 | 3300050507 | Bacteria | 2645 |
| 899 | nmdc:mga05p37_2179272_c1 | 3300050507 | Bacteria | 516 |
| 900 | nmdc:mga05p37_347156_c1 | 3300050507 | Bacteria | 1748 |
| 901 | nmdc:mga05p37_377811_c1 | 3300050507 | Bacteria | 1661 |
| 902 | nmdc:mga05p37_59237_c1 | 3300050507 | Bacteria | 4716 |
| 903 | nmdc:mga05p37_72233_c1 | 3300050507 | Bacteria | 4246 |
| 904 | nmdc:mga05p37_991603_c1 | 3300050507 | Bacteria | 894 |
| 905 | nmdc:mga09592_321560_c1 | 3300050508 | Bacteria | 1340 |
| 906 | nmdc:mga0qj67_190974_c1 | 3300050509 | Bacteria | 1664 |
| 907 | nmdc:mga06r32_1047328_c1 | 3300050510 | Bacteria | 767 |
| 908 | nmdc:mga06r32_1960483_c1 | 3300050510 | Bacteria | 520 |
| 909 | nmdc:mga06r32_315107_c1 | 3300050510 | Bacteria | 1550 |
| 910 | nmdc:mga06r32_40138_c1 | 3300050510 | Bacteria | 4442 |
| 911 | nmdc:mga08y16_316874_c1 | 3300050511 | Bacteria | 1606 |
| 912 | nmdc:mga0n895_11777_c1 | 3300050512 | Bacteria | 7820 |
| 913 | nmdc:mga0n895_1339698_c1 | 3300050512 | Bacteria | 686 |
| 914 | nmdc:mga0rr50_36491_c1 | 3300050513 | Bacteria | 3541 |
| 915 | nmdc:mga0rr50_783886_c1 | 3300050513 | Bacteria | 813 |
| 916 | nmdc:mga0rr50_9239_c1 | 3300050513 | Bacteria | 6187 |
| 917 | nmdc:mga08x19_15715_c1 | 3300050514 | Bacteria | 4605 |
| 918 | nmdc:mga0a205_698137_c1 | 3300050515 | Bacteria | 864 |
| 919 | nmdc:mga0a205_758538_c1 | 3300050515 | Bacteria | 819 |
| 920 | Ga0495612_0154639 | 3300053078 | Bacteria | 999 |
| 921 | Ga0495655_0251852 | 3300053083 | Bacteria | 594 |
| 922 | Ga0495595_0001405 | 3300053084 | Bacteria | 9355 |
| 923 | Ga0495595_0022666 | 3300053084 | Bacteria | 2758 |
| 924 | Ga0495619_0197350 | 3300053085 | Bacteria | 1393 |
| 925 | Ga0495619_0331317 | 3300053085 | Bacteria | 1054 |
| 926 | Ga0495619_0355921 | 3300053085 | Bacteria | 1012 |
| 927 | Ga0495619_0376893 | 3300053085 | Bacteria | 981 |
| 928 | Ga0495619_0432966 | 3300053085 | Bacteria | 907 |
| 929 | Ga0500646_0000593 | 3300053090 | Bacteria | 10416 |
| 930 | Ga0500583_0081794 | 3300053092 | Bacteria | 1561 |
| 931 | Ga0500641_0021612 | 3300053096 | Bacteria | 2456 |
| 932 | Ga0500641_0069807 | 3300053096 | Bacteria | 1477 |
| 933 | Ga0500654_125727 | 3300053099 | Bacteria | 990 |
| 934 | Ga0500660_198084 | 3300053100 | Bacteria | 696 |
| 935 | Ga0500577_0338815 | 3300053142 | Bacteria | 657 |
| 936 | Ga0500579_074305 | 3300053143 | Bacteria | 1942 |
| 937 | Ga0500588_0038157 | 3300053146 | Bacteria | 1431 |
| 938 | Ga0500600_0353849 | 3300053149 | Bacteria | 603 |
| 939 | Ga0587070_152852 | 3300059491 | Bacteria | 580 |
| 940 | Ga0587073_0133899 | 3300059492 | Bacteria | 683 |
| 941 | Ga0587082_134431 | 3300059504 | Bacteria | 571 |
| 942 | Ga0587083_0150883 | 3300059505 | Bacteria | 627 |
| 943 | Ga0587106_127345 | 3300059605 | Bacteria | 546 |
| 944 | Ga0587101_040138 | 3300059623 | Bacteria | 769 |
| 945 | Ga0587101_074857 | 3300059623 | Bacteria | 631 |
| 946 | Ga0587101_107839 | 3300059623 | Bacteria | 562 |
| 947 | Ga0587122_032884 | 3300059628 | Bacteria | 617 |
| 948 | Ga0587067_094086 | 3300059640 | Bacteria | 684 |
| 949 | Ga0587069_112240 | 3300059642 | Bacteria | 569 |
| 950 | Ga0587072_146546 | 3300059643 | Bacteria | 567 |
| 951 | Ga0587076_087696 | 3300059645 | Bacteria | 675 |
| 952 | Ga0587071_087682 | 3300060344 | Bacteria | 702 |
| 953 | Ga0587111_0243129 | 3300060346 | Bacteria | 529 |
| 954 | Ga0466962_0010972 | 3300061719 | Bacteria | 4360 |
| 955 | Ga0530510_0661708 | 3300061734 | Bacteria | 795 |
| 956 | Ga0530510_0838798 | 3300061734 | Bacteria | 702 |
| 957 | 2753267460 | 2751185782 | Bacteria | 11227053 |
| 958 | 2855672004 | 2855670206 | Bacteria | 7120389 |
| 959 | 2855678123 | 2855676851 | Bacteria | 7063653 |
| 960 | 2856747639 | 2856741275 | Bacteria | 8096094 |
| 961 | 2857291636 | 2857288857 | Bacteria | 7189066 |
| 962 | 2858849697 | 2858848962 | Bacteria | 6963058 |
| 963 | 2858886145 | 2858882152 | Bacteria | 7230291 |
| 964 | 2858889453 | 2858888857 | Bacteria | 7060307 |
| 965 | 2858898095 | 2858895516 | Bacteria | 7378898 |
| 966 | 2867302785 | 2867302475 | Bacteria | 7087181 |
| 967 | 2867314861 | 2867312974 | Bacteria | 7058875 |
| 968 | 2867316732 | 2867312974 | Bacteria | 7058875 |
| 969 | 2867321925 | 2867319477 | Bacteria | 7069771 |
| 970 | 2867322126 | 2867319477 | Bacteria | 7069771 |
| 971 | 2867512239 | 2867507094 | Bacteria | 6506033 |
| 972 | 2869052230 | 2869048445 | Bacteria | 6875584 |
| 973 | 2869065371 | 2869061728 | Bacteria | 7112407 |
| 974 | 2869069887 | 2869068681 | Bacteria | 7205615 |
| 975 | 2880492527 | 2880489317 | Bacteria | 7096270 |
| 976 | 2887484848 | 2887478801 | Bacteria | 8972725 |
| 977 | 2891566069 | 2891562705 | Bacteria | 8039471 |
| 978 | 2929228337 | 2929226422 | Bacteria | 7248583 |
| 979 | 8001782218 | 8001781756 | Bacteria | 9586736 |
| 980 | 8003831358 | 8003830390 | Bacteria | 6541657 |
| 981 | 8003863243 | 8003856774 | Bacteria | 7675274 |
| 982 | 8054710460 | 8054704163 | Bacteria | 7247792 |
| 983 | 8054728379 | 8054727385 | Bacteria | 7558670 |
| 984 | 8054738601 | 8054734606 | Bacteria | 6947278 |
| 985 | Ga0495629_0242858 | |||
| 986 | JGI24740J21852_10095534 | |||
| 987 | JGI24739J22299_10246418 | |||
| 988 | JGI24034J26672_10100481 | |||
| 989 | JGI25406J46586_10118020 | |||
| 990 | JGI25404J52841_10055524 | |||
| 991 | JGI25404J52841_10091508 | |||
| 992 | Ga0058859_11820616 | |||
| 993 | Ga0058863_10036897 | |||
| 994 | Ga0058861_11876488 | |||
| 995 | Ga0058861_12020820 | |||
| 996 | Ga0058860_12150652 | |||
| 997 | Ga0058862_10018238 | |||
| 998 | Ga0058862_10095433 | |||
| 999 | Ga0070658_10002809 | |||
| 1000 | Ga0070658_10090810 | |||
| 1001 | Ga0070658_10815776 | |||
| 1002 | Ga0070683_100564453 | |||
| 1003 | Ga0070683_100896386 | |||
| 1004 | Ga0070683_101057001 | |||
| 1005 | Ga0070670_100426773 | |||
| 1006 | Ga0070670_100909930 | |||
| 1007 | Ga0070666_10007271 | |||
| 1008 | Ga0070680_100528082 | |||
| 1009 | Ga0070680_100601343 | |||
| 1010 | Ga0070682_100226671 | |||
| 1011 | Ga0070682_100552065 | |||
| 1012 | Ga0070682_100858159 | |||
| 1013 | Ga0070682_101194187 | |||
| 1014 | Ga0070660_100180596 | |||
| 1015 | Ga0070660_100218869 | |||
| 1016 | Ga0070689_100130370 | |||
| 1017 | Ga0070691_10549264 | |||
| 1018 | Ga0070661_100044193 | |||
| 1019 | Ga0070661_100078363 | |||
| 1020 | Ga0070661_100636516 | |||
| 1021 | Ga0070661_101108623 | |||
| 1022 | Ga0070692_10051650 | |||
| 1023 | Ga0070668_100008173 | |||
| 1024 | Ga0070668_100033438 | |||
| 1025 | Ga0070668_100241440 | |||
| 1026 | Ga0070675_100655065 | |||
| 1027 | Ga0070671_100252094 | |||
| 1028 | Ga0070671_100558062 | |||
| 1029 | Ga0070671_100568077 | |||
| 1030 | Ga0070688_100180778 | |||
| 1031 | Ga0070659_100037634 | |||
| 1032 | Ga0070667_100087343 | |||
| 1033 | Ga0070667_100185405 | |||
| 1034 | Ga0070667_100369800 | |||
| 1035 | Ga0070709_10034833 | |||
| 1036 | Ga0070709_10147201 | |||
| 1037 | Ga0070709_10248843 | |||
| 1038 | Ga0070709_10761140 | |||
| 1039 | Ga0070714_100000753 | |||
| 1040 | Ga0070714_100008171 | |||
| 1041 | Ga0070714_100017153 | |||
| 1042 | Ga0070714_100067024 | |||
| 1043 | Ga0070714_100558441 | |||
| 1044 | Ga0070714_100586640 | |||
| 1045 | Ga0070713_100044135 | |||
| 1046 | Ga0070713_100191400 | |||
| 1047 | Ga0070713_100652198 | |||
| 1048 | Ga0070713_100786403 | |||
| 1049 | Ga0070713_101184371 | |||
| 1050 | Ga0070713_101255665 | |||
| 1051 | Ga0070713_102065715 | |||
| 1052 | Ga0070710_10129766 | |||
| 1053 | Ga0070710_10613715 | |||
| 1054 | Ga0070710_10620803 | |||
| 1055 | Ga0070710_10707653 | |||
| 1056 | Ga0070711_100028645 | |||
| 1057 | Ga0070711_100133748 | |||
| 1058 | Ga0070711_100258732 | |||
| 1059 | Ga0070711_100612060 | |||
| 1060 | Ga0070711_100894559 | |||
| 1061 | Ga0070711_101708129 | |||
| 1062 | Ga0070705_100832150 | |||
| 1063 | Ga0070705_101223244 | |||
| 1064 | Ga0070700_100320578 | |||
| 1065 | Ga0070694_100407694 | |||
| 1066 | Ga0070663_100014425 | |||
| 1067 | Ga0070663_100024443 | |||
| 1068 | Ga0070663_101012715 | |||
| 1069 | Ga0070678_100334708 | |||
| 1070 | Ga0070678_100395146 | |||
| 1071 | Ga0070678_100605162 | |||
| 1072 | Ga0070662_100143834 | |||
| 1073 | Ga0070681_10162855 | |||
| 1074 | Ga0070681_10419746 | |||
| 1075 | Ga0070681_10451585 | |||
| 1076 | Ga0070681_10517477 | |||
| 1077 | Ga0070681_11297241 | |||
| 1078 | Ga0070706_100066339 | |||
| 1079 | Ga0070706_100121380 | |||
| 1080 | Ga0070707_100076694 | |||
| 1081 | Ga0070707_100085908 | |||
| 1082 | Ga0070707_100275834 | |||
| 1083 | Ga0070698_100005079 | |||
| 1084 | Ga0070698_100087099 | |||
| 1085 | Ga0070698_100740993 | |||
| 1086 | Ga0070698_101064854 | |||
| 1087 | Ga0070699_100976339 | |||
| 1088 | Ga0070699_101051772 | |||
| 1089 | Ga0070679_100047394 | |||
| 1090 | Ga0070679_100052945 | |||
| 1091 | Ga0070679_100172479 | |||
| 1092 | Ga0070679_100434645 | |||
| 1093 | Ga0070679_101301257 | |||
| 1094 | Ga0070684_100184680 | |||
| 1095 | Ga0070684_100246432 | |||
| 1096 | Ga0070684_100323587 | |||
| 1097 | Ga0070684_100550520 | |||
| 1098 | Ga0070684_100662553 | |||
| 1099 | Ga0070697_101728792 | |||
| 1100 | Ga0070697_101873390 | |||
| 1101 | Ga0068853_100567015 | |||
| 1102 | Ga0070686_100018630 | |||
| 1103 | Ga0070696_100082410 | |||
| 1104 | Ga0070696_101847818 | |||
| 1105 | Ga0070665_100518403 | |||
| 1106 | Ga0070665_100813066 | |||
| 1107 | Ga0068855_100643143 | |||
| 1108 | Ga0070664_100044889 | |||
| 1109 | Ga0070664_100356882 | |||
| 1110 | Ga0068857_100050339 | |||
| 1111 | Ga0068857_100102046 | |||
| 1112 | Ga0068857_100889640 | |||
| 1113 | Ga0068857_100936935 | |||
| 1114 | Ga0068857_101757970 | |||
| 1115 | Ga0068854_100068940 | |||
| 1116 | Ga0068854_100937952 | |||
| 1117 | Ga0068856_100313462 | |||
| 1118 | Ga0068856_100673899 | |||
| 1119 | Ga0068856_100730096 | |||
| 1120 | Ga0068856_100953678 | |||
| 1121 | Ga0068852_101108801 | |||
| 1122 | Ga0068852_101406450 | |||
| 1123 | Ga0068852_101520825 | |||
| 1124 | Ga0068864_100014862 | |||
| 1125 | Ga0068864_100048803 | |||
| 1126 | Ga0068864_101489333 | |||
| 1127 | Ga0068866_10971195 | |||
| 1128 | Ga0068861_100579844 | |||
| 1129 | Ga0068861_100611453 | |||
| 1130 | Ga0068851_10245611 | |||
| 1131 | Ga0068851_10415622 | |||
| 1132 | Ga0068870_10323452 | |||
| 1133 | Ga0068863_100112067 | |||
| 1134 | Ga0068863_100180153 | |||
| 1135 | Ga0068863_100521399 | |||
| 1136 | Ga0068858_100068410 | |||
| 1137 | Ga0068858_100985802 | |||
| 1138 | Ga0068860_100264090 | |||
| 1139 | Ga0068860_100747225 | |||
| 1140 | Ga0068862_100058307 | |||
| 1141 | Ga0068862_100302063 | |||
| 1142 | Ga0081455_10127209 | |||
| 1143 | Ga0081455_10350544 | |||
| 1144 | Ga0081540_1000607 | |||
| 1145 | Ga0081540_1006932 | |||
| 1146 | Ga0081540_1007264 | |||
| 1147 | Ga0081540_1011440 | |||
| 1148 | Ga0081540_1090579 | |||
| 1149 | Ga0081540_1187352 | |||
| 1150 | Ga0081540_1248110 | |||
| 1151 | Ga0081539_10000367 | |||
| 1152 | Ga0081539_10004494 | |||
| 1153 | Ga0081539_10004919 | |||
| 1154 | Ga0081539_10011051 | |||
| 1155 | Ga0070717_10103636 | |||
| 1156 | Ga0070717_10160733 | |||
| 1157 | Ga0070717_10164931 | |||
| 1158 | Ga0070717_10796549 | |||
| 1159 | Ga0070717_11343370 | |||
| 1160 | Ga0075365_10040154 | |||
| 1161 | Ga0075364_10413538 | |||
| 1162 | Ga0075432_10230818 | |||
| 1163 | Ga0070715_10084966 | |||
| 1164 | Ga0070715_10105393 | |||
| 1165 | Ga0070715_10123664 | |||
| 1166 | Ga0070715_10201849 | |||
| 1167 | Ga0070716_100002471 | |||
| 1168 | Ga0070716_100043547 | |||
| 1169 | Ga0070716_100062145 | |||
| 1170 | Ga0070716_100252866 | |||
| 1171 | Ga0070716_100539372 | |||
| 1172 | Ga0070712_100083106 | |||
| 1173 | Ga0070712_100301821 | |||
| 1174 | Ga0070712_100357028 | |||
| 1175 | Ga0070712_101017488 | |||
| 1176 | Ga0070712_101284837 | |||
| 1177 | Ga0070712_101759587 | |||
| 1178 | Ga0075367_10180800 | |||
| 1179 | Ga0097621_100691399 | |||
| 1180 | Ga0068871_101285604 | |||
| 1181 | Ga0075428_100065541 | |||
| 1182 | Ga0075428_100284917 | |||
| 1183 | Ga0075428_100507992 | |||
| 1184 | Ga0075428_100567630 | |||
| 1185 | Ga0075431_100040901 | |||
| 1186 | Ga0075431_100216866 | |||
| 1187 | Ga0075431_100301099 | |||
| 1188 | Ga0075431_100409743 | |||
| 1189 | Ga0075431_100871578 | |||
| 1190 | Ga0075433_10005443 | |||
| 1191 | Ga0075433_10260593 | |||
| 1192 | Ga0075434_100051405 | |||
| 1193 | Ga0075434_100453657 | |||
| 1194 | Ga0075434_100582083 | |||
| 1195 | Ga0075434_100791751 | |||
| 1196 | Ga0075429_100371752 | |||
| 1197 | Ga0068865_100023726 | |||
| 1198 | Ga0075436_100025943 | |||
| 1199 | Ga0075436_100383482 | |||
| 1200 | Ga0075435_100707242 | |||
| 1201 | Ga0105251_10071437 | |||
| 1202 | Ga0105251_10155197 | |||
| 1203 | Ga0105244_10295526 | |||
| 1204 | Ga0105250_10037099 | |||
| 1205 | Ga0105240_10291918 | |||
| 1206 | Ga0105240_10765289 | |||
| 1207 | Ga0111539_10482804 | |||
| 1208 | Ga0105245_10168892 | |||
| 1209 | Ga0105245_10516459 | |||
| 1210 | Ga0105245_10765479 | |||
| 1211 | Ga0105247_10316782 | |||
| 1212 | Ga0105247_10549544 | |||
| 1213 | Ga0114129_10108046 | |||
| 1214 | Ga0114129_10193989 | |||
| 1215 | Ga0114129_10303555 | |||
| 1216 | Ga0114129_10376770 | |||
| 1217 | Ga0114129_13400088 | |||
| 1218 | Ga0105243_11243506 | |||
| 1219 | Ga0105243_11355323 | |||
| 1220 | Ga0105243_11780974 | |||
| 1221 | Ga0105241_10883017 | |||
| 1222 | Ga0105242_10428936 | |||
| 1223 | Ga0105242_11571396 | |||
| 1224 | Ga0105242_13034902 | |||
| 1225 | Ga0105248_10049688 | |||
| 1226 | Ga0105248_10526018 | |||
| 1227 | Ga0105248_11358877 | |||
| 1228 | Ga0105239_10099887 | |||
| 1229 | Ga0105239_10422685 | |||
| 1230 | Ga0105239_10527787 | |||
| 1231 | Ga0157340_1007745 | |||
| 1232 | Ga0157337_1027361 | |||
| 1233 | Ga0157323_1003421 | |||
| 1234 | Ga0157339_1057686 | |||
| 1235 | Ga0157371_10058304 | |||
| 1236 | Ga0157371_10172674 | |||
| 1237 | Ga0157369_10008899 | |||
| 1238 | Ga0157369_10021008 | |||
| 1239 | Ga0157369_10022064 | |||
| 1240 | Ga0157369_11456328 | |||
| 1241 | Ga0157374_10842653 | |||
| 1242 | Ga0163162_10047239 | |||
| 1243 | Ga0163162_10402358 | |||
| 1244 | Ga0163162_11032191 | |||
| 1245 | Ga0163162_11131053 | |||
| 1246 | Ga0157372_10172952 | |||
| 1247 | Ga0157372_10269641 | |||
| 1248 | Ga0157372_10855343 | |||
| 1249 | Ga0157372_11130575 | |||
| 1250 | Ga0157375_10013964 | |||
| 1251 | Ga0157375_10188673 | |||
| 1252 | Ga0157375_10338188 | |||
| 1253 | Ga0157375_10688432 | |||
| 1254 | Ga0163163_10053614 | |||
| 1255 | Ga0163163_10123189 | |||
| 1256 | Ga0163163_10525975 | |||
| 1257 | Ga0163163_10883459 | |||
| 1258 | Ga0157380_10076143 | |||
| 1259 | Ga0182008_10092340 | |||
| 1260 | Ga0157377_10022617 | |||
| 1261 | Ga0157379_10107226 | |||
| 1262 | Ga0157379_10614617 | |||
| 1263 | Ga0157376_11045231 | |||
| 1264 | Ga0182005_1151693 | |||
| 1265 | Ga0163161_10346937 | |||
| 1266 | Ga0184594_126852 | |||
| 1267 | Ga0197907_10194637 | |||
| 1268 | Ga0197907_10765725 | |||
| 1269 | Ga0197907_11163380 | |||
| 1270 | Ga0197907_11282396 | |||
| 1271 | Ga0206356_11216319 | |||
| 1272 | Ga0206356_11275235 | |||
| 1273 | Ga0206356_11308114 | |||
| 1274 | Ga0206349_1229811 | |||
| 1275 | Ga0206349_1400002 | |||
| 1276 | Ga0206349_1568890 | |||
| 1277 | Ga0206355_1481324 | |||
| 1278 | Ga0206355_1661015 | |||
| 1279 | Ga0206351_10471509 | |||
| 1280 | Ga0206351_10629504 | |||
| 1281 | Ga0206352_10306540 | |||
| 1282 | Ga0206352_10876827 | |||
| 1283 | Ga0206352_11293270 | |||
| 1284 | Ga0206350_10176573 | |||
| 1285 | Ga0206350_10229569 | |||
| 1286 | Ga0206350_10689443 | |||
| 1287 | Ga0206350_11074900 | |||
| 1288 | Ga0206350_11609588 | |||
| 1289 | Ga0206354_10064564 | |||
| 1290 | Ga0206354_10391073 | |||
| 1291 | Ga0206354_11549948 | |||
| 1292 | Ga0206353_10851551 | |||
| 1293 | Ga0206353_11229849 | |||
| 1294 | Ga0206353_11327800 | |||
| 1295 | Ga0154015_1265672 | |||
| 1296 | Ga0154015_1563874 | |||
| 1297 | Ga0213874_10048215 | |||
| 1298 | Ga0213876_10000552 | |||
| 1299 | Ga0213875_10001581 | |||
| 1300 | Ga0224712_10003059 | |||
| 1301 | Ga0224712_10011091 | |||
| 1302 | Ga0224712_10095488 | |||
| 1303 | Ga0224712_10204536 | |||
| 1304 | Ga0224712_10213198 | |||
| 1305 | Ga0224712_10313819 | |||
| 1306 | Ga0224712_10506093 | |||
| 1307 | Ga0224712_10649205 | |||
| 1308 | Ga0207656_10622745 | |||
| 1309 | Ga0207692_10005854 | |||
| 1310 | Ga0207692_10021609 | |||
| 1311 | Ga0207692_10131224 | |||
| 1312 | Ga0207710_10486349 | |||
| 1313 | Ga0207680_10299896 | |||
| 1314 | Ga0207647_10126140 | |||
| 1315 | Ga0207685_10244282 | |||
| 1316 | Ga0207685_10611323 | |||
| 1317 | Ga0207699_10002617 | |||
| 1318 | Ga0207699_10004556 | |||
| 1319 | Ga0207699_10014348 | |||
| 1320 | Ga0207699_10167591 | |||
| 1321 | Ga0207699_10173758 | |||
| 1322 | Ga0207699_10205630 | |||
| 1323 | Ga0207643_10396507 | |||
| 1324 | Ga0207705_10022712 | |||
| 1325 | Ga0207705_10661768 | |||
| 1326 | Ga0207684_10074214 | |||
| 1327 | Ga0207684_10592394 | |||
| 1328 | Ga0207654_10502077 | |||
| 1329 | Ga0207707_10197330 | |||
| 1330 | Ga0207671_10104410 | |||
| 1331 | Ga0207693_10064332 | |||
| 1332 | Ga0207693_10064916 | |||
| 1333 | Ga0207693_10910147 | |||
| 1334 | Ga0207693_10917682 | |||
| 1335 | Ga0207693_10984149 | |||
| 1336 | Ga0207663_10002762 | |||
| 1337 | Ga0207663_10002815 | |||
| 1338 | Ga0207663_10331530 | |||
| 1339 | Ga0207663_10370087 | |||
| 1340 | Ga0207663_10421812 | |||
| 1341 | Ga0207660_10047885 | |||
| 1342 | Ga0207660_10325024 | |||
| 1343 | Ga0207660_10767296 | |||
| 1344 | Ga0207660_10779106 | |||
| 1345 | Ga0207662_10652212 | |||
| 1346 | Ga0207657_10021306 | |||
| 1347 | Ga0207657_10238203 | |||
| 1348 | Ga0207649_10177331 | |||
| 1349 | Ga0207652_10242328 | |||
| 1350 | Ga0207652_10244642 | |||
| 1351 | Ga0207652_10380956 | |||
| 1352 | Ga0207652_10701356 | |||
| 1353 | Ga0207646_10072295 | |||
| 1354 | Ga0207646_10197155 | |||
| 1355 | Ga0207646_10689784 | |||
| 1356 | Ga0207681_10359844 | |||
| 1357 | Ga0207694_11336145 | |||
| 1358 | Ga0207650_10914644 | |||
| 1359 | Ga0207687_10103645 | |||
| 1360 | Ga0207687_10107691 | |||
| 1361 | Ga0207687_11799135 | |||
| 1362 | Ga0207700_10019183 | |||
| 1363 | Ga0207700_10054441 | |||
| 1364 | Ga0207700_10527843 | |||
| 1365 | Ga0207700_10559670 | |||
| 1366 | Ga0207700_10672628 | |||
| 1367 | Ga0207700_10981029 | |||
| 1368 | Ga0207664_10000609 | |||
| 1369 | Ga0207664_10000754 | |||
| 1370 | Ga0207664_10005800 | |||
| 1371 | Ga0207664_10013300 | |||
| 1372 | Ga0207664_10071485 | |||
| 1373 | Ga0207664_10113090 | |||
| 1374 | Ga0207664_10144549 | |||
| 1375 | Ga0207664_10288141 | |||
| 1376 | Ga0207664_11076556 | |||
| 1377 | Ga0207664_11201490 | |||
| 1378 | Ga0207664_11758380 | |||
| 1379 | Ga0207644_11078306 | |||
| 1380 | Ga0207690_10067049 | |||
| 1381 | Ga0207690_10129153 | |||
| 1382 | Ga0207690_11025439 | |||
| 1383 | Ga0207706_11070777 | |||
| 1384 | Ga0207686_10186143 | |||
| 1385 | Ga0207665_10002957 | |||
| 1386 | Ga0207665_10003780 | |||
| 1387 | Ga0207665_10017977 | |||
| 1388 | Ga0207665_10086975 | |||
| 1389 | Ga0207665_10985737 | |||
| 1390 | Ga0207711_10062502 | |||
| 1391 | Ga0207711_10870110 | |||
| 1392 | Ga0207711_10976259 | |||
| 1393 | Ga0207711_11183351 | |||
| 1394 | Ga0207661_10115196 | |||
| 1395 | Ga0207661_10144822 | |||
| 1396 | Ga0207661_10329575 | |||
| 1397 | Ga0207661_10820705 | |||
| 1398 | Ga0207661_12072932 | |||
| 1399 | Ga0207679_10187178 | |||
| 1400 | Ga0207679_10789724 | |||
| 1401 | Ga0207679_11125916 | |||
| 1402 | Ga0207667_10456156 | |||
| 1403 | Ga0207668_10009004 | |||
| 1404 | Ga0207668_10024098 | |||
| 1405 | Ga0207640_10738495 | |||
| 1406 | Ga0207640_11348802 | |||
| 1407 | Ga0207658_10055142 | |||
| 1408 | Ga0207658_10721796 | |||
| 1409 | Ga0207677_10326452 | |||
| 1410 | Ga0207677_10402885 | |||
| 1411 | Ga0207677_11408329 | |||
| 1412 | Ga0207703_10166155 | |||
| 1413 | Ga0207703_10204638 | |||
| 1414 | Ga0207678_10012834 | |||
| 1415 | Ga0207678_10014366 | |||
| 1416 | Ga0207678_10858502 | |||
| 1417 | Ga0207702_10030884 | |||
| 1418 | Ga0207702_10098854 | |||
| 1419 | Ga0207702_10338725 | |||
| 1420 | Ga0207702_11733908 | |||
| 1421 | Ga0207641_10013004 | |||
| 1422 | Ga0207641_10110957 | |||
| 1423 | Ga0207641_10178100 | |||
| 1424 | Ga0207641_10232316 | |||
| 1425 | Ga0207676_10062278 | |||
| 1426 | Ga0207676_10248755 | |||
| 1427 | Ga0207676_11786009 | |||
| 1428 | Ga0207674_10012377 | |||
| 1429 | Ga0207674_10072418 | |||
| 1430 | Ga0207674_10162070 | |||
| 1431 | Ga0207674_10326170 | |||
| 1432 | Ga0207674_10617135 | |||
| 1433 | Ga0207675_100184724 | |||
| 1434 | Ga0207675_100314455 | |||
| 1435 | Ga0207683_10015971 | |||
| 1436 | Ga0207683_10096786 | |||
| 1437 | Ga0207683_10409692 | |||
| 1438 | Ga0207698_10111400 | |||
| 1439 | Ga0207698_10279255 | |||
| 1440 | Ga0207698_10691197 | |||
| 1441 | Ga0207698_11670937 | |||
| 1442 | Ga0207428_10217676 | |||
| 1443 | Ga0207428_10237935 | |||
| 1444 | Ga0268266_10287483 | |||
| 1445 | Ga0268266_10313310 | |||
| 1446 | Ga0268266_10380354 | |||
| 1447 | Ga0268266_10641698 | |||
| 1448 | Ga0268266_11200851 | |||
| 1449 | Ga0268265_10045861 | |||
| 1450 | Ga0268265_10112804 | |||
| 1451 | Ga0268265_10437030 | |||
| 1452 | Ga0268264_10112282 | |||
| 1453 | Ga0268264_10390341 | |||
| 1454 | Ga0268264_10681248 | |||
| 1455 | Ga0265337_1000047 | |||
| 1456 | Ga0265326_10001418 | |||
| 1457 | Ga0265319_1001012 | |||
| 1458 | Ga0265334_10000196 | |||
| 1459 | Ga0265318_10030188 | |||
| 1460 | Ga0265323_10007189 | |||
| 1461 | Ga0265322_10046531 | |||
| 1462 | Ga0265336_10003247 | |||
| 1463 | Ga0307515_10000065 | |||
| 1464 | Ga0265338_10000315 | |||
| 1465 | Ga0265338_10004007 | |||
| 1466 | Ga0265324_10001017 | |||
| 1467 | Ga0307512_10037074 | |||
| 1468 | Ga0265767_116348 | |||
| 1469 | Ga0265767_119098 | |||
| 1470 | Ga0265766_1019937 | |||
| 1471 | Ga0265777_112814 | |||
| 1472 | Ga0265765_1040137 | |||
| 1473 | Ga0265768_110707 | |||
| 1474 | Ga0265332_10000555 | |||
| 1475 | Ga0265320_10001096 | |||
| 1476 | Ga0265325_10004303 | |||
| 1477 | Ga0265340_10000227 | |||
| 1478 | Ga0265339_10040123 | |||
| 1479 | Ga0265316_10009276 | |||
| 1480 | Ga0307513_10068018 | |||
| 1481 | Ga0307513_10179558 | |||
| 1482 | Ga0307509_10049017 | |||
| 1483 | Ga0307509_10127111 | |||
| 1484 | Ga0307408_100016145 | |||
| 1485 | Ga0307408_100040618 | |||
| 1486 | Ga0307408_100073547 | |||
| 1487 | Ga0310117_123185 | |||
| 1488 | Ga0265313_10040705 | |||
| 1489 | Ga0310103_138803 | |||
| 1490 | Ga0310103_140500 | |||
| 1491 | Ga0307508_10000654 | |||
| 1492 | Ga0307508_10090733 | |||
| 1493 | Ga0307508_10225322 | |||
| 1494 | Ga0307508_10237078 | |||
| 1495 | Ga0307508_10681243 | |||
| 1496 | Ga0310108_120659 | |||
| 1497 | Ga0310115_125776 | |||
| 1498 | Ga0310111_138010 | |||
| 1499 | Ga0310101_124840 | |||
| 1500 | Ga0316579_10006505 | |||
| 1501 | Ga0265314_10004449 | |||
| 1502 | Ga0265342_10000413 | |||
| 1503 | Ga0316576_10040310 | |||
| 1504 | Ga0316578_10010080 | |||
| 1505 | Ga0316578_10107884 | |||
| 1506 | Ga0307516_10001866 | |||
| 1507 | Ga0307516_10004273 | |||
| 1508 | Ga0307516_10042382 | |||
| 1509 | Ga0307516_10172871 | |||
| 1510 | Ga0307405_10228486 | |||
| 1511 | Ga0307405_11104007 | |||
| 1512 | Ga0316577_10007915 | |||
| 1513 | Ga0316045_125342 | |||
| 1514 | Ga0307413_10375949 | |||
| 1515 | Ga0307413_11374518 | |||
| 1516 | Ga0307410_10051690 | |||
| 1517 | Ga0307410_10162451 | |||
| 1518 | Ga0307410_11375079 | |||
| 1519 | Ga0307410_11506944 | |||
| 1520 | Ga0326468_10000007 | |||
| 1521 | Ga0307406_10009183 | |||
| 1522 | Ga0307406_10029598 | |||
| 1523 | Ga0307406_10040842 | |||
| 1524 | Ga0307406_10114874 | |||
| 1525 | Ga0307406_10697601 | |||
| 1526 | Ga0307406_11095428 | |||
| 1527 | Ga0307407_10013293 | |||
| 1528 | Ga0307407_10157597 | |||
| 1529 | Ga0307407_11626462 | |||
| 1530 | Ga0307412_10081909 | |||
| 1531 | Ga0307412_10386700 | |||
| 1532 | Ga0307412_10908420 | |||
| 1533 | Ga0307409_100007834 | |||
| 1534 | Ga0307409_100014580 | |||
| 1535 | Ga0307409_100095946 | |||
| 1536 | Ga0307409_100602917 | |||
| 1537 | Ga0307409_100766213 | |||
| 1538 | Ga0307409_101563880 | |||
| 1539 | Ga0307409_102336611 | |||
| 1540 | Ga0307416_100000153 | |||
| 1541 | Ga0307416_100110990 | |||
| 1542 | Ga0307416_100204144 | |||
| 1543 | Ga0307416_100600756 | |||
| 1544 | Ga0307416_101254732 | |||
| 1545 | Ga0307414_11587295 | |||
| 1546 | Ga0307411_11760899 | |||
| 1547 | Ga0307415_100000016 | |||
| 1548 | Ga0307415_100014325 | |||
| 1549 | Ga0307415_100015415 | |||
| 1550 | Ga0307415_100104857 | |||
| 1551 | Ga0307415_100221541 | |||
| 1552 | Ga0307415_100322131 | |||
| 1553 | Ga0307415_100495974 | |||
| 1554 | Ga0307415_100567308 | |||
| 1555 | Ga0307415_102381778 | |||
| 1556 | Ga0307415_102402908 | |||
| 1557 | Ga0316583_10050026 | |||
| 1558 | Ga0316585_10007045 | |||
| 1559 | Ga0316580_10002770 | |||
| 1560 | Ga0307507_10078450 | |||
| 1561 | Ga0307507_10155305 | |||
| 1562 | Ga0316592_1081285 | |||
| 1563 | Ga0316214_1003005 | |||
| 1564 | Ga0316214_1010118 | |||
| 1565 | Ga0373930_0054146 | |||
| 1566 | Ga0373930_0070418 | |||
| 1567 | Ga0373958_0024134 | |||
| 1568 | Ga0373938_0051347 | |||
| 1569 | Ga0373938_0093903 | |||
| 1570 | Ga0373938_0163848 | |||
| 1571 | Ga0373928_0026565 | |||
| 1572 | Ga0373928_0059459 | |||
| 1573 | Ga0373934_0002313 | |||
| 1574 | Ga0373934_0012780 | |||
| 1575 | Ga0373940_0069912 | |||
| 1576 | Ga0373949_0018066 | |||
| 1577 | Ga0373951_0000058 | |||
| 1578 | Ga0373951_0076130 | |||
| 1579 | Ga0373952_0006985 | |||
| 1580 | Ga0373952_0128694 | |||
| 1581 | Ga0373923_0076659 | |||
| 1582 | Ga0373932_0042822 | |||
| 1583 | Ga0373932_0081842 | |||
| 1584 | Ga0373936_0076071 | |||
| 1585 | Ga0373941_0006048 | |||
| 1586 | Ga0373941_0298258 | |||
| 1587 | Ga0373953_0002141 | |||
| 1588 | Ga0373953_0002719 | |||
| 1589 | Ga0373953_0009856 | |||
| 1590 | Ga0373954_0013578 | |||
| 1591 | Ga0373954_0045720 | |||
| 1592 | Ga0373954_0069882 | |||
| 1593 | Ga0373956_0002214 | |||
| 1594 | Ga0373956_0015881 | |||
| 1595 | Ga0373956_0028371 | |||
| 1596 | Ga0373956_0102192 | |||
| 1597 | Ga0373957_0010168 | |||
| 1598 | Ga0373957_0021416 | |||
| 1599 | Ga0373957_0072794 | |||
| 1600 | Ga0373960_0224231 | |||
| 1601 | Ga0373943_0394578 | |||
| 1602 | Ga0373943_0600104 | |||
| 1603 | Ga0373946_0283612 | |||
| 1604 | Ga0373955_0001688 | |||
| 1605 | Ga0373955_0016336 | |||
| 1606 | Ga0373955_0265192 | |||
| 1607 | Ga0373942_0001457 | |||
| 1608 | Ga0373942_0056274 | |||
| 1609 | Ga0373961_0057536 | |||
| 1610 | Ga0373962_0015104 | |||
| 1611 | Ga0316574_0042391 | |||
| 1612 | Ga0316574_0137141 | |||
| 1613 | Ga0373924_0000850 | |||
| 1614 | Ga0373924_0013089 | |||
| 1615 | Ga0373924_0064082 | |||
| 1616 | Ga0373931_0062088 | |||
| 1617 | Ga0373931_0113884 | |||
| 1618 | Ga0373931_0906833 | |||
| 1619 | Ga0373935_0601357 | |||
| 1620 | Ga0373927_0044884 | |||
| 1621 | Ga0373933_0003558 | |||
| 1622 | Ga0373933_0004461 | |||
| 1623 | Ga0373933_0154314 | |||
| 1624 | Ga0373933_0165272 | |||
| 1625 | Ga0373933_0538786 | |||
| 1626 | Ga0373947_0013352 | |||
| 1627 | Ga0373947_0361151 | |||
| 1628 | Ga0373947_0901942 | |||
| 1629 | Ga0373947_1038671 | |||
| 1630 | Ga0373937_0002840 | |||
| 1631 | Ga0373937_0006712 | |||
| 1632 | Ga0373937_0008793 | |||
| 1633 | Ga0373937_1193256 | |||
| 1634 | Ga0265778_047462 | |||
| 1635 | Ga0265778_060909 | |||
| 1636 | Ga0310112_048477 | |||
| 1637 | Ga0372808_002007 | |||
| 1638 | Ga0372808_023732 | |||
| 1639 | Ga0310109_047700 | |||
| 1640 | Ga0310110_046997 | |||
| 1641 | Ga0316582_0002094 | |||
| 1642 | Ga0316582_0086167 | |||
| 1643 | Ga0316584_0103230 | |||
| 1644 | Ga0373925_0000259 | |||
| 1645 | Ga0395899_0013079 | |||
| 1646 | Ga0395900_0004313 | |||
| 1647 | Ga0395898_0013021 | |||
| 1648 | Ga0436364_0148488 | |||
| 1649 | Ga0436364_0393888 | |||
| 1650 | Ga0436364_1328267 | |||
| 1651 | Ga0395901_0004087 | |||
| 1652 | Ga0242420_142503 | |||
| 1653 | Ga0436365_0484881 | |||
| 1654 | Ga0436365_1781586 | |||
| 1655 | Ga0436361_0131965 | |||
| 1656 | Ga0436361_0144445 | |||
| 1657 | Ga0436361_0462313 | |||
| 1658 | Ga0436363_0274219 | |||
| 1659 | Ga0436363_1262988 | |||
| 1660 | Ga0436362_0771186 | |||
| 1661 | Ga0436362_0827173 | |||
| 1662 | Ga0436362_1265637 | |||
| 1663 | Ga0451793_0349235 | |||
| 1664 | Ga0451845_0407979 | |||
| 1665 | Ga0439448_0008690 | |||
| 1666 | Ga0439449_0027379 | |||
| 1667 | Ga0439451_091413 | |||
| 1668 | Ga0439459_0058102 | |||
| 1669 | Ga0439459_0243171 | |||
| 1670 | Ga0466969_0003943 | |||
| 1671 | Ga0466966_0017589 | |||
| 1672 | Ga0466966_0294957 | |||
| 1673 | Ga0466961_0016526 | |||
| 1674 | Ga0466963_0212599 | |||
| 1675 | Ga0466963_0365436 | |||
| 1676 | Ga0466971_0001960 | |||
| 1677 | Ga0466968_0725123 | |||
| 1678 | Ga0466970_0077403 | |||
| 1679 | Ga0466957_0021253 | |||
| 1680 | Ga0466957_0363918 | |||
| 1681 | Ga0466959_0002842 | |||
| 1682 | Ga0466958_0010153 | |||
| 1683 | Ga0466958_0150010 | |||
| 1684 | Ga0466967_0313547 | |||
| 1685 | Ga0495592_0003303 | |||
| 1686 | Ga0495592_0091089 | |||
| 1687 | Ga0495592_0118246 | |||
| 1688 | Ga0495603_0065707 | |||
| 1689 | Ga0495629_0027761 | |||
| 1690 | Ga0495629_0343624 | |||
| 1691 | Ga0495629_0402265 | |||
| 1692 | Ga0495651_0005196 | |||
| 1693 | Ga0495651_0006896 | |||
| 1694 | Ga0495651_0030795 | |||
| 1695 | Ga0495651_0098721 | |||
| 1696 | Ga0495651_0799824 | |||
| 1697 | Ga0495653_0058922 | |||
| 1698 | Ga0495653_0088258 | |||
| 1699 | Ga0495653_0145208 | |||
| 1700 | Ga0495653_0831247 | |||
| 1701 | Ga0495582_0093889 | |||
| 1702 | Ga0495582_0177180 | |||
| 1703 | Ga0495662_0039942 | |||
| 1704 | Ga0495664_0011128 | |||
| 1705 | Ga0495664_0636507 | |||
| 1706 | Ga0495594_0003940 | |||
| 1707 | Ga0495594_0153812 | |||
| 1708 | Ga0495608_0006283 | |||
| 1709 | Ga0495608_0014958 | |||
| 1710 | Ga0495608_0052276 | |||
| 1711 | Ga0495608_0062362 | |||
| 1712 | Ga0495608_0906656 | |||
| 1713 | Ga0495618_0063654 | |||
| 1714 | Ga0495618_0197589 | |||
| 1715 | Ga0495618_0223383 | |||
| 1716 | Ga0495628_0007458 | |||
| 1717 | Ga0495628_0091144 | |||
| 1718 | Ga0495628_0360637 | |||
| 1719 | Ga0495630_0025766 | |||
| 1720 | Ga0495630_1170410 | |||
| 1721 | Ga0495666_0287224 | |||
| 1722 | Ga0495652_0007781 | |||
| 1723 | Ga0495652_0012322 | |||
| 1724 | Ga0495652_0040882 | |||
| 1725 | Ga0495652_0077597 | |||
| 1726 | Ga0495652_0292570 | |||
| 1727 | Ga0495665_0045394 | |||
| 1728 | Ga0495640_0033402 | |||
| 1729 | Ga0495640_0935220 | |||
| 1730 | Ga0495586_0069962 | |||
| 1731 | Ga0495587_0002870 | |||
| 1732 | Ga0495587_0031351 | |||
| 1733 | Ga0495587_0162104 | |||
| 1734 | Ga0495645_0045259 | |||
| 1735 | Ga0495667_0002881 | |||
| 1736 | Ga0495667_0012959 | |||
| 1737 | Ga0495667_0043121 | |||
| 1738 | Ga0495667_0364126 | |||
| 1739 | Ga0495634_0018519 | |||
| 1740 | Ga0495634_0063405 | |||
| 1741 | Ga0495634_0372157 | |||
| 1742 | Ga0495625_0000630 | |||
| 1743 | Ga0495635_0023369 | |||
| 1744 | Ga0495635_0039963 | |||
| 1745 | Ga0495635_0706178 | |||
| 1746 | Ga0495588_0012157 | |||
| 1747 | Ga0495657_0005656 | |||
| 1748 | Ga0495657_0043768 | |||
| 1749 | Ga0495657_0546587 | |||
| 1750 | Ga0495599_0002291 | |||
| 1751 | Ga0495599_0041129 | |||
| 1752 | Ga0495599_0048487 | |||
| 1753 | Ga0495623_0002822 | |||
| 1754 | Ga0495623_0128831 | |||
| 1755 | Ga0495623_0242468 | |||
| 1756 | Ga0495646_0051431 | |||
| 1757 | Ga0495646_0107747 | |||
| 1758 | Ga0495646_0207492 | |||
| 1759 | Ga0495658_0024540 | |||
| 1760 | Ga0495613_0022530 | |||
| 1761 | Ga0495600_0039423 | |||
| 1762 | Ga0495600_0046447 | |||
| 1763 | Ga0495600_0326484 | |||
| 1764 | Ga0495581_0004394 | |||
| 1765 | Ga0495604_0005098 | |||
| 1766 | Ga0495604_0027755 | |||
| 1767 | Ga0495604_0044166 | |||
| 1768 | Ga0495604_0079543 | |||
| 1769 | Ga0495674_0053599 | |||
| 1770 | Ga0495674_0497345 | |||
| 1771 | Ga0495674_0765014 | |||
| 1772 | Ga0495676_0007337 | |||
| 1773 | Ga0495676_0454571 | |||
| 1774 | Ga0495680_0002413 | |||
| 1775 | Ga0495680_0008567 | |||
| 1776 | Ga0495680_0036223 | |||
| 1777 | Ga0495680_0089116 | |||
| 1778 | Ga0495680_0203693 | |||
| 1779 | Ga0495683_0032795 | |||
| 1780 | Ga0495675_0002519 | |||
| 1781 | Ga0495675_0083658 | |||
| 1782 | Ga0495593_0352130 | |||
| 1783 | Ga0495602_0009822 | |||
| 1784 | Ga0495602_0173440 | |||
| 1785 | Ga0495602_0225974 | |||
| 1786 | Ga0495614_0003635 | |||
| 1787 | Ga0495614_0628910 | |||
| 1788 | Ga0495626_0000147 | |||
| 1789 | Ga0496100_0064659 | |||
| 1790 | Ga0496100_0461722 | |||
| 1791 | Ga0496100_0730076 | |||
| 1792 | Ga0496100_1272202 | |||
| 1793 | Ga0496101_0036103 | |||
| 1794 | Ga0496101_0881813 | |||
| 1795 | Ga0496101_1576236 | |||
| 1796 | Ga0496102_0376758 | |||
| 1797 | Ga0496103_0027693 | |||
| 1798 | Ga0496103_0029992 | |||
| 1799 | Ga0496104_0034337 | |||
| 1800 | Ga0496104_0066155 | |||
| 1801 | Ga0496104_0113655 | |||
| 1802 | Ga0496104_0317356 | |||
| 1803 | Ga0496104_0545737 | |||
| 1804 | Ga0496104_0750366 | |||
| 1805 | Ga0496104_1691081 | |||
| 1806 | Ga0496105_0046887 | |||
| 1807 | Ga0496105_0051063 | |||
| 1808 | Ga0496105_0073559 | |||
| 1809 | Ga0496105_0083585 | |||
| 1810 | Ga0496105_0524294 | |||
| 1811 | Ga0496106_0071907 | |||
| 1812 | Ga0496106_0570817 | |||
| 1813 | Ga0496106_1113245 | |||
| 1814 | Ga0496107_0354164 | |||
| 1815 | Ga0496107_0648600 | |||
| 1816 | Ga0496108_0000010 | |||
| 1817 | Ga0496108_0033047 | |||
| 1818 | Ga0496108_0524379 | |||
| 1819 | Ga0496108_0595441 | |||
| 1820 | Ga0496108_0773989 | |||
| 1821 | Ga0496108_1194741 | |||
| 1822 | Ga0496108_1320367 | |||
| 1823 | Ga0496108_1796062 | |||
| 1824 | Ga0496109_0005429 | |||
| 1825 | Ga0496109_0029223 | |||
| 1826 | Ga0496109_0317123 | |||
| 1827 | Ga0496109_0762454 | |||
| 1828 | Ga0496109_2072080 | |||
| 1829 | Ga0496110_0003656 | |||
| 1830 | Ga0496110_0023767 | |||
| 1831 | Ga0496110_0058180 | |||
| 1832 | Ga0496110_0068560 | |||
| 1833 | Ga0496110_0769609 | |||
| 1834 | Ga0496111_0019322 | |||
| 1835 | Ga0496111_0025321 | |||
| 1836 | Ga0496112_0005145 | |||
| 1837 | Ga0496112_0058741 | |||
| 1838 | Ga0496112_0063031 | |||
| 1839 | Ga0496112_0129711 | |||
| 1840 | Ga0496112_0138317 | |||
| 1841 | Ga0496112_0194323 | |||
| 1842 | Ga0496112_0276584 | |||
| 1843 | Ga0496112_0953032 | |||
| 1844 | Ga0496112_1762841 | |||
| 1845 | Ga0496113_0066592 | |||
| 1846 | Ga0496113_0122024 | |||
| 1847 | Ga0496113_0341336 | |||
| 1848 | Ga0496113_0386311 | |||
| 1849 | Ga0496114_0511171 | |||
| 1850 | Ga0496114_0613768 | |||
| 1851 | Ga0496115_0087104 | |||
| 1852 | Ga0496115_0195462 | |||
| 1853 | Ga0496115_0689837 | |||
| 1854 | Ga0496126_0147087 | |||
| 1855 | Ga0496126_0206748 | |||
| 1856 | Ga0496126_0594395 | |||
| 1857 | Ga0501031_0498669 | |||
| 1858 | Ga0501032_0067015 | |||
| 1859 | Ga0501032_0151997 | |||
| 1860 | Ga0501034_0005678 | |||
| 1861 | Ga0501036_0001066 | |||
| 1862 | Ga0501037_0155252 | |||
| 1863 | Ga0501037_0832568 | |||
| 1864 | Ga0501038_0082635 | |||
| 1865 | Ga0501042_0039046 | |||
| 1866 | Ga0501043_0018519 | |||
| 1867 | Ga0501047_0014517 | |||
| 1868 | Ga0501047_0081462 | |||
| 1869 | Ga0501048_0013899 | |||
| 1870 | Ga0501070_0164318 | |||
| 1871 | Ga0501073_0870898 | |||
| 1872 | Ga0501074_0027099 | |||
| 1873 | Ga0501074_0618995 | |||
| 1874 | Ga0501225_0150698 | |||
| 1875 | Ga0501080_0014313 | |||
| 1876 | Ga0501080_0327615 | |||
| 1877 | Ga0501044_0012884 | |||
| 1878 | nmdc:mga00v17_444185_c1 | |||
| 1879 | nmdc:mga07m45_580018_c1 | |||
| 1880 | nmdc:mga05p37_1073173_c1 | |||
| 1881 | nmdc:mga05p37_1094655_c1 | |||
| 1882 | nmdc:mga05p37_171513_c1 | |||
| 1883 | nmdc:mga05p37_2179272_c1 | |||
| 1884 | nmdc:mga05p37_347156_c1 | |||
| 1885 | nmdc:mga05p37_377811_c1 | |||
| 1886 | nmdc:mga05p37_59237_c1 | |||
| 1887 | nmdc:mga05p37_72233_c1 | |||
| 1888 | nmdc:mga05p37_991603_c1 | |||
| 1889 | nmdc:mga09592_321560_c1 | |||
| 1890 | nmdc:mga0qj67_190974_c1 | |||
| 1891 | nmdc:mga06r32_1047328_c1 | |||
| 1892 | nmdc:mga06r32_1960483_c1 | |||
| 1893 | nmdc:mga06r32_315107_c1 | |||
| 1894 | nmdc:mga06r32_40138_c1 | |||
| 1895 | nmdc:mga08y16_316874_c1 | |||
| 1896 | nmdc:mga0n895_11777_c1 | |||
| 1897 | nmdc:mga0n895_1339698_c1 | |||
| 1898 | nmdc:mga0rr50_36491_c1 | |||
| 1899 | nmdc:mga0rr50_783886_c1 | |||
| 1900 | nmdc:mga0rr50_9239_c1 | |||
| 1901 | nmdc:mga08x19_15715_c1 | |||
| 1902 | nmdc:mga0a205_698137_c1 | |||
| 1903 | nmdc:mga0a205_758538_c1 | |||
| 1904 | Ga0495612_0154639 | |||
| 1905 | Ga0495655_0251852 | |||
| 1906 | Ga0495595_0001405 | |||
| 1907 | Ga0495595_0022666 | |||
| 1908 | Ga0495619_0197350 | |||
| 1909 | Ga0495619_0331317 | |||
| 1910 | Ga0495619_0355921 | |||
| 1911 | Ga0495619_0376893 | |||
| 1912 | Ga0495619_0432966 | |||
| 1913 | Ga0500646_0000593 | |||
| 1914 | Ga0500583_0081794 | |||
| 1915 | Ga0500641_0021612 | |||
| 1916 | Ga0500641_0069807 | |||
| 1917 | Ga0500654_125727 | |||
| 1918 | Ga0500660_198084 | |||
| 1919 | Ga0500577_0338815 | |||
| 1920 | Ga0500579_074305 | |||
| 1921 | Ga0500588_0038157 | |||
| 1922 | Ga0500600_0353849 | |||
| 1923 | Ga0587070_152852 | |||
| 1924 | Ga0587073_0133899 | |||
| 1925 | Ga0587082_134431 | |||
| 1926 | Ga0587083_0150883 | |||
| 1927 | Ga0587106_127345 | |||
| 1928 | Ga0587101_040138 | |||
| 1929 | Ga0587101_074857 | |||
| 1930 | Ga0587101_107839 | |||
| 1931 | Ga0587122_032884 | |||
| 1932 | Ga0587067_094086 | |||
| 1933 | Ga0587069_112240 | |||
| 1934 | Ga0587072_146546 | |||
| 1935 | Ga0587076_087696 | |||
| 1936 | Ga0587071_087682 | |||
| 1937 | Ga0587111_0243129 | |||
| 1938 | Ga0466962_0010972 | |||
| 1939 | Ga0530510_0661708 | |||
| 1940 | Ga0530510_0838798 | |||
| 1941 | 2753267460 | |||
| 1942 | 2855672004 | |||
| 1943 | 2855678123 | |||
| 1944 | 2856747639 | |||
| 1945 | 2857291636 | |||
| 1946 | 2858849697 | |||
| 1947 | 2858886145 | |||
| 1948 | 2858889453 | |||
| 1949 | 2858898095 | |||
| 1950 | 2867302785 | |||
| 1951 | 2867314861 | |||
| 1952 | 2867316732 | |||
| 1953 | 2867321925 | |||
| 1954 | 2867322126 | |||
| 1955 | 2867512239 | |||
| 1956 | 2869052230 | |||
| 1957 | 2869065371 | |||
| 1958 | 2869069887 | |||
| 1959 | 2880492527 | |||
| 1960 | 2887484848 | |||
| 1961 | 2891566069 | |||
| 1962 | 2929228337 | |||
| 1963 | 8001782218 | |||
| 1964 | 8003831358 | |||
| 1965 | 8003863243 | |||
| 1966 | 8054710460 | |||
| 1967 | 8054728379 | |||
| 1968 | 8054738601 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ncq-assembly1.cif.gz_B-2 | crystal structure of nisod h1a mutant | 0.9836 | 24 | 133 |
| 1t6i-assembly1.cif.gz_A | nickel superoxide dismutase (nisod) apo structure | 0.9832 | 23 | 135 |
| 4ncq-assembly1.cif.gz_C-2 | crystal structure of nisod h1a mutant | 0.983 | 24 | 133 |
| 1t6q-assembly1.cif.gz_B-2 | nickel superoxide dismutase (nisod) cn-treated apo structure | 0.9784 | 22 | 135 |
| 1t6i-assembly1.cif.gz_A | nickel superoxide dismutase (nisod) apo structure | 0.9745 | 23 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t6qC00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase | 0.9852 | 23 | 133 | 1.20.120.400 |
| 1t6qA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase | 0.9851 | 23 | 133 | 1.20.120.400 |
| 1t6iA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase | 0.9767 | 23 | 135 | 1.20.120.400 |
| 1t6iA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase | 0.9679 | 23 | 135 | 1.20.120.400 |
| 1t6qC00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase | 0.9676 | 23 | 133 | 1.20.120.400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I2X3L6-F1-model_v4 | Superoxide dismutase, Ni | 1.003 | 59 | 133 |
GO:0004784
GO:0016151 |
| AF-A0A6J6MP41-F1-model_v4 | Unannotated protein | 1.002 | 42 | 133 |
GO:0004784
GO:0016151 |
| AF-A0A7K0WLI2-F1-model_v4 | deleted | 1 | 39 | 133 |
|
| AF-A0A7K0YH35-F1-model_v4 | deleted | 0.9989 | 51 | 133 |
|
| AF-A0A350RKC0-F1-model_v4 | Superoxide dismutase, Ni | 0.9895 | 38 | 130 |
GO:0004784
GO:0016151 |