F487482

General Info

Members Datasets Scaffolds Average Seq Length
984 453 1968 135

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0242858|Ga0495629_0242858_45_512
Length 155
Sequence MPVIGATQRFSTLANPGGTDMRLPRMLTPRTVVRAHCDLPCGVYDPAQARIEAESVKAICVKLQGNSDPDFRTRALIIKEQRSELVKHHLWVLWTDYFKPPHFEKYPQLHGLFNEATKLAGGGNGTKSSSDPAVADQLLAKIEEISKIFWETKQA

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
102 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
103 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
104 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
218 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
219 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
220 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
242 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
243 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
244 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
245 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
247 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
248 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
281 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
282 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
283 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
284 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
285 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
298 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
302 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
329 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
330 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
331 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
408 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
409 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
410 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
411 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
412 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
413 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
429 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
430 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
431 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
432 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
433 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
434 2858882152 Micromonospora noduli MED15 Isolate Nodule
435 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
436 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
437 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
438 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
439 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
440 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
441 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
442 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
443 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
444 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
445 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
446 2891562705 Microbispora tritici MT50 Isolate Unclassified
447 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
448 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
449 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
450 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
451 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
452 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
453 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.72
Metatranscriptomes 8.43
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0.51
Rhizoplane 6.71
Rhizosphere 84.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0242858 3300046459 Bacteria 1240
2 JGI24740J21852_10095534 3300001979 Bacteria 762
3 JGI24739J22299_10246418 3300001989 Bacteria 523
4 JGI24034J26672_10100481 3300002239 Bacteria 545
5 JGI25406J46586_10118020 3300003203 Bacteria 782
6 JGI25404J52841_10055524 3300003659 Bacteria 831
7 JGI25404J52841_10091508 3300003659 Bacteria 636
8 Ga0058859_11820616 3300004798 Bacteria 666
9 Ga0058863_10036897 3300004799 Bacteria 908
10 Ga0058861_11876488 3300004800 Bacteria 580
11 Ga0058861_12020820 3300004800 Bacteria 702
12 Ga0058860_12150652 3300004801 Bacteria 540
13 Ga0058862_10018238 3300004803 Bacteria 514
14 Ga0058862_10095433 3300004803 Bacteria 623
15 Ga0070658_10002809 3300005327 Bacteria 14469
16 Ga0070658_10090810 3300005327 Bacteria 2517
17 Ga0070658_10815776 3300005327 Bacteria 811
18 Ga0070683_100564453 3300005329 Bacteria 1088
19 Ga0070683_100896386 3300005329 Bacteria 851
20 Ga0070683_101057001 3300005329 Bacteria 780
21 Ga0070670_100426773 3300005331 Bacteria 1172
22 Ga0070670_100909930 3300005331 Bacteria 798
23 Ga0070666_10007271 3300005335 Bacteria 6826
24 Ga0070680_100528082 3300005336 Bacteria 1011
25 Ga0070680_100601343 3300005336 Bacteria 944
26 Ga0070682_100226671 3300005337 Bacteria 1334
27 Ga0070682_100552065 3300005337 Bacteria 902
28 Ga0070682_100858159 3300005337 Bacteria 742
29 Ga0070682_101194187 3300005337 Bacteria 642
30 Ga0070660_100180596 3300005339 Bacteria 1708
31 Ga0070660_100218869 3300005339 Bacteria 1547
32 Ga0070689_100130370 3300005340 Bacteria 2016
33 Ga0070691_10549264 3300005341 Bacteria 675
34 Ga0070661_100044193 3300005344 Bacteria 3255
35 Ga0070661_100078363 3300005344 Bacteria 2437
36 Ga0070661_100636516 3300005344 Bacteria 865
37 Ga0070661_101108623 3300005344 Bacteria 660
38 Ga0070692_10051650 3300005345 Bacteria 2139
39 Ga0070668_100008173 3300005347 Bacteria 7770
40 Ga0070668_100033438 3300005347 Bacteria 3916
41 Ga0070668_100241440 3300005347 Bacteria 1496
42 Ga0070675_100655065 3300005354 Bacteria 954
43 Ga0070671_100252094 3300005355 Bacteria 1499
44 Ga0070671_100558062 3300005355 Bacteria 988
45 Ga0070671_100568077 3300005355 Bacteria 979
46 Ga0070688_100180778 3300005365 Bacteria 1463
47 Ga0070659_100037634 3300005366 Bacteria 3773
48 Ga0070667_100087343 3300005367 Bacteria 2677
49 Ga0070667_100185405 3300005367 Bacteria 1841
50 Ga0070667_100369800 3300005367 Bacteria 1300
51 Ga0070709_10034833 3300005434 Bacteria 3056
52 Ga0070709_10147201 3300005434 Bacteria 1624
53 Ga0070709_10248843 3300005434 Bacteria 1279
54 Ga0070709_10761140 3300005434 Bacteria 757
55 Ga0070714_100000753 3300005435 Bacteria 22949
56 Ga0070714_100008171 3300005435 Bacteria 8158
57 Ga0070714_100017153 3300005435 Bacteria 5863
58 Ga0070714_100067024 3300005435 Bacteria 3094
59 Ga0070714_100558441 3300005435 Bacteria 1096
60 Ga0070714_100586640 3300005435 Bacteria 1069
61 Ga0070713_100044135 3300005436 Bacteria 3647
62 Ga0070713_100191400 3300005436 Bacteria 1843
63 Ga0070713_100652198 3300005436 Bacteria 1002
64 Ga0070713_100786403 3300005436 Bacteria 912
65 Ga0070713_101184371 3300005436 Bacteria 739
66 Ga0070713_101255665 3300005436 Bacteria 717
67 Ga0070713_102065715 3300005436 Bacteria 552
68 Ga0070710_10129766 3300005437 Bacteria 1535
69 Ga0070710_10613715 3300005437 Bacteria 758
70 Ga0070710_10620803 3300005437 Bacteria 755
71 Ga0070710_10707653 3300005437 Bacteria 711
72 Ga0070711_100028645 3300005439 Bacteria 3667
73 Ga0070711_100133748 3300005439 Bacteria 1850
74 Ga0070711_100258732 3300005439 Bacteria 1368
75 Ga0070711_100612060 3300005439 Bacteria 910
76 Ga0070711_100894559 3300005439 Bacteria 757
77 Ga0070711_101708129 3300005439 Bacteria 551
78 Ga0070705_100832150 3300005440 Bacteria 737
79 Ga0070705_101223244 3300005440 Bacteria 620
80 Ga0070700_100320578 3300005441 Bacteria 1138
81 Ga0070694_100407694 3300005444 Bacteria 1065
82 Ga0070663_100014425 3300005455 Bacteria 5071
83 Ga0070663_100024443 3300005455 Bacteria 4067
84 Ga0070663_101012715 3300005455 Bacteria 723
85 Ga0070678_100334708 3300005456 Bacteria 1297
86 Ga0070678_100395146 3300005456 Bacteria 1200
87 Ga0070678_100605162 3300005456 Bacteria 979
88 Ga0070662_100143834 3300005457 Bacteria 1851
89 Ga0070681_10162855 3300005458 Bacteria 2154
90 Ga0070681_10419746 3300005458 Bacteria 1250
91 Ga0070681_10451585 3300005458 Bacteria 1197
92 Ga0070681_10517477 3300005458 Bacteria 1106
93 Ga0070681_11297241 3300005458 Bacteria 651
94 Ga0070706_100066339 3300005467 Bacteria 3339
95 Ga0070706_100121380 3300005467 Bacteria 2436
96 Ga0070707_100076694 3300005468 Bacteria 3224
97 Ga0070707_100085908 3300005468 Bacteria 3042
98 Ga0070707_100275834 3300005468 Bacteria 1634
99 Ga0070698_100005079 3300005471 Bacteria 14410
100 Ga0070698_100087099 3300005471 Bacteria 3109
101 Ga0070698_100740993 3300005471 Bacteria 925
102 Ga0070698_101064854 3300005471 Bacteria 757
103 Ga0070699_100976339 3300005518 Bacteria 776
104 Ga0070699_101051772 3300005518 Bacteria 747
105 Ga0070679_100047394 3300005530 Bacteria 4283
106 Ga0070679_100052945 3300005530 Bacteria 4040
107 Ga0070679_100172479 3300005530 Bacteria 2136
108 Ga0070679_100434645 3300005530 Bacteria 1257
109 Ga0070679_101301257 3300005530 Bacteria 673
110 Ga0070684_100184680 3300005535 Bacteria 1896
111 Ga0070684_100246432 3300005535 Bacteria 1633
112 Ga0070684_100323587 3300005535 Bacteria 1416
113 Ga0070684_100550520 3300005535 Bacteria 1071
114 Ga0070684_100662553 3300005535 Bacteria 972
115 Ga0070697_101728792 3300005536 Bacteria 560
116 Ga0070697_101873390 3300005536 Bacteria 537
117 Ga0068853_100567015 3300005539 Bacteria 1076
118 Ga0070686_100018630 3300005544 Bacteria 4080
119 Ga0070696_100082410 3300005546 Bacteria 2280
120 Ga0070696_101847818 3300005546 Bacteria 523
121 Ga0070665_100518403 3300005548 Bacteria 1204
122 Ga0070665_100813066 3300005548 Bacteria 948
123 Ga0068855_100643143 3300005563 Bacteria 1140
124 Ga0070664_100044889 3300005564 Bacteria 3732
125 Ga0070664_100356882 3300005564 Bacteria 1331
126 Ga0068857_100050339 3300005577 Bacteria 3696
127 Ga0068857_100102046 3300005577 Bacteria 2574
128 Ga0068857_100889640 3300005577 Bacteria 853
129 Ga0068857_100936935 3300005577 Bacteria 832
130 Ga0068857_101757970 3300005577 Bacteria 607
131 Ga0068854_100068940 3300005578 Bacteria 2580
132 Ga0068854_100937952 3300005578 Bacteria 763
133 Ga0068856_100313462 3300005614 Bacteria 1586
134 Ga0068856_100673899 3300005614 Bacteria 1055
135 Ga0068856_100730096 3300005614 Bacteria 1011
136 Ga0068856_100953678 3300005614 Bacteria 876
137 Ga0068852_101108801 3300005616 Bacteria 812
138 Ga0068852_101406450 3300005616 Bacteria 720
139 Ga0068852_101520825 3300005616 Bacteria 692
140 Ga0068864_100014862 3300005618 Bacteria 6468
141 Ga0068864_100048803 3300005618 Bacteria 3640
142 Ga0068864_101489333 3300005618 Bacteria 680
143 Ga0068866_10971195 3300005718 Bacteria 602
144 Ga0068861_100579844 3300005719 Bacteria 1026
145 Ga0068861_100611453 3300005719 Bacteria 1002
146 Ga0068851_10245611 3300005834 Bacteria 1014
147 Ga0068851_10415622 3300005834 Bacteria 793
148 Ga0068870_10323452 3300005840 Bacteria 981
149 Ga0068863_100112067 3300005841 Bacteria 2598
150 Ga0068863_100180153 3300005841 Bacteria 2028
151 Ga0068863_100521399 3300005841 Bacteria 1172
152 Ga0068858_100068410 3300005842 Bacteria 3291
153 Ga0068858_100985802 3300005842 Bacteria 825
154 Ga0068860_100264090 3300005843 Bacteria 1678
155 Ga0068860_100747225 3300005843 Bacteria 990
156 Ga0068862_100058307 3300005844 Bacteria 3312
157 Ga0068862_100302063 3300005844 Bacteria 1473
158 Ga0081455_10127209 3300005937 Bacteria 1997
159 Ga0081455_10350544 3300005937 Bacteria 1041
160 Ga0081540_1000607 3300005983 Bacteria 34146
161 Ga0081540_1006932 3300005983 Bacteria 8167
162 Ga0081540_1007264 3300005983 Bacteria 7933
163 Ga0081540_1011440 3300005983 Bacteria 5929
164 Ga0081540_1090579 3300005983 Bacteria 1346
165 Ga0081540_1187352 3300005983 Bacteria 767
166 Ga0081540_1248110 3300005983 Bacteria 622
167 Ga0081539_10000367 3300005985 Bacteria 98630
168 Ga0081539_10004494 3300005985 Bacteria 15344
169 Ga0081539_10004919 3300005985 Bacteria 14234
170 Ga0081539_10011051 3300005985 Bacteria 7216
171 Ga0070717_10103636 3300006028 Bacteria 2419
172 Ga0070717_10160733 3300006028 Bacteria 1948
173 Ga0070717_10164931 3300006028 Bacteria 1924
174 Ga0070717_10796549 3300006028 Bacteria 860
175 Ga0070717_11343370 3300006028 Bacteria 649
176 Ga0075365_10040154 3300006038 Bacteria 3051
177 Ga0075364_10413538 3300006051 Bacteria 920
178 Ga0075432_10230818 3300006058 Bacteria 744
179 Ga0070715_10084966 3300006163 Bacteria 1444
180 Ga0070715_10105393 3300006163 Bacteria 1322
181 Ga0070715_10123664 3300006163 Bacteria 1236
182 Ga0070715_10201849 3300006163 Bacteria 1011
183 Ga0070716_100002471 3300006173 Bacteria 8534
184 Ga0070716_100043547 3300006173 Bacteria 2510
185 Ga0070716_100062145 3300006173 Bacteria 2164
186 Ga0070716_100252866 3300006173 Bacteria 1201
187 Ga0070716_100539372 3300006173 Bacteria 868
188 Ga0070712_100083106 3300006175 Bacteria 2324
189 Ga0070712_100301821 3300006175 Bacteria 1296
190 Ga0070712_100357028 3300006175 Bacteria 1197
191 Ga0070712_101017488 3300006175 Bacteria 717
192 Ga0070712_101284837 3300006175 Bacteria 637
193 Ga0070712_101759587 3300006175 Bacteria 543
194 Ga0075367_10180800 3300006178 Bacteria 1315
195 Ga0097621_100691399 3300006237 Bacteria 938
196 Ga0068871_101285604 3300006358 Bacteria 688
197 Ga0075428_100065541 3300006844 Bacteria 3977
198 Ga0075428_100284917 3300006844 Bacteria 1778
199 Ga0075428_100507992 3300006844 Bacteria 1289
200 Ga0075428_100567630 3300006844 Bacteria 1213
201 Ga0075431_100040901 3300006847 Bacteria 4779
202 Ga0075431_100216866 3300006847 Bacteria 1953
203 Ga0075431_100301099 3300006847 Bacteria 1620
204 Ga0075431_100409743 3300006847 Bacteria 1356
205 Ga0075431_100871578 3300006847 Bacteria 871
206 Ga0075433_10005443 3300006852 Bacteria 10005
207 Ga0075433_10260593 3300006852 Bacteria 1537
208 Ga0075434_100051405 3300006871 Bacteria 4096
209 Ga0075434_100453657 3300006871 Bacteria 1303
210 Ga0075434_100582083 3300006871 Bacteria 1138
211 Ga0075434_100791751 3300006871 Bacteria 964
212 Ga0075429_100371752 3300006880 Bacteria 1251
213 Ga0068865_100023726 3300006881 Bacteria 4020
214 Ga0075436_100025943 3300006914 Bacteria 4034
215 Ga0075436_100383482 3300006914 Bacteria 1016
216 Ga0075435_100707242 3300007076 Bacteria 876
217 Ga0105251_10071437 3300009011 Bacteria 1615
218 Ga0105251_10155197 3300009011 Bacteria 1033
219 Ga0105244_10295526 3300009036 Bacteria 750
220 Ga0105250_10037099 3300009092 Bacteria 1956
221 Ga0105240_10291918 3300009093 Bacteria 1869
222 Ga0105240_10765289 3300009093 Bacteria 1049
223 Ga0111539_10482804 3300009094 Bacteria 1443
224 Ga0105245_10168892 3300009098 Bacteria 2081
225 Ga0105245_10516459 3300009098 Bacteria 1212
226 Ga0105245_10765479 3300009098 Bacteria 1002
227 Ga0105247_10316782 3300009101 Bacteria 1087
228 Ga0105247_10549544 3300009101 Bacteria 849
229 Ga0114129_10108046 3300009147 Bacteria 3842
230 Ga0114129_10193989 3300009147 Bacteria 2756
231 Ga0114129_10303555 3300009147 Bacteria 2127
232 Ga0114129_10376770 3300009147 Bacteria 1875
233 Ga0114129_13400088 3300009147 Bacteria 512
234 Ga0105243_11243506 3300009148 Bacteria 759
235 Ga0105243_11355323 3300009148 Bacteria 730
236 Ga0105243_11780974 3300009148 Bacteria 646
237 Ga0105241_10883017 3300009174 Bacteria 829
238 Ga0105242_10428936 3300009176 Bacteria 1241
239 Ga0105242_11571396 3300009176 Bacteria 691
240 Ga0105242_13034902 3300009176 Bacteria 520
241 Ga0105248_10049688 3300009177 Bacteria 4704
242 Ga0105248_10526018 3300009177 Bacteria 1334
243 Ga0105248_11358877 3300009177 Bacteria 804
244 Ga0105239_10099887 3300010375 Bacteria 3209
245 Ga0105239_10422685 3300010375 Bacteria 1510
246 Ga0105239_10527787 3300010375 Bacteria 1343
247 Ga0157340_1007745 3300012473 Bacteria 704
248 Ga0157337_1027361 3300012483 Bacteria 564
249 Ga0157323_1003421 3300012495 Bacteria 956
250 Ga0157339_1057686 3300012505 Bacteria 531
251 Ga0157371_10058304 3300013102 Bacteria 2739
252 Ga0157371_10172674 3300013102 Bacteria 1545
253 Ga0157369_10008899 3300013105 Bacteria 11502
254 Ga0157369_10021008 3300013105 Bacteria 7299
255 Ga0157369_10022064 3300013105 Bacteria 7114
256 Ga0157369_11456328 3300013105 Bacteria 697
257 Ga0157374_10842653 3300013296 Bacteria 933
258 Ga0163162_10047239 3300013306 Bacteria 4314
259 Ga0163162_10402358 3300013306 Bacteria 1502
260 Ga0163162_11032191 3300013306 Bacteria 930
261 Ga0163162_11131053 3300013306 Bacteria 888
262 Ga0157372_10172952 3300013307 Bacteria 2499
263 Ga0157372_10269641 3300013307 Bacteria 1977
264 Ga0157372_10855343 3300013307 Bacteria 1056
265 Ga0157372_11130575 3300013307 Bacteria 906
266 Ga0157375_10013964 3300013308 Bacteria 7159
267 Ga0157375_10188673 3300013308 Bacteria 2216
268 Ga0157375_10338188 3300013308 Bacteria 1671
269 Ga0157375_10688432 3300013308 Bacteria 1177
270 Ga0163163_10053614 3300014325 Bacteria 3981
271 Ga0163163_10123189 3300014325 Bacteria 2628
272 Ga0163163_10525975 3300014325 Bacteria 1245
273 Ga0163163_10883459 3300014325 Bacteria 957
274 Ga0157380_10076143 3300014326 Bacteria 2730
275 Ga0182008_10092340 3300014497 Bacteria 1493
276 Ga0157377_10022617 3300014745 Bacteria 3322
277 Ga0157379_10107226 3300014968 Bacteria 2508
278 Ga0157379_10614617 3300014968 Bacteria 1015
279 Ga0157376_11045231 3300014969 Bacteria 841
280 Ga0182005_1151693 3300015265 Bacteria 675
281 Ga0163161_10346937 3300017792 Bacteria 1179
282 Ga0184594_126852 3300019181 Bacteria 500
283 Ga0197907_10194637 3300020069 Bacteria 899
284 Ga0197907_10765725 3300020069 Bacteria 2167
285 Ga0197907_11163380 3300020069 Bacteria 3466
286 Ga0197907_11282396 3300020069 Bacteria 702
287 Ga0206356_11216319 3300020070 Bacteria 1867
288 Ga0206356_11275235 3300020070 Bacteria 638
289 Ga0206356_11308114 3300020070 Bacteria 4987
290 Ga0206349_1229811 3300020075 Bacteria 2064
291 Ga0206349_1400002 3300020075 Bacteria 1121
292 Ga0206349_1568890 3300020075 Bacteria 566
293 Ga0206355_1481324 3300020076 Bacteria 860
294 Ga0206355_1661015 3300020076 Bacteria 1013
295 Ga0206351_10471509 3300020077 Bacteria 935
296 Ga0206351_10629504 3300020077 Bacteria 1955
297 Ga0206352_10306540 3300020078 Bacteria 1276
298 Ga0206352_10876827 3300020078 Bacteria 554
299 Ga0206352_11293270 3300020078 Bacteria 543
300 Ga0206350_10176573 3300020080 Bacteria 810
301 Ga0206350_10229569 3300020080 Bacteria 550
302 Ga0206350_10689443 3300020080 Bacteria 1962
303 Ga0206350_11074900 3300020080 Bacteria 654
304 Ga0206350_11609588 3300020080 Bacteria 1748
305 Ga0206354_10064564 3300020081 Bacteria 2686
306 Ga0206354_10391073 3300020081 Bacteria 1751
307 Ga0206354_11549948 3300020081 Bacteria 637
308 Ga0206353_10851551 3300020082 Bacteria 735
309 Ga0206353_11229849 3300020082 Bacteria 2097
310 Ga0206353_11327800 3300020082 Bacteria 4483
311 Ga0154015_1265672 3300020610 Bacteria 827
312 Ga0154015_1563874 3300020610 Bacteria 660
313 Ga0213874_10048215 3300021377 Bacteria 1299
314 Ga0213876_10000552 3300021384 Bacteria 28013
315 Ga0213875_10001581 3300021388 Bacteria 14507
316 Ga0224712_10003059 3300022467 Bacteria 4267
317 Ga0224712_10011091 3300022467 Bacteria 2781
318 Ga0224712_10095488 3300022467 Bacteria 1252
319 Ga0224712_10204536 3300022467 Bacteria 898
320 Ga0224712_10213198 3300022467 Bacteria 881
321 Ga0224712_10313819 3300022467 Bacteria 735
322 Ga0224712_10506093 3300022467 Bacteria 584
323 Ga0224712_10649205 3300022467 Bacteria 517
324 Ga0207656_10622745 3300025321 Bacteria 551
325 Ga0207692_10005854 3300025898 Bacteria 4954
326 Ga0207692_10021609 3300025898 Bacteria 2947
327 Ga0207692_10131224 3300025898 Bacteria 1415
328 Ga0207710_10486349 3300025900 Bacteria 640
329 Ga0207680_10299896 3300025903 Bacteria 1120
330 Ga0207647_10126140 3300025904 Bacteria 1506
331 Ga0207685_10244282 3300025905 Bacteria 865
332 Ga0207685_10611323 3300025905 Bacteria 586
333 Ga0207699_10002617 3300025906 Bacteria 8501
334 Ga0207699_10004556 3300025906 Bacteria 6623
335 Ga0207699_10014348 3300025906 Bacteria 4081
336 Ga0207699_10167591 3300025906 Bacteria 1467
337 Ga0207699_10173758 3300025906 Bacteria 1443
338 Ga0207699_10205630 3300025906 Bacteria 1336
339 Ga0207643_10396507 3300025908 Bacteria 872
340 Ga0207705_10022712 3300025909 Bacteria 4474
341 Ga0207705_10661768 3300025909 Bacteria 812
342 Ga0207684_10074214 3300025910 Bacteria 2890
343 Ga0207684_10592394 3300025910 Bacteria 947
344 Ga0207654_10502077 3300025911 Bacteria 857
345 Ga0207707_10197330 3300025912 Bacteria 1755
346 Ga0207671_10104410 3300025914 Bacteria 2150
347 Ga0207693_10064332 3300025915 Bacteria 2873
348 Ga0207693_10064916 3300025915 Bacteria 2859
349 Ga0207693_10910147 3300025915 Bacteria 675
350 Ga0207693_10917682 3300025915 Bacteria 671
351 Ga0207693_10984149 3300025915 Bacteria 645
352 Ga0207663_10002762 3300025916 Bacteria 8464
353 Ga0207663_10002815 3300025916 Bacteria 8394
354 Ga0207663_10331530 3300025916 Bacteria 1146
355 Ga0207663_10370087 3300025916 Bacteria 1089
356 Ga0207663_10421812 3300025916 Bacteria 1024
357 Ga0207660_10047885 3300025917 Bacteria 3024
358 Ga0207660_10325024 3300025917 Bacteria 1229
359 Ga0207660_10767296 3300025917 Bacteria 787
360 Ga0207660_10779106 3300025917 Bacteria 780
361 Ga0207662_10652212 3300025918 Bacteria 735
362 Ga0207657_10021306 3300025919 Bacteria 6103
363 Ga0207657_10238203 3300025919 Bacteria 1453
364 Ga0207649_10177331 3300025920 Bacteria 1489
365 Ga0207652_10242328 3300025921 Bacteria 1625
366 Ga0207652_10244642 3300025921 Bacteria 1617
367 Ga0207652_10380956 3300025921 Bacteria 1273
368 Ga0207652_10701356 3300025921 Bacteria 903
369 Ga0207646_10072295 3300025922 Bacteria 3081
370 Ga0207646_10197155 3300025922 Bacteria 1818
371 Ga0207646_10689784 3300025922 Bacteria 913
372 Ga0207681_10359844 3300025923 Bacteria 1167
373 Ga0207694_11336145 3300025924 Bacteria 606
374 Ga0207650_10914644 3300025925 Bacteria 745
375 Ga0207687_10103645 3300025927 Bacteria 2098
376 Ga0207687_10107691 3300025927 Bacteria 2063
377 Ga0207687_11799135 3300025927 Bacteria 524
378 Ga0207700_10019183 3300025928 Bacteria 4615
379 Ga0207700_10054441 3300025928 Bacteria 3003
380 Ga0207700_10527843 3300025928 Bacteria 1046
381 Ga0207700_10559670 3300025928 Bacteria 1015
382 Ga0207700_10672628 3300025928 Bacteria 923
383 Ga0207700_10981029 3300025928 Bacteria 756
384 Ga0207664_10000609 3300025929 Bacteria 24792
385 Ga0207664_10000754 3300025929 Bacteria 22024
386 Ga0207664_10005800 3300025929 Bacteria 8444
387 Ga0207664_10013300 3300025929 Bacteria 5903
388 Ga0207664_10071485 3300025929 Bacteria 2795
389 Ga0207664_10113090 3300025929 Bacteria 2260
390 Ga0207664_10144549 3300025929 Bacteria 2016
391 Ga0207664_10288141 3300025929 Bacteria 1442
392 Ga0207664_11076556 3300025929 Bacteria 719
393 Ga0207664_11201490 3300025929 Bacteria 676
394 Ga0207664_11758380 3300025929 Bacteria 542
395 Ga0207644_11078306 3300025931 Bacteria 675
396 Ga0207690_10067049 3300025932 Bacteria 2461
397 Ga0207690_10129153 3300025932 Bacteria 1847
398 Ga0207690_11025439 3300025932 Bacteria 687
399 Ga0207706_11070777 3300025933 Bacteria 675
400 Ga0207686_10186143 3300025934 Bacteria 1476
401 Ga0207665_10002957 3300025939 Bacteria 11387
402 Ga0207665_10003780 3300025939 Bacteria 10114
403 Ga0207665_10017977 3300025939 Bacteria 4648
404 Ga0207665_10086975 3300025939 Bacteria 2160
405 Ga0207665_10985737 3300025939 Bacteria 670
406 Ga0207711_10062502 3300025941 Bacteria 3211
407 Ga0207711_10870110 3300025941 Bacteria 838
408 Ga0207711_10976259 3300025941 Bacteria 786
409 Ga0207711_11183351 3300025941 Bacteria 706
410 Ga0207661_10115196 3300025944 Bacteria 2280
411 Ga0207661_10144822 3300025944 Bacteria 2048
412 Ga0207661_10329575 3300025944 Bacteria 1374
413 Ga0207661_10820705 3300025944 Bacteria 856
414 Ga0207661_12072932 3300025944 Bacteria 515
415 Ga0207679_10187178 3300025945 Bacteria 1718
416 Ga0207679_10789724 3300025945 Bacteria 865
417 Ga0207679_11125916 3300025945 Bacteria 720
418 Ga0207667_10456156 3300025949 Bacteria 1299
419 Ga0207668_10009004 3300025972 Bacteria 5968
420 Ga0207668_10024098 3300025972 Bacteria 3923
421 Ga0207640_10738495 3300025981 Bacteria 847
422 Ga0207640_11348802 3300025981 Bacteria 638
423 Ga0207658_10055142 3300025986 Bacteria 2944
424 Ga0207658_10721796 3300025986 Bacteria 901
425 Ga0207677_10326452 3300026023 Bacteria 1277
426 Ga0207677_10402885 3300026023 Bacteria 1161
427 Ga0207677_11408329 3300026023 Bacteria 642
428 Ga0207703_10166155 3300026035 Bacteria 1937
429 Ga0207703_10204638 3300026035 Bacteria 1756
430 Ga0207678_10012834 3300026067 Bacteria 7355
431 Ga0207678_10014366 3300026067 Bacteria 6963
432 Ga0207678_10858502 3300026067 Bacteria 802
433 Ga0207702_10030884 3300026078 Bacteria 4464
434 Ga0207702_10098854 3300026078 Bacteria 2571
435 Ga0207702_10338725 3300026078 Bacteria 1436
436 Ga0207702_11733908 3300026078 Bacteria 617
437 Ga0207641_10013004 3300026088 Bacteria 6827
438 Ga0207641_10110957 3300026088 Bacteria 2431
439 Ga0207641_10178100 3300026088 Bacteria 1945
440 Ga0207641_10232316 3300026088 Bacteria 1715
441 Ga0207676_10062278 3300026095 Bacteria 2958
442 Ga0207676_10248755 3300026095 Bacteria 1599
443 Ga0207676_11786009 3300026095 Bacteria 613
444 Ga0207674_10012377 3300026116 Bacteria 9536
445 Ga0207674_10072418 3300026116 Bacteria 3462
446 Ga0207674_10162070 3300026116 Bacteria 2191
447 Ga0207674_10326170 3300026116 Bacteria 1485
448 Ga0207674_10617135 3300026116 Bacteria 1047
449 Ga0207675_100184724 3300026118 Bacteria 1998
450 Ga0207675_100314455 3300026118 Bacteria 1528
451 Ga0207683_10015971 3300026121 Bacteria 6389
452 Ga0207683_10096786 3300026121 Bacteria 2632
453 Ga0207683_10409692 3300026121 Bacteria 1248
454 Ga0207698_10111400 3300026142 Bacteria 2294
455 Ga0207698_10279255 3300026142 Bacteria 1544
456 Ga0207698_10691197 3300026142 Bacteria 1014
457 Ga0207698_11670937 3300026142 Bacteria 652
458 Ga0207428_10217676 3300027907 Bacteria 1433
459 Ga0207428_10237935 3300027907 Bacteria 1361
460 Ga0268266_10287483 3300028379 Bacteria 1530
461 Ga0268266_10313310 3300028379 Bacteria 1467
462 Ga0268266_10380354 3300028379 Bacteria 1331
463 Ga0268266_10641698 3300028379 Bacteria 1021
464 Ga0268266_11200851 3300028379 Bacteria 733
465 Ga0268265_10045861 3300028380 Bacteria 3265
466 Ga0268265_10112804 3300028380 Bacteria 2223
467 Ga0268265_10437030 3300028380 Bacteria 1219
468 Ga0268264_10112282 3300028381 Bacteria 2389
469 Ga0268264_10390341 3300028381 Bacteria 1335
470 Ga0268264_10681248 3300028381 Bacteria 1020
471 Ga0265337_1000047 3300028556 Bacteria 53962
472 Ga0265326_10001418 3300028558 Bacteria 8437
473 Ga0265319_1001012 3300028563 Bacteria 17563
474 Ga0265334_10000196 3300028573 Bacteria 34888
475 Ga0265318_10030188 3300028577 Bacteria 2109
476 Ga0265323_10007189 3300028653 Bacteria 4642
477 Ga0265322_10046531 3300028654 Bacteria 1233
478 Ga0265336_10003247 3300028666 Bacteria 6443
479 Ga0307515_10000065 3300028794 Bacteria 244497
480 Ga0265338_10000315 3300028800 Bacteria 87685
481 Ga0265338_10004007 3300028800 Bacteria 20224
482 Ga0265324_10001017 3300029957 Bacteria 17233
483 Ga0307512_10037074 3300030522 Bacteria 4124
484 Ga0265767_116348 3300030836 Bacteria 539
485 Ga0265767_119098 3300030836 Bacteria 511
486 Ga0265766_1019937 3300030863 Bacteria 547
487 Ga0265777_112814 3300030877 Bacteria 635
488 Ga0265765_1040137 3300030879 Bacteria 620
489 Ga0265768_110707 3300030963 Bacteria 592
490 Ga0265332_10000555 3300031238 Bacteria 25185
491 Ga0265320_10001096 3300031240 Bacteria 19985
492 Ga0265325_10004303 3300031241 Bacteria 9021
493 Ga0265340_10000227 3300031247 Bacteria 28794
494 Ga0265339_10040123 3300031249 Bacteria 2603
495 Ga0265316_10009276 3300031344 Bacteria 9063
496 Ga0307513_10068018 3300031456 Bacteria 3733
497 Ga0307513_10179558 3300031456 Bacteria 1982
498 Ga0307509_10049017 3300031507 Bacteria 4532
499 Ga0307509_10127111 3300031507 Bacteria 2513
500 Ga0307408_100016145 3300031548 Bacteria 4979
501 Ga0307408_100040618 3300031548 Bacteria 3295
502 Ga0307408_100073547 3300031548 Bacteria 2534
503 Ga0310117_123185 3300031592 Bacteria 615
504 Ga0265313_10040705 3300031595 Bacteria 2295
505 Ga0310103_138803 3300031614 Bacteria 552
506 Ga0310103_140500 3300031614 Bacteria 536
507 Ga0307508_10000654 3300031616 Bacteria 41574
508 Ga0307508_10090733 3300031616 Bacteria 2643
509 Ga0307508_10225322 3300031616 Bacteria 1474
510 Ga0307508_10237078 3300031616 Bacteria 1422
511 Ga0307508_10681243 3300031616 Bacteria 636
512 Ga0310108_120659 3300031633 Bacteria 605
513 Ga0310115_125776 3300031635 Bacteria 563
514 Ga0310111_138010 3300031667 Bacteria 543
515 Ga0310101_124840 3300031690 Bacteria 560
516 Ga0316579_10006505 3300031691 Bacteria 4770
517 Ga0265314_10004449 3300031711 Bacteria 13011
518 Ga0265342_10000413 3300031712 Bacteria 46857
519 Ga0316576_10040310 3300031727 Bacteria 3356
520 Ga0316578_10010080 3300031728 Bacteria 4889
521 Ga0316578_10107884 3300031728 Bacteria 1671
522 Ga0307516_10001866 3300031730 Bacteria 28881
523 Ga0307516_10004273 3300031730 Bacteria 17755
524 Ga0307516_10042382 3300031730 Bacteria 4515
525 Ga0307516_10172871 3300031730 Bacteria 1899
526 Ga0307405_10228486 3300031731 Bacteria 1370
527 Ga0307405_11104007 3300031731 Bacteria 682
528 Ga0316577_10007915 3300031733 Bacteria 5676
529 Ga0316045_125342 3300031815 Bacteria 539
530 Ga0307413_10375949 3300031824 Bacteria 1105
531 Ga0307413_11374518 3300031824 Bacteria 620
532 Ga0307410_10051690 3300031852 Bacteria 2771
533 Ga0307410_10162451 3300031852 Bacteria 1675
534 Ga0307410_11375079 3300031852 Bacteria 619
535 Ga0307410_11506944 3300031852 Bacteria 592
536 Ga0326468_10000007 3300031889 Bacteria 13984
537 Ga0307406_10009183 3300031901 Bacteria 5539
538 Ga0307406_10029598 3300031901 Bacteria 3317
539 Ga0307406_10040842 3300031901 Bacteria 2887
540 Ga0307406_10114874 3300031901 Bacteria 1860
541 Ga0307406_10697601 3300031901 Bacteria 847
542 Ga0307406_11095428 3300031901 Bacteria 687
543 Ga0307407_10013293 3300031903 Bacteria 3990
544 Ga0307407_10157597 3300031903 Bacteria 1482
545 Ga0307407_11626462 3300031903 Bacteria 513
546 Ga0307412_10081909 3300031911 Bacteria 2233
547 Ga0307412_10386700 3300031911 Bacteria 1135
548 Ga0307412_10908420 3300031911 Bacteria 772
549 Ga0307409_100007834 3300031995 Bacteria 6428
550 Ga0307409_100014580 3300031995 Bacteria 5120
551 Ga0307409_100095946 3300031995 Bacteria 2445
552 Ga0307409_100602917 3300031995 Bacteria 1085
553 Ga0307409_100766213 3300031995 Bacteria 970
554 Ga0307409_101563880 3300031995 Bacteria 687
555 Ga0307409_102336611 3300031995 Bacteria 564
556 Ga0307416_100000153 3300032002 Bacteria 40170
557 Ga0307416_100110990 3300032002 Bacteria 2416
558 Ga0307416_100204144 3300032002 Bacteria 1878
559 Ga0307416_100600756 3300032002 Bacteria 1180
560 Ga0307416_101254732 3300032002 Bacteria 847
561 Ga0307414_11587295 3300032004 Bacteria 610
562 Ga0307411_11760899 3300032005 Bacteria 574
563 Ga0307415_100000016 3300032126 Bacteria 78647
564 Ga0307415_100014325 3300032126 Bacteria 4659
565 Ga0307415_100015415 3300032126 Bacteria 4526
566 Ga0307415_100104857 3300032126 Bacteria 2084
567 Ga0307415_100221541 3300032126 Bacteria 1517
568 Ga0307415_100322131 3300032126 Bacteria 1289
569 Ga0307415_100495974 3300032126 Bacteria 1066
570 Ga0307415_100567308 3300032126 Bacteria 1004
571 Ga0307415_102381778 3300032126 Bacteria 520
572 Ga0307415_102402908 3300032126 Bacteria 518
573 Ga0316583_10050026 3300032133 Bacteria 1471
574 Ga0316585_10007045 3300032137 Bacteria 3228
575 Ga0316580_10002770 3300032139 Bacteria 4885
576 Ga0307507_10078450 3300033179 Bacteria 2928
577 Ga0307507_10155305 3300033179 Bacteria 1708
578 Ga0316592_1081285 3300033524 Bacteria 737
579 Ga0316214_1003005 3300033545 Bacteria 2103
580 Ga0316214_1010118 3300033545 Bacteria 1277
581 Ga0373930_0054146 3300034816 Bacteria 882
582 Ga0373930_0070418 3300034816 Bacteria 794
583 Ga0373958_0024134 3300034819 Bacteria 1148
584 Ga0373938_0051347 3300034957 Bacteria 943
585 Ga0373938_0093903 3300034957 Bacteria 746
586 Ga0373938_0163848 3300034957 Bacteria 598
587 Ga0373928_0026565 3300035084 Bacteria 1255
588 Ga0373928_0059459 3300035084 Bacteria 921
589 Ga0373934_0002313 3300035086 Bacteria 7011
590 Ga0373934_0012780 3300035086 Bacteria 3172
591 Ga0373940_0069912 3300035088 Bacteria 1020
592 Ga0373949_0018066 3300035090 Bacteria 1595
593 Ga0373951_0000058 3300035091 Bacteria 45018
594 Ga0373951_0076130 3300035091 Bacteria 862
595 Ga0373952_0006985 3300035092 Bacteria 2103
596 Ga0373952_0128694 3300035092 Bacteria 693
597 Ga0373923_0076659 3300035111 Bacteria 1444
598 Ga0373932_0042822 3300035112 Bacteria 1314
599 Ga0373932_0081842 3300035112 Bacteria 1021
600 Ga0373936_0076071 3300035113 Bacteria 1391
601 Ga0373941_0006048 3300035115 Bacteria 2892
602 Ga0373941_0298258 3300035115 Bacteria 642
603 Ga0373953_0002141 3300035117 Bacteria 5910
604 Ga0373953_0002719 3300035117 Bacteria 5367
605 Ga0373953_0009856 3300035117 Bacteria 3307
606 Ga0373954_0013578 3300035118 Bacteria 3631
607 Ga0373954_0045720 3300035118 Bacteria 2046
608 Ga0373954_0069882 3300035118 Bacteria 1667
609 Ga0373956_0002214 3300035119 Bacteria 8016
610 Ga0373956_0015881 3300035119 Bacteria 3158
611 Ga0373956_0028371 3300035119 Bacteria 2435
612 Ga0373956_0102192 3300035119 Bacteria 1330
613 Ga0373957_0010168 3300035120 Bacteria 3102
614 Ga0373957_0021416 3300035120 Bacteria 2294
615 Ga0373957_0072794 3300035120 Bacteria 1346
616 Ga0373960_0224231 3300035121 Bacteria 673
617 Ga0373943_0394578 3300035170 Bacteria 798
618 Ga0373943_0600104 3300035170 Bacteria 648
619 Ga0373946_0283612 3300035171 Bacteria 815
620 Ga0373955_0001688 3300035172 Bacteria 9439
621 Ga0373955_0016336 3300035172 Bacteria 3650
622 Ga0373955_0265192 3300035172 Bacteria 1031
623 Ga0373942_0001457 3300035207 Bacteria 6074
624 Ga0373942_0056274 3300035207 Bacteria 1116
625 Ga0373961_0057536 3300035241 Bacteria 1170
626 Ga0373962_0015104 3300035242 Bacteria 1975
627 Ga0316574_0042391 3300035398 Bacteria 2807
628 Ga0316574_0137141 3300035398 Bacteria 1575
629 Ga0373924_0000850 3300035410 Bacteria 9595
630 Ga0373924_0013089 3300035410 Bacteria 3113
631 Ga0373924_0064082 3300035410 Bacteria 1542
632 Ga0373931_0062088 3300035691 Bacteria 2016
633 Ga0373931_0113884 3300035691 Bacteria 1538
634 Ga0373931_0906833 3300035691 Bacteria 592
635 Ga0373935_0601357 3300035692 Bacteria 804
636 Ga0373927_0044884 3300035695 Bacteria 2859
637 Ga0373933_0003558 3300035724 Bacteria 8659
638 Ga0373933_0004461 3300035724 Bacteria 7674
639 Ga0373933_0154314 3300035724 Bacteria 1455
640 Ga0373933_0165272 3300035724 Bacteria 1406
641 Ga0373933_0538786 3300035724 Bacteria 766
642 Ga0373947_0013352 3300035725 Bacteria 4706
643 Ga0373947_0361151 3300035725 Bacteria 975
644 Ga0373947_0901942 3300035725 Bacteria 603
645 Ga0373947_1038671 3300035725 Bacteria 559
646 Ga0373937_0002840 3300036401 Bacteria 14476
647 Ga0373937_0006712 3300036401 Bacteria 9927
648 Ga0373937_0008793 3300036401 Bacteria 8760
649 Ga0373937_1193256 3300036401 Bacteria 709
650 Ga0265778_047462 3300036457 Bacteria 582
651 Ga0265778_060909 3300036457 Bacteria 528
652 Ga0310112_048477 3300036458 Bacteria 576
653 Ga0372808_002007 3300036459 Bacteria 2260
654 Ga0372808_023732 3300036459 Bacteria 880
655 Ga0310109_047700 3300036534 Bacteria 553
656 Ga0310110_046997 3300036535 Bacteria 524
657 Ga0316582_0002094 3300036647 Bacteria 9203
658 Ga0316582_0086167 3300036647 Bacteria 2059
659 Ga0316584_0103230 3300036712 Bacteria 2134
660 Ga0373925_0000259 3300037068 Bacteria 55034
661 Ga0395899_0013079 3300037312 Bacteria 6347
662 Ga0395900_0004313 3300037418 Bacteria 15078
663 Ga0395898_0013021 3300037466 Bacteria 8572
664 Ga0436364_0148488 3300037853 Bacteria 795
665 Ga0436364_0393888 3300037853 Bacteria 62164
666 Ga0436364_1328267 3300037853 Bacteria 1058
667 Ga0395901_0004087 3300038443 Bacteria 14704
668 Ga0242420_142503 3300038996 Bacteria 534
669 Ga0436365_0484881 3300039437 Bacteria 603
670 Ga0436365_1781586 3300039437 Bacteria 55120
671 Ga0436361_0131965 3300039447 Bacteria 944
672 Ga0436361_0144445 3300039447 Bacteria 726
673 Ga0436361_0462313 3300039447 Bacteria 670
674 Ga0436363_0274219 3300039450 Bacteria 2324
675 Ga0436363_1262988 3300039450 Bacteria 726
676 Ga0436362_0771186 3300039453 Bacteria 680
677 Ga0436362_0827173 3300039453 Bacteria 645
678 Ga0436362_1265637 3300039453 Bacteria 1549
679 Ga0451793_0349235 3300041452 Bacteria 806
680 Ga0451845_0407979 3300041501 Bacteria 1119
681 Ga0439448_0008690 3300042005 Bacteria 2975
682 Ga0439449_0027379 3300042007 Bacteria 2127
683 Ga0439451_091413 3300042009 Bacteria 613
684 Ga0439459_0058102 3300042438 Bacteria 867
685 Ga0439459_0243171 3300042438 Bacteria 506
686 Ga0466969_0003943 3300044656 Bacteria 7878
687 Ga0466966_0017589 3300044684 Bacteria 4723
688 Ga0466966_0294957 3300044684 Bacteria 975
689 Ga0466961_0016526 3300044693 Bacteria 4741
690 Ga0466963_0212599 3300044694 Bacteria 1354
691 Ga0466963_0365436 3300044694 Bacteria 1016
692 Ga0466971_0001960 3300044719 Bacteria 8714
693 Ga0466968_0725123 3300044735 Bacteria 509
694 Ga0466970_0077403 3300044765 Bacteria 1793
695 Ga0466957_0021253 3300044842 Bacteria 3823
696 Ga0466957_0363918 3300044842 Bacteria 983
697 Ga0466959_0002842 3300045049 Bacteria 11156
698 Ga0466958_0010153 3300045836 Bacteria 5264
699 Ga0466958_0150010 3300045836 Bacteria 1470
700 Ga0466967_0313547 3300045976 Bacteria 1511
701 Ga0495592_0003303 3300046454 Bacteria 11554
702 Ga0495592_0091089 3300046454 Bacteria 2187
703 Ga0495592_0118246 3300046454 Bacteria 1867
704 Ga0495603_0065707 3300046455 Bacteria 2138
705 Ga0495629_0027761 3300046459 Bacteria 4020
706 Ga0495629_0343624 3300046459 Bacteria 1018
707 Ga0495629_0402265 3300046459 Bacteria 930
708 Ga0495651_0005196 3300046462 Bacteria 9927
709 Ga0495651_0006896 3300046462 Bacteria 8681
710 Ga0495651_0030795 3300046462 Bacteria 4183
711 Ga0495651_0098721 3300046462 Bacteria 2178
712 Ga0495651_0799824 3300046462 Bacteria 582
713 Ga0495653_0058922 3300046463 Bacteria 2917
714 Ga0495653_0088258 3300046463 Bacteria 2275
715 Ga0495653_0145208 3300046463 Bacteria 1663
716 Ga0495653_0831247 3300046463 Bacteria 553
717 Ga0495582_0093889 3300046473 Bacteria 1674
718 Ga0495582_0177180 3300046473 Bacteria 1214
719 Ga0495662_0039942 3300046476 Bacteria 2266
720 Ga0495664_0011128 3300046477 Bacteria 5063
721 Ga0495664_0636507 3300046477 Bacteria 632
722 Ga0495594_0003940 3300046499 Bacteria 7640
723 Ga0495594_0153812 3300046499 Bacteria 1306
724 Ga0495608_0006283 3300046511 Bacteria 8426
725 Ga0495608_0014958 3300046511 Bacteria 5385
726 Ga0495608_0052276 3300046511 Bacteria 2705
727 Ga0495608_0062362 3300046511 Bacteria 2449
728 Ga0495608_0906656 3300046511 Bacteria 516
729 Ga0495618_0063654 3300046514 Bacteria 2342
730 Ga0495618_0197589 3300046514 Bacteria 1273
731 Ga0495618_0223383 3300046514 Bacteria 1187
732 Ga0495628_0007458 3300046516 Bacteria 9464
733 Ga0495628_0091144 3300046516 Bacteria 2359
734 Ga0495628_0360637 3300046516 Bacteria 1067
735 Ga0495630_0025766 3300046517 Bacteria 4349
736 Ga0495630_1170410 3300046517 Bacteria 582
737 Ga0495666_0287224 3300046526 Bacteria 745
738 Ga0495652_0007781 3300046529 Bacteria 9844
739 Ga0495652_0012322 3300046529 Bacteria 7719
740 Ga0495652_0040882 3300046529 Bacteria 4006
741 Ga0495652_0077597 3300046529 Bacteria 2752
742 Ga0495652_0292570 3300046529 Bacteria 1187
743 Ga0495665_0045394 3300046531 Bacteria 2334
744 Ga0495640_0033402 3300046533 Bacteria 3654
745 Ga0495640_0935220 3300046533 Bacteria 512
746 Ga0495586_0069962 3300046535 Bacteria 1916
747 Ga0495587_0002870 3300046536 Bacteria 11535
748 Ga0495587_0031351 3300046536 Bacteria 3219
749 Ga0495587_0162104 3300046536 Bacteria 1272
750 Ga0495645_0045259 3300046543 Bacteria 3210
751 Ga0495667_0002881 3300046559 Bacteria 11526
752 Ga0495667_0012959 3300046559 Bacteria 5653
753 Ga0495667_0043121 3300046559 Bacteria 2990
754 Ga0495667_0364126 3300046559 Bacteria 913
755 Ga0495634_0018519 3300046642 Bacteria 4957
756 Ga0495634_0063405 3300046642 Bacteria 2453
757 Ga0495634_0372157 3300046642 Bacteria 852
758 Ga0495625_0000630 3300046660 Bacteria 50920
759 Ga0495635_0023369 3300046663 Bacteria 4308
760 Ga0495635_0039963 3300046663 Bacteria 3243
761 Ga0495635_0706178 3300046663 Bacteria 653
762 Ga0495588_0012157 3300046674 Bacteria 4059
763 Ga0495657_0005656 3300046675 Bacteria 9862
764 Ga0495657_0043768 3300046675 Bacteria 3050
765 Ga0495657_0546587 3300046675 Bacteria 673
766 Ga0495599_0002291 3300046678 Bacteria 11128
767 Ga0495599_0041129 3300046678 Bacteria 2903
768 Ga0495599_0048487 3300046678 Bacteria 2662
769 Ga0495623_0002822 3300046679 Bacteria 11458
770 Ga0495623_0128831 3300046679 Bacteria 1517
771 Ga0495623_0242468 3300046679 Bacteria 1017
772 Ga0495646_0051431 3300046680 Bacteria 2493
773 Ga0495646_0107747 3300046680 Bacteria 1589
774 Ga0495646_0207492 3300046680 Bacteria 1064
775 Ga0495658_0024540 3300046683 Bacteria 3212
776 Ga0495613_0022530 3300046689 Bacteria 4691
777 Ga0495600_0039423 3300046809 Bacteria 3076
778 Ga0495600_0046447 3300046809 Bacteria 2833
779 Ga0495600_0326484 3300046809 Bacteria 964
780 Ga0495581_0004394 3300047315 Bacteria 8146
781 Ga0495604_0005098 3300047317 Bacteria 10401
782 Ga0495604_0027755 3300047317 Bacteria 4502
783 Ga0495604_0044166 3300047317 Bacteria 3484
784 Ga0495604_0079543 3300047317 Bacteria 2458
785 Ga0495674_0053599 3300047319 Bacteria 3544
786 Ga0495674_0497345 3300047319 Bacteria 975
787 Ga0495674_0765014 3300047319 Bacteria 754
788 Ga0495676_0007337 3300047321 Bacteria 10118
789 Ga0495676_0454571 3300047321 Bacteria 844
790 Ga0495680_0002413 3300047322 Bacteria 19130
791 Ga0495680_0008567 3300047322 Bacteria 9284
792 Ga0495680_0036223 3300047322 Bacteria 3963
793 Ga0495680_0089116 3300047322 Bacteria 2316
794 Ga0495680_0203693 3300047322 Bacteria 1418
795 Ga0495683_0032795 3300047323 Bacteria 2645
796 Ga0495675_0002519 3300047444 Bacteria 10971
797 Ga0495675_0083658 3300047444 Bacteria 2008
798 Ga0495593_0352130 3300047673 Bacteria 736
799 Ga0495602_0009822 3300048088 Bacteria 9930
800 Ga0495602_0173440 3300048088 Bacteria 1671
801 Ga0495602_0225974 3300048088 Bacteria 1409
802 Ga0495614_0003635 3300048089 Bacteria 6914
803 Ga0495614_0628910 3300048089 Bacteria 517
804 Ga0495626_0000147 3300048091 Bacteria 87994
805 Ga0496100_0064659 3300048903 Bacteria 2421
806 Ga0496100_0461722 3300048903 Bacteria 975
807 Ga0496100_0730076 3300048903 Bacteria 774
808 Ga0496100_1272202 3300048903 Bacteria 580
809 Ga0496101_0036103 3300048904 Bacteria 3499
810 Ga0496101_0881813 3300048904 Bacteria 705
811 Ga0496101_1576236 3300048904 Bacteria 510
812 Ga0496102_0376758 3300048905 Bacteria 1336
813 Ga0496103_0027693 3300048906 Bacteria 3436
814 Ga0496103_0029992 3300048906 Bacteria 3307
815 Ga0496104_0034337 3300048907 Bacteria 4729
816 Ga0496104_0066155 3300048907 Bacteria 3431
817 Ga0496104_0113655 3300048907 Bacteria 2596
818 Ga0496104_0317356 3300048907 Bacteria 1471
819 Ga0496104_0545737 3300048907 Bacteria 1070
820 Ga0496104_0750366 3300048907 Bacteria 883
821 Ga0496104_1691081 3300048907 Bacteria 535
822 Ga0496105_0046887 3300048908 Bacteria 3567
823 Ga0496105_0051063 3300048908 Bacteria 3417
824 Ga0496105_0073559 3300048908 Bacteria 2823
825 Ga0496105_0083585 3300048908 Bacteria 2636
826 Ga0496105_0524294 3300048908 Bacteria 928
827 Ga0496106_0071907 3300048909 Bacteria 2644
828 Ga0496106_0570817 3300048909 Bacteria 907
829 Ga0496106_1113245 3300048909 Bacteria 618
830 Ga0496107_0354164 3300048910 Bacteria 1092
831 Ga0496107_0648600 3300048910 Bacteria 778
832 Ga0496108_0000010 3300048911 Bacteria 273269
833 Ga0496108_0033047 3300048911 Bacteria 4298
834 Ga0496108_0524379 3300048911 Bacteria 1034
835 Ga0496108_0595441 3300048911 Bacteria 963
836 Ga0496108_0773989 3300048911 Bacteria 829
837 Ga0496108_1194741 3300048911 Bacteria 643
838 Ga0496108_1320367 3300048911 Bacteria 606
839 Ga0496108_1796062 3300048911 Bacteria 502
840 Ga0496109_0005429 3300048912 Bacteria 10661
841 Ga0496109_0029223 3300048912 Bacteria 4936
842 Ga0496109_0317123 3300048912 Bacteria 1471
843 Ga0496109_0762454 3300048912 Bacteria 905
844 Ga0496109_2072080 3300048912 Bacteria 501
845 Ga0496110_0003656 3300048913 Bacteria 11830
846 Ga0496110_0023767 3300048913 Bacteria 5216
847 Ga0496110_0058180 3300048913 Bacteria 3404
848 Ga0496110_0068560 3300048913 Bacteria 3139
849 Ga0496110_0769609 3300048913 Bacteria 866
850 Ga0496111_0019322 3300048914 Bacteria 4730
851 Ga0496111_0025321 3300048914 Bacteria 4187
852 Ga0496112_0005145 3300048915 Bacteria 11246
853 Ga0496112_0058741 3300048915 Bacteria 3788
854 Ga0496112_0063031 3300048915 Bacteria 3657
855 Ga0496112_0129711 3300048915 Bacteria 2492
856 Ga0496112_0138317 3300048915 Bacteria 2405
857 Ga0496112_0194323 3300048915 Bacteria 1990
858 Ga0496112_0276584 3300048915 Bacteria 1626
859 Ga0496112_0953032 3300048915 Bacteria 779
860 Ga0496112_1762841 3300048915 Bacteria 531
861 Ga0496113_0066592 3300048916 Bacteria 2728
862 Ga0496113_0122024 3300048916 Bacteria 2038
863 Ga0496113_0341336 3300048916 Bacteria 1201
864 Ga0496113_0386311 3300048916 Bacteria 1124
865 Ga0496114_0511171 3300048917 Bacteria 1062
866 Ga0496114_0613768 3300048917 Bacteria 958
867 Ga0496115_0087104 3300048918 Bacteria 2548
868 Ga0496115_0195462 3300048918 Bacteria 1671
869 Ga0496115_0689837 3300048918 Bacteria 804
870 Ga0496126_0147087 3300048929 Bacteria 2022
871 Ga0496126_0206748 3300048929 Bacteria 1654
872 Ga0496126_0594395 3300048929 Bacteria 873
873 Ga0501031_0498669 3300049568 Bacteria 785
874 Ga0501032_0067015 3300049569 Bacteria 2399
875 Ga0501032_0151997 3300049569 Bacteria 1522
876 Ga0501034_0005678 3300049571 Bacteria 13574
877 Ga0501036_0001066 3300049572 Bacteria 20756
878 Ga0501037_0155252 3300049573 Bacteria 1634
879 Ga0501037_0832568 3300049573 Bacteria 608
880 Ga0501038_0082635 3300049574 Bacteria 2705
881 Ga0501042_0039046 3300049578 Bacteria 3373
882 Ga0501043_0018519 3300049579 Bacteria 5463
883 Ga0501047_0014517 3300049581 Bacteria 7491
884 Ga0501047_0081462 3300049581 Bacteria 3111
885 Ga0501048_0013899 3300049582 Bacteria 5969
886 Ga0501070_0164318 3300049586 Bacteria 1829
887 Ga0501073_0870898 3300049589 Bacteria 620
888 Ga0501074_0027099 3300049590 Bacteria 4153
889 Ga0501074_0618995 3300049590 Bacteria 765
890 Ga0501225_0150698 3300049705 Bacteria 709
891 Ga0501080_0014313 3300049742 Bacteria 7305
892 Ga0501080_0327615 3300049742 Bacteria 1386
893 Ga0501044_0012884 3300049823 Bacteria 9051
894 nmdc:mga00v17_444185_c1 3300050491 Bacteria 842
895 nmdc:mga07m45_580018_c1 3300050496 Bacteria 648
896 nmdc:mga05p37_1073173_c1 3300050507 Bacteria 847
897 nmdc:mga05p37_1094655_c1 3300050507 Bacteria 835
898 nmdc:mga05p37_171513_c1 3300050507 Bacteria 2645
899 nmdc:mga05p37_2179272_c1 3300050507 Bacteria 516
900 nmdc:mga05p37_347156_c1 3300050507 Bacteria 1748
901 nmdc:mga05p37_377811_c1 3300050507 Bacteria 1661
902 nmdc:mga05p37_59237_c1 3300050507 Bacteria 4716
903 nmdc:mga05p37_72233_c1 3300050507 Bacteria 4246
904 nmdc:mga05p37_991603_c1 3300050507 Bacteria 894
905 nmdc:mga09592_321560_c1 3300050508 Bacteria 1340
906 nmdc:mga0qj67_190974_c1 3300050509 Bacteria 1664
907 nmdc:mga06r32_1047328_c1 3300050510 Bacteria 767
908 nmdc:mga06r32_1960483_c1 3300050510 Bacteria 520
909 nmdc:mga06r32_315107_c1 3300050510 Bacteria 1550
910 nmdc:mga06r32_40138_c1 3300050510 Bacteria 4442
911 nmdc:mga08y16_316874_c1 3300050511 Bacteria 1606
912 nmdc:mga0n895_11777_c1 3300050512 Bacteria 7820
913 nmdc:mga0n895_1339698_c1 3300050512 Bacteria 686
914 nmdc:mga0rr50_36491_c1 3300050513 Bacteria 3541
915 nmdc:mga0rr50_783886_c1 3300050513 Bacteria 813
916 nmdc:mga0rr50_9239_c1 3300050513 Bacteria 6187
917 nmdc:mga08x19_15715_c1 3300050514 Bacteria 4605
918 nmdc:mga0a205_698137_c1 3300050515 Bacteria 864
919 nmdc:mga0a205_758538_c1 3300050515 Bacteria 819
920 Ga0495612_0154639 3300053078 Bacteria 999
921 Ga0495655_0251852 3300053083 Bacteria 594
922 Ga0495595_0001405 3300053084 Bacteria 9355
923 Ga0495595_0022666 3300053084 Bacteria 2758
924 Ga0495619_0197350 3300053085 Bacteria 1393
925 Ga0495619_0331317 3300053085 Bacteria 1054
926 Ga0495619_0355921 3300053085 Bacteria 1012
927 Ga0495619_0376893 3300053085 Bacteria 981
928 Ga0495619_0432966 3300053085 Bacteria 907
929 Ga0500646_0000593 3300053090 Bacteria 10416
930 Ga0500583_0081794 3300053092 Bacteria 1561
931 Ga0500641_0021612 3300053096 Bacteria 2456
932 Ga0500641_0069807 3300053096 Bacteria 1477
933 Ga0500654_125727 3300053099 Bacteria 990
934 Ga0500660_198084 3300053100 Bacteria 696
935 Ga0500577_0338815 3300053142 Bacteria 657
936 Ga0500579_074305 3300053143 Bacteria 1942
937 Ga0500588_0038157 3300053146 Bacteria 1431
938 Ga0500600_0353849 3300053149 Bacteria 603
939 Ga0587070_152852 3300059491 Bacteria 580
940 Ga0587073_0133899 3300059492 Bacteria 683
941 Ga0587082_134431 3300059504 Bacteria 571
942 Ga0587083_0150883 3300059505 Bacteria 627
943 Ga0587106_127345 3300059605 Bacteria 546
944 Ga0587101_040138 3300059623 Bacteria 769
945 Ga0587101_074857 3300059623 Bacteria 631
946 Ga0587101_107839 3300059623 Bacteria 562
947 Ga0587122_032884 3300059628 Bacteria 617
948 Ga0587067_094086 3300059640 Bacteria 684
949 Ga0587069_112240 3300059642 Bacteria 569
950 Ga0587072_146546 3300059643 Bacteria 567
951 Ga0587076_087696 3300059645 Bacteria 675
952 Ga0587071_087682 3300060344 Bacteria 702
953 Ga0587111_0243129 3300060346 Bacteria 529
954 Ga0466962_0010972 3300061719 Bacteria 4360
955 Ga0530510_0661708 3300061734 Bacteria 795
956 Ga0530510_0838798 3300061734 Bacteria 702
957 2753267460 2751185782 Bacteria 11227053
958 2855672004 2855670206 Bacteria 7120389
959 2855678123 2855676851 Bacteria 7063653
960 2856747639 2856741275 Bacteria 8096094
961 2857291636 2857288857 Bacteria 7189066
962 2858849697 2858848962 Bacteria 6963058
963 2858886145 2858882152 Bacteria 7230291
964 2858889453 2858888857 Bacteria 7060307
965 2858898095 2858895516 Bacteria 7378898
966 2867302785 2867302475 Bacteria 7087181
967 2867314861 2867312974 Bacteria 7058875
968 2867316732 2867312974 Bacteria 7058875
969 2867321925 2867319477 Bacteria 7069771
970 2867322126 2867319477 Bacteria 7069771
971 2867512239 2867507094 Bacteria 6506033
972 2869052230 2869048445 Bacteria 6875584
973 2869065371 2869061728 Bacteria 7112407
974 2869069887 2869068681 Bacteria 7205615
975 2880492527 2880489317 Bacteria 7096270
976 2887484848 2887478801 Bacteria 8972725
977 2891566069 2891562705 Bacteria 8039471
978 2929228337 2929226422 Bacteria 7248583
979 8001782218 8001781756 Bacteria 9586736
980 8003831358 8003830390 Bacteria 6541657
981 8003863243 8003856774 Bacteria 7675274
982 8054710460 8054704163 Bacteria 7247792
983 8054728379 8054727385 Bacteria 7558670
984 8054738601 8054734606 Bacteria 6947278
985 Ga0495629_0242858
986 JGI24740J21852_10095534
987 JGI24739J22299_10246418
988 JGI24034J26672_10100481
989 JGI25406J46586_10118020
990 JGI25404J52841_10055524
991 JGI25404J52841_10091508
992 Ga0058859_11820616
993 Ga0058863_10036897
994 Ga0058861_11876488
995 Ga0058861_12020820
996 Ga0058860_12150652
997 Ga0058862_10018238
998 Ga0058862_10095433
999 Ga0070658_10002809
1000 Ga0070658_10090810
1001 Ga0070658_10815776
1002 Ga0070683_100564453
1003 Ga0070683_100896386
1004 Ga0070683_101057001
1005 Ga0070670_100426773
1006 Ga0070670_100909930
1007 Ga0070666_10007271
1008 Ga0070680_100528082
1009 Ga0070680_100601343
1010 Ga0070682_100226671
1011 Ga0070682_100552065
1012 Ga0070682_100858159
1013 Ga0070682_101194187
1014 Ga0070660_100180596
1015 Ga0070660_100218869
1016 Ga0070689_100130370
1017 Ga0070691_10549264
1018 Ga0070661_100044193
1019 Ga0070661_100078363
1020 Ga0070661_100636516
1021 Ga0070661_101108623
1022 Ga0070692_10051650
1023 Ga0070668_100008173
1024 Ga0070668_100033438
1025 Ga0070668_100241440
1026 Ga0070675_100655065
1027 Ga0070671_100252094
1028 Ga0070671_100558062
1029 Ga0070671_100568077
1030 Ga0070688_100180778
1031 Ga0070659_100037634
1032 Ga0070667_100087343
1033 Ga0070667_100185405
1034 Ga0070667_100369800
1035 Ga0070709_10034833
1036 Ga0070709_10147201
1037 Ga0070709_10248843
1038 Ga0070709_10761140
1039 Ga0070714_100000753
1040 Ga0070714_100008171
1041 Ga0070714_100017153
1042 Ga0070714_100067024
1043 Ga0070714_100558441
1044 Ga0070714_100586640
1045 Ga0070713_100044135
1046 Ga0070713_100191400
1047 Ga0070713_100652198
1048 Ga0070713_100786403
1049 Ga0070713_101184371
1050 Ga0070713_101255665
1051 Ga0070713_102065715
1052 Ga0070710_10129766
1053 Ga0070710_10613715
1054 Ga0070710_10620803
1055 Ga0070710_10707653
1056 Ga0070711_100028645
1057 Ga0070711_100133748
1058 Ga0070711_100258732
1059 Ga0070711_100612060
1060 Ga0070711_100894559
1061 Ga0070711_101708129
1062 Ga0070705_100832150
1063 Ga0070705_101223244
1064 Ga0070700_100320578
1065 Ga0070694_100407694
1066 Ga0070663_100014425
1067 Ga0070663_100024443
1068 Ga0070663_101012715
1069 Ga0070678_100334708
1070 Ga0070678_100395146
1071 Ga0070678_100605162
1072 Ga0070662_100143834
1073 Ga0070681_10162855
1074 Ga0070681_10419746
1075 Ga0070681_10451585
1076 Ga0070681_10517477
1077 Ga0070681_11297241
1078 Ga0070706_100066339
1079 Ga0070706_100121380
1080 Ga0070707_100076694
1081 Ga0070707_100085908
1082 Ga0070707_100275834
1083 Ga0070698_100005079
1084 Ga0070698_100087099
1085 Ga0070698_100740993
1086 Ga0070698_101064854
1087 Ga0070699_100976339
1088 Ga0070699_101051772
1089 Ga0070679_100047394
1090 Ga0070679_100052945
1091 Ga0070679_100172479
1092 Ga0070679_100434645
1093 Ga0070679_101301257
1094 Ga0070684_100184680
1095 Ga0070684_100246432
1096 Ga0070684_100323587
1097 Ga0070684_100550520
1098 Ga0070684_100662553
1099 Ga0070697_101728792
1100 Ga0070697_101873390
1101 Ga0068853_100567015
1102 Ga0070686_100018630
1103 Ga0070696_100082410
1104 Ga0070696_101847818
1105 Ga0070665_100518403
1106 Ga0070665_100813066
1107 Ga0068855_100643143
1108 Ga0070664_100044889
1109 Ga0070664_100356882
1110 Ga0068857_100050339
1111 Ga0068857_100102046
1112 Ga0068857_100889640
1113 Ga0068857_100936935
1114 Ga0068857_101757970
1115 Ga0068854_100068940
1116 Ga0068854_100937952
1117 Ga0068856_100313462
1118 Ga0068856_100673899
1119 Ga0068856_100730096
1120 Ga0068856_100953678
1121 Ga0068852_101108801
1122 Ga0068852_101406450
1123 Ga0068852_101520825
1124 Ga0068864_100014862
1125 Ga0068864_100048803
1126 Ga0068864_101489333
1127 Ga0068866_10971195
1128 Ga0068861_100579844
1129 Ga0068861_100611453
1130 Ga0068851_10245611
1131 Ga0068851_10415622
1132 Ga0068870_10323452
1133 Ga0068863_100112067
1134 Ga0068863_100180153
1135 Ga0068863_100521399
1136 Ga0068858_100068410
1137 Ga0068858_100985802
1138 Ga0068860_100264090
1139 Ga0068860_100747225
1140 Ga0068862_100058307
1141 Ga0068862_100302063
1142 Ga0081455_10127209
1143 Ga0081455_10350544
1144 Ga0081540_1000607
1145 Ga0081540_1006932
1146 Ga0081540_1007264
1147 Ga0081540_1011440
1148 Ga0081540_1090579
1149 Ga0081540_1187352
1150 Ga0081540_1248110
1151 Ga0081539_10000367
1152 Ga0081539_10004494
1153 Ga0081539_10004919
1154 Ga0081539_10011051
1155 Ga0070717_10103636
1156 Ga0070717_10160733
1157 Ga0070717_10164931
1158 Ga0070717_10796549
1159 Ga0070717_11343370
1160 Ga0075365_10040154
1161 Ga0075364_10413538
1162 Ga0075432_10230818
1163 Ga0070715_10084966
1164 Ga0070715_10105393
1165 Ga0070715_10123664
1166 Ga0070715_10201849
1167 Ga0070716_100002471
1168 Ga0070716_100043547
1169 Ga0070716_100062145
1170 Ga0070716_100252866
1171 Ga0070716_100539372
1172 Ga0070712_100083106
1173 Ga0070712_100301821
1174 Ga0070712_100357028
1175 Ga0070712_101017488
1176 Ga0070712_101284837
1177 Ga0070712_101759587
1178 Ga0075367_10180800
1179 Ga0097621_100691399
1180 Ga0068871_101285604
1181 Ga0075428_100065541
1182 Ga0075428_100284917
1183 Ga0075428_100507992
1184 Ga0075428_100567630
1185 Ga0075431_100040901
1186 Ga0075431_100216866
1187 Ga0075431_100301099
1188 Ga0075431_100409743
1189 Ga0075431_100871578
1190 Ga0075433_10005443
1191 Ga0075433_10260593
1192 Ga0075434_100051405
1193 Ga0075434_100453657
1194 Ga0075434_100582083
1195 Ga0075434_100791751
1196 Ga0075429_100371752
1197 Ga0068865_100023726
1198 Ga0075436_100025943
1199 Ga0075436_100383482
1200 Ga0075435_100707242
1201 Ga0105251_10071437
1202 Ga0105251_10155197
1203 Ga0105244_10295526
1204 Ga0105250_10037099
1205 Ga0105240_10291918
1206 Ga0105240_10765289
1207 Ga0111539_10482804
1208 Ga0105245_10168892
1209 Ga0105245_10516459
1210 Ga0105245_10765479
1211 Ga0105247_10316782
1212 Ga0105247_10549544
1213 Ga0114129_10108046
1214 Ga0114129_10193989
1215 Ga0114129_10303555
1216 Ga0114129_10376770
1217 Ga0114129_13400088
1218 Ga0105243_11243506
1219 Ga0105243_11355323
1220 Ga0105243_11780974
1221 Ga0105241_10883017
1222 Ga0105242_10428936
1223 Ga0105242_11571396
1224 Ga0105242_13034902
1225 Ga0105248_10049688
1226 Ga0105248_10526018
1227 Ga0105248_11358877
1228 Ga0105239_10099887
1229 Ga0105239_10422685
1230 Ga0105239_10527787
1231 Ga0157340_1007745
1232 Ga0157337_1027361
1233 Ga0157323_1003421
1234 Ga0157339_1057686
1235 Ga0157371_10058304
1236 Ga0157371_10172674
1237 Ga0157369_10008899
1238 Ga0157369_10021008
1239 Ga0157369_10022064
1240 Ga0157369_11456328
1241 Ga0157374_10842653
1242 Ga0163162_10047239
1243 Ga0163162_10402358
1244 Ga0163162_11032191
1245 Ga0163162_11131053
1246 Ga0157372_10172952
1247 Ga0157372_10269641
1248 Ga0157372_10855343
1249 Ga0157372_11130575
1250 Ga0157375_10013964
1251 Ga0157375_10188673
1252 Ga0157375_10338188
1253 Ga0157375_10688432
1254 Ga0163163_10053614
1255 Ga0163163_10123189
1256 Ga0163163_10525975
1257 Ga0163163_10883459
1258 Ga0157380_10076143
1259 Ga0182008_10092340
1260 Ga0157377_10022617
1261 Ga0157379_10107226
1262 Ga0157379_10614617
1263 Ga0157376_11045231
1264 Ga0182005_1151693
1265 Ga0163161_10346937
1266 Ga0184594_126852
1267 Ga0197907_10194637
1268 Ga0197907_10765725
1269 Ga0197907_11163380
1270 Ga0197907_11282396
1271 Ga0206356_11216319
1272 Ga0206356_11275235
1273 Ga0206356_11308114
1274 Ga0206349_1229811
1275 Ga0206349_1400002
1276 Ga0206349_1568890
1277 Ga0206355_1481324
1278 Ga0206355_1661015
1279 Ga0206351_10471509
1280 Ga0206351_10629504
1281 Ga0206352_10306540
1282 Ga0206352_10876827
1283 Ga0206352_11293270
1284 Ga0206350_10176573
1285 Ga0206350_10229569
1286 Ga0206350_10689443
1287 Ga0206350_11074900
1288 Ga0206350_11609588
1289 Ga0206354_10064564
1290 Ga0206354_10391073
1291 Ga0206354_11549948
1292 Ga0206353_10851551
1293 Ga0206353_11229849
1294 Ga0206353_11327800
1295 Ga0154015_1265672
1296 Ga0154015_1563874
1297 Ga0213874_10048215
1298 Ga0213876_10000552
1299 Ga0213875_10001581
1300 Ga0224712_10003059
1301 Ga0224712_10011091
1302 Ga0224712_10095488
1303 Ga0224712_10204536
1304 Ga0224712_10213198
1305 Ga0224712_10313819
1306 Ga0224712_10506093
1307 Ga0224712_10649205
1308 Ga0207656_10622745
1309 Ga0207692_10005854
1310 Ga0207692_10021609
1311 Ga0207692_10131224
1312 Ga0207710_10486349
1313 Ga0207680_10299896
1314 Ga0207647_10126140
1315 Ga0207685_10244282
1316 Ga0207685_10611323
1317 Ga0207699_10002617
1318 Ga0207699_10004556
1319 Ga0207699_10014348
1320 Ga0207699_10167591
1321 Ga0207699_10173758
1322 Ga0207699_10205630
1323 Ga0207643_10396507
1324 Ga0207705_10022712
1325 Ga0207705_10661768
1326 Ga0207684_10074214
1327 Ga0207684_10592394
1328 Ga0207654_10502077
1329 Ga0207707_10197330
1330 Ga0207671_10104410
1331 Ga0207693_10064332
1332 Ga0207693_10064916
1333 Ga0207693_10910147
1334 Ga0207693_10917682
1335 Ga0207693_10984149
1336 Ga0207663_10002762
1337 Ga0207663_10002815
1338 Ga0207663_10331530
1339 Ga0207663_10370087
1340 Ga0207663_10421812
1341 Ga0207660_10047885
1342 Ga0207660_10325024
1343 Ga0207660_10767296
1344 Ga0207660_10779106
1345 Ga0207662_10652212
1346 Ga0207657_10021306
1347 Ga0207657_10238203
1348 Ga0207649_10177331
1349 Ga0207652_10242328
1350 Ga0207652_10244642
1351 Ga0207652_10380956
1352 Ga0207652_10701356
1353 Ga0207646_10072295
1354 Ga0207646_10197155
1355 Ga0207646_10689784
1356 Ga0207681_10359844
1357 Ga0207694_11336145
1358 Ga0207650_10914644
1359 Ga0207687_10103645
1360 Ga0207687_10107691
1361 Ga0207687_11799135
1362 Ga0207700_10019183
1363 Ga0207700_10054441
1364 Ga0207700_10527843
1365 Ga0207700_10559670
1366 Ga0207700_10672628
1367 Ga0207700_10981029
1368 Ga0207664_10000609
1369 Ga0207664_10000754
1370 Ga0207664_10005800
1371 Ga0207664_10013300
1372 Ga0207664_10071485
1373 Ga0207664_10113090
1374 Ga0207664_10144549
1375 Ga0207664_10288141
1376 Ga0207664_11076556
1377 Ga0207664_11201490
1378 Ga0207664_11758380
1379 Ga0207644_11078306
1380 Ga0207690_10067049
1381 Ga0207690_10129153
1382 Ga0207690_11025439
1383 Ga0207706_11070777
1384 Ga0207686_10186143
1385 Ga0207665_10002957
1386 Ga0207665_10003780
1387 Ga0207665_10017977
1388 Ga0207665_10086975
1389 Ga0207665_10985737
1390 Ga0207711_10062502
1391 Ga0207711_10870110
1392 Ga0207711_10976259
1393 Ga0207711_11183351
1394 Ga0207661_10115196
1395 Ga0207661_10144822
1396 Ga0207661_10329575
1397 Ga0207661_10820705
1398 Ga0207661_12072932
1399 Ga0207679_10187178
1400 Ga0207679_10789724
1401 Ga0207679_11125916
1402 Ga0207667_10456156
1403 Ga0207668_10009004
1404 Ga0207668_10024098
1405 Ga0207640_10738495
1406 Ga0207640_11348802
1407 Ga0207658_10055142
1408 Ga0207658_10721796
1409 Ga0207677_10326452
1410 Ga0207677_10402885
1411 Ga0207677_11408329
1412 Ga0207703_10166155
1413 Ga0207703_10204638
1414 Ga0207678_10012834
1415 Ga0207678_10014366
1416 Ga0207678_10858502
1417 Ga0207702_10030884
1418 Ga0207702_10098854
1419 Ga0207702_10338725
1420 Ga0207702_11733908
1421 Ga0207641_10013004
1422 Ga0207641_10110957
1423 Ga0207641_10178100
1424 Ga0207641_10232316
1425 Ga0207676_10062278
1426 Ga0207676_10248755
1427 Ga0207676_11786009
1428 Ga0207674_10012377
1429 Ga0207674_10072418
1430 Ga0207674_10162070
1431 Ga0207674_10326170
1432 Ga0207674_10617135
1433 Ga0207675_100184724
1434 Ga0207675_100314455
1435 Ga0207683_10015971
1436 Ga0207683_10096786
1437 Ga0207683_10409692
1438 Ga0207698_10111400
1439 Ga0207698_10279255
1440 Ga0207698_10691197
1441 Ga0207698_11670937
1442 Ga0207428_10217676
1443 Ga0207428_10237935
1444 Ga0268266_10287483
1445 Ga0268266_10313310
1446 Ga0268266_10380354
1447 Ga0268266_10641698
1448 Ga0268266_11200851
1449 Ga0268265_10045861
1450 Ga0268265_10112804
1451 Ga0268265_10437030
1452 Ga0268264_10112282
1453 Ga0268264_10390341
1454 Ga0268264_10681248
1455 Ga0265337_1000047
1456 Ga0265326_10001418
1457 Ga0265319_1001012
1458 Ga0265334_10000196
1459 Ga0265318_10030188
1460 Ga0265323_10007189
1461 Ga0265322_10046531
1462 Ga0265336_10003247
1463 Ga0307515_10000065
1464 Ga0265338_10000315
1465 Ga0265338_10004007
1466 Ga0265324_10001017
1467 Ga0307512_10037074
1468 Ga0265767_116348
1469 Ga0265767_119098
1470 Ga0265766_1019937
1471 Ga0265777_112814
1472 Ga0265765_1040137
1473 Ga0265768_110707
1474 Ga0265332_10000555
1475 Ga0265320_10001096
1476 Ga0265325_10004303
1477 Ga0265340_10000227
1478 Ga0265339_10040123
1479 Ga0265316_10009276
1480 Ga0307513_10068018
1481 Ga0307513_10179558
1482 Ga0307509_10049017
1483 Ga0307509_10127111
1484 Ga0307408_100016145
1485 Ga0307408_100040618
1486 Ga0307408_100073547
1487 Ga0310117_123185
1488 Ga0265313_10040705
1489 Ga0310103_138803
1490 Ga0310103_140500
1491 Ga0307508_10000654
1492 Ga0307508_10090733
1493 Ga0307508_10225322
1494 Ga0307508_10237078
1495 Ga0307508_10681243
1496 Ga0310108_120659
1497 Ga0310115_125776
1498 Ga0310111_138010
1499 Ga0310101_124840
1500 Ga0316579_10006505
1501 Ga0265314_10004449
1502 Ga0265342_10000413
1503 Ga0316576_10040310
1504 Ga0316578_10010080
1505 Ga0316578_10107884
1506 Ga0307516_10001866
1507 Ga0307516_10004273
1508 Ga0307516_10042382
1509 Ga0307516_10172871
1510 Ga0307405_10228486
1511 Ga0307405_11104007
1512 Ga0316577_10007915
1513 Ga0316045_125342
1514 Ga0307413_10375949
1515 Ga0307413_11374518
1516 Ga0307410_10051690
1517 Ga0307410_10162451
1518 Ga0307410_11375079
1519 Ga0307410_11506944
1520 Ga0326468_10000007
1521 Ga0307406_10009183
1522 Ga0307406_10029598
1523 Ga0307406_10040842
1524 Ga0307406_10114874
1525 Ga0307406_10697601
1526 Ga0307406_11095428
1527 Ga0307407_10013293
1528 Ga0307407_10157597
1529 Ga0307407_11626462
1530 Ga0307412_10081909
1531 Ga0307412_10386700
1532 Ga0307412_10908420
1533 Ga0307409_100007834
1534 Ga0307409_100014580
1535 Ga0307409_100095946
1536 Ga0307409_100602917
1537 Ga0307409_100766213
1538 Ga0307409_101563880
1539 Ga0307409_102336611
1540 Ga0307416_100000153
1541 Ga0307416_100110990
1542 Ga0307416_100204144
1543 Ga0307416_100600756
1544 Ga0307416_101254732
1545 Ga0307414_11587295
1546 Ga0307411_11760899
1547 Ga0307415_100000016
1548 Ga0307415_100014325
1549 Ga0307415_100015415
1550 Ga0307415_100104857
1551 Ga0307415_100221541
1552 Ga0307415_100322131
1553 Ga0307415_100495974
1554 Ga0307415_100567308
1555 Ga0307415_102381778
1556 Ga0307415_102402908
1557 Ga0316583_10050026
1558 Ga0316585_10007045
1559 Ga0316580_10002770
1560 Ga0307507_10078450
1561 Ga0307507_10155305
1562 Ga0316592_1081285
1563 Ga0316214_1003005
1564 Ga0316214_1010118
1565 Ga0373930_0054146
1566 Ga0373930_0070418
1567 Ga0373958_0024134
1568 Ga0373938_0051347
1569 Ga0373938_0093903
1570 Ga0373938_0163848
1571 Ga0373928_0026565
1572 Ga0373928_0059459
1573 Ga0373934_0002313
1574 Ga0373934_0012780
1575 Ga0373940_0069912
1576 Ga0373949_0018066
1577 Ga0373951_0000058
1578 Ga0373951_0076130
1579 Ga0373952_0006985
1580 Ga0373952_0128694
1581 Ga0373923_0076659
1582 Ga0373932_0042822
1583 Ga0373932_0081842
1584 Ga0373936_0076071
1585 Ga0373941_0006048
1586 Ga0373941_0298258
1587 Ga0373953_0002141
1588 Ga0373953_0002719
1589 Ga0373953_0009856
1590 Ga0373954_0013578
1591 Ga0373954_0045720
1592 Ga0373954_0069882
1593 Ga0373956_0002214
1594 Ga0373956_0015881
1595 Ga0373956_0028371
1596 Ga0373956_0102192
1597 Ga0373957_0010168
1598 Ga0373957_0021416
1599 Ga0373957_0072794
1600 Ga0373960_0224231
1601 Ga0373943_0394578
1602 Ga0373943_0600104
1603 Ga0373946_0283612
1604 Ga0373955_0001688
1605 Ga0373955_0016336
1606 Ga0373955_0265192
1607 Ga0373942_0001457
1608 Ga0373942_0056274
1609 Ga0373961_0057536
1610 Ga0373962_0015104
1611 Ga0316574_0042391
1612 Ga0316574_0137141
1613 Ga0373924_0000850
1614 Ga0373924_0013089
1615 Ga0373924_0064082
1616 Ga0373931_0062088
1617 Ga0373931_0113884
1618 Ga0373931_0906833
1619 Ga0373935_0601357
1620 Ga0373927_0044884
1621 Ga0373933_0003558
1622 Ga0373933_0004461
1623 Ga0373933_0154314
1624 Ga0373933_0165272
1625 Ga0373933_0538786
1626 Ga0373947_0013352
1627 Ga0373947_0361151
1628 Ga0373947_0901942
1629 Ga0373947_1038671
1630 Ga0373937_0002840
1631 Ga0373937_0006712
1632 Ga0373937_0008793
1633 Ga0373937_1193256
1634 Ga0265778_047462
1635 Ga0265778_060909
1636 Ga0310112_048477
1637 Ga0372808_002007
1638 Ga0372808_023732
1639 Ga0310109_047700
1640 Ga0310110_046997
1641 Ga0316582_0002094
1642 Ga0316582_0086167
1643 Ga0316584_0103230
1644 Ga0373925_0000259
1645 Ga0395899_0013079
1646 Ga0395900_0004313
1647 Ga0395898_0013021
1648 Ga0436364_0148488
1649 Ga0436364_0393888
1650 Ga0436364_1328267
1651 Ga0395901_0004087
1652 Ga0242420_142503
1653 Ga0436365_0484881
1654 Ga0436365_1781586
1655 Ga0436361_0131965
1656 Ga0436361_0144445
1657 Ga0436361_0462313
1658 Ga0436363_0274219
1659 Ga0436363_1262988
1660 Ga0436362_0771186
1661 Ga0436362_0827173
1662 Ga0436362_1265637
1663 Ga0451793_0349235
1664 Ga0451845_0407979
1665 Ga0439448_0008690
1666 Ga0439449_0027379
1667 Ga0439451_091413
1668 Ga0439459_0058102
1669 Ga0439459_0243171
1670 Ga0466969_0003943
1671 Ga0466966_0017589
1672 Ga0466966_0294957
1673 Ga0466961_0016526
1674 Ga0466963_0212599
1675 Ga0466963_0365436
1676 Ga0466971_0001960
1677 Ga0466968_0725123
1678 Ga0466970_0077403
1679 Ga0466957_0021253
1680 Ga0466957_0363918
1681 Ga0466959_0002842
1682 Ga0466958_0010153
1683 Ga0466958_0150010
1684 Ga0466967_0313547
1685 Ga0495592_0003303
1686 Ga0495592_0091089
1687 Ga0495592_0118246
1688 Ga0495603_0065707
1689 Ga0495629_0027761
1690 Ga0495629_0343624
1691 Ga0495629_0402265
1692 Ga0495651_0005196
1693 Ga0495651_0006896
1694 Ga0495651_0030795
1695 Ga0495651_0098721
1696 Ga0495651_0799824
1697 Ga0495653_0058922
1698 Ga0495653_0088258
1699 Ga0495653_0145208
1700 Ga0495653_0831247
1701 Ga0495582_0093889
1702 Ga0495582_0177180
1703 Ga0495662_0039942
1704 Ga0495664_0011128
1705 Ga0495664_0636507
1706 Ga0495594_0003940
1707 Ga0495594_0153812
1708 Ga0495608_0006283
1709 Ga0495608_0014958
1710 Ga0495608_0052276
1711 Ga0495608_0062362
1712 Ga0495608_0906656
1713 Ga0495618_0063654
1714 Ga0495618_0197589
1715 Ga0495618_0223383
1716 Ga0495628_0007458
1717 Ga0495628_0091144
1718 Ga0495628_0360637
1719 Ga0495630_0025766
1720 Ga0495630_1170410
1721 Ga0495666_0287224
1722 Ga0495652_0007781
1723 Ga0495652_0012322
1724 Ga0495652_0040882
1725 Ga0495652_0077597
1726 Ga0495652_0292570
1727 Ga0495665_0045394
1728 Ga0495640_0033402
1729 Ga0495640_0935220
1730 Ga0495586_0069962
1731 Ga0495587_0002870
1732 Ga0495587_0031351
1733 Ga0495587_0162104
1734 Ga0495645_0045259
1735 Ga0495667_0002881
1736 Ga0495667_0012959
1737 Ga0495667_0043121
1738 Ga0495667_0364126
1739 Ga0495634_0018519
1740 Ga0495634_0063405
1741 Ga0495634_0372157
1742 Ga0495625_0000630
1743 Ga0495635_0023369
1744 Ga0495635_0039963
1745 Ga0495635_0706178
1746 Ga0495588_0012157
1747 Ga0495657_0005656
1748 Ga0495657_0043768
1749 Ga0495657_0546587
1750 Ga0495599_0002291
1751 Ga0495599_0041129
1752 Ga0495599_0048487
1753 Ga0495623_0002822
1754 Ga0495623_0128831
1755 Ga0495623_0242468
1756 Ga0495646_0051431
1757 Ga0495646_0107747
1758 Ga0495646_0207492
1759 Ga0495658_0024540
1760 Ga0495613_0022530
1761 Ga0495600_0039423
1762 Ga0495600_0046447
1763 Ga0495600_0326484
1764 Ga0495581_0004394
1765 Ga0495604_0005098
1766 Ga0495604_0027755
1767 Ga0495604_0044166
1768 Ga0495604_0079543
1769 Ga0495674_0053599
1770 Ga0495674_0497345
1771 Ga0495674_0765014
1772 Ga0495676_0007337
1773 Ga0495676_0454571
1774 Ga0495680_0002413
1775 Ga0495680_0008567
1776 Ga0495680_0036223
1777 Ga0495680_0089116
1778 Ga0495680_0203693
1779 Ga0495683_0032795
1780 Ga0495675_0002519
1781 Ga0495675_0083658
1782 Ga0495593_0352130
1783 Ga0495602_0009822
1784 Ga0495602_0173440
1785 Ga0495602_0225974
1786 Ga0495614_0003635
1787 Ga0495614_0628910
1788 Ga0495626_0000147
1789 Ga0496100_0064659
1790 Ga0496100_0461722
1791 Ga0496100_0730076
1792 Ga0496100_1272202
1793 Ga0496101_0036103
1794 Ga0496101_0881813
1795 Ga0496101_1576236
1796 Ga0496102_0376758
1797 Ga0496103_0027693
1798 Ga0496103_0029992
1799 Ga0496104_0034337
1800 Ga0496104_0066155
1801 Ga0496104_0113655
1802 Ga0496104_0317356
1803 Ga0496104_0545737
1804 Ga0496104_0750366
1805 Ga0496104_1691081
1806 Ga0496105_0046887
1807 Ga0496105_0051063
1808 Ga0496105_0073559
1809 Ga0496105_0083585
1810 Ga0496105_0524294
1811 Ga0496106_0071907
1812 Ga0496106_0570817
1813 Ga0496106_1113245
1814 Ga0496107_0354164
1815 Ga0496107_0648600
1816 Ga0496108_0000010
1817 Ga0496108_0033047
1818 Ga0496108_0524379
1819 Ga0496108_0595441
1820 Ga0496108_0773989
1821 Ga0496108_1194741
1822 Ga0496108_1320367
1823 Ga0496108_1796062
1824 Ga0496109_0005429
1825 Ga0496109_0029223
1826 Ga0496109_0317123
1827 Ga0496109_0762454
1828 Ga0496109_2072080
1829 Ga0496110_0003656
1830 Ga0496110_0023767
1831 Ga0496110_0058180
1832 Ga0496110_0068560
1833 Ga0496110_0769609
1834 Ga0496111_0019322
1835 Ga0496111_0025321
1836 Ga0496112_0005145
1837 Ga0496112_0058741
1838 Ga0496112_0063031
1839 Ga0496112_0129711
1840 Ga0496112_0138317
1841 Ga0496112_0194323
1842 Ga0496112_0276584
1843 Ga0496112_0953032
1844 Ga0496112_1762841
1845 Ga0496113_0066592
1846 Ga0496113_0122024
1847 Ga0496113_0341336
1848 Ga0496113_0386311
1849 Ga0496114_0511171
1850 Ga0496114_0613768
1851 Ga0496115_0087104
1852 Ga0496115_0195462
1853 Ga0496115_0689837
1854 Ga0496126_0147087
1855 Ga0496126_0206748
1856 Ga0496126_0594395
1857 Ga0501031_0498669
1858 Ga0501032_0067015
1859 Ga0501032_0151997
1860 Ga0501034_0005678
1861 Ga0501036_0001066
1862 Ga0501037_0155252
1863 Ga0501037_0832568
1864 Ga0501038_0082635
1865 Ga0501042_0039046
1866 Ga0501043_0018519
1867 Ga0501047_0014517
1868 Ga0501047_0081462
1869 Ga0501048_0013899
1870 Ga0501070_0164318
1871 Ga0501073_0870898
1872 Ga0501074_0027099
1873 Ga0501074_0618995
1874 Ga0501225_0150698
1875 Ga0501080_0014313
1876 Ga0501080_0327615
1877 Ga0501044_0012884
1878 nmdc:mga00v17_444185_c1
1879 nmdc:mga07m45_580018_c1
1880 nmdc:mga05p37_1073173_c1
1881 nmdc:mga05p37_1094655_c1
1882 nmdc:mga05p37_171513_c1
1883 nmdc:mga05p37_2179272_c1
1884 nmdc:mga05p37_347156_c1
1885 nmdc:mga05p37_377811_c1
1886 nmdc:mga05p37_59237_c1
1887 nmdc:mga05p37_72233_c1
1888 nmdc:mga05p37_991603_c1
1889 nmdc:mga09592_321560_c1
1890 nmdc:mga0qj67_190974_c1
1891 nmdc:mga06r32_1047328_c1
1892 nmdc:mga06r32_1960483_c1
1893 nmdc:mga06r32_315107_c1
1894 nmdc:mga06r32_40138_c1
1895 nmdc:mga08y16_316874_c1
1896 nmdc:mga0n895_11777_c1
1897 nmdc:mga0n895_1339698_c1
1898 nmdc:mga0rr50_36491_c1
1899 nmdc:mga0rr50_783886_c1
1900 nmdc:mga0rr50_9239_c1
1901 nmdc:mga08x19_15715_c1
1902 nmdc:mga0a205_698137_c1
1903 nmdc:mga0a205_758538_c1
1904 Ga0495612_0154639
1905 Ga0495655_0251852
1906 Ga0495595_0001405
1907 Ga0495595_0022666
1908 Ga0495619_0197350
1909 Ga0495619_0331317
1910 Ga0495619_0355921
1911 Ga0495619_0376893
1912 Ga0495619_0432966
1913 Ga0500646_0000593
1914 Ga0500583_0081794
1915 Ga0500641_0021612
1916 Ga0500641_0069807
1917 Ga0500654_125727
1918 Ga0500660_198084
1919 Ga0500577_0338815
1920 Ga0500579_074305
1921 Ga0500588_0038157
1922 Ga0500600_0353849
1923 Ga0587070_152852
1924 Ga0587073_0133899
1925 Ga0587082_134431
1926 Ga0587083_0150883
1927 Ga0587106_127345
1928 Ga0587101_040138
1929 Ga0587101_074857
1930 Ga0587101_107839
1931 Ga0587122_032884
1932 Ga0587067_094086
1933 Ga0587069_112240
1934 Ga0587072_146546
1935 Ga0587076_087696
1936 Ga0587071_087682
1937 Ga0587111_0243129
1938 Ga0466962_0010972
1939 Ga0530510_0661708
1940 Ga0530510_0838798
1941 2753267460
1942 2855672004
1943 2855678123
1944 2856747639
1945 2857291636
1946 2858849697
1947 2858886145
1948 2858889453
1949 2858898095
1950 2867302785
1951 2867314861
1952 2867316732
1953 2867321925
1954 2867322126
1955 2867512239
1956 2869052230
1957 2869065371
1958 2869069887
1959 2880492527
1960 2887484848
1961 2891566069
1962 2929228337
1963 8001782218
1964 8003831358
1965 8003863243
1966 8054710460
1967 8054728379
1968 8054738601

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09055

Sod_Ni

Nickel-containing superoxide dismutase

31

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ncq-assembly1.cif.gz_B-2 crystal structure of nisod h1a mutant 0.9836 24 133
1t6i-assembly1.cif.gz_A nickel superoxide dismutase (nisod) apo structure 0.9832 23 135
4ncq-assembly1.cif.gz_C-2 crystal structure of nisod h1a mutant 0.983 24 133
1t6q-assembly1.cif.gz_B-2 nickel superoxide dismutase (nisod) cn-treated apo structure 0.9784 22 135
1t6i-assembly1.cif.gz_A nickel superoxide dismutase (nisod) apo structure 0.9745 23 135
ID Description Score Start End Superfamily
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9852 23 133 1.20.120.400
1t6qA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9851 23 133 1.20.120.400
1t6iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9767 23 135 1.20.120.400
1t6iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9679 23 135 1.20.120.400
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9676 23 133 1.20.120.400
ID Description Score Start End GO Terms
AF-A0A6I2X3L6-F1-model_v4 Superoxide dismutase, Ni 1.003 59 133 GO:0004784
GO:0016151
AF-A0A6J6MP41-F1-model_v4 Unannotated protein 1.002 42 133 GO:0004784
GO:0016151
AF-A0A7K0WLI2-F1-model_v4 deleted 1 39 133
AF-A0A7K0YH35-F1-model_v4 deleted 0.9989 51 133
AF-A0A350RKC0-F1-model_v4 Superoxide dismutase, Ni 0.9895 38 130 GO:0004784
GO:0016151

Map