F487302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 978 | 380 | 977 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300026095|Ga0207676_10707429|Ga0207676_107074291 |
| Length | 192 |
| Sequence | MSNMNKTFAAIITGLVLTVSVGASEAKITGVHLCCQSCVKGVEKAGELKVTLVPEVDASVDADGVTLTPRKDMERAAAMWGLSRSLVNNLVVGVTAGFSSKLEIQGVGYRAAVQGKNLNLQLGFSHDVAYPIPASITITAEKPTMLTIAGIDKQLVGQVAAEIRGYRPPEPYKGKGVRYEGEYVRRKEGKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 218 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 251 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 374 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 376 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 377 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 1.23 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.4 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 91.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1001315 | 3300003214 | Bacteria | 14050 |
| 2 | JGI25153J46596_10000830 | 3300003215 | Bacteria | 18874 |
| 3 | rootH2_10048944 | 3300003320 | Bacteria | 1909 |
| 4 | Ga0058859_10022480 | 3300004798 | Bacteria | 1971 |
| 5 | Ga0058863_11970613 | 3300004799 | Bacteria | 1145 |
| 6 | Ga0058862_11940969 | 3300004803 | Bacteria | 1024 |
| 7 | Ga0070658_10045521 | 3300005327 | Bacteria | 3548 |
| 8 | Ga0070658_11372238 | 3300005327 | Bacteria | 613 |
| 9 | Ga0070676_10079075 | 3300005328 | Bacteria | 1990 |
| 10 | Ga0070676_10302467 | 3300005328 | Bacteria | 1085 |
| 11 | Ga0070683_100088671 | 3300005329 | Bacteria | 2902 |
| 12 | Ga0070683_100187211 | 3300005329 | Bacteria | 1965 |
| 13 | Ga0070690_100219016 | 3300005330 | Bacteria | 1333 |
| 14 | Ga0070690_100294104 | 3300005330 | Bacteria | 1162 |
| 15 | Ga0070690_100539086 | 3300005330 | Bacteria | 878 |
| 16 | Ga0068869_100070091 | 3300005334 | Bacteria | 2593 |
| 17 | Ga0068869_101415616 | 3300005334 | Bacteria | 616 |
| 18 | Ga0070666_10007106 | 3300005335 | Bacteria | 6904 |
| 19 | Ga0070666_10123583 | 3300005335 | Bacteria | 1795 |
| 20 | Ga0070680_100002998 | 3300005336 | Bacteria | 12534 |
| 21 | Ga0070680_100072787 | 3300005336 | Bacteria | 2825 |
| 22 | Ga0070680_100078879 | 3300005336 | Bacteria | 2713 |
| 23 | Ga0070680_100226414 | 3300005336 | Bacteria | 1579 |
| 24 | Ga0070680_100255022 | 3300005336 | Bacteria | 1484 |
| 25 | Ga0068868_100153898 | 3300005338 | Bacteria | 1895 |
| 26 | Ga0068868_100397645 | 3300005338 | Bacteria | 1188 |
| 27 | Ga0068868_101181538 | 3300005338 | Bacteria | 707 |
| 28 | Ga0070660_100018276 | 3300005339 | Bacteria | 5121 |
| 29 | Ga0070660_100069129 | 3300005339 | Bacteria | 2753 |
| 30 | Ga0070660_100089034 | 3300005339 | Bacteria | 2432 |
| 31 | Ga0070660_100108074 | 3300005339 | Bacteria | 2211 |
| 32 | Ga0070660_100174288 | 3300005339 | Bacteria | 1739 |
| 33 | Ga0070660_100477533 | 3300005339 | Bacteria | 1036 |
| 34 | Ga0070689_100415195 | 3300005340 | Bacteria | 1140 |
| 35 | Ga0070691_10000386 | 3300005341 | Bacteria | 16019 |
| 36 | Ga0070691_10149346 | 3300005341 | Bacteria | 1197 |
| 37 | Ga0070691_10155140 | 3300005341 | Bacteria | 1176 |
| 38 | Ga0070691_10222565 | 3300005341 | Bacteria | 1001 |
| 39 | Ga0070661_100005946 | 3300005344 | Bacteria | 8403 |
| 40 | Ga0070661_100843647 | 3300005344 | Bacteria | 754 |
| 41 | Ga0070675_101654718 | 3300005354 | Bacteria | 591 |
| 42 | Ga0070671_100262784 | 3300005355 | Bacteria | 1467 |
| 43 | Ga0070671_100563781 | 3300005355 | Bacteria | 983 |
| 44 | Ga0070674_100041872 | 3300005356 | Bacteria | 3107 |
| 45 | Ga0070688_100357639 | 3300005365 | Bacteria | 1071 |
| 46 | Ga0070659_100012925 | 3300005366 | Bacteria | 6204 |
| 47 | Ga0070659_100027373 | 3300005366 | Bacteria | 4393 |
| 48 | Ga0070667_100061525 | 3300005367 | Bacteria | 3179 |
| 49 | Ga0070667_100349423 | 3300005367 | Bacteria | 1338 |
| 50 | Ga0070709_10003511 | 3300005434 | Bacteria | 8423 |
| 51 | Ga0070709_10171867 | 3300005434 | Bacteria | 1515 |
| 52 | Ga0070714_100000676 | 3300005435 | Bacteria | 24155 |
| 53 | Ga0070714_100068815 | 3300005435 | Bacteria | 3056 |
| 54 | Ga0070714_100109782 | 3300005435 | Bacteria | 2441 |
| 55 | Ga0070714_100530839 | 3300005435 | Bacteria | 1125 |
| 56 | Ga0070714_101124907 | 3300005435 | Bacteria | 766 |
| 57 | Ga0070714_101188515 | 3300005435 | Unclassified | 744 |
| 58 | Ga0070713_100000012 | 3300005436 | Bacteria | 137708 |
| 59 | Ga0070713_100162144 | 3300005436 | Bacteria | 1997 |
| 60 | Ga0070713_100213904 | 3300005436 | Bacteria | 1746 |
| 61 | Ga0070713_100364268 | 3300005436 | Bacteria | 1344 |
| 62 | Ga0070710_10040281 | 3300005437 | Bacteria | 2575 |
| 63 | Ga0070710_10553255 | 3300005437 | Bacteria | 795 |
| 64 | Ga0070711_100240856 | 3300005439 | Bacteria | 1414 |
| 65 | Ga0070711_100351636 | 3300005439 | Bacteria | 1185 |
| 66 | Ga0070711_100570669 | 3300005439 | Bacteria | 941 |
| 67 | Ga0070694_100283260 | 3300005444 | Bacteria | 1264 |
| 68 | Ga0070694_100340525 | 3300005444 | Bacteria | 1159 |
| 69 | Ga0070663_100264255 | 3300005455 | Bacteria | 1366 |
| 70 | Ga0070678_100013560 | 3300005456 | Bacteria | 5116 |
| 71 | Ga0070678_100021125 | 3300005456 | Bacteria | 4286 |
| 72 | Ga0070678_100069504 | 3300005456 | Bacteria | 2629 |
| 73 | Ga0070678_100681426 | 3300005456 | Bacteria | 925 |
| 74 | Ga0070681_10000037 | 3300005458 | Bacteria | 96087 |
| 75 | Ga0070681_10034634 | 3300005458 | Bacteria | 5070 |
| 76 | Ga0070681_10048475 | 3300005458 | Bacteria | 4244 |
| 77 | Ga0070681_10160044 | 3300005458 | Bacteria | 2175 |
| 78 | Ga0070681_10179316 | 3300005458 | Bacteria | 2040 |
| 79 | Ga0070681_10237697 | 3300005458 | Bacteria | 1735 |
| 80 | Ga0068867_100100755 | 3300005459 | Bacteria | 2205 |
| 81 | Ga0068867_100540816 | 3300005459 | Bacteria | 1007 |
| 82 | Ga0070707_101144481 | 3300005468 | Bacteria | 744 |
| 83 | Ga0070699_100114998 | 3300005518 | Bacteria | 2364 |
| 84 | Ga0070699_100215896 | 3300005518 | Bacteria | 1708 |
| 85 | Ga0070679_100008411 | 3300005530 | Bacteria | 9712 |
| 86 | Ga0070679_100064794 | 3300005530 | Bacteria | 3642 |
| 87 | Ga0070679_100082939 | 3300005530 | Bacteria | 3195 |
| 88 | Ga0070679_100335688 | 3300005530 | Bacteria | 1460 |
| 89 | Ga0070684_100283884 | 3300005535 | Bacteria | 1517 |
| 90 | Ga0068853_100002020 | 3300005539 | Bacteria | 15004 |
| 91 | Ga0068853_100002660 | 3300005539 | Bacteria | 13466 |
| 92 | Ga0068853_100237414 | 3300005539 | Bacteria | 1670 |
| 93 | Ga0068853_100714452 | 3300005539 | Bacteria | 956 |
| 94 | Ga0068853_101136376 | 3300005539 | Bacteria | 754 |
| 95 | Ga0070686_100311002 | 3300005544 | Bacteria | 1172 |
| 96 | Ga0070695_100019206 | 3300005545 | Bacteria | 4159 |
| 97 | Ga0070696_101268626 | 3300005546 | Bacteria | 624 |
| 98 | Ga0070693_100381808 | 3300005547 | Bacteria | 972 |
| 99 | Ga0070665_100087868 | 3300005548 | Bacteria | 3114 |
| 100 | Ga0070665_100093536 | 3300005548 | Bacteria | 3011 |
| 101 | Ga0070665_100175548 | 3300005548 | Bacteria | 2143 |
| 102 | Ga0070665_100264776 | 3300005548 | Bacteria | 1720 |
| 103 | Ga0070665_100600604 | 3300005548 | Bacteria | 1113 |
| 104 | Ga0070704_100029374 | 3300005549 | Bacteria | 3670 |
| 105 | Ga0068855_100000385 | 3300005563 | Bacteria | 54304 |
| 106 | Ga0068855_100034625 | 3300005563 | Bacteria | 6019 |
| 107 | Ga0068855_100121416 | 3300005563 | Bacteria | 2990 |
| 108 | Ga0068855_100161413 | 3300005563 | Bacteria | 2543 |
| 109 | Ga0068855_100693807 | 3300005563 | Bacteria | 1090 |
| 110 | Ga0068855_100953360 | 3300005563 | Bacteria | 904 |
| 111 | Ga0068855_101722291 | 3300005563 | Bacteria | 639 |
| 112 | Ga0068857_100007896 | 3300005577 | Bacteria | 9178 |
| 113 | Ga0068857_100258522 | 3300005577 | Bacteria | 1598 |
| 114 | Ga0068857_100361571 | 3300005577 | Bacteria | 1345 |
| 115 | Ga0068857_100983381 | 3300005577 | Bacteria | 812 |
| 116 | Ga0068854_100347723 | 3300005578 | Bacteria | 1213 |
| 117 | Ga0068856_100001032 | 3300005614 | Bacteria | 29659 |
| 118 | Ga0068856_100021325 | 3300005614 | Bacteria | 6296 |
| 119 | Ga0068856_100155308 | 3300005614 | Bacteria | 2298 |
| 120 | Ga0068856_100478045 | 3300005614 | Bacteria | 1267 |
| 121 | Ga0068856_100685912 | 3300005614 | Bacteria | 1045 |
| 122 | Ga0070702_100299022 | 3300005615 | Bacteria | 1112 |
| 123 | Ga0068852_100063743 | 3300005616 | Bacteria | 3210 |
| 124 | Ga0068852_100142311 | 3300005616 | Bacteria | 2221 |
| 125 | Ga0068852_100187615 | 3300005616 | Bacteria | 1948 |
| 126 | Ga0068852_100289160 | 3300005616 | Bacteria | 1583 |
| 127 | Ga0068852_100393106 | 3300005616 | Bacteria | 1362 |
| 128 | Ga0068864_100440435 | 3300005618 | Bacteria | 1245 |
| 129 | Ga0068864_101611468 | 3300005618 | Bacteria | 653 |
| 130 | Ga0068866_10072414 | 3300005718 | Bacteria | 1826 |
| 131 | Ga0068866_10260834 | 3300005718 | Bacteria | 1065 |
| 132 | Ga0068863_100043883 | 3300005841 | Bacteria | 4244 |
| 133 | Ga0068863_101146006 | 3300005841 | Bacteria | 783 |
| 134 | Ga0068858_100049282 | 3300005842 | Bacteria | 3900 |
| 135 | Ga0068858_100477057 | 3300005842 | Bacteria | 1204 |
| 136 | Ga0068860_100950609 | 3300005843 | Bacteria | 876 |
| 137 | Ga0068860_101559447 | 3300005843 | Bacteria | 682 |
| 138 | Ga0068862_100100297 | 3300005844 | Bacteria | 2532 |
| 139 | Ga0081540_1008438 | 3300005983 | Bacteria | 7199 |
| 140 | Ga0075365_10000030 | 3300006038 | Bacteria | 56932 |
| 141 | Ga0075368_10095597 | 3300006042 | Bacteria | 1217 |
| 142 | Ga0075363_100001020 | 3300006048 | Bacteria | 10057 |
| 143 | Ga0075364_10000068 | 3300006051 | Bacteria | 39877 |
| 144 | Ga0075364_10024136 | 3300006051 | Bacteria | 3857 |
| 145 | Ga0070716_100211553 | 3300006173 | Bacteria | 1296 |
| 146 | Ga0070716_100564291 | 3300006173 | Bacteria | 851 |
| 147 | Ga0070712_100000902 | 3300006175 | Bacteria | 17764 |
| 148 | Ga0070712_100004052 | 3300006175 | Bacteria | 8996 |
| 149 | Ga0070712_100113045 | 3300006175 | Bacteria | 2030 |
| 150 | Ga0070712_100317927 | 3300006175 | Bacteria | 1265 |
| 151 | Ga0075367_10018355 | 3300006178 | Bacteria | 3858 |
| 152 | Ga0075369_10000030 | 3300006186 | Bacteria | 39211 |
| 153 | Ga0097621_100047344 | 3300006237 | Bacteria | 3484 |
| 154 | Ga0097621_100106219 | 3300006237 | Bacteria | 2368 |
| 155 | Ga0097621_100161557 | 3300006237 | Bacteria | 1926 |
| 156 | Ga0097621_100227174 | 3300006237 | Bacteria | 1629 |
| 157 | Ga0097621_100318759 | 3300006237 | Bacteria | 1376 |
| 158 | Ga0097621_100402268 | 3300006237 | Bacteria | 1226 |
| 159 | Ga0075370_10000042 | 3300006353 | Bacteria | 39566 |
| 160 | Ga0068871_100019627 | 3300006358 | Bacteria | 5165 |
| 161 | Ga0068871_100071528 | 3300006358 | Bacteria | 2853 |
| 162 | Ga0068871_100162546 | 3300006358 | Bacteria | 1910 |
| 163 | Ga0068871_100175438 | 3300006358 | Bacteria | 1840 |
| 164 | Ga0068871_100301487 | 3300006358 | Bacteria | 1407 |
| 165 | Ga0068871_100419656 | 3300006358 | Bacteria | 1194 |
| 166 | Ga0068871_100839602 | 3300006358 | Bacteria | 849 |
| 167 | Ga0075428_100000808 | 3300006844 | Bacteria | 32725 |
| 168 | Ga0075430_100194948 | 3300006846 | Bacteria | 1683 |
| 169 | Ga0075431_100116845 | 3300006847 | Bacteria | 2753 |
| 170 | Ga0075431_101399219 | 3300006847 | Bacteria | 659 |
| 171 | Ga0075433_10105346 | 3300006852 | Bacteria | 2499 |
| 172 | Ga0075434_100176261 | 3300006871 | Bacteria | 2158 |
| 173 | Ga0075434_100262322 | 3300006871 | Bacteria | 1747 |
| 174 | Ga0075434_100441455 | 3300006871 | Bacteria | 1323 |
| 175 | Ga0075429_100028322 | 3300006880 | Bacteria | 4864 |
| 176 | Ga0075429_100043701 | 3300006880 | Bacteria | 3899 |
| 177 | Ga0068865_100002505 | 3300006881 | Bacteria | 10873 |
| 178 | Ga0075436_100000458 | 3300006914 | Bacteria | 26344 |
| 179 | Ga0075436_100000862 | 3300006914 | Bacteria | 20155 |
| 180 | Ga0075436_100002564 | 3300006914 | Bacteria | 12509 |
| 181 | Ga0075436_100029529 | 3300006914 | Bacteria | 3771 |
| 182 | Ga0075435_100006049 | 3300007076 | Bacteria | 8522 |
| 183 | Ga0075435_100018960 | 3300007076 | Bacteria | 5244 |
| 184 | Ga0075435_100609814 | 3300007076 | Bacteria | 947 |
| 185 | Ga0105250_10440537 | 3300009092 | Bacteria | 583 |
| 186 | Ga0105240_10004232 | 3300009093 | Bacteria | 21946 |
| 187 | Ga0105240_10004696 | 3300009093 | Bacteria | 20647 |
| 188 | Ga0105240_10017473 | 3300009093 | Bacteria | 9666 |
| 189 | Ga0105240_10025381 | 3300009093 | Bacteria | 7788 |
| 190 | Ga0105240_10150688 | 3300009093 | Bacteria | 2770 |
| 191 | Ga0105240_10252800 | 3300009093 | Bacteria | 2037 |
| 192 | Ga0105240_10571025 | 3300009093 | Bacteria | 1249 |
| 193 | Ga0105240_10675787 | 3300009093 | Bacteria | 1129 |
| 194 | Ga0105240_10722476 | 3300009093 | Bacteria | 1085 |
| 195 | Ga0105240_11279886 | 3300009093 | Bacteria | 774 |
| 196 | Ga0111539_10002099 | 3300009094 | Bacteria | 26631 |
| 197 | Ga0111539_10023579 | 3300009094 | Bacteria | 7562 |
| 198 | Ga0105245_10230243 | 3300009098 | Bacteria | 1792 |
| 199 | Ga0105245_10538363 | 3300009098 | Bacteria | 1188 |
| 200 | Ga0105247_10056711 | 3300009101 | Bacteria | 2420 |
| 201 | Ga0114129_10070335 | 3300009147 | Bacteria | 4880 |
| 202 | Ga0105243_10014172 | 3300009148 | Bacteria | 6032 |
| 203 | Ga0105243_10222994 | 3300009148 | Bacteria | 1668 |
| 204 | Ga0105241_10035275 | 3300009174 | Bacteria | 3762 |
| 205 | Ga0105241_10116852 | 3300009174 | Bacteria | 2143 |
| 206 | Ga0105241_10455114 | 3300009174 | Bacteria | 1133 |
| 207 | Ga0105241_10469421 | 3300009174 | Bacteria | 1116 |
| 208 | Ga0105241_10477193 | 3300009174 | Bacteria | 1108 |
| 209 | Ga0105241_10731521 | 3300009174 | Bacteria | 906 |
| 210 | Ga0105242_10123893 | 3300009176 | Bacteria | 2222 |
| 211 | Ga0105242_10848595 | 3300009176 | Bacteria | 909 |
| 212 | Ga0105242_10891180 | 3300009176 | Bacteria | 889 |
| 213 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 214 | Ga0105248_10047589 | 3300009177 | Bacteria | 4810 |
| 215 | Ga0105248_10063706 | 3300009177 | Bacteria | 4138 |
| 216 | Ga0105248_10408693 | 3300009177 | Bacteria | 1528 |
| 217 | Ga0105237_10003253 | 3300009545 | Bacteria | 19420 |
| 218 | Ga0105237_10181890 | 3300009545 | Bacteria | 2102 |
| 219 | Ga0105237_10627975 | 3300009545 | Bacteria | 1081 |
| 220 | Ga0105238_10001939 | 3300009551 | Bacteria | 20807 |
| 221 | Ga0105238_10017491 | 3300009551 | Bacteria | 7288 |
| 222 | Ga0105238_10055822 | 3300009551 | Bacteria | 3964 |
| 223 | Ga0105238_10130022 | 3300009551 | Bacteria | 2496 |
| 224 | Ga0105238_10179895 | 3300009551 | Bacteria | 2092 |
| 225 | Ga0105238_10426203 | 3300009551 | Bacteria | 1322 |
| 226 | Ga0105238_10826441 | 3300009551 | Bacteria | 943 |
| 227 | Ga0105249_10348653 | 3300009553 | Bacteria | 1499 |
| 228 | Ga0099796_10011720 | 3300010159 | Bacteria | 2455 |
| 229 | Ga0105239_10005584 | 3300010375 | Bacteria | 14708 |
| 230 | Ga0105239_10073553 | 3300010375 | Bacteria | 3757 |
| 231 | Ga0105239_10077915 | 3300010375 | Bacteria | 3647 |
| 232 | Ga0105239_10210784 | 3300010375 | Bacteria | 2178 |
| 233 | Ga0105239_10243523 | 3300010375 | Bacteria | 2018 |
| 234 | Ga0105239_10259863 | 3300010375 | Bacteria | 1951 |
| 235 | Ga0105239_10377439 | 3300010375 | Bacteria | 1603 |
| 236 | Ga0105239_12206314 | 3300010375 | Bacteria | 640 |
| 237 | Ga0105246_10013218 | 3300011119 | Bacteria | 5169 |
| 238 | Ga0105246_10062954 | 3300011119 | Bacteria | 2586 |
| 239 | Ga0105246_10516333 | 3300011119 | Bacteria | 1017 |
| 240 | Ga0105246_10563413 | 3300011119 | Bacteria | 978 |
| 241 | Ga0157373_10000820 | 3300013100 | Bacteria | 24076 |
| 242 | Ga0157373_10567405 | 3300013100 | Bacteria | 824 |
| 243 | Ga0157371_10098586 | 3300013102 | Bacteria | 2072 |
| 244 | Ga0157371_10655232 | 3300013102 | Bacteria | 784 |
| 245 | Ga0157370_10003448 | 3300013104 | Bacteria | 18559 |
| 246 | Ga0157370_10008323 | 3300013104 | Bacteria | 11186 |
| 247 | Ga0157370_10035566 | 3300013104 | Bacteria | 4839 |
| 248 | Ga0157370_10083851 | 3300013104 | Bacteria | 2996 |
| 249 | Ga0157370_11614616 | 3300013104 | Bacteria | 582 |
| 250 | Ga0157369_10001535 | 3300013105 | Bacteria | 28280 |
| 251 | Ga0157369_10033188 | 3300013105 | Bacteria | 5675 |
| 252 | Ga0157369_10345530 | 3300013105 | Bacteria | 1546 |
| 253 | Ga0157369_10407520 | 3300013105 | Bacteria | 1410 |
| 254 | Ga0157369_11085912 | 3300013105 | Bacteria | 818 |
| 255 | Ga0157374_10377448 | 3300013296 | Bacteria | 1412 |
| 256 | Ga0157378_10115850 | 3300013297 | Bacteria | 2464 |
| 257 | Ga0157378_10232385 | 3300013297 | Bacteria | 1758 |
| 258 | Ga0157378_10424647 | 3300013297 | Bacteria | 1314 |
| 259 | Ga0157378_10549314 | 3300013297 | Bacteria | 1160 |
| 260 | Ga0157378_10885088 | 3300013297 | Bacteria | 923 |
| 261 | Ga0157378_10906097 | 3300013297 | Bacteria | 913 |
| 262 | Ga0163162_10250500 | 3300013306 | Bacteria | 1903 |
| 263 | Ga0163162_10446856 | 3300013306 | Bacteria | 1425 |
| 264 | Ga0163162_11179552 | 3300013306 | Bacteria | 869 |
| 265 | Ga0157372_10007016 | 3300013307 | Bacteria | 11997 |
| 266 | Ga0157372_10008268 | 3300013307 | Bacteria | 11062 |
| 267 | Ga0157372_10032489 | 3300013307 | Bacteria | 5724 |
| 268 | Ga0157372_10037651 | 3300013307 | Bacteria | 5337 |
| 269 | Ga0157372_10066383 | 3300013307 | Bacteria | 4053 |
| 270 | Ga0157372_10327295 | 3300013307 | Bacteria | 1784 |
| 271 | Ga0157375_10614872 | 3300013308 | Bacteria | 1245 |
| 272 | Ga0163163_10008003 | 3300014325 | Bacteria | 9355 |
| 273 | Ga0163163_10332968 | 3300014325 | Bacteria | 1573 |
| 274 | Ga0163163_10915513 | 3300014325 | Bacteria | 940 |
| 275 | Ga0157380_10294611 | 3300014326 | Bacteria | 1491 |
| 276 | Ga0157379_10007681 | 3300014968 | Bacteria | 9336 |
| 277 | Ga0157379_10010518 | 3300014968 | Bacteria | 8065 |
| 278 | Ga0157379_10019718 | 3300014968 | Bacteria | 5958 |
| 279 | Ga0157379_10052289 | 3300014968 | Bacteria | 3649 |
| 280 | Ga0157379_10232957 | 3300014968 | Bacteria | 1670 |
| 281 | Ga0157379_10428308 | 3300014968 | Bacteria | 1219 |
| 282 | Ga0157376_10147364 | 3300014969 | Bacteria | 2119 |
| 283 | Ga0157376_10291481 | 3300014969 | Bacteria | 1541 |
| 284 | Ga0157376_10517483 | 3300014969 | Bacteria | 1175 |
| 285 | Ga0163161_10646087 | 3300017792 | Bacteria | 876 |
| 286 | Ga0213874_10002785 | 3300021377 | Bacteria | 3804 |
| 287 | Ga0213874_10006777 | 3300021377 | Bacteria | 2724 |
| 288 | Ga0213876_10000421 | 3300021384 | Bacteria | 35344 |
| 289 | Ga0213876_10003189 | 3300021384 | Bacteria | 9433 |
| 290 | Ga0213876_10027585 | 3300021384 | Bacteria | 2996 |
| 291 | Ga0213876_10103540 | 3300021384 | Bacteria | 1509 |
| 292 | Ga0209563_105604 | 3300025230 | Bacteria | 2249 |
| 293 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 294 | Ga0209455_1020331 | 3300025272 | Bacteria | 1316 |
| 295 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 296 | Ga0209758_1152298 | 3300025297 | Bacteria | 585 |
| 297 | Ga0207642_10017630 | 3300025899 | Bacteria | 2721 |
| 298 | Ga0207680_10002564 | 3300025903 | Bacteria | 8470 |
| 299 | Ga0207680_10106453 | 3300025903 | Bacteria | 1811 |
| 300 | Ga0207699_10000164 | 3300025906 | Bacteria | 41177 |
| 301 | Ga0207699_10037734 | 3300025906 | Bacteria | 2764 |
| 302 | Ga0207645_10011392 | 3300025907 | Bacteria | 6075 |
| 303 | Ga0207645_10473091 | 3300025907 | Bacteria | 847 |
| 304 | Ga0207643_10030805 | 3300025908 | Bacteria | 2989 |
| 305 | Ga0207643_10032595 | 3300025908 | Bacteria | 2911 |
| 306 | Ga0207705_10000180 | 3300025909 | Bacteria | 66404 |
| 307 | Ga0207705_10004720 | 3300025909 | Bacteria | 10265 |
| 308 | Ga0207705_10194396 | 3300025909 | Bacteria | 1535 |
| 309 | Ga0207705_10311673 | 3300025909 | Bacteria | 1208 |
| 310 | Ga0207684_10294542 | 3300025910 | Bacteria | 1399 |
| 311 | Ga0207654_10033200 | 3300025911 | Bacteria | 2859 |
| 312 | Ga0207654_10063489 | 3300025911 | Bacteria | 2168 |
| 313 | Ga0207654_10164797 | 3300025911 | Bacteria | 1434 |
| 314 | Ga0207654_10428144 | 3300025911 | Bacteria | 925 |
| 315 | Ga0207654_10803875 | 3300025911 | Bacteria | 679 |
| 316 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 317 | Ga0207707_10002715 | 3300025912 | Bacteria | 15806 |
| 318 | Ga0207707_10048827 | 3300025912 | Bacteria | 3687 |
| 319 | Ga0207707_10124122 | 3300025912 | Bacteria | 2258 |
| 320 | Ga0207707_10267082 | 3300025912 | Bacteria | 1483 |
| 321 | Ga0207707_10563709 | 3300025912 | Bacteria | 967 |
| 322 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 323 | Ga0207695_10028316 | 3300025913 | Bacteria | 6218 |
| 324 | Ga0207695_10040352 | 3300025913 | Bacteria | 5007 |
| 325 | Ga0207695_10128661 | 3300025913 | Bacteria | 2492 |
| 326 | Ga0207695_10182399 | 3300025913 | Bacteria | 2020 |
| 327 | Ga0207695_10217861 | 3300025913 | Bacteria | 1817 |
| 328 | Ga0207695_10284139 | 3300025913 | Bacteria | 1548 |
| 329 | Ga0207695_10284558 | 3300025913 | Bacteria | 1546 |
| 330 | Ga0207695_10340402 | 3300025913 | Bacteria | 1388 |
| 331 | Ga0207695_10383850 | 3300025913 | Bacteria | 1290 |
| 332 | Ga0207671_10019547 | 3300025914 | Bacteria | 5178 |
| 333 | Ga0207671_10049879 | 3300025914 | Bacteria | 3099 |
| 334 | Ga0207671_10408901 | 3300025914 | Bacteria | 1079 |
| 335 | Ga0207671_10499698 | 3300025914 | Bacteria | 970 |
| 336 | Ga0207693_10001210 | 3300025915 | Bacteria | 23009 |
| 337 | Ga0207693_10001929 | 3300025915 | Bacteria | 18163 |
| 338 | Ga0207693_10054085 | 3300025915 | Bacteria | 3150 |
| 339 | Ga0207693_10055946 | 3300025915 | Bacteria | 3093 |
| 340 | Ga0207693_10266868 | 3300025915 | Bacteria | 1341 |
| 341 | Ga0207693_10375640 | 3300025915 | Bacteria | 1112 |
| 342 | Ga0207663_10015424 | 3300025916 | Bacteria | 4215 |
| 343 | Ga0207663_10172408 | 3300025916 | Bacteria | 1538 |
| 344 | Ga0207663_11098027 | 3300025916 | Bacteria | 639 |
| 345 | Ga0207660_10000110 | 3300025917 | Bacteria | 46792 |
| 346 | Ga0207660_10003537 | 3300025917 | Bacteria | 10180 |
| 347 | Ga0207660_10069892 | 3300025917 | Bacteria | 2551 |
| 348 | Ga0207660_10181434 | 3300025917 | Bacteria | 1635 |
| 349 | Ga0207657_10000241 | 3300025919 | Bacteria | 57958 |
| 350 | Ga0207657_10063406 | 3300025919 | Bacteria | 3160 |
| 351 | Ga0207657_10196503 | 3300025919 | Bacteria | 1625 |
| 352 | Ga0207657_10280758 | 3300025919 | Bacteria | 1322 |
| 353 | Ga0207657_10734228 | 3300025919 | Bacteria | 766 |
| 354 | Ga0207649_10000194 | 3300025920 | Bacteria | 50112 |
| 355 | Ga0207652_10000824 | 3300025921 | Bacteria | 29561 |
| 356 | Ga0207652_10007774 | 3300025921 | Bacteria | 8614 |
| 357 | Ga0207652_10108322 | 3300025921 | Bacteria | 2462 |
| 358 | Ga0207652_10115732 | 3300025921 | Bacteria | 2382 |
| 359 | Ga0207694_10000010 | 3300025924 | Bacteria | 439722 |
| 360 | Ga0207694_10025930 | 3300025924 | Bacteria | 4456 |
| 361 | Ga0207694_10026889 | 3300025924 | Bacteria | 4381 |
| 362 | Ga0207694_10221393 | 3300025924 | Bacteria | 1544 |
| 363 | Ga0207694_10810215 | 3300025924 | Bacteria | 791 |
| 364 | Ga0207694_10850182 | 3300025924 | Bacteria | 771 |
| 365 | Ga0207694_10864858 | 3300025924 | Bacteria | 764 |
| 366 | Ga0207694_10906379 | 3300025924 | Bacteria | 745 |
| 367 | Ga0207650_10171098 | 3300025925 | Bacteria | 1726 |
| 368 | Ga0207650_10536252 | 3300025925 | Bacteria | 980 |
| 369 | Ga0207659_10166081 | 3300025926 | Bacteria | 1737 |
| 370 | Ga0207687_10017844 | 3300025927 | Bacteria | 4682 |
| 371 | Ga0207687_10085895 | 3300025927 | Bacteria | 2284 |
| 372 | Ga0207687_10325007 | 3300025927 | Bacteria | 1246 |
| 373 | Ga0207687_10390587 | 3300025927 | Bacteria | 1142 |
| 374 | Ga0207700_10000295 | 3300025928 | Bacteria | 29631 |
| 375 | Ga0207700_10130882 | 3300025928 | Bacteria | 2048 |
| 376 | Ga0207664_10032838 | 3300025929 | Bacteria | 3982 |
| 377 | Ga0207664_10073108 | 3300025929 | Bacteria | 2766 |
| 378 | Ga0207664_10177988 | 3300025929 | Bacteria | 1825 |
| 379 | Ga0207664_10312818 | 3300025929 | Bacteria | 1384 |
| 380 | Ga0207664_10411486 | 3300025929 | Bacteria | 1204 |
| 381 | Ga0207644_10562368 | 3300025931 | Bacteria | 945 |
| 382 | Ga0207690_10346628 | 3300025932 | Bacteria | 1173 |
| 383 | Ga0207686_10073147 | 3300025934 | Bacteria | 2211 |
| 384 | Ga0207686_10163989 | 3300025934 | Bacteria | 1560 |
| 385 | Ga0207709_10125051 | 3300025935 | Bacteria | 1743 |
| 386 | Ga0207670_10845695 | 3300025936 | Bacteria | 764 |
| 387 | Ga0207669_10280567 | 3300025937 | Bacteria | 1256 |
| 388 | Ga0207704_10122838 | 3300025938 | Bacteria | 1781 |
| 389 | Ga0207665_10241385 | 3300025939 | Bacteria | 1331 |
| 390 | Ga0207665_10301672 | 3300025939 | Bacteria | 1197 |
| 391 | Ga0207691_10325382 | 3300025940 | Bacteria | 1318 |
| 392 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 393 | Ga0207711_10145656 | 3300025941 | Bacteria | 2134 |
| 394 | Ga0207689_10127211 | 3300025942 | Bacteria | 2096 |
| 395 | Ga0207689_10261962 | 3300025942 | Bacteria | 1430 |
| 396 | Ga0207661_10144696 | 3300025944 | Bacteria | 2049 |
| 397 | Ga0207661_10219381 | 3300025944 | Bacteria | 1680 |
| 398 | Ga0207661_10500695 | 3300025944 | Bacteria | 1110 |
| 399 | Ga0207679_10701601 | 3300025945 | Bacteria | 918 |
| 400 | Ga0207667_10000388 | 3300025949 | Bacteria | 59263 |
| 401 | Ga0207667_10031700 | 3300025949 | Bacteria | 5704 |
| 402 | Ga0207667_10542855 | 3300025949 | Bacteria | 1176 |
| 403 | Ga0207667_10582275 | 3300025949 | Bacteria | 1130 |
| 404 | Ga0207651_10169073 | 3300025960 | Bacteria | 1722 |
| 405 | Ga0207651_10727070 | 3300025960 | Bacteria | 876 |
| 406 | Ga0207712_11134703 | 3300025961 | Bacteria | 696 |
| 407 | Ga0207712_11399583 | 3300025961 | Bacteria | 626 |
| 408 | Ga0207668_10971586 | 3300025972 | Bacteria | 758 |
| 409 | Ga0207640_10040030 | 3300025981 | Bacteria | 2971 |
| 410 | Ga0207658_10058513 | 3300025986 | Bacteria | 2868 |
| 411 | Ga0207658_10134474 | 3300025986 | Bacteria | 1991 |
| 412 | Ga0207703_10027678 | 3300026035 | Bacteria | 4464 |
| 413 | Ga0207703_10064130 | 3300026035 | Bacteria | 3014 |
| 414 | Ga0207639_10000867 | 3300026041 | Bacteria | 20545 |
| 415 | Ga0207639_10059896 | 3300026041 | Bacteria | 2935 |
| 416 | Ga0207639_10979110 | 3300026041 | Bacteria | 792 |
| 417 | Ga0207639_11233052 | 3300026041 | Bacteria | 702 |
| 418 | Ga0207639_11280022 | 3300026041 | Bacteria | 688 |
| 419 | Ga0207678_10367816 | 3300026067 | Bacteria | 1242 |
| 420 | Ga0207702_10000315 | 3300026078 | Bacteria | 55383 |
| 421 | Ga0207702_10348694 | 3300026078 | Bacteria | 1416 |
| 422 | Ga0207702_10583836 | 3300026078 | Bacteria | 1095 |
| 423 | Ga0207702_10776759 | 3300026078 | Bacteria | 946 |
| 424 | Ga0207702_11758665 | 3300026078 | Bacteria | 612 |
| 425 | Ga0207641_10035109 | 3300026088 | Bacteria | 4175 |
| 426 | Ga0207648_10154508 | 3300026089 | Bacteria | 2025 |
| 427 | Ga0207648_10243653 | 3300026089 | Bacteria | 1601 |
| 428 | Ga0207676_10707429 | 3300026095 | Bacteria | 977 |
| 429 | Ga0207674_10001605 | 3300026116 | Bacteria | 29115 |
| 430 | Ga0207674_10192958 | 3300026116 | Bacteria | 1987 |
| 431 | Ga0207674_10291835 | 3300026116 | Bacteria | 1579 |
| 432 | Ga0207674_11105553 | 3300026116 | Bacteria | 762 |
| 433 | Ga0207675_100278079 | 3300026118 | Bacteria | 1626 |
| 434 | Ga0207683_10018489 | 3300026121 | Bacteria | 5947 |
| 435 | Ga0207683_10103171 | 3300026121 | Bacteria | 2547 |
| 436 | Ga0207683_10264595 | 3300026121 | Bacteria | 1570 |
| 437 | Ga0207683_10493868 | 3300026121 | Bacteria | 1130 |
| 438 | Ga0207683_11029523 | 3300026121 | Bacteria | 764 |
| 439 | Ga0207698_10042447 | 3300026142 | Bacteria | 3398 |
| 440 | Ga0207698_10086858 | 3300026142 | Bacteria | 2545 |
| 441 | Ga0207698_10144541 | 3300026142 | Bacteria | 2055 |
| 442 | Ga0209995_1003999 | 3300027471 | Bacteria | 2354 |
| 443 | Ga0209968_1004743 | 3300027526 | Bacteria | 2038 |
| 444 | Ga0209970_1056276 | 3300027614 | Bacteria | 717 |
| 445 | Ga0209971_1044728 | 3300027682 | Bacteria | 1067 |
| 446 | Ga0209813_10045800 | 3300027866 | Bacteria | 1348 |
| 447 | Ga0209813_10091394 | 3300027866 | Bacteria | 1022 |
| 448 | Ga0209974_10060510 | 3300027876 | Bacteria | 1282 |
| 449 | Ga0209974_10065728 | 3300027876 | Bacteria | 1232 |
| 450 | Ga0207428_10002412 | 3300027907 | Bacteria | 18661 |
| 451 | Ga0268266_10000557 | 3300028379 | Bacteria | 51935 |
| 452 | Ga0268266_10055515 | 3300028379 | Bacteria | 3405 |
| 453 | Ga0268266_10076582 | 3300028379 | Bacteria | 2907 |
| 454 | Ga0268266_10092509 | 3300028379 | Bacteria | 2653 |
| 455 | Ga0268266_10095842 | 3300028379 | Bacteria | 2606 |
| 456 | Ga0268266_11207351 | 3300028379 | Bacteria | 731 |
| 457 | Ga0268265_10295536 | 3300028380 | Bacteria | 1456 |
| 458 | Ga0268264_10561069 | 3300028381 | Bacteria | 1121 |
| 459 | Ga0268264_11168559 | 3300028381 | Bacteria | 779 |
| 460 | Ga0265337_1001102 | 3300028556 | Bacteria | 13866 |
| 461 | Ga0265334_10001106 | 3300028573 | Bacteria | 13201 |
| 462 | Ga0265334_10116749 | 3300028573 | Bacteria | 956 |
| 463 | Ga0265318_10000037 | 3300028577 | Bacteria | 138223 |
| 464 | Ga0265318_10004788 | 3300028577 | Bacteria | 6480 |
| 465 | Ga0265338_10000017 | 3300028800 | Bacteria | 344481 |
| 466 | Ga0265338_10002896 | 3300028800 | Bacteria | 24981 |
| 467 | Ga0265338_10005387 | 3300028800 | Bacteria | 16717 |
| 468 | Ga0265338_10017000 | 3300028800 | Bacteria | 7869 |
| 469 | Ga0265338_10038201 | 3300028800 | Bacteria | 4553 |
| 470 | Ga0265338_10073797 | 3300028800 | Bacteria | 2906 |
| 471 | Ga0265338_10106186 | 3300028800 | Bacteria | 2274 |
| 472 | Ga0265338_10165948 | 3300028800 | Bacteria | 1700 |
| 473 | Ga0265338_10203129 | 3300028800 | Bacteria | 1493 |
| 474 | Ga0265338_10647847 | 3300028800 | Bacteria | 732 |
| 475 | Ga0265324_10193448 | 3300029957 | Bacteria | 691 |
| 476 | Ga0265324_10208133 | 3300029957 | Bacteria | 664 |
| 477 | Ga0265330_10006774 | 3300031235 | Bacteria | 5647 |
| 478 | Ga0265332_10017915 | 3300031238 | Bacteria | 3122 |
| 479 | Ga0265332_10031083 | 3300031238 | Bacteria | 2330 |
| 480 | Ga0265332_10071412 | 3300031238 | Bacteria | 1478 |
| 481 | Ga0265332_10075392 | 3300031238 | Bacteria | 1434 |
| 482 | Ga0265332_10197011 | 3300031238 | Bacteria | 838 |
| 483 | Ga0265320_10002069 | 3300031240 | Bacteria | 14126 |
| 484 | Ga0265320_10057577 | 3300031240 | Bacteria | 1864 |
| 485 | Ga0265320_10375024 | 3300031240 | Bacteria | 628 |
| 486 | Ga0265325_10000014 | 3300031241 | Bacteria | 131579 |
| 487 | Ga0265325_10000782 | 3300031241 | Bacteria | 23019 |
| 488 | Ga0265325_10001732 | 3300031241 | Bacteria | 15146 |
| 489 | Ga0265325_10021041 | 3300031241 | Bacteria | 3590 |
| 490 | Ga0265325_10026992 | 3300031241 | Bacteria | 3107 |
| 491 | Ga0265325_10032967 | 3300031241 | Bacteria | 2763 |
| 492 | Ga0265325_10194349 | 3300031241 | Bacteria | 939 |
| 493 | Ga0265329_10025358 | 3300031242 | Bacteria | 1963 |
| 494 | Ga0265329_10046592 | 3300031242 | Bacteria | 1385 |
| 495 | Ga0265340_10001159 | 3300031247 | Bacteria | 15088 |
| 496 | Ga0265340_10002869 | 3300031247 | Bacteria | 9812 |
| 497 | Ga0265340_10007526 | 3300031247 | Bacteria | 5912 |
| 498 | Ga0265340_10038201 | 3300031247 | Bacteria | 2376 |
| 499 | Ga0265340_10042240 | 3300031247 | Bacteria | 2239 |
| 500 | Ga0265340_10088506 | 3300031247 | Bacteria | 1450 |
| 501 | Ga0265340_10092888 | 3300031247 | Bacteria | 1409 |
| 502 | Ga0265339_10000256 | 3300031249 | Bacteria | 42839 |
| 503 | Ga0265339_10004825 | 3300031249 | Bacteria | 9117 |
| 504 | Ga0265339_10007379 | 3300031249 | Bacteria | 7114 |
| 505 | Ga0265339_10342389 | 3300031249 | Bacteria | 706 |
| 506 | Ga0265339_10485136 | 3300031249 | Bacteria | 572 |
| 507 | Ga0265331_10000186 | 3300031250 | Bacteria | 76149 |
| 508 | Ga0265331_10003502 | 3300031250 | Bacteria | 10110 |
| 509 | Ga0265331_10013838 | 3300031250 | Bacteria | 4322 |
| 510 | Ga0265331_10021847 | 3300031250 | Bacteria | 3269 |
| 511 | Ga0265331_10022887 | 3300031250 | Bacteria | 3183 |
| 512 | Ga0265331_10030688 | 3300031250 | Bacteria | 2675 |
| 513 | Ga0265327_10000392 | 3300031251 | Bacteria | 82296 |
| 514 | Ga0265327_10009609 | 3300031251 | Bacteria | 6946 |
| 515 | Ga0265316_10021496 | 3300031344 | Bacteria | 5463 |
| 516 | Ga0265316_10025355 | 3300031344 | Bacteria | 4950 |
| 517 | Ga0265316_10026745 | 3300031344 | Bacteria | 4793 |
| 518 | Ga0265316_10044806 | 3300031344 | Bacteria | 3516 |
| 519 | Ga0265316_10086571 | 3300031344 | Bacteria | 2395 |
| 520 | Ga0265316_10096460 | 3300031344 | Bacteria | 2252 |
| 521 | Ga0265316_10148087 | 3300031344 | Bacteria | 1760 |
| 522 | Ga0265316_10257932 | 3300031344 | Bacteria | 1279 |
| 523 | Ga0265316_10284113 | 3300031344 | Bacteria | 1209 |
| 524 | Ga0265316_10377952 | 3300031344 | Bacteria | 1022 |
| 525 | Ga0307408_100051689 | 3300031548 | Bacteria | 2961 |
| 526 | Ga0265313_10000800 | 3300031595 | Bacteria | 31814 |
| 527 | Ga0265313_10006102 | 3300031595 | Bacteria | 8671 |
| 528 | Ga0265313_10012941 | 3300031595 | Bacteria | 5055 |
| 529 | Ga0265313_10016941 | 3300031595 | Bacteria | 4166 |
| 530 | Ga0265313_10019748 | 3300031595 | Bacteria | 3739 |
| 531 | Ga0265313_10025680 | 3300031595 | Bacteria | 3115 |
| 532 | Ga0265313_10076276 | 3300031595 | Bacteria | 1532 |
| 533 | Ga0265313_10089662 | 3300031595 | Bacteria | 1383 |
| 534 | Ga0265313_10100614 | 3300031595 | Bacteria | 1284 |
| 535 | Ga0265313_10207677 | 3300031595 | Bacteria | 812 |
| 536 | Ga0316575_10000986 | 3300031665 | Bacteria | 8786 |
| 537 | Ga0316575_10019455 | 3300031665 | Bacteria | 2597 |
| 538 | Ga0316579_10005295 | 3300031691 | Bacteria | 5195 |
| 539 | Ga0316579_10010128 | 3300031691 | Bacteria | 3978 |
| 540 | Ga0265314_10000963 | 3300031711 | Bacteria | 33816 |
| 541 | Ga0265314_10004460 | 3300031711 | Bacteria | 12990 |
| 542 | Ga0265314_10024805 | 3300031711 | Bacteria | 4537 |
| 543 | Ga0265314_10027129 | 3300031711 | Bacteria | 4292 |
| 544 | Ga0265314_10041547 | 3300031711 | Bacteria | 3289 |
| 545 | Ga0265314_10055387 | 3300031711 | Bacteria | 2738 |
| 546 | Ga0265314_10056619 | 3300031711 | Bacteria | 2697 |
| 547 | Ga0265314_10068911 | 3300031711 | Bacteria | 2376 |
| 548 | Ga0265314_10107669 | 3300031711 | Bacteria | 1778 |
| 549 | Ga0265314_10178064 | 3300031711 | Bacteria | 1277 |
| 550 | Ga0265314_10213503 | 3300031711 | Bacteria | 1131 |
| 551 | Ga0265342_10006333 | 3300031712 | Bacteria | 8824 |
| 552 | Ga0265342_10021698 | 3300031712 | Bacteria | 4095 |
| 553 | Ga0265342_10072247 | 3300031712 | Bacteria | 2009 |
| 554 | Ga0265342_10090627 | 3300031712 | Bacteria | 1753 |
| 555 | Ga0265342_10338731 | 3300031712 | Bacteria | 785 |
| 556 | Ga0265342_10344967 | 3300031712 | Bacteria | 776 |
| 557 | Ga0316576_10005834 | 3300031727 | Bacteria | 7592 |
| 558 | Ga0316578_10039175 | 3300031728 | Bacteria | 2736 |
| 559 | Ga0316578_10212536 | 3300031728 | Bacteria | 1163 |
| 560 | Ga0307516_10054857 | 3300031730 | Bacteria | 3893 |
| 561 | Ga0307516_10069198 | 3300031730 | Bacteria | 3396 |
| 562 | Ga0307516_10507566 | 3300031730 | Bacteria | 860 |
| 563 | Ga0307405_10008723 | 3300031731 | Bacteria | 5154 |
| 564 | Ga0316577_10032670 | 3300031733 | Bacteria | 2907 |
| 565 | Ga0316577_10043034 | 3300031733 | Bacteria | 2527 |
| 566 | Ga0307413_10061509 | 3300031824 | Bacteria | 2317 |
| 567 | Ga0307410_10138609 | 3300031852 | Bacteria | 1796 |
| 568 | Ga0307410_10183150 | 3300031852 | Bacteria | 1587 |
| 569 | Ga0307406_10072399 | 3300031901 | Bacteria | 2262 |
| 570 | Ga0307407_10102413 | 3300031903 | Bacteria | 1780 |
| 571 | Ga0307412_10046496 | 3300031911 | Bacteria | 2844 |
| 572 | Ga0307409_100030160 | 3300031995 | Bacteria | 3892 |
| 573 | Ga0307416_100005600 | 3300032002 | Bacteria | 7741 |
| 574 | Ga0307416_100212504 | 3300032002 | Bacteria | 1847 |
| 575 | Ga0307414_10939816 | 3300032004 | Bacteria | 794 |
| 576 | Ga0307411_10103293 | 3300032005 | Bacteria | 2021 |
| 577 | Ga0307411_11126293 | 3300032005 | Unclassified | 709 |
| 578 | Ga0307415_100095913 | 3300032126 | Bacteria | 2160 |
| 579 | Ga0316583_10000484 | 3300032133 | Bacteria | 11841 |
| 580 | Ga0316583_10018653 | 3300032133 | Bacteria | 2491 |
| 581 | Ga0316583_10069563 | 3300032133 | Bacteria | 1231 |
| 582 | Ga0316585_10002061 | 3300032137 | Bacteria | 5391 |
| 583 | Ga0316585_10058099 | 3300032137 | Bacteria | 1246 |
| 584 | Ga0316580_10020547 | 3300032139 | Bacteria | 2034 |
| 585 | Ga0316580_10021418 | 3300032139 | Bacteria | 1992 |
| 586 | Ga0316580_10025904 | 3300032139 | Bacteria | 1813 |
| 587 | Ga0316593_10000349 | 3300032168 | Bacteria | 8071 |
| 588 | Ga0316593_10001237 | 3300032168 | Bacteria | 5509 |
| 589 | Ga0316593_10054391 | 3300032168 | Bacteria | 1358 |
| 590 | Ga0316592_1007100 | 3300033524 | Bacteria | 2177 |
| 591 | Ga0316586_1000300 | 3300033527 | Bacteria | 4509 |
| 592 | Ga0316588_1046158 | 3300033528 | Bacteria | 1050 |
| 593 | Ga0316596_1000615 | 3300033541 | Bacteria | 6324 |
| 594 | Ga0373944_0067559 | 3300035089 | Bacteria | 1158 |
| 595 | Ga0373923_0032705 | 3300035111 | Bacteria | 2102 |
| 596 | Ga0373923_0098301 | 3300035111 | Bacteria | 1288 |
| 597 | Ga0373932_0201431 | 3300035112 | Bacteria | 708 |
| 598 | Ga0373936_0008097 | 3300035113 | Bacteria | 3952 |
| 599 | Ga0373939_0042238 | 3300035114 | Bacteria | 1378 |
| 600 | Ga0373939_0081663 | 3300035114 | Bacteria | 1074 |
| 601 | Ga0373945_0006653 | 3300035116 | Bacteria | 3735 |
| 602 | Ga0373945_0078958 | 3300035116 | Bacteria | 1258 |
| 603 | Ga0373953_0157382 | 3300035117 | Bacteria | 976 |
| 604 | Ga0373956_0029348 | 3300035119 | Bacteria | 2398 |
| 605 | Ga0373956_0248982 | 3300035119 | Bacteria | 845 |
| 606 | Ga0373943_0007235 | 3300035170 | Bacteria | 4980 |
| 607 | Ga0373943_0080948 | 3300035170 | Bacteria | 1665 |
| 608 | Ga0373955_0005106 | 3300035172 | Bacteria | 5866 |
| 609 | Ga0373955_0036549 | 3300035172 | Bacteria | 2607 |
| 610 | Ga0373955_0246502 | 3300035172 | Bacteria | 1071 |
| 611 | Ga0373942_0071250 | 3300035207 | Bacteria | 1015 |
| 612 | Ga0373961_0048959 | 3300035241 | Bacteria | 1247 |
| 613 | Ga0373961_0095359 | 3300035241 | Bacteria | 956 |
| 614 | Ga0316574_0001643 | 3300035398 | Bacteria | 10749 |
| 615 | Ga0316574_0008846 | 3300035398 | Bacteria | 5614 |
| 616 | Ga0316574_0038291 | 3300035398 | Bacteria | 2943 |
| 617 | Ga0316574_0203323 | 3300035398 | Bacteria | 1272 |
| 618 | Ga0316574_0389410 | 3300035398 | Bacteria | 878 |
| 619 | Ga0373931_0085845 | 3300035691 | Bacteria | 1745 |
| 620 | Ga0373931_0111163 | 3300035691 | Bacteria | 1555 |
| 621 | Ga0373931_0553263 | 3300035691 | Bacteria | 748 |
| 622 | Ga0373935_0003403 | 3300035692 | Bacteria | 9238 |
| 623 | Ga0373935_0084560 | 3300035692 | Bacteria | 2067 |
| 624 | Ga0373935_0133269 | 3300035692 | Bacteria | 1672 |
| 625 | Ga0373935_0934841 | 3300035692 | Bacteria | 643 |
| 626 | Ga0373927_0064151 | 3300035695 | Bacteria | 2376 |
| 627 | Ga0373927_0158783 | 3300035695 | Bacteria | 1481 |
| 628 | Ga0373927_0167531 | 3300035695 | Bacteria | 1440 |
| 629 | Ga0373933_0005271 | 3300035724 | Bacteria | 7048 |
| 630 | Ga0373933_0043309 | 3300035724 | Bacteria | 2663 |
| 631 | Ga0373933_0433396 | 3300035724 | Bacteria | 859 |
| 632 | Ga0373947_0011709 | 3300035725 | Bacteria | 5027 |
| 633 | Ga0373947_0407002 | 3300035725 | Bacteria | 918 |
| 634 | Ga0373937_0003527 | 3300036401 | Bacteria | 13164 |
| 635 | Ga0373937_0070199 | 3300036401 | Bacteria | 3231 |
| 636 | Ga0373937_0104200 | 3300036401 | Bacteria | 2635 |
| 637 | Ga0373937_0128743 | 3300036401 | Bacteria | 2363 |
| 638 | Ga0373937_0190143 | 3300036401 | Bacteria | 1929 |
| 639 | Ga0373937_0193416 | 3300036401 | Bacteria | 1912 |
| 640 | Ga0373937_0198482 | 3300036401 | Bacteria | 1886 |
| 641 | Ga0373937_0310051 | 3300036401 | Bacteria | 1492 |
| 642 | Ga0373937_0777101 | 3300036401 | Bacteria | 905 |
| 643 | Ga0316582_0012337 | 3300036647 | Bacteria | 4764 |
| 644 | Ga0316582_0056650 | 3300036647 | Bacteria | 2501 |
| 645 | Ga0316582_0243316 | 3300036647 | Bacteria | 1233 |
| 646 | Ga0316584_0001849 | 3300036712 | Bacteria | 13108 |
| 647 | Ga0373925_0002514 | 3300037068 | Bacteria | 14651 |
| 648 | Ga0373925_0133491 | 3300037068 | Bacteria | 1937 |
| 649 | Ga0373925_1342811 | 3300037068 | Bacteria | 586 |
| 650 | Ga0395899_0004948 | 3300037312 | Bacteria | 10369 |
| 651 | Ga0395899_0224824 | 3300037312 | Bacteria | 1299 |
| 652 | Ga0395900_0062599 | 3300037418 | Bacteria | 3824 |
| 653 | Ga0395900_0098142 | 3300037418 | Bacteria | 3010 |
| 654 | Ga0395900_0618268 | 3300037418 | Bacteria | 1022 |
| 655 | Ga0395898_0003055 | 3300037466 | Bacteria | 18965 |
| 656 | Ga0395898_0079037 | 3300037466 | Bacteria | 3173 |
| 657 | Ga0395898_0359028 | 3300037466 | Bacteria | 1389 |
| 658 | Ga0316581_0008237 | 3300037588 | Bacteria | 2829 |
| 659 | Ga0316581_0013780 | 3300037588 | Bacteria | 2296 |
| 660 | Ga0395901_0012391 | 3300038443 | Bacteria | 8650 |
| 661 | Ga0395901_0072035 | 3300038443 | Bacteria | 3601 |
| 662 | Ga0400488_12334 | 3300038741 | Bacteria | 4329 |
| 663 | Ga0400486_17540 | 3300038742 | Bacteria | 1091 |
| 664 | Ga0400487_00820 | 3300039110 | Bacteria | 3258 |
| 665 | Ga0436365_0480014 | 3300039437 | Bacteria | 887 |
| 666 | Ga0436365_0544722 | 3300039437 | Bacteria | 16758 |
| 667 | Ga0436365_0868084 | 3300039437 | Bacteria | 797 |
| 668 | Ga0436365_1215018 | 3300039437 | Bacteria | 3685 |
| 669 | Ga0436365_1239236 | 3300039437 | Bacteria | 18833 |
| 670 | Ga0436365_1351612 | 3300039437 | Bacteria | 842 |
| 671 | Ga0436365_1437117 | 3300039437 | Bacteria | 1434 |
| 672 | Ga0436365_1584141 | 3300039437 | Bacteria | 579 |
| 673 | Ga0436365_1637588 | 3300039437 | Bacteria | 49130 |
| 674 | Ga0436360_0360048 | 3300039438 | Bacteria | 2053 |
| 675 | Ga0436360_0449234 | 3300039438 | Bacteria | 1196 |
| 676 | Ga0436360_0716296 | 3300039438 | Bacteria | 2775 |
| 677 | Ga0436361_0767135 | 3300039447 | Bacteria | 1162 |
| 678 | Ga0436363_0427400 | 3300039450 | Bacteria | 3997 |
| 679 | Ga0436363_0896516 | 3300039450 | Bacteria | 1486 |
| 680 | Ga0436363_1041884 | 3300039450 | Bacteria | 652 |
| 681 | Ga0436363_1470856 | 3300039450 | Bacteria | 3937 |
| 682 | Ga0451793_0170406 | 3300041452 | Bacteria | 796 |
| 683 | Ga0451800_0024754 | 3300041459 | Bacteria | 869 |
| 684 | Ga0451802_1407499 | 3300041460 | Bacteria | 735 |
| 685 | Ga0439460_0224418 | 3300042461 | Unclassified | 645 |
| 686 | Ga0451577_0743919 | 3300042876 | Bacteria | 887 |
| 687 | Ga0453684_0000682 | 3300044712 | Bacteria | 121090 |
| 688 | Ga0466957_0637262 | 3300044842 | Bacteria | 748 |
| 689 | Ga0451576_0363162 | 3300045051 | Bacteria | 1516 |
| 690 | Ga0466967_0059567 | 3300045976 | Bacteria | 3380 |
| 691 | Ga0495592_0176228 | 3300046454 | Bacteria | 1460 |
| 692 | Ga0495592_0423576 | 3300046454 | Bacteria | 839 |
| 693 | Ga0495629_0083513 | 3300046459 | Bacteria | 2229 |
| 694 | Ga0495651_0186790 | 3300046462 | Bacteria | 1462 |
| 695 | Ga0495651_0385149 | 3300046462 | Bacteria | 919 |
| 696 | Ga0495580_0003736 | 3300046472 | Bacteria | 12895 |
| 697 | Ga0495580_0046288 | 3300046472 | Bacteria | 3087 |
| 698 | Ga0495582_0043074 | 3300046473 | Bacteria | 2486 |
| 699 | Ga0495582_0065981 | 3300046473 | Bacteria | 2000 |
| 700 | Ga0495662_0112098 | 3300046476 | Bacteria | 1337 |
| 701 | Ga0495664_0034829 | 3300046477 | Bacteria | 2963 |
| 702 | Ga0495664_0225171 | 3300046477 | Bacteria | 1135 |
| 703 | Ga0495664_0237404 | 3300046477 | Bacteria | 1103 |
| 704 | Ga0495585_0181428 | 3300046492 | Bacteria | 1082 |
| 705 | Ga0495606_0159747 | 3300046507 | Bacteria | 1316 |
| 706 | Ga0495628_0328258 | 3300046516 | Bacteria | 1128 |
| 707 | Ga0495631_0321349 | 3300046518 | Bacteria | 659 |
| 708 | Ga0495632_0278674 | 3300046519 | Bacteria | 745 |
| 709 | Ga0495652_0041688 | 3300046529 | Bacteria | 3961 |
| 710 | Ga0495654_0052557 | 3300046530 | Bacteria | 1983 |
| 711 | Ga0495665_0106424 | 3300046531 | Bacteria | 1472 |
| 712 | Ga0495587_0050256 | 3300046536 | Bacteria | 2467 |
| 713 | Ga0495587_0122784 | 3300046536 | Bacteria | 1487 |
| 714 | Ga0495621_0007305 | 3300046539 | Bacteria | 3267 |
| 715 | Ga0495645_0086993 | 3300046543 | Bacteria | 2236 |
| 716 | Ga0495645_0219231 | 3300046543 | Bacteria | 1280 |
| 717 | Ga0495622_0003379 | 3300046557 | Bacteria | 7527 |
| 718 | Ga0495622_0149869 | 3300046557 | Bacteria | 1056 |
| 719 | Ga0495633_0110090 | 3300046558 | Bacteria | 1277 |
| 720 | Ga0495656_0173839 | 3300046615 | Bacteria | 1055 |
| 721 | Ga0495625_0123475 | 3300046660 | Bacteria | 1760 |
| 722 | Ga0495661_0198281 | 3300046665 | Bacteria | 1053 |
| 723 | Ga0495657_0129487 | 3300046675 | Bacteria | 1582 |
| 724 | Ga0495599_0306982 | 3300046678 | Bacteria | 957 |
| 725 | Ga0495623_0165906 | 3300046679 | Bacteria | 1294 |
| 726 | Ga0495658_0001492 | 3300046683 | Bacteria | 12268 |
| 727 | Ga0495613_0442729 | 3300046689 | Bacteria | 881 |
| 728 | Ga0495624_0413944 | 3300046690 | Bacteria | 809 |
| 729 | Ga0495671_0298960 | 3300046692 | Bacteria | 774 |
| 730 | Ga0495649_0106764 | 3300046694 | Bacteria | 1486 |
| 731 | Ga0495649_0224280 | 3300046694 | Bacteria | 971 |
| 732 | Ga0495589_0093052 | 3300046794 | Bacteria | 1463 |
| 733 | Ga0495636_0324543 | 3300047318 | Bacteria | 723 |
| 734 | Ga0495674_0687412 | 3300047319 | Bacteria | 804 |
| 735 | Ga0495683_0134375 | 3300047323 | Bacteria | 1164 |
| 736 | Ga0495675_0062651 | 3300047444 | Bacteria | 2354 |
| 737 | Ga0495675_0256692 | 3300047444 | Bacteria | 1048 |
| 738 | Ga0495673_0177677 | 3300047469 | Bacteria | 808 |
| 739 | Ga0495681_0247614 | 3300047470 | Bacteria | 705 |
| 740 | Ga0495684_0119581 | 3300047471 | Bacteria | 1985 |
| 741 | Ga0495602_0035348 | 3300048088 | Bacteria | 4660 |
| 742 | Ga0495602_0175950 | 3300048088 | Bacteria | 1656 |
| 743 | Ga0495602_0308838 | 3300048088 | Bacteria | 1155 |
| 744 | Ga0495602_0563739 | 3300048088 | Bacteria | 788 |
| 745 | Ga0495615_0027787 | 3300048090 | Bacteria | 1331 |
| 746 | Ga0495626_0026549 | 3300048091 | Bacteria | 2822 |
| 747 | Ga0496100_0292146 | 3300048903 | Bacteria | 1218 |
| 748 | Ga0496104_0414671 | 3300048907 | Bacteria | 1259 |
| 749 | Ga0496107_0164931 | 3300048910 | Bacteria | 1642 |
| 750 | Ga0496112_0440330 | 3300048915 | Bacteria | 1241 |
| 751 | Ga0496115_0373355 | 3300048918 | Bacteria | 1161 |
| 752 | Ga0496121_0006108 | 3300048924 | Bacteria | 15150 |
| 753 | Ga0496126_0000480 | 3300048929 | Bacteria | 79257 |
| 754 | Ga0496126_0077598 | 3300048929 | Bacteria | 2945 |
| 755 | Ga0495682_0005207 | 3300049460 | Bacteria | 5432 |
| 756 | Ga0501313_009732 | 3300049529 | Bacteria | 1086 |
| 757 | Ga0501335_006385 | 3300049551 | Bacteria | 1073 |
| 758 | Ga0501031_0037261 | 3300049568 | Bacteria | 3173 |
| 759 | Ga0501031_0068962 | 3300049568 | Bacteria | 2303 |
| 760 | Ga0501031_0094198 | 3300049568 | Bacteria | 1954 |
| 761 | Ga0501031_0518639 | 3300049568 | Bacteria | 768 |
| 762 | Ga0501032_0001267 | 3300049569 | Bacteria | 20244 |
| 763 | Ga0501032_0004362 | 3300049569 | Bacteria | 10681 |
| 764 | Ga0501032_0019862 | 3300049569 | Bacteria | 4691 |
| 765 | Ga0501032_0020357 | 3300049569 | Bacteria | 4622 |
| 766 | Ga0501032_0030051 | 3300049569 | Bacteria | 3727 |
| 767 | Ga0501032_0178940 | 3300049569 | Bacteria | 1389 |
| 768 | Ga0501032_0201791 | 3300049569 | Bacteria | 1298 |
| 769 | Ga0501033_0005260 | 3300049570 | Bacteria | 10269 |
| 770 | Ga0501033_0012240 | 3300049570 | Bacteria | 6548 |
| 771 | Ga0501033_0012917 | 3300049570 | Bacteria | 6369 |
| 772 | Ga0501033_0036296 | 3300049570 | Bacteria | 3693 |
| 773 | Ga0501033_0175565 | 3300049570 | Bacteria | 1537 |
| 774 | Ga0501033_0180575 | 3300049570 | Bacteria | 1513 |
| 775 | Ga0501033_0245126 | 3300049570 | Bacteria | 1271 |
| 776 | Ga0501033_0322472 | 3300049570 | Bacteria | 1085 |
| 777 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 778 | Ga0501034_0010632 | 3300049571 | Bacteria | 9573 |
| 779 | Ga0501034_0011194 | 3300049571 | Bacteria | 9312 |
| 780 | Ga0501034_0027593 | 3300049571 | Bacteria | 5774 |
| 781 | Ga0501034_0076662 | 3300049571 | Bacteria | 3350 |
| 782 | Ga0501034_0076809 | 3300049571 | Bacteria | 3346 |
| 783 | Ga0501034_0091835 | 3300049571 | Bacteria | 3033 |
| 784 | Ga0501034_0133506 | 3300049571 | Bacteria | 2464 |
| 785 | Ga0501034_0171039 | 3300049571 | Bacteria | 2140 |
| 786 | Ga0501034_0251625 | 3300049571 | Bacteria | 1711 |
| 787 | Ga0501034_1082268 | 3300049571 | Bacteria | 683 |
| 788 | Ga0501036_0005653 | 3300049572 | Bacteria | 10145 |
| 789 | Ga0501036_0005682 | 3300049572 | Bacteria | 10117 |
| 790 | Ga0501036_0009536 | 3300049572 | Bacteria | 7983 |
| 791 | Ga0501037_0024753 | 3300049573 | Bacteria | 4438 |
| 792 | Ga0501037_0039814 | 3300049573 | Bacteria | 3459 |
| 793 | Ga0501037_0091860 | 3300049573 | Bacteria | 2196 |
| 794 | Ga0501037_0130333 | 3300049573 | Bacteria | 1803 |
| 795 | Ga0501037_0314591 | 3300049573 | Bacteria | 1085 |
| 796 | Ga0501037_0466743 | 3300049573 | Bacteria | 860 |
| 797 | Ga0501038_0088134 | 3300049574 | Bacteria | 2605 |
| 798 | Ga0501038_0116476 | 3300049574 | Bacteria | 2208 |
| 799 | Ga0501038_0146861 | 3300049574 | Bacteria | 1925 |
| 800 | Ga0501038_0147189 | 3300049574 | Bacteria | 1922 |
| 801 | Ga0501038_0237262 | 3300049574 | Bacteria | 1449 |
| 802 | Ga0501038_0240433 | 3300049574 | Bacteria | 1438 |
| 803 | Ga0501038_0349287 | 3300049574 | Bacteria | 1152 |
| 804 | Ga0501038_0681305 | 3300049574 | Bacteria | 772 |
| 805 | Ga0501039_0000029 | 3300049575 | Bacteria | 131786 |
| 806 | Ga0501039_0019053 | 3300049575 | Bacteria | 5264 |
| 807 | Ga0501039_0168128 | 3300049575 | Bacteria | 1724 |
| 808 | Ga0501039_0222759 | 3300049575 | Bacteria | 1483 |
| 809 | Ga0501039_0349542 | 3300049575 | Bacteria | 1162 |
| 810 | Ga0501039_1171961 | 3300049575 | Bacteria | 595 |
| 811 | Ga0501042_0098300 | 3300049578 | Bacteria | 2105 |
| 812 | Ga0501042_0392993 | 3300049578 | Bacteria | 1005 |
| 813 | Ga0501043_0010388 | 3300049579 | Bacteria | 7296 |
| 814 | Ga0501043_0014584 | 3300049579 | Bacteria | 6152 |
| 815 | Ga0501043_0097012 | 3300049579 | Bacteria | 2317 |
| 816 | Ga0501043_0198900 | 3300049579 | Bacteria | 1556 |
| 817 | Ga0501043_0228594 | 3300049579 | Bacteria | 1437 |
| 818 | Ga0501043_0369496 | 3300049579 | Bacteria | 1087 |
| 819 | Ga0501043_0399659 | 3300049579 | Bacteria | 1038 |
| 820 | Ga0501046_0005416 | 3300049580 | Bacteria | 11410 |
| 821 | Ga0501046_0011762 | 3300049580 | Bacteria | 7472 |
| 822 | Ga0501046_0012992 | 3300049580 | Bacteria | 7068 |
| 823 | Ga0501047_0018715 | 3300049581 | Bacteria | 6641 |
| 824 | Ga0501047_0025996 | 3300049581 | Bacteria | 5629 |
| 825 | Ga0501047_0033976 | 3300049581 | Bacteria | 4923 |
| 826 | Ga0501047_0065087 | 3300049581 | Bacteria | 3514 |
| 827 | Ga0501047_0075405 | 3300049581 | Bacteria | 3245 |
| 828 | Ga0501047_0131220 | 3300049581 | Bacteria | 2386 |
| 829 | Ga0501047_0138742 | 3300049581 | Bacteria | 2310 |
| 830 | Ga0501047_0160994 | 3300049581 | Bacteria | 2116 |
| 831 | Ga0501047_0171826 | 3300049581 | Bacteria | 2036 |
| 832 | Ga0501047_0176653 | 3300049581 | Bacteria | 2003 |
| 833 | Ga0501047_0220930 | 3300049581 | Bacteria | 1751 |
| 834 | Ga0501047_0251827 | 3300049581 | Bacteria | 1614 |
| 835 | Ga0501047_0375584 | 3300049581 | Bacteria | 1256 |
| 836 | Ga0501047_0441537 | 3300049581 | Bacteria | 1131 |
| 837 | Ga0501047_0492805 | 3300049581 | Bacteria | 1052 |
| 838 | Ga0501047_0559308 | 3300049581 | Bacteria | 968 |
| 839 | Ga0501047_0798800 | 3300049581 | Bacteria | 758 |
| 840 | Ga0501047_0883324 | 3300049581 | Bacteria | 707 |
| 841 | Ga0501048_0023812 | 3300049582 | Bacteria | 4471 |
| 842 | Ga0501048_0124442 | 3300049582 | Bacteria | 1823 |
| 843 | Ga0501048_0209717 | 3300049582 | Bacteria | 1382 |
| 844 | Ga0501048_0278719 | 3300049582 | Bacteria | 1189 |
| 845 | Ga0501067_0001776 | 3300049583 | Bacteria | 11844 |
| 846 | Ga0501067_0005578 | 3300049583 | Bacteria | 6979 |
| 847 | Ga0501067_0022624 | 3300049583 | Bacteria | 3478 |
| 848 | Ga0501068_0077512 | 3300049584 | Bacteria | 2035 |
| 849 | Ga0501068_0601467 | 3300049584 | Bacteria | 716 |
| 850 | Ga0501069_0022165 | 3300049585 | Bacteria | 3452 |
| 851 | Ga0501069_0333797 | 3300049585 | Bacteria | 892 |
| 852 | Ga0501070_0000481 | 3300049586 | Bacteria | 36249 |
| 853 | Ga0501070_0003398 | 3300049586 | Bacteria | 13819 |
| 854 | Ga0501070_0014964 | 3300049586 | Bacteria | 6527 |
| 855 | Ga0501070_0143912 | 3300049586 | Bacteria | 1968 |
| 856 | Ga0501070_0178515 | 3300049586 | Bacteria | 1748 |
| 857 | Ga0501070_0309863 | 3300049586 | Bacteria | 1285 |
| 858 | Ga0501070_0382617 | 3300049586 | Bacteria | 1140 |
| 859 | Ga0501071_0135415 | 3300049587 | Bacteria | 1833 |
| 860 | Ga0501071_0156932 | 3300049587 | Bacteria | 1699 |
| 861 | Ga0501072_0015507 | 3300049588 | Bacteria | 5840 |
| 862 | Ga0501073_0001669 | 3300049589 | Bacteria | 16438 |
| 863 | Ga0501073_0004494 | 3300049589 | Bacteria | 10476 |
| 864 | Ga0501073_0015128 | 3300049589 | Bacteria | 5597 |
| 865 | Ga0501073_0059739 | 3300049589 | Bacteria | 2662 |
| 866 | Ga0501073_0059886 | 3300049589 | Bacteria | 2658 |
| 867 | Ga0501073_0061078 | 3300049589 | Bacteria | 2630 |
| 868 | Ga0501073_0070275 | 3300049589 | Bacteria | 2439 |
| 869 | Ga0501073_0987301 | 3300049589 | Bacteria | 579 |
| 870 | Ga0501074_0004453 | 3300049590 | Bacteria | 10023 |
| 871 | Ga0501074_0042382 | 3300049590 | Bacteria | 3293 |
| 872 | Ga0501074_0079197 | 3300049590 | Bacteria | 2358 |
| 873 | Ga0501077_0059400 | 3300049593 | Bacteria | 2427 |
| 874 | Ga0501079_0001478 | 3300049741 | Bacteria | 16629 |
| 875 | Ga0501079_0017836 | 3300049741 | Bacteria | 5421 |
| 876 | Ga0501079_0140727 | 3300049741 | Bacteria | 1880 |
| 877 | Ga0501079_0188192 | 3300049741 | Bacteria | 1611 |
| 878 | Ga0501079_0330695 | 3300049741 | Bacteria | 1193 |
| 879 | Ga0501080_0018079 | 3300049742 | Bacteria | 6526 |
| 880 | Ga0501080_0040364 | 3300049742 | Bacteria | 4353 |
| 881 | Ga0501080_0043846 | 3300049742 | Bacteria | 4165 |
| 882 | Ga0501080_0062400 | 3300049742 | Bacteria | 3468 |
| 883 | Ga0501080_0125187 | 3300049742 | Bacteria | 2380 |
| 884 | Ga0501080_0179248 | 3300049742 | Bacteria | 1951 |
| 885 | Ga0501080_0283362 | 3300049742 | Bacteria | 1506 |
| 886 | Ga0501080_0628681 | 3300049742 | Bacteria | 951 |
| 887 | Ga0501080_1069414 | 3300049742 | Bacteria | 697 |
| 888 | Ga0501083_0077301 | 3300049744 | Bacteria | 2209 |
| 889 | Ga0501083_0089262 | 3300049744 | Bacteria | 2037 |
| 890 | Ga0501083_0117891 | 3300049744 | Bacteria | 1742 |
| 891 | Ga0501083_0135923 | 3300049744 | Bacteria | 1611 |
| 892 | Ga0501083_0275277 | 3300049744 | Bacteria | 1095 |
| 893 | Ga0501083_0712658 | 3300049744 | Bacteria | 653 |
| 894 | Ga0501280_000425 | 3300049776 | Bacteria | 10117 |
| 895 | Ga0501282_002357 | 3300049778 | Bacteria | 2062 |
| 896 | Ga0501035_0019622 | 3300049822 | Bacteria | 6212 |
| 897 | Ga0501035_0037025 | 3300049822 | Bacteria | 4420 |
| 898 | Ga0501035_0044851 | 3300049822 | Bacteria | 3979 |
| 899 | Ga0501035_0048543 | 3300049822 | Bacteria | 3807 |
| 900 | Ga0501035_0065562 | 3300049822 | Bacteria | 3225 |
| 901 | Ga0501035_0085166 | 3300049822 | Bacteria | 2786 |
| 902 | Ga0501035_0162505 | 3300049822 | Bacteria | 1932 |
| 903 | Ga0501035_0190474 | 3300049822 | Bacteria | 1763 |
| 904 | Ga0501035_0254054 | 3300049822 | Bacteria | 1492 |
| 905 | Ga0501035_0283204 | 3300049822 | Bacteria | 1400 |
| 906 | Ga0501035_0300904 | 3300049822 | Bacteria | 1351 |
| 907 | Ga0501035_0914179 | 3300049822 | Bacteria | 694 |
| 908 | Ga0501044_0015755 | 3300049823 | Bacteria | 8141 |
| 909 | Ga0501044_0024878 | 3300049823 | Bacteria | 6351 |
| 910 | Ga0501044_0032329 | 3300049823 | Bacteria | 5501 |
| 911 | Ga0501044_0044540 | 3300049823 | Bacteria | 4604 |
| 912 | Ga0501044_0099276 | 3300049823 | Bacteria | 2930 |
| 913 | Ga0501044_0114803 | 3300049823 | Bacteria | 2698 |
| 914 | Ga0501044_0129184 | 3300049823 | Bacteria | 2522 |
| 915 | Ga0501044_0140739 | 3300049823 | Bacteria | 2401 |
| 916 | Ga0501044_0161480 | 3300049823 | Bacteria | 2217 |
| 917 | Ga0501044_0210012 | 3300049823 | Bacteria | 1901 |
| 918 | Ga0501044_0504734 | 3300049823 | Bacteria | 1110 |
| 919 | Ga0501044_0519482 | 3300049823 | Bacteria | 1090 |
| 920 | Ga0501045_0128835 | 3300049824 | Bacteria | 1881 |
| 921 | nmdc:mga03683_252067_c1 | 3300050489 | Bacteria | 820 |
| 922 | nmdc:mga03n38_135_c1 | 3300050490 | Bacteria | 16000 |
| 923 | nmdc:mga00v17_123_c1 | 3300050491 | Bacteria | 45547 |
| 924 | nmdc:mga00v17_385_c1 | 3300050491 | Bacteria | 25012 |
| 925 | nmdc:mga0yw44_265_c1 | 3300050492 | Bacteria | 17906 |
| 926 | nmdc:mga06z11_3977_c1 | 3300050494 | Bacteria | 5765 |
| 927 | nmdc:mga06z11_6666_c1 | 3300050494 | Bacteria | 4721 |
| 928 | nmdc:mga04h51_108108_c1 | 3300050495 | Bacteria | 1022 |
| 929 | nmdc:mga04h51_55057_c1 | 3300050495 | Bacteria | 1347 |
| 930 | nmdc:mga07m45_68_c1 | 3300050496 | Bacteria | 39566 |
| 931 | nmdc:mga05p37_167955_c1 | 3300050507 | Bacteria | 2677 |
| 932 | nmdc:mga05p37_507131_c1 | 3300050507 | Bacteria | 1383 |
| 933 | nmdc:mga09592_25742_c1 | 3300050508 | Bacteria | 4871 |
| 934 | nmdc:mga09592_80345_c1 | 3300050508 | Bacteria | 2777 |
| 935 | nmdc:mga0qj67_173986_c1 | 3300050509 | Bacteria | 1748 |
| 936 | nmdc:mga0qj67_275124_c1 | 3300050509 | Bacteria | 1365 |
| 937 | nmdc:mga08y16_19140_c1 | 3300050511 | Bacteria | 7214 |
| 938 | nmdc:mga08y16_2559_c1 | 3300050511 | Bacteria | 18707 |
| 939 | nmdc:mga0n895_10772_c1 | 3300050512 | Bacteria | 8108 |
| 940 | nmdc:mga0n895_17129_c1 | 3300050512 | Bacteria | 6675 |
| 941 | nmdc:mga0n895_277025_c1 | 3300050512 | Bacteria | 1701 |
| 942 | nmdc:mga0n895_789078_c1 | 3300050512 | Bacteria | 941 |
| 943 | nmdc:mga0rr50_45774_c1 | 3300050513 | Bacteria | 3218 |
| 944 | nmdc:mga0rr50_7934_c1 | 3300050513 | Bacteria | 6586 |
| 945 | nmdc:mga08x19_177_c1 | 3300050514 | Bacteria | 51482 |
| 946 | nmdc:mga08x19_2026_c1 | 3300050514 | Bacteria | 12425 |
| 947 | nmdc:mga08x19_945_c1 | 3300050514 | Bacteria | 18277 |
| 948 | nmdc:mga0a205_20420_c1 | 3300050515 | Bacteria | 6248 |
| 949 | nmdc:mga0sz30_17_c1 | 3300050516 | Bacteria | 48963 |
| 950 | Ga0495619_0184369 | 3300053085 | Bacteria | 1444 |
| 951 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 952 | Ga0500566_0181241 | 3300053094 | Bacteria | 1080 |
| 953 | Ga0500592_011077 | 3300053116 | Bacteria | 1441 |
| 954 | Ga0500594_0012014 | 3300053118 | Bacteria | 2032 |
| 955 | Ga0500595_001661 | 3300053119 | Bacteria | 11694 |
| 956 | Ga0500595_101861 | 3300053119 | Bacteria | 822 |
| 957 | Ga0500655_006392 | 3300053133 | Bacteria | 2121 |
| 958 | Ga0500559_0020972 | 3300053136 | Bacteria | 2766 |
| 959 | Ga0500568_0047421 | 3300053139 | Bacteria | 1702 |
| 960 | Ga0500573_0000452 | 3300053140 | Bacteria | 17648 |
| 961 | Ga0500619_043325 | 3300053154 | Bacteria | 1430 |
| 962 | Ga0500639_087393 | 3300053163 | Bacteria | 1559 |
| 963 | Ga0500576_168654 | 3300053725 | Bacteria | 791 |
| 964 | Ga0500645_070785 | 3300053730 | Bacteria | 1001 |
| 965 | Ga0500645_104061 | 3300053730 | Bacteria | 799 |
| 966 | Ga0501084_0000175 | 3300054114 | Bacteria | 50123 |
| 967 | Ga0501084_0007620 | 3300054114 | Bacteria | 8925 |
| 968 | Ga0501084_0029906 | 3300054114 | Bacteria | 4556 |
| 969 | Ga0501084_0074161 | 3300054114 | Bacteria | 2849 |
| 970 | Ga0501084_0145505 | 3300054114 | Bacteria | 1996 |
| 971 | Ga0501084_0363006 | 3300054114 | Bacteria | 1224 |
| 972 | Ga0501082_0006964 | 3300060353 | Bacteria | 9766 |
| 973 | Ga0501082_0039783 | 3300060353 | Bacteria | 4056 |
| 974 | Ga0501082_0069701 | 3300060353 | Bacteria | 3028 |
| 975 | Ga0501082_0107936 | 3300060353 | Bacteria | 2409 |
| 976 | Ga0501082_0590704 | 3300060353 | Bacteria | 972 |
| 977 | Ga0530510_0238077 | 3300061734 | Bacteria | 1355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025910 | Ga0207684_10294542 | Ga0207684_102945422 | 154 |
| 2 | 3300039437 | Ga0436365_1584141 | Ga0436365_1584141_12_476 | 154 |
| 3 | 3300005338 | Ga0068868_100153898 | Ga0068868_1001538981 | 156 |
| 4 | 3300005355 | Ga0070671_100563781 | Ga0070671_1005637812 | 156 |
| 5 | 3300005436 | Ga0070713_100364268 | Ga0070713_1003642682 | 156 |
| 6 | 3300005437 | Ga0070710_10553255 | Ga0070710_105532552 | 156 |
| 7 | 3300005455 | Ga0070663_100264255 | Ga0070663_1002642553 | 156 |
| 8 | 3300005578 | Ga0068854_100347723 | Ga0068854_1003477232 | 156 |
| 9 | 3300005615 | Ga0070702_100299022 | Ga0070702_1002990223 | 156 |
| 10 | 3300005718 | Ga0068866_10072414 | Ga0068866_100724143 | 156 |
| 11 | 3300005841 | Ga0068863_101146006 | Ga0068863_1011460062 | 156 |
| 12 | 3300009098 | Ga0105245_10538363 | Ga0105245_105383631 | 156 |
| 13 | 3300009545 | Ga0105237_10627975 | Ga0105237_106279753 | 156 |
| 14 | 3300011119 | Ga0105246_10062954 | Ga0105246_100629544 | 156 |
| 15 | 3300013297 | Ga0157378_10115850 | Ga0157378_101158504 | 156 |
| 16 | 3300014325 | Ga0163163_10915513 | Ga0163163_109155132 | 156 |
| 17 | 3300025899 | Ga0207642_10017630 | Ga0207642_100176303 | 156 |
| 18 | 3300025908 | Ga0207643_10032595 | Ga0207643_100325957 | 156 |
| 19 | 3300025911 | Ga0207654_10063489 | Ga0207654_100634894 | 156 |
| 20 | 3300025925 | Ga0207650_10171098 | Ga0207650_101710984 | 156 |
| 21 | 3300025927 | Ga0207687_10325007 | Ga0207687_103250072 | 156 |
| 22 | 3300026067 | Ga0207678_10367816 | Ga0207678_103678162 | 156 |
| 23 | 3300035172 | Ga0373955_0246502 | Ga0373955_0246502_446_979 | 156 |
| 24 | 3300035207 | Ga0373942_0071250 | Ga0373942_0071250_195_728 | 156 |
| 25 | 3300035692 | Ga0373935_0133269 | Ga0373935_0133269_1107_1640 | 156 |
| 26 | 3300005328 | Ga0070676_10079075 | Ga0070676_100790754 | 157 |
| 27 | 3300005334 | Ga0068869_100070091 | Ga0068869_1000700914 | 157 |
| 28 | 3300005459 | Ga0068867_100540816 | Ga0068867_1005408161 | 157 |
| 29 | 3300005577 | Ga0068857_100361571 | Ga0068857_1003615712 | 157 |
| 30 | 3300005718 | Ga0068866_10260834 | Ga0068866_102608342 | 157 |
| 31 | 3300009098 | Ga0105245_10230243 | Ga0105245_102302432 | 157 |
| 32 | 3300009148 | Ga0105243_10014172 | Ga0105243_100141726 | 157 |
| 33 | 3300009176 | Ga0105242_10891180 | Ga0105242_108911802 | 157 |
| 34 | 3300011119 | Ga0105246_10563413 | Ga0105246_105634131 | 157 |
| 35 | 3300025908 | Ga0207643_10030805 | Ga0207643_100308055 | 157 |
| 36 | 3300025926 | Ga0207659_10166081 | Ga0207659_101660812 | 157 |
| 37 | 3300025927 | Ga0207687_10085895 | Ga0207687_100858953 | 157 |
| 38 | 3300025934 | Ga0207686_10073147 | Ga0207686_100731472 | 157 |
| 39 | 3300025935 | Ga0207709_10125051 | Ga0207709_101250512 | 157 |
| 40 | 3300025936 | Ga0207670_10845695 | Ga0207670_108456951 | 157 |
| 41 | 3300025942 | Ga0207689_10127211 | Ga0207689_101272114 | 157 |
| 42 | 3300026089 | Ga0207648_10154508 | Ga0207648_101545082 | 157 |
| 43 | 3300035112 | Ga0373932_0201431 | Ga0373932_0201431_159_692 | 157 |
| 44 | 3300005435 | Ga0070714_100000676 | Ga0070714_1000006764 | 158 |
| 45 | 3300025919 | Ga0207657_10734228 | Ga0207657_107342282 | 158 |
| 46 | 3300025929 | Ga0207664_10032838 | Ga0207664_100328386 | 158 |
| 47 | 3300046539 | Ga0495621_0007305 | Ga0495621_0007305_1811_2332 | 158 |
| 48 | 3300026121 | Ga0207683_11029523 | Ga0207683_110295232 | 159 |
| 49 | 3300039450 | Ga0436363_1041884 | Ga0436363_1041884_46_579 | 159 |
| 50 | 3300049589 | Ga0501073_0987301 | Ga0501073_0987301_23_502 | 159 |
| 51 | 3300006237 | Ga0097621_100047344 | Ga0097621_1000473446 | 160 |
| 52 | 3300006358 | Ga0068871_100162546 | Ga0068871_1001625464 | 160 |
| 53 | 3300009148 | Ga0105243_10222994 | Ga0105243_102229943 | 160 |
| 54 | 3300013297 | Ga0157378_10549314 | Ga0157378_105493143 | 160 |
| 55 | 3300014968 | Ga0157379_10052289 | Ga0157379_100522894 | 160 |
| 56 | 3300026078 | Ga0207702_11758665 | Ga0207702_117586651 | 160 |
| 57 | 3300037068 | Ga0373925_1342811 | Ga0373925_1342811_26_508 | 160 |
| 58 | 3300006847 | Ga0075431_100116845 | Ga0075431_1001168453 | 161 |
| 59 | 3300014326 | Ga0157380_10294611 | Ga0157380_102946113 | 161 |
| 60 | 3300025931 | Ga0207644_10562368 | Ga0207644_105623681 | 161 |
| 61 | 3300039437 | Ga0436365_1351612 | Ga0436365_1351612_26_559 | 161 |
| 62 | 3300005341 | Ga0070691_10222565 | Ga0070691_102225651 | 162 |
| 63 | 3300005456 | Ga0070678_100013560 | Ga0070678_1000135602 | 162 |
| 64 | 3300005618 | Ga0068864_100440435 | Ga0068864_1004404352 | 162 |
| 65 | 3300010375 | Ga0105239_12206314 | Ga0105239_122063141 | 162 |
| 66 | 3300025925 | Ga0207650_10536252 | Ga0207650_105362522 | 162 |
| 67 | 3300025940 | Ga0207691_10325382 | Ga0207691_103253822 | 162 |
| 68 | 3300046492 | Ga0495585_0181428 | Ga0495585_0181428_499_1032 | 162 |
| 69 | 3300046558 | Ga0495633_0110090 | Ga0495633_0110090_557_1090 | 162 |
| 70 | 3300046665 | Ga0495661_0198281 | Ga0495661_0198281_317_850 | 162 |
| 71 | 3300005458 | Ga0070681_10160044 | Ga0070681_101600443 | 163 |
| 72 | 3300049581 | Ga0501047_0220930 | Ga0501047_0220930_466_999 | 163 |
| 73 | 3300009177 | Ga0105248_10408693 | Ga0105248_104086933 | 164 |
| 74 | 3300035691 | Ga0373931_0111163 | Ga0373931_0111163_249_782 | 164 |
| 75 | 3300005336 | Ga0070680_100226414 | Ga0070680_1002264142 | 165 |
| 76 | 3300005458 | Ga0070681_10179316 | Ga0070681_101793162 | 165 |
| 77 | 3300025912 | Ga0207707_10124122 | Ga0207707_101241222 | 165 |
| 78 | 3300049570 | Ga0501033_0245126 | Ga0501033_0245126_559_1092 | 165 |
| 79 | 3300028379 | Ga0268266_11207351 | Ga0268266_112073511 | 166 |
| 80 | 3300028577 | Ga0265318_10004788 | Ga0265318_100047884 | 166 |
| 81 | 3300031238 | Ga0265332_10031083 | Ga0265332_100310835 | 166 |
| 82 | 3300031240 | Ga0265320_10057577 | Ga0265320_100575773 | 166 |
| 83 | 3300031241 | Ga0265325_10021041 | Ga0265325_100210414 | 166 |
| 84 | 3300031250 | Ga0265331_10021847 | Ga0265331_100218476 | 166 |
| 85 | 3300031711 | Ga0265314_10213503 | Ga0265314_102135032 | 166 |
| 86 | 3300048918 | Ga0496115_0373355 | Ga0496115_0373355_93_626 | 166 |
| 87 | 3300048929 | Ga0496126_0000480 | Ga0496126_0000480_21158_21691 | 166 |
| 88 | 3300025915 | Ga0207693_10054085 | Ga0207693_100540854 | 167 |
| 89 | 3300031344 | Ga0265316_10044806 | Ga0265316_100448062 | 167 |
| 90 | 3300046459 | Ga0495629_0083513 | Ga0495629_0083513_1078_1611 | 167 |
| 91 | 3300047319 | Ga0495674_0687412 | Ga0495674_0687412_184_768 | 167 |
| 92 | 3300049551 | Ga0501335_006385 | Ga0501335_006385_551_1054 | 167 |
| 93 | 3300049581 | Ga0501047_0033976 | Ga0501047_0033976_1696_2229 | 167 |
| 94 | 3300049744 | Ga0501083_0275277 | Ga0501083_0275277_125_658 | 167 |
| 95 | 3300049822 | Ga0501035_0283204 | Ga0501035_0283204_821_1354 | 167 |
| 96 | 3300049823 | Ga0501044_0114803 | Ga0501044_0114803_1766_2299 | 167 |
| 97 | 3300005327 | Ga0070658_11372238 | Ga0070658_113722381 | 169 |
| 98 | 3300005339 | Ga0070660_100174288 | Ga0070660_1001742883 | 169 |
| 99 | 3300005435 | Ga0070714_101124907 | Ga0070714_1011249071 | 169 |
| 100 | 3300005458 | Ga0070681_10034634 | Ga0070681_100346345 | 169 |
| 101 | 3300005530 | Ga0070679_100064794 | Ga0070679_1000647944 | 169 |
| 102 | 3300005530 | Ga0070679_100335688 | Ga0070679_1003356883 | 169 |
| 103 | 3300005539 | Ga0068853_100714452 | Ga0068853_1007144521 | 169 |
| 104 | 3300005548 | Ga0070665_100175548 | Ga0070665_1001755485 | 169 |
| 105 | 3300005548 | Ga0070665_100600604 | Ga0070665_1006006042 | 169 |
| 106 | 3300005563 | Ga0068855_100121416 | Ga0068855_1001214164 | 169 |
| 107 | 3300005563 | Ga0068855_100953360 | Ga0068855_1009533602 | 169 |
| 108 | 3300005577 | Ga0068857_100983381 | Ga0068857_1009833812 | 169 |
| 109 | 3300006175 | Ga0070712_100113045 | Ga0070712_1001130453 | 169 |
| 110 | 3300006358 | Ga0068871_100419656 | Ga0068871_1004196562 | 169 |
| 111 | 3300009093 | Ga0105240_10571025 | Ga0105240_105710253 | 169 |
| 112 | 3300009174 | Ga0105241_10455114 | Ga0105241_104551142 | 169 |
| 113 | 3300009551 | Ga0105238_10130022 | Ga0105238_101300225 | 169 |
| 114 | 3300010375 | Ga0105239_10243523 | Ga0105239_102435235 | 169 |
| 115 | 3300010375 | Ga0105239_10259863 | Ga0105239_102598633 | 169 |
| 116 | 3300013105 | Ga0157369_10345530 | Ga0157369_103455302 | 169 |
| 117 | 3300025909 | Ga0207705_10194396 | Ga0207705_101943963 | 169 |
| 118 | 3300025913 | Ga0207695_10128661 | Ga0207695_101286615 | 169 |
| 119 | 3300025913 | Ga0207695_10383850 | Ga0207695_103838503 | 169 |
| 120 | 3300025914 | Ga0207671_10408901 | Ga0207671_104089012 | 169 |
| 121 | 3300025914 | Ga0207671_10499698 | Ga0207671_104996982 | 169 |
| 122 | 3300025924 | Ga0207694_10026889 | Ga0207694_100268893 | 169 |
| 123 | 3300025924 | Ga0207694_10864858 | Ga0207694_108648581 | 169 |
| 124 | 3300025929 | Ga0207664_10411486 | Ga0207664_104114863 | 169 |
| 125 | 3300025960 | Ga0207651_10169073 | Ga0207651_101690734 | 169 |
| 126 | 3300026116 | Ga0207674_10192958 | Ga0207674_101929584 | 169 |
| 127 | 3300037312 | Ga0395899_0224824 | Ga0395899_0224824_671_1204 | 169 |
| 128 | 3300037418 | Ga0395900_0098142 | Ga0395900_0098142_1328_1861 | 169 |
| 129 | 3300037466 | Ga0395898_0359028 | Ga0395898_0359028_663_1196 | 169 |
| 130 | 3300038443 | Ga0395901_0072035 | Ga0395901_0072035_2713_3246 | 169 |
| 131 | 3300046473 | Ga0495582_0065981 | Ga0495582_0065981_555_1088 | 169 |
| 132 | 3300046476 | Ga0495662_0112098 | Ga0495662_0112098_275_808 | 169 |
| 133 | 3300046477 | Ga0495664_0237404 | Ga0495664_0237404_552_1085 | 169 |
| 134 | 3300046536 | Ga0495587_0122784 | Ga0495587_0122784_347_880 | 169 |
| 135 | 3300047444 | Ga0495675_0256692 | Ga0495675_0256692_150_683 | 169 |
| 136 | 3300048088 | Ga0495602_0175950 | Ga0495602_0175950_1019_1552 | 169 |
| 137 | 3300049581 | Ga0501047_0171826 | Ga0501047_0171826_146_679 | 169 |
| 138 | 3300050507 | nmdc:mga05p37_507131_c1 | nmdc:mga05p37_507131_c1_170_679 | 169 |
| 139 | 3300050508 | nmdc:mga09592_80345_c1 | nmdc:mga09592_80345_c1_1954_2463 | 169 |
| 140 | 3300050511 | nmdc:mga08y16_2559_c1 | nmdc:mga08y16_2559_c1_12472_12981 | 169 |
| 141 | 3300053725 | Ga0500576_168654 | Ga0500576_168654_146_679 | 169 |
| 142 | 3300013306 | Ga0163162_11179552 | Ga0163162_111795522 | 170 |
| 143 | 3300014325 | Ga0163163_10008003 | Ga0163163_100080034 | 170 |
| 144 | 3300046507 | Ga0495606_0159747 | Ga0495606_0159747_104_637 | 170 |
| 145 | 3300046694 | Ga0495649_0224280 | Ga0495649_0224280_126_659 | 170 |
| 146 | 3300049529 | Ga0501313_009732 | Ga0501313_009732_152_667 | 171 |
| 147 | iso_pu_bacteria | 2739367655 | 2739613616 | 173 |
| 148 | 3300006038 | Ga0075365_10000030 | Ga0075365_1000003019 | 175 |
| 149 | 3300006042 | Ga0075368_10095597 | Ga0075368_100955973 | 175 |
| 150 | 3300006048 | Ga0075363_100001020 | Ga0075363_10000102015 | 175 |
| 151 | 3300006051 | Ga0075364_10000068 | Ga0075364_1000006832 | 175 |
| 152 | 3300006051 | Ga0075364_10024136 | Ga0075364_100241369 | 175 |
| 153 | 3300006178 | Ga0075367_10018355 | Ga0075367_100183559 | 175 |
| 154 | 3300006186 | Ga0075369_10000030 | Ga0075369_1000003013 | 175 |
| 155 | 3300006353 | Ga0075370_10000042 | Ga0075370_1000004231 | 175 |
| 156 | 3300006880 | Ga0075429_100028322 | Ga0075429_1000283224 | 175 |
| 157 | 3300009147 | Ga0114129_10070335 | Ga0114129_1007033510 | 175 |
| 158 | 3300025939 | Ga0207665_10241385 | Ga0207665_102413853 | 175 |
| 159 | 3300027866 | Ga0209813_10045800 | Ga0209813_100458002 | 175 |
| 160 | 3300027866 | Ga0209813_10091394 | Ga0209813_100913942 | 175 |
| 161 | 3300050489 | nmdc:mga03683_252067_c1 | nmdc:mga03683_252067_c1_21_551 | 175 |
| 162 | 3300050490 | nmdc:mga03n38_135_c1 | nmdc:mga03n38_135_c1_15065_15595 | 175 |
| 163 | 3300050491 | nmdc:mga00v17_123_c1 | nmdc:mga00v17_123_c1_33237_33767 | 175 |
| 164 | 3300050491 | nmdc:mga00v17_385_c1 | nmdc:mga00v17_385_c1_12577_13107 | 175 |
| 165 | 3300050492 | nmdc:mga0yw44_265_c1 | nmdc:mga0yw44_265_c1_13189_13719 | 175 |
| 166 | 3300050494 | nmdc:mga06z11_3977_c1 | nmdc:mga06z11_3977_c1_5135_5665 | 175 |
| 167 | 3300050494 | nmdc:mga06z11_6666_c1 | nmdc:mga06z11_6666_c1_3786_4316 | 175 |
| 168 | 3300050495 | nmdc:mga04h51_108108_c1 | nmdc:mga04h51_108108_c1_53_583 | 175 |
| 169 | 3300050495 | nmdc:mga04h51_55057_c1 | nmdc:mga04h51_55057_c1_445_975 | 175 |
| 170 | 3300050496 | nmdc:mga07m45_68_c1 | nmdc:mga07m45_68_c1_24002_24532 | 175 |
| 171 | 3300050507 | nmdc:mga05p37_167955_c1 | nmdc:mga05p37_167955_c1_1014_1541 | 175 |
| 172 | 3300050508 | nmdc:mga09592_25742_c1 | nmdc:mga09592_25742_c1_3196_3726 | 175 |
| 173 | 3300050512 | nmdc:mga0n895_17129_c1 | nmdc:mga0n895_17129_c1_5026_5556 | 175 |
| 174 | 3300050516 | nmdc:mga0sz30_17_c1 | nmdc:mga0sz30_17_c1_33378_33908 | 175 |
| 175 | 3300013297 | Ga0157378_10232385 | Ga0157378_102323853 | 176 |
| 176 | 3300042876 | Ga0451577_0743919 | Ga0451577_0743919_220_750 | 176 |
| 177 | 3300044712 | Ga0453684_0000682 | Ga0453684_0000682_112972_113502 | 176 |
| 178 | 3300045051 | Ga0451576_0363162 | Ga0451576_0363162_969_1499 | 176 |
| 179 | 3300003214 | JGI25165J46597_1001315 | JGI25165J46597_100131510 | 177 |
| 180 | 3300003215 | JGI25153J46596_10000830 | JGI25153J46596_1000083016 | 177 |
| 181 | 3300003320 | rootH2_10048944 | rootH2_100489443 | 177 |
| 182 | 3300004798 | Ga0058859_10022480 | Ga0058859_100224803 | 177 |
| 183 | 3300004799 | Ga0058863_11970613 | Ga0058863_119706132 | 177 |
| 184 | 3300004803 | Ga0058862_11940969 | Ga0058862_119409692 | 177 |
| 185 | 3300005327 | Ga0070658_10045521 | Ga0070658_100455212 | 177 |
| 186 | 3300005328 | Ga0070676_10302467 | Ga0070676_103024671 | 177 |
| 187 | 3300005329 | Ga0070683_100088671 | Ga0070683_1000886714 | 177 |
| 188 | 3300005329 | Ga0070683_100187211 | Ga0070683_1001872112 | 177 |
| 189 | 3300005330 | Ga0070690_100219016 | Ga0070690_1002190162 | 177 |
| 190 | 3300005330 | Ga0070690_100294104 | Ga0070690_1002941043 | 177 |
| 191 | 3300005330 | Ga0070690_100539086 | Ga0070690_1005390862 | 177 |
| 192 | 3300005334 | Ga0068869_101415616 | Ga0068869_1014156161 | 177 |
| 193 | 3300005335 | Ga0070666_10007106 | Ga0070666_100071068 | 177 |
| 194 | 3300005335 | Ga0070666_10123583 | Ga0070666_101235833 | 177 |
| 195 | 3300005336 | Ga0070680_100002998 | Ga0070680_10000299812 | 177 |
| 196 | 3300005336 | Ga0070680_100072787 | Ga0070680_1000727872 | 177 |
| 197 | 3300005336 | Ga0070680_100078879 | Ga0070680_1000788796 | 177 |
| 198 | 3300005336 | Ga0070680_100255022 | Ga0070680_1002550222 | 177 |
| 199 | 3300005338 | Ga0068868_100397645 | Ga0068868_1003976451 | 177 |
| 200 | 3300005338 | Ga0068868_101181538 | Ga0068868_1011815381 | 177 |
| 201 | 3300005339 | Ga0070660_100018276 | Ga0070660_10001827610 | 177 |
| 202 | 3300005339 | Ga0070660_100069129 | Ga0070660_1000691295 | 177 |
| 203 | 3300005339 | Ga0070660_100089034 | Ga0070660_1000890343 | 177 |
| 204 | 3300005339 | Ga0070660_100108074 | Ga0070660_1001080744 | 177 |
| 205 | 3300005339 | Ga0070660_100477533 | Ga0070660_1004775332 | 177 |
| 206 | 3300005340 | Ga0070689_100415195 | Ga0070689_1004151951 | 177 |
| 207 | 3300005341 | Ga0070691_10000386 | Ga0070691_1000038613 | 177 |
| 208 | 3300005341 | Ga0070691_10149346 | Ga0070691_101493461 | 177 |
| 209 | 3300005341 | Ga0070691_10155140 | Ga0070691_101551401 | 177 |
| 210 | 3300005344 | Ga0070661_100005946 | Ga0070661_1000059463 | 177 |
| 211 | 3300005344 | Ga0070661_100843647 | Ga0070661_1008436471 | 177 |
| 212 | 3300005354 | Ga0070675_101654718 | Ga0070675_1016547181 | 177 |
| 213 | 3300005355 | Ga0070671_100262784 | Ga0070671_1002627843 | 177 |
| 214 | 3300005356 | Ga0070674_100041872 | Ga0070674_1000418722 | 177 |
| 215 | 3300005365 | Ga0070688_100357639 | Ga0070688_1003576392 | 177 |
| 216 | 3300005366 | Ga0070659_100012925 | Ga0070659_10001292511 | 177 |
| 217 | 3300005366 | Ga0070659_100027373 | Ga0070659_1000273732 | 177 |
| 218 | 3300005367 | Ga0070667_100061525 | Ga0070667_1000615255 | 177 |
| 219 | 3300005367 | Ga0070667_100349423 | Ga0070667_1003494231 | 177 |
| 220 | 3300005434 | Ga0070709_10003511 | Ga0070709_1000351118 | 177 |
| 221 | 3300005434 | Ga0070709_10171867 | Ga0070709_101718673 | 177 |
| 222 | 3300005435 | Ga0070714_100068815 | Ga0070714_1000688153 | 177 |
| 223 | 3300005435 | Ga0070714_100109782 | Ga0070714_1001097823 | 177 |
| 224 | 3300005435 | Ga0070714_100530839 | Ga0070714_1005308392 | 177 |
| 225 | 3300005435 | Ga0070714_101188515 | Ga0070714_1011885151 | 177 |
| 226 | 3300005436 | Ga0070713_100000012 | Ga0070713_100000012131 | 177 |
| 227 | 3300005436 | Ga0070713_100162144 | Ga0070713_1001621442 | 177 |
| 228 | 3300005436 | Ga0070713_100213904 | Ga0070713_1002139042 | 177 |
| 229 | 3300005437 | Ga0070710_10040281 | Ga0070710_100402816 | 177 |
| 230 | 3300005439 | Ga0070711_100240856 | Ga0070711_1002408562 | 177 |
| 231 | 3300005439 | Ga0070711_100351636 | Ga0070711_1003516362 | 177 |
| 232 | 3300005439 | Ga0070711_100570669 | Ga0070711_1005706692 | 177 |
| 233 | 3300005444 | Ga0070694_100283260 | Ga0070694_1002832602 | 177 |
| 234 | 3300005444 | Ga0070694_100340525 | Ga0070694_1003405251 | 177 |
| 235 | 3300005456 | Ga0070678_100021125 | Ga0070678_1000211256 | 177 |
| 236 | 3300005456 | Ga0070678_100069504 | Ga0070678_1000695045 | 177 |
| 237 | 3300005456 | Ga0070678_100681426 | Ga0070678_1006814261 | 177 |
| 238 | 3300005458 | Ga0070681_10000037 | Ga0070681_1000003718 | 177 |
| 239 | 3300005458 | Ga0070681_10048475 | Ga0070681_100484756 | 177 |
| 240 | 3300005458 | Ga0070681_10237697 | Ga0070681_102376973 | 177 |
| 241 | 3300005459 | Ga0068867_100100755 | Ga0068867_1001007552 | 177 |
| 242 | 3300005468 | Ga0070707_101144481 | Ga0070707_1011444812 | 177 |
| 243 | 3300005518 | Ga0070699_100114998 | Ga0070699_1001149981 | 177 |
| 244 | 3300005518 | Ga0070699_100215896 | Ga0070699_1002158963 | 177 |
| 245 | 3300005530 | Ga0070679_100008411 | Ga0070679_10000841118 | 177 |
| 246 | 3300005530 | Ga0070679_100082939 | Ga0070679_1000829393 | 177 |
| 247 | 3300005535 | Ga0070684_100283884 | Ga0070684_1002838842 | 177 |
| 248 | 3300005539 | Ga0068853_100002020 | Ga0068853_10000202017 | 177 |
| 249 | 3300005539 | Ga0068853_100002660 | Ga0068853_1000026608 | 177 |
| 250 | 3300005539 | Ga0068853_100237414 | Ga0068853_1002374141 | 177 |
| 251 | 3300005539 | Ga0068853_101136376 | Ga0068853_1011363761 | 177 |
| 252 | 3300005544 | Ga0070686_100311002 | Ga0070686_1003110023 | 177 |
| 253 | 3300005545 | Ga0070695_100019206 | Ga0070695_1000192066 | 177 |
| 254 | 3300005546 | Ga0070696_101268626 | Ga0070696_1012686261 | 177 |
| 255 | 3300005547 | Ga0070693_100381808 | Ga0070693_1003818081 | 177 |
| 256 | 3300005548 | Ga0070665_100087868 | Ga0070665_1000878683 | 177 |
| 257 | 3300005548 | Ga0070665_100093536 | Ga0070665_1000935366 | 177 |
| 258 | 3300005548 | Ga0070665_100264776 | Ga0070665_1002647762 | 177 |
| 259 | 3300005549 | Ga0070704_100029374 | Ga0070704_1000293746 | 177 |
| 260 | 3300005563 | Ga0068855_100000385 | Ga0068855_1000003858 | 177 |
| 261 | 3300005563 | Ga0068855_100034625 | Ga0068855_1000346259 | 177 |
| 262 | 3300005563 | Ga0068855_100161413 | Ga0068855_1001614135 | 177 |
| 263 | 3300005563 | Ga0068855_100693807 | Ga0068855_1006938071 | 177 |
| 264 | 3300005563 | Ga0068855_101722291 | Ga0068855_1017222911 | 177 |
| 265 | 3300005577 | Ga0068857_100007896 | Ga0068857_1000078964 | 177 |
| 266 | 3300005577 | Ga0068857_100258522 | Ga0068857_1002585223 | 177 |
| 267 | 3300005614 | Ga0068856_100001032 | Ga0068856_10000103218 | 177 |
| 268 | 3300005614 | Ga0068856_100021325 | Ga0068856_1000213258 | 177 |
| 269 | 3300005614 | Ga0068856_100155308 | Ga0068856_1001553085 | 177 |
| 270 | 3300005614 | Ga0068856_100478045 | Ga0068856_1004780452 | 177 |
| 271 | 3300005614 | Ga0068856_100685912 | Ga0068856_1006859122 | 177 |
| 272 | 3300005616 | Ga0068852_100063743 | Ga0068852_1000637436 | 177 |
| 273 | 3300005616 | Ga0068852_100142311 | Ga0068852_1001423114 | 177 |
| 274 | 3300005616 | Ga0068852_100187615 | Ga0068852_1001876152 | 177 |
| 275 | 3300005616 | Ga0068852_100289160 | Ga0068852_1002891603 | 177 |
| 276 | 3300005616 | Ga0068852_100393106 | Ga0068852_1003931062 | 177 |
| 277 | 3300005618 | Ga0068864_101611468 | Ga0068864_1016114682 | 177 |
| 278 | 3300005841 | Ga0068863_100043883 | Ga0068863_1000438836 | 177 |
| 279 | 3300005842 | Ga0068858_100049282 | Ga0068858_1000492825 | 177 |
| 280 | 3300005842 | Ga0068858_100477057 | Ga0068858_1004770572 | 177 |
| 281 | 3300005843 | Ga0068860_100950609 | Ga0068860_1009506092 | 177 |
| 282 | 3300005843 | Ga0068860_101559447 | Ga0068860_1015594472 | 177 |
| 283 | 3300005844 | Ga0068862_100100297 | Ga0068862_1001002974 | 177 |
| 284 | 3300005983 | Ga0081540_1008438 | Ga0081540_10084383 | 177 |
| 285 | 3300006173 | Ga0070716_100211553 | Ga0070716_1002115533 | 177 |
| 286 | 3300006173 | Ga0070716_100564291 | Ga0070716_1005642912 | 177 |
| 287 | 3300006175 | Ga0070712_100000902 | Ga0070712_10000090217 | 177 |
| 288 | 3300006175 | Ga0070712_100004052 | Ga0070712_10000405218 | 177 |
| 289 | 3300006175 | Ga0070712_100317927 | Ga0070712_1003179272 | 177 |
| 290 | 3300006237 | Ga0097621_100106219 | Ga0097621_1001062195 | 177 |
| 291 | 3300006237 | Ga0097621_100161557 | Ga0097621_1001615574 | 177 |
| 292 | 3300006237 | Ga0097621_100227174 | Ga0097621_1002271744 | 177 |
| 293 | 3300006237 | Ga0097621_100318759 | Ga0097621_1003187591 | 177 |
| 294 | 3300006237 | Ga0097621_100402268 | Ga0097621_1004022682 | 177 |
| 295 | 3300006358 | Ga0068871_100019627 | Ga0068871_1000196278 | 177 |
| 296 | 3300006358 | Ga0068871_100071528 | Ga0068871_1000715285 | 177 |
| 297 | 3300006358 | Ga0068871_100175438 | Ga0068871_1001754382 | 177 |
| 298 | 3300006358 | Ga0068871_100301487 | Ga0068871_1003014872 | 177 |
| 299 | 3300006358 | Ga0068871_100839602 | Ga0068871_1008396021 | 177 |
| 300 | 3300006844 | Ga0075428_100000808 | Ga0075428_10000080818 | 177 |
| 301 | 3300006846 | Ga0075430_100194948 | Ga0075430_1001949482 | 177 |
| 302 | 3300006847 | Ga0075431_101399219 | Ga0075431_1013992192 | 177 |
| 303 | 3300006852 | Ga0075433_10105346 | Ga0075433_101053465 | 177 |
| 304 | 3300006871 | Ga0075434_100176261 | Ga0075434_1001762614 | 177 |
| 305 | 3300006871 | Ga0075434_100262322 | Ga0075434_1002623221 | 177 |
| 306 | 3300006871 | Ga0075434_100441455 | Ga0075434_1004414552 | 177 |
| 307 | 3300006880 | Ga0075429_100043701 | Ga0075429_1000437014 | 177 |
| 308 | 3300006881 | Ga0068865_100002505 | Ga0068865_1000025058 | 177 |
| 309 | 3300006914 | Ga0075436_100000458 | Ga0075436_10000045825 | 177 |
| 310 | 3300006914 | Ga0075436_100000862 | Ga0075436_10000086214 | 177 |
| 311 | 3300006914 | Ga0075436_100002564 | Ga0075436_1000025646 | 177 |
| 312 | 3300006914 | Ga0075436_100029529 | Ga0075436_1000295296 | 177 |
| 313 | 3300007076 | Ga0075435_100006049 | Ga0075435_10000604913 | 177 |
| 314 | 3300007076 | Ga0075435_100018960 | Ga0075435_1000189609 | 177 |
| 315 | 3300007076 | Ga0075435_100609814 | Ga0075435_1006098142 | 177 |
| 316 | 3300009092 | Ga0105250_10440537 | Ga0105250_104405371 | 177 |
| 317 | 3300009093 | Ga0105240_10004232 | Ga0105240_100042329 | 177 |
| 318 | 3300009093 | Ga0105240_10004696 | Ga0105240_1000469618 | 177 |
| 319 | 3300009093 | Ga0105240_10017473 | Ga0105240_1001747318 | 177 |
| 320 | 3300009093 | Ga0105240_10025381 | Ga0105240_100253813 | 177 |
| 321 | 3300009093 | Ga0105240_10150688 | Ga0105240_101506883 | 177 |
| 322 | 3300009093 | Ga0105240_10252800 | Ga0105240_102528003 | 177 |
| 323 | 3300009093 | Ga0105240_10675787 | Ga0105240_106757872 | 177 |
| 324 | 3300009093 | Ga0105240_10722476 | Ga0105240_107224762 | 177 |
| 325 | 3300009093 | Ga0105240_11279886 | Ga0105240_112798861 | 177 |
| 326 | 3300009094 | Ga0111539_10002099 | Ga0111539_1000209918 | 177 |
| 327 | 3300009094 | Ga0111539_10023579 | Ga0111539_100235798 | 177 |
| 328 | 3300009101 | Ga0105247_10056711 | Ga0105247_100567113 | 177 |
| 329 | 3300009174 | Ga0105241_10035275 | Ga0105241_100352757 | 177 |
| 330 | 3300009174 | Ga0105241_10116852 | Ga0105241_101168525 | 177 |
| 331 | 3300009174 | Ga0105241_10469421 | Ga0105241_104694212 | 177 |
| 332 | 3300009174 | Ga0105241_10477193 | Ga0105241_104771932 | 177 |
| 333 | 3300009174 | Ga0105241_10731521 | Ga0105241_107315212 | 177 |
| 334 | 3300009176 | Ga0105242_10123893 | Ga0105242_101238934 | 177 |
| 335 | 3300009176 | Ga0105242_10848595 | Ga0105242_108485952 | 177 |
| 336 | 3300009177 | Ga0105248_10000005 | Ga0105248_1000000518 | 177 |
| 337 | 3300009177 | Ga0105248_10047589 | Ga0105248_100475893 | 177 |
| 338 | 3300009177 | Ga0105248_10063706 | Ga0105248_100637067 | 177 |
| 339 | 3300009545 | Ga0105237_10003253 | Ga0105237_1000325322 | 177 |
| 340 | 3300009545 | Ga0105237_10181890 | Ga0105237_101818904 | 177 |
| 341 | 3300009551 | Ga0105238_10001939 | Ga0105238_1000193918 | 177 |
| 342 | 3300009551 | Ga0105238_10017491 | Ga0105238_100174917 | 177 |
| 343 | 3300009551 | Ga0105238_10055822 | Ga0105238_100558224 | 177 |
| 344 | 3300009551 | Ga0105238_10179895 | Ga0105238_101798952 | 177 |
| 345 | 3300009551 | Ga0105238_10426203 | Ga0105238_104262032 | 177 |
| 346 | 3300009551 | Ga0105238_10826441 | Ga0105238_108264411 | 177 |
| 347 | 3300009553 | Ga0105249_10348653 | Ga0105249_103486533 | 177 |
| 348 | 3300010159 | Ga0099796_10011720 | Ga0099796_100117204 | 177 |
| 349 | 3300010375 | Ga0105239_10005584 | Ga0105239_100055843 | 177 |
| 350 | 3300010375 | Ga0105239_10073553 | Ga0105239_100735535 | 177 |
| 351 | 3300010375 | Ga0105239_10077915 | Ga0105239_100779156 | 177 |
| 352 | 3300010375 | Ga0105239_10210784 | Ga0105239_102107845 | 177 |
| 353 | 3300010375 | Ga0105239_10377439 | Ga0105239_103774391 | 177 |
| 354 | 3300011119 | Ga0105246_10013218 | Ga0105246_100132188 | 177 |
| 355 | 3300011119 | Ga0105246_10516333 | Ga0105246_105163332 | 177 |
| 356 | 3300013100 | Ga0157373_10000820 | Ga0157373_1000082021 | 177 |
| 357 | 3300013100 | Ga0157373_10567405 | Ga0157373_105674052 | 177 |
| 358 | 3300013102 | Ga0157371_10098586 | Ga0157371_100985862 | 177 |
| 359 | 3300013102 | Ga0157371_10655232 | Ga0157371_106552322 | 177 |
| 360 | 3300013104 | Ga0157370_10003448 | Ga0157370_1000344815 | 177 |
| 361 | 3300013104 | Ga0157370_10008323 | Ga0157370_100083236 | 177 |
| 362 | 3300013104 | Ga0157370_10035566 | Ga0157370_100355669 | 177 |
| 363 | 3300013104 | Ga0157370_10083851 | Ga0157370_100838513 | 177 |
| 364 | 3300013104 | Ga0157370_11614616 | Ga0157370_116146161 | 177 |
| 365 | 3300013105 | Ga0157369_10001535 | Ga0157369_1000153518 | 177 |
| 366 | 3300013105 | Ga0157369_10033188 | Ga0157369_100331886 | 177 |
| 367 | 3300013105 | Ga0157369_10407520 | Ga0157369_104075203 | 177 |
| 368 | 3300013105 | Ga0157369_11085912 | Ga0157369_110859121 | 177 |
| 369 | 3300013296 | Ga0157374_10377448 | Ga0157374_103774482 | 177 |
| 370 | 3300013297 | Ga0157378_10424647 | Ga0157378_104246472 | 177 |
| 371 | 3300013297 | Ga0157378_10885088 | Ga0157378_108850882 | 177 |
| 372 | 3300013297 | Ga0157378_10906097 | Ga0157378_109060972 | 177 |
| 373 | 3300013306 | Ga0163162_10250500 | Ga0163162_102505003 | 177 |
| 374 | 3300013306 | Ga0163162_10446856 | Ga0163162_104468562 | 177 |
| 375 | 3300013307 | Ga0157372_10007016 | Ga0157372_100070169 | 177 |
| 376 | 3300013307 | Ga0157372_10008268 | Ga0157372_1000826816 | 177 |
| 377 | 3300013307 | Ga0157372_10032489 | Ga0157372_100324894 | 177 |
| 378 | 3300013307 | Ga0157372_10037651 | Ga0157372_100376518 | 177 |
| 379 | 3300013307 | Ga0157372_10066383 | Ga0157372_100663835 | 177 |
| 380 | 3300013307 | Ga0157372_10327295 | Ga0157372_103272951 | 177 |
| 381 | 3300013308 | Ga0157375_10614872 | Ga0157375_106148721 | 177 |
| 382 | 3300014325 | Ga0163163_10332968 | Ga0163163_103329682 | 177 |
| 383 | 3300014968 | Ga0157379_10007681 | Ga0157379_100076818 | 177 |
| 384 | 3300014968 | Ga0157379_10010518 | Ga0157379_1001051812 | 177 |
| 385 | 3300014968 | Ga0157379_10019718 | Ga0157379_100197184 | 177 |
| 386 | 3300014968 | Ga0157379_10232957 | Ga0157379_102329572 | 177 |
| 387 | 3300014968 | Ga0157379_10428308 | Ga0157379_104283082 | 177 |
| 388 | 3300014969 | Ga0157376_10147364 | Ga0157376_101473642 | 177 |
| 389 | 3300014969 | Ga0157376_10291481 | Ga0157376_102914812 | 177 |
| 390 | 3300014969 | Ga0157376_10517483 | Ga0157376_105174831 | 177 |
| 391 | 3300017792 | Ga0163161_10646087 | Ga0163161_106460871 | 177 |
| 392 | 3300021377 | Ga0213874_10002785 | Ga0213874_100027855 | 177 |
| 393 | 3300021377 | Ga0213874_10006777 | Ga0213874_100067772 | 177 |
| 394 | 3300021384 | Ga0213876_10000421 | Ga0213876_1000042119 | 177 |
| 395 | 3300021384 | Ga0213876_10003189 | Ga0213876_1000318918 | 177 |
| 396 | 3300021384 | Ga0213876_10027585 | Ga0213876_100275854 | 177 |
| 397 | 3300021384 | Ga0213876_10103540 | Ga0213876_101035401 | 177 |
| 398 | 3300025230 | Ga0209563_105604 | Ga0209563_1056043 | 177 |
| 399 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013742 | 177 |
| 400 | 3300025272 | Ga0209455_1020331 | Ga0209455_10203312 | 177 |
| 401 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013895 | 177 |
| 402 | 3300025297 | Ga0209758_1152298 | Ga0209758_11522981 | 177 |
| 403 | 3300025903 | Ga0207680_10002564 | Ga0207680_100025648 | 177 |
| 404 | 3300025903 | Ga0207680_10106453 | Ga0207680_101064533 | 177 |
| 405 | 3300025906 | Ga0207699_10000164 | Ga0207699_1000016422 | 177 |
| 406 | 3300025906 | Ga0207699_10037734 | Ga0207699_100377343 | 177 |
| 407 | 3300025907 | Ga0207645_10011392 | Ga0207645_100113927 | 177 |
| 408 | 3300025907 | Ga0207645_10473091 | Ga0207645_104730911 | 177 |
| 409 | 3300025909 | Ga0207705_10000180 | Ga0207705_1000018056 | 177 |
| 410 | 3300025909 | Ga0207705_10004720 | Ga0207705_1000472018 | 177 |
| 411 | 3300025909 | Ga0207705_10311673 | Ga0207705_103116733 | 177 |
| 412 | 3300025911 | Ga0207654_10033200 | Ga0207654_100332003 | 177 |
| 413 | 3300025911 | Ga0207654_10164797 | Ga0207654_101647973 | 177 |
| 414 | 3300025911 | Ga0207654_10428144 | Ga0207654_104281441 | 177 |
| 415 | 3300025911 | Ga0207654_10803875 | Ga0207654_108038752 | 177 |
| 416 | 3300025912 | Ga0207707_10000011 | Ga0207707_1000001118 | 177 |
| 417 | 3300025912 | Ga0207707_10002715 | Ga0207707_1000271518 | 177 |
| 418 | 3300025912 | Ga0207707_10048827 | Ga0207707_100488276 | 177 |
| 419 | 3300025912 | Ga0207707_10267082 | Ga0207707_102670822 | 177 |
| 420 | 3300025912 | Ga0207707_10563709 | Ga0207707_105637091 | 177 |
| 421 | 3300025913 | Ga0207695_10000018 | Ga0207695_1000001844 | 177 |
| 422 | 3300025913 | Ga0207695_10028316 | Ga0207695_100283167 | 177 |
| 423 | 3300025913 | Ga0207695_10040352 | Ga0207695_100403525 | 177 |
| 424 | 3300025913 | Ga0207695_10182399 | Ga0207695_101823992 | 177 |
| 425 | 3300025913 | Ga0207695_10217861 | Ga0207695_102178612 | 177 |
| 426 | 3300025913 | Ga0207695_10284139 | Ga0207695_102841392 | 177 |
| 427 | 3300025913 | Ga0207695_10284558 | Ga0207695_102845584 | 177 |
| 428 | 3300025913 | Ga0207695_10340402 | Ga0207695_103404022 | 177 |
| 429 | 3300025914 | Ga0207671_10019547 | Ga0207671_100195479 | 177 |
| 430 | 3300025914 | Ga0207671_10049879 | Ga0207671_100498792 | 177 |
| 431 | 3300025915 | Ga0207693_10001210 | Ga0207693_1000121019 | 177 |
| 432 | 3300025915 | Ga0207693_10001929 | Ga0207693_1000192915 | 177 |
| 433 | 3300025915 | Ga0207693_10055946 | Ga0207693_100559463 | 177 |
| 434 | 3300025915 | Ga0207693_10266868 | Ga0207693_102668683 | 177 |
| 435 | 3300025915 | Ga0207693_10375640 | Ga0207693_103756402 | 177 |
| 436 | 3300025916 | Ga0207663_10015424 | Ga0207663_100154245 | 177 |
| 437 | 3300025916 | Ga0207663_10172408 | Ga0207663_101724083 | 177 |
| 438 | 3300025916 | Ga0207663_11098027 | Ga0207663_110980271 | 177 |
| 439 | 3300025917 | Ga0207660_10000110 | Ga0207660_1000011026 | 177 |
| 440 | 3300025917 | Ga0207660_10003537 | Ga0207660_1000353718 | 177 |
| 441 | 3300025917 | Ga0207660_10069892 | Ga0207660_100698924 | 177 |
| 442 | 3300025917 | Ga0207660_10181434 | Ga0207660_101814342 | 177 |
| 443 | 3300025919 | Ga0207657_10000241 | Ga0207657_1000024129 | 177 |
| 444 | 3300025919 | Ga0207657_10063406 | Ga0207657_100634064 | 177 |
| 445 | 3300025919 | Ga0207657_10196503 | Ga0207657_101965031 | 177 |
| 446 | 3300025919 | Ga0207657_10280758 | Ga0207657_102807582 | 177 |
| 447 | 3300025920 | Ga0207649_10000194 | Ga0207649_1000019454 | 177 |
| 448 | 3300025921 | Ga0207652_10000824 | Ga0207652_1000082426 | 177 |
| 449 | 3300025921 | Ga0207652_10007774 | Ga0207652_1000777412 | 177 |
| 450 | 3300025921 | Ga0207652_10108322 | Ga0207652_101083224 | 177 |
| 451 | 3300025921 | Ga0207652_10115732 | Ga0207652_101157322 | 177 |
| 452 | 3300025924 | Ga0207694_10000010 | Ga0207694_10000010366 | 177 |
| 453 | 3300025924 | Ga0207694_10025930 | Ga0207694_100259309 | 177 |
| 454 | 3300025924 | Ga0207694_10221393 | Ga0207694_102213934 | 177 |
| 455 | 3300025924 | Ga0207694_10810215 | Ga0207694_108102151 | 177 |
| 456 | 3300025924 | Ga0207694_10850182 | Ga0207694_108501822 | 177 |
| 457 | 3300025924 | Ga0207694_10906379 | Ga0207694_109063791 | 177 |
| 458 | 3300025927 | Ga0207687_10017844 | Ga0207687_100178446 | 177 |
| 459 | 3300025927 | Ga0207687_10390587 | Ga0207687_103905871 | 177 |
| 460 | 3300025928 | Ga0207700_10000295 | Ga0207700_1000029518 | 177 |
| 461 | 3300025928 | Ga0207700_10130882 | Ga0207700_101308825 | 177 |
| 462 | 3300025929 | Ga0207664_10073108 | Ga0207664_100731085 | 177 |
| 463 | 3300025929 | Ga0207664_10177988 | Ga0207664_101779883 | 177 |
| 464 | 3300025929 | Ga0207664_10312818 | Ga0207664_103128183 | 177 |
| 465 | 3300025932 | Ga0207690_10346628 | Ga0207690_103466282 | 177 |
| 466 | 3300025934 | Ga0207686_10163989 | Ga0207686_101639893 | 177 |
| 467 | 3300025937 | Ga0207669_10280567 | Ga0207669_102805671 | 177 |
| 468 | 3300025938 | Ga0207704_10122838 | Ga0207704_101228383 | 177 |
| 469 | 3300025939 | Ga0207665_10301672 | Ga0207665_103016723 | 177 |
| 470 | 3300025941 | Ga0207711_10000002 | Ga0207711_1000000218 | 177 |
| 471 | 3300025941 | Ga0207711_10145656 | Ga0207711_101456563 | 177 |
| 472 | 3300025942 | Ga0207689_10261962 | Ga0207689_102619621 | 177 |
| 473 | 3300025944 | Ga0207661_10144696 | Ga0207661_101446964 | 177 |
| 474 | 3300025944 | Ga0207661_10219381 | Ga0207661_102193811 | 177 |
| 475 | 3300025944 | Ga0207661_10500695 | Ga0207661_105006952 | 177 |
| 476 | 3300025945 | Ga0207679_10701601 | Ga0207679_107016011 | 177 |
| 477 | 3300025949 | Ga0207667_10000388 | Ga0207667_1000038857 | 177 |
| 478 | 3300025949 | Ga0207667_10031700 | Ga0207667_1003170010 | 177 |
| 479 | 3300025949 | Ga0207667_10542855 | Ga0207667_105428552 | 177 |
| 480 | 3300025949 | Ga0207667_10582275 | Ga0207667_105822753 | 177 |
| 481 | 3300025960 | Ga0207651_10727070 | Ga0207651_107270702 | 177 |
| 482 | 3300025961 | Ga0207712_11134703 | Ga0207712_111347032 | 177 |
| 483 | 3300025961 | Ga0207712_11399583 | Ga0207712_113995831 | 177 |
| 484 | 3300025972 | Ga0207668_10971586 | Ga0207668_109715862 | 177 |
| 485 | 3300025981 | Ga0207640_10040030 | Ga0207640_100400301 | 177 |
| 486 | 3300025986 | Ga0207658_10058513 | Ga0207658_100585134 | 177 |
| 487 | 3300025986 | Ga0207658_10134474 | Ga0207658_101344742 | 177 |
| 488 | 3300026035 | Ga0207703_10027678 | Ga0207703_100276784 | 177 |
| 489 | 3300026035 | Ga0207703_10064130 | Ga0207703_100641303 | 177 |
| 490 | 3300026041 | Ga0207639_10000867 | Ga0207639_100008677 | 177 |
| 491 | 3300026041 | Ga0207639_10059896 | Ga0207639_100598962 | 177 |
| 492 | 3300026041 | Ga0207639_10979110 | Ga0207639_109791102 | 177 |
| 493 | 3300026041 | Ga0207639_11233052 | Ga0207639_112330522 | 177 |
| 494 | 3300026041 | Ga0207639_11280022 | Ga0207639_112800221 | 177 |
| 495 | 3300026078 | Ga0207702_10000315 | Ga0207702_1000031533 | 177 |
| 496 | 3300026078 | Ga0207702_10348694 | Ga0207702_103486942 | 177 |
| 497 | 3300026078 | Ga0207702_10583836 | Ga0207702_105838362 | 177 |
| 498 | 3300026078 | Ga0207702_10776759 | Ga0207702_107767592 | 177 |
| 499 | 3300026088 | Ga0207641_10035109 | Ga0207641_100351098 | 177 |
| 500 | 3300026089 | Ga0207648_10243653 | Ga0207648_102436533 | 177 |
| 501 | 3300026095 | Ga0207676_10707429 | Ga0207676_107074291 | 177 |
| 502 | 3300026116 | Ga0207674_10001605 | Ga0207674_1000160523 | 177 |
| 503 | 3300026116 | Ga0207674_10291835 | Ga0207674_102918353 | 177 |
| 504 | 3300026116 | Ga0207674_11105553 | Ga0207674_111055532 | 177 |
| 505 | 3300026118 | Ga0207675_100278079 | Ga0207675_1002780793 | 177 |
| 506 | 3300026121 | Ga0207683_10018489 | Ga0207683_100184897 | 177 |
| 507 | 3300026121 | Ga0207683_10103171 | Ga0207683_101031715 | 177 |
| 508 | 3300026121 | Ga0207683_10264595 | Ga0207683_102645952 | 177 |
| 509 | 3300026121 | Ga0207683_10493868 | Ga0207683_104938682 | 177 |
| 510 | 3300026142 | Ga0207698_10042447 | Ga0207698_100424476 | 177 |
| 511 | 3300026142 | Ga0207698_10086858 | Ga0207698_100868583 | 177 |
| 512 | 3300026142 | Ga0207698_10144541 | Ga0207698_101445412 | 177 |
| 513 | 3300027471 | Ga0209995_1003999 | Ga0209995_10039995 | 177 |
| 514 | 3300027526 | Ga0209968_1004743 | Ga0209968_10047432 | 177 |
| 515 | 3300027614 | Ga0209970_1056276 | Ga0209970_10562762 | 177 |
| 516 | 3300027682 | Ga0209971_1044728 | Ga0209971_10447282 | 177 |
| 517 | 3300027876 | Ga0209974_10060510 | Ga0209974_100605101 | 177 |
| 518 | 3300027876 | Ga0209974_10065728 | Ga0209974_100657281 | 177 |
| 519 | 3300027907 | Ga0207428_10002412 | Ga0207428_1000241213 | 177 |
| 520 | 3300028379 | Ga0268266_10000557 | Ga0268266_1000055718 | 177 |
| 521 | 3300028379 | Ga0268266_10055515 | Ga0268266_100555154 | 177 |
| 522 | 3300028379 | Ga0268266_10076582 | Ga0268266_100765825 | 177 |
| 523 | 3300028379 | Ga0268266_10092509 | Ga0268266_100925093 | 177 |
| 524 | 3300028379 | Ga0268266_10095842 | Ga0268266_100958424 | 177 |
| 525 | 3300028380 | Ga0268265_10295536 | Ga0268265_102955362 | 177 |
| 526 | 3300028381 | Ga0268264_10561069 | Ga0268264_105610692 | 177 |
| 527 | 3300028381 | Ga0268264_11168559 | Ga0268264_111685592 | 177 |
| 528 | 3300028556 | Ga0265337_1001102 | Ga0265337_100110213 | 177 |
| 529 | 3300028573 | Ga0265334_10001106 | Ga0265334_1000110617 | 177 |
| 530 | 3300028573 | Ga0265334_10116749 | Ga0265334_101167492 | 177 |
| 531 | 3300028577 | Ga0265318_10000037 | Ga0265318_1000003718 | 177 |
| 532 | 3300028800 | Ga0265338_10000017 | Ga0265338_10000017293 | 177 |
| 533 | 3300028800 | Ga0265338_10002896 | Ga0265338_1000289629 | 177 |
| 534 | 3300028800 | Ga0265338_10005387 | Ga0265338_1000538718 | 177 |
| 535 | 3300028800 | Ga0265338_10017000 | Ga0265338_1001700016 | 177 |
| 536 | 3300028800 | Ga0265338_10038201 | Ga0265338_1003820110 | 177 |
| 537 | 3300028800 | Ga0265338_10073797 | Ga0265338_100737975 | 177 |
| 538 | 3300028800 | Ga0265338_10106186 | Ga0265338_101061865 | 177 |
| 539 | 3300028800 | Ga0265338_10165948 | Ga0265338_101659483 | 177 |
| 540 | 3300028800 | Ga0265338_10203129 | Ga0265338_102031293 | 177 |
| 541 | 3300028800 | Ga0265338_10647847 | Ga0265338_106478471 | 177 |
| 542 | 3300029957 | Ga0265324_10193448 | Ga0265324_101934482 | 177 |
| 543 | 3300029957 | Ga0265324_10208133 | Ga0265324_102081331 | 177 |
| 544 | 3300031235 | Ga0265330_10006774 | Ga0265330_100067744 | 177 |
| 545 | 3300031238 | Ga0265332_10017915 | Ga0265332_100179156 | 177 |
| 546 | 3300031238 | Ga0265332_10071412 | Ga0265332_100714121 | 177 |
| 547 | 3300031238 | Ga0265332_10075392 | Ga0265332_100753923 | 177 |
| 548 | 3300031238 | Ga0265332_10197011 | Ga0265332_101970111 | 177 |
| 549 | 3300031240 | Ga0265320_10002069 | Ga0265320_1000206911 | 177 |
| 550 | 3300031240 | Ga0265320_10375024 | Ga0265320_103750241 | 177 |
| 551 | 3300031241 | Ga0265325_10000014 | Ga0265325_10000014136 | 177 |
| 552 | 3300031241 | Ga0265325_10000782 | Ga0265325_100007824 | 177 |
| 553 | 3300031241 | Ga0265325_10001732 | Ga0265325_1000173220 | 177 |
| 554 | 3300031241 | Ga0265325_10026992 | Ga0265325_100269926 | 177 |
| 555 | 3300031241 | Ga0265325_10032967 | Ga0265325_100329673 | 177 |
| 556 | 3300031241 | Ga0265325_10194349 | Ga0265325_101943491 | 177 |
| 557 | 3300031242 | Ga0265329_10025358 | Ga0265329_100253583 | 177 |
| 558 | 3300031242 | Ga0265329_10046592 | Ga0265329_100465923 | 177 |
| 559 | 3300031247 | Ga0265340_10001159 | Ga0265340_100011593 | 177 |
| 560 | 3300031247 | Ga0265340_10002869 | Ga0265340_1000286913 | 177 |
| 561 | 3300031247 | Ga0265340_10007526 | Ga0265340_1000752610 | 177 |
| 562 | 3300031247 | Ga0265340_10038201 | Ga0265340_100382012 | 177 |
| 563 | 3300031247 | Ga0265340_10042240 | Ga0265340_100422405 | 177 |
| 564 | 3300031247 | Ga0265340_10088506 | Ga0265340_100885063 | 177 |
| 565 | 3300031247 | Ga0265340_10092888 | Ga0265340_100928882 | 177 |
| 566 | 3300031249 | Ga0265339_10000256 | Ga0265339_1000025628 | 177 |
| 567 | 3300031249 | Ga0265339_10004825 | Ga0265339_1000482510 | 177 |
| 568 | 3300031249 | Ga0265339_10007379 | Ga0265339_1000737912 | 177 |
| 569 | 3300031249 | Ga0265339_10342389 | Ga0265339_103423891 | 177 |
| 570 | 3300031249 | Ga0265339_10485136 | Ga0265339_104851361 | 177 |
| 571 | 3300031250 | Ga0265331_10000186 | Ga0265331_1000018641 | 177 |
| 572 | 3300031250 | Ga0265331_10003502 | Ga0265331_1000350214 | 177 |
| 573 | 3300031250 | Ga0265331_10013838 | Ga0265331_100138387 | 177 |
| 574 | 3300031250 | Ga0265331_10022887 | Ga0265331_100228875 | 177 |
| 575 | 3300031250 | Ga0265331_10030688 | Ga0265331_100306885 | 177 |
| 576 | 3300031251 | Ga0265327_10000392 | Ga0265327_10000392120 | 177 |
| 577 | 3300031251 | Ga0265327_10009609 | Ga0265327_1000960915 | 177 |
| 578 | 3300031344 | Ga0265316_10021496 | Ga0265316_100214961 | 177 |
| 579 | 3300031344 | Ga0265316_10025355 | Ga0265316_100253552 | 177 |
| 580 | 3300031344 | Ga0265316_10026745 | Ga0265316_100267454 | 177 |
| 581 | 3300031344 | Ga0265316_10086571 | Ga0265316_100865715 | 177 |
| 582 | 3300031344 | Ga0265316_10096460 | Ga0265316_100964605 | 177 |
| 583 | 3300031344 | Ga0265316_10148087 | Ga0265316_101480873 | 177 |
| 584 | 3300031344 | Ga0265316_10257932 | Ga0265316_102579323 | 177 |
| 585 | 3300031344 | Ga0265316_10284113 | Ga0265316_102841131 | 177 |
| 586 | 3300031344 | Ga0265316_10377952 | Ga0265316_103779522 | 177 |
| 587 | 3300031548 | Ga0307408_100051689 | Ga0307408_1000516895 | 177 |
| 588 | 3300031595 | Ga0265313_10000800 | Ga0265313_1000080016 | 177 |
| 589 | 3300031595 | Ga0265313_10006102 | Ga0265313_100061027 | 177 |
| 590 | 3300031595 | Ga0265313_10012941 | Ga0265313_100129415 | 177 |
| 591 | 3300031595 | Ga0265313_10016941 | Ga0265313_100169416 | 177 |
| 592 | 3300031595 | Ga0265313_10019748 | Ga0265313_100197484 | 177 |
| 593 | 3300031595 | Ga0265313_10025680 | Ga0265313_100256803 | 177 |
| 594 | 3300031595 | Ga0265313_10076276 | Ga0265313_100762763 | 177 |
| 595 | 3300031595 | Ga0265313_10089662 | Ga0265313_100896623 | 177 |
| 596 | 3300031595 | Ga0265313_10100614 | Ga0265313_101006143 | 177 |
| 597 | 3300031595 | Ga0265313_10207677 | Ga0265313_102076772 | 177 |
| 598 | 3300031665 | Ga0316575_10000986 | Ga0316575_100009866 | 177 |
| 599 | 3300031665 | Ga0316575_10019455 | Ga0316575_100194555 | 177 |
| 600 | 3300031691 | Ga0316579_10005295 | Ga0316579_1000529513 | 177 |
| 601 | 3300031691 | Ga0316579_10010128 | Ga0316579_100101284 | 177 |
| 602 | 3300031711 | Ga0265314_10000963 | Ga0265314_100009632 | 177 |
| 603 | 3300031711 | Ga0265314_10004460 | Ga0265314_1000446019 | 177 |
| 604 | 3300031711 | Ga0265314_10024805 | Ga0265314_100248057 | 177 |
| 605 | 3300031711 | Ga0265314_10027129 | Ga0265314_1002712910 | 177 |
| 606 | 3300031711 | Ga0265314_10041547 | Ga0265314_100415471 | 177 |
| 607 | 3300031711 | Ga0265314_10055387 | Ga0265314_100553875 | 177 |
| 608 | 3300031711 | Ga0265314_10056619 | Ga0265314_100566192 | 177 |
| 609 | 3300031711 | Ga0265314_10068911 | Ga0265314_100689114 | 177 |
| 610 | 3300031711 | Ga0265314_10107669 | Ga0265314_101076694 | 177 |
| 611 | 3300031711 | Ga0265314_10178064 | Ga0265314_101780643 | 177 |
| 612 | 3300031712 | Ga0265342_10006333 | Ga0265342_100063336 | 177 |
| 613 | 3300031712 | Ga0265342_10021698 | Ga0265342_100216987 | 177 |
| 614 | 3300031712 | Ga0265342_10072247 | Ga0265342_100722473 | 177 |
| 615 | 3300031712 | Ga0265342_10090627 | Ga0265342_100906274 | 177 |
| 616 | 3300031712 | Ga0265342_10338731 | Ga0265342_103387311 | 177 |
| 617 | 3300031712 | Ga0265342_10344967 | Ga0265342_103449671 | 177 |
| 618 | 3300031727 | Ga0316576_10005834 | Ga0316576_1000583413 | 177 |
| 619 | 3300031728 | Ga0316578_10039175 | Ga0316578_100391752 | 177 |
| 620 | 3300031728 | Ga0316578_10212536 | Ga0316578_102125362 | 177 |
| 621 | 3300031730 | Ga0307516_10054857 | Ga0307516_100548573 | 177 |
| 622 | 3300031730 | Ga0307516_10069198 | Ga0307516_100691986 | 177 |
| 623 | 3300031730 | Ga0307516_10507566 | Ga0307516_105075662 | 177 |
| 624 | 3300031731 | Ga0307405_10008723 | Ga0307405_100087233 | 177 |
| 625 | 3300031733 | Ga0316577_10032670 | Ga0316577_100326702 | 177 |
| 626 | 3300031733 | Ga0316577_10043034 | Ga0316577_100430343 | 177 |
| 627 | 3300031824 | Ga0307413_10061509 | Ga0307413_100615095 | 177 |
| 628 | 3300031852 | Ga0307410_10138609 | Ga0307410_101386094 | 177 |
| 629 | 3300031852 | Ga0307410_10183150 | Ga0307410_101831502 | 177 |
| 630 | 3300031901 | Ga0307406_10072399 | Ga0307406_100723994 | 177 |
| 631 | 3300031903 | Ga0307407_10102413 | Ga0307407_101024134 | 177 |
| 632 | 3300031911 | Ga0307412_10046496 | Ga0307412_100464963 | 177 |
| 633 | 3300031995 | Ga0307409_100030160 | Ga0307409_1000301606 | 177 |
| 634 | 3300032002 | Ga0307416_100005600 | Ga0307416_10000560015 | 177 |
| 635 | 3300032002 | Ga0307416_100212504 | Ga0307416_1002125041 | 177 |
| 636 | 3300032004 | Ga0307414_10939816 | Ga0307414_109398161 | 177 |
| 637 | 3300032005 | Ga0307411_10103293 | Ga0307411_101032934 | 177 |
| 638 | 3300032005 | Ga0307411_11126293 | Ga0307411_111262931 | 177 |
| 639 | 3300032126 | Ga0307415_100095913 | Ga0307415_1000959133 | 177 |
| 640 | 3300032133 | Ga0316583_10000484 | Ga0316583_1000048414 | 177 |
| 641 | 3300032133 | Ga0316583_10018653 | Ga0316583_100186535 | 177 |
| 642 | 3300032133 | Ga0316583_10069563 | Ga0316583_100695632 | 177 |
| 643 | 3300032137 | Ga0316585_10002061 | Ga0316585_100020616 | 177 |
| 644 | 3300032137 | Ga0316585_10058099 | Ga0316585_100580992 | 177 |
| 645 | 3300032139 | Ga0316580_10020547 | Ga0316580_100205474 | 177 |
| 646 | 3300032139 | Ga0316580_10021418 | Ga0316580_100214182 | 177 |
| 647 | 3300032139 | Ga0316580_10025904 | Ga0316580_100259044 | 177 |
| 648 | 3300032168 | Ga0316593_10000349 | Ga0316593_100003493 | 177 |
| 649 | 3300032168 | Ga0316593_10001237 | Ga0316593_100012372 | 177 |
| 650 | 3300032168 | Ga0316593_10054391 | Ga0316593_100543912 | 177 |
| 651 | 3300033524 | Ga0316592_1007100 | Ga0316592_10071001 | 177 |
| 652 | 3300033527 | Ga0316586_1000300 | Ga0316586_10003002 | 177 |
| 653 | 3300033528 | Ga0316588_1046158 | Ga0316588_10461582 | 177 |
| 654 | 3300033541 | Ga0316596_1000615 | Ga0316596_100061512 | 177 |
| 655 | 3300035089 | Ga0373944_0067559 | Ga0373944_0067559_593_1126 | 177 |
| 656 | 3300035111 | Ga0373923_0032705 | Ga0373923_0032705_961_1497 | 177 |
| 657 | 3300035111 | Ga0373923_0098301 | Ga0373923_0098301_415_948 | 177 |
| 658 | 3300035113 | Ga0373936_0008097 | Ga0373936_0008097_798_1331 | 177 |
| 659 | 3300035114 | Ga0373939_0042238 | Ga0373939_0042238_721_1254 | 177 |
| 660 | 3300035114 | Ga0373939_0081663 | Ga0373939_0081663_282_815 | 177 |
| 661 | 3300035116 | Ga0373945_0006653 | Ga0373945_0006653_2715_3248 | 177 |
| 662 | 3300035116 | Ga0373945_0078958 | Ga0373945_0078958_471_1007 | 177 |
| 663 | 3300035117 | Ga0373953_0157382 | Ga0373953_0157382_55_588 | 177 |
| 664 | 3300035119 | Ga0373956_0029348 | Ga0373956_0029348_778_1314 | 177 |
| 665 | 3300035119 | Ga0373956_0248982 | Ga0373956_0248982_283_816 | 177 |
| 666 | 3300035170 | Ga0373943_0007235 | Ga0373943_0007235_3746_4279 | 177 |
| 667 | 3300035170 | Ga0373943_0080948 | Ga0373943_0080948_55_588 | 177 |
| 668 | 3300035172 | Ga0373955_0005106 | Ga0373955_0005106_4195_4731 | 177 |
| 669 | 3300035172 | Ga0373955_0036549 | Ga0373955_0036549_679_1212 | 177 |
| 670 | 3300035241 | Ga0373961_0048959 | Ga0373961_0048959_642_1175 | 177 |
| 671 | 3300035241 | Ga0373961_0095359 | Ga0373961_0095359_37_570 | 177 |
| 672 | 3300035398 | Ga0316574_0001643 | Ga0316574_0001643_2092_2625 | 177 |
| 673 | 3300035398 | Ga0316574_0008846 | Ga0316574_0008846_224_757 | 177 |
| 674 | 3300035398 | Ga0316574_0038291 | Ga0316574_0038291_1909_2442 | 177 |
| 675 | 3300035398 | Ga0316574_0203323 | Ga0316574_0203323_148_681 | 177 |
| 676 | 3300035398 | Ga0316574_0389410 | Ga0316574_0389410_182_715 | 177 |
| 677 | 3300035691 | Ga0373931_0085845 | Ga0373931_0085845_688_1221 | 177 |
| 678 | 3300035691 | Ga0373931_0553263 | Ga0373931_0553263_124_657 | 177 |
| 679 | 3300035692 | Ga0373935_0003403 | Ga0373935_0003403_7095_7628 | 177 |
| 680 | 3300035692 | Ga0373935_0084560 | Ga0373935_0084560_937_1473 | 177 |
| 681 | 3300035692 | Ga0373935_0934841 | Ga0373935_0934841_16_549 | 177 |
| 682 | 3300035695 | Ga0373927_0064151 | Ga0373927_0064151_1384_1917 | 177 |
| 683 | 3300035695 | Ga0373927_0158783 | Ga0373927_0158783_728_1264 | 177 |
| 684 | 3300035695 | Ga0373927_0167531 | Ga0373927_0167531_619_1152 | 177 |
| 685 | 3300035724 | Ga0373933_0005271 | Ga0373933_0005271_6394_6930 | 177 |
| 686 | 3300035724 | Ga0373933_0043309 | Ga0373933_0043309_1336_1872 | 177 |
| 687 | 3300035724 | Ga0373933_0433396 | Ga0373933_0433396_97_630 | 177 |
| 688 | 3300035725 | Ga0373947_0011709 | Ga0373947_0011709_2745_3278 | 177 |
| 689 | 3300035725 | Ga0373947_0407002 | Ga0373947_0407002_168_701 | 177 |
| 690 | 3300036401 | Ga0373937_0003527 | Ga0373937_0003527_8868_9404 | 177 |
| 691 | 3300036401 | Ga0373937_0070199 | Ga0373937_0070199_718_1254 | 177 |
| 692 | 3300036401 | Ga0373937_0104200 | Ga0373937_0104200_1566_2099 | 177 |
| 693 | 3300036401 | Ga0373937_0128743 | Ga0373937_0128743_1655_2188 | 177 |
| 694 | 3300036401 | Ga0373937_0190143 | Ga0373937_0190143_60_593 | 177 |
| 695 | 3300036401 | Ga0373937_0193416 | Ga0373937_0193416_1089_1622 | 177 |
| 696 | 3300036401 | Ga0373937_0198482 | Ga0373937_0198482_642_1175 | 177 |
| 697 | 3300036401 | Ga0373937_0310051 | Ga0373937_0310051_821_1357 | 177 |
| 698 | 3300036401 | Ga0373937_0777101 | Ga0373937_0777101_260_793 | 177 |
| 699 | 3300036647 | Ga0316582_0012337 | Ga0316582_0012337_1083_1616 | 177 |
| 700 | 3300036647 | Ga0316582_0056650 | Ga0316582_0056650_1820_2353 | 177 |
| 701 | 3300036647 | Ga0316582_0243316 | Ga0316582_0243316_262_795 | 177 |
| 702 | 3300036712 | Ga0316584_0001849 | Ga0316584_0001849_9673_10206 | 177 |
| 703 | 3300037068 | Ga0373925_0002514 | Ga0373925_0002514_9015_9548 | 177 |
| 704 | 3300037068 | Ga0373925_0133491 | Ga0373925_0133491_1248_1784 | 177 |
| 705 | 3300037312 | Ga0395899_0004948 | Ga0395899_0004948_7470_8003 | 177 |
| 706 | 3300037418 | Ga0395900_0062599 | Ga0395900_0062599_2456_2989 | 177 |
| 707 | 3300037418 | Ga0395900_0618268 | Ga0395900_0618268_278_811 | 177 |
| 708 | 3300037466 | Ga0395898_0003055 | Ga0395898_0003055_14694_15227 | 177 |
| 709 | 3300037466 | Ga0395898_0079037 | Ga0395898_0079037_1445_1978 | 177 |
| 710 | 3300037588 | Ga0316581_0008237 | Ga0316581_0008237_1074_1607 | 177 |
| 711 | 3300037588 | Ga0316581_0013780 | Ga0316581_0013780_509_1042 | 177 |
| 712 | 3300038443 | Ga0395901_0012391 | Ga0395901_0012391_2099_2632 | 177 |
| 713 | 3300038741 | Ga0400488_12334 | Ga0400488_12334_719_1252 | 177 |
| 714 | 3300038742 | Ga0400486_17540 | Ga0400486_17540_523_1056 | 177 |
| 715 | 3300039110 | Ga0400487_00820 | Ga0400487_00820_846_1379 | 177 |
| 716 | 3300039437 | Ga0436365_0480014 | Ga0436365_0480014_56_589 | 177 |
| 717 | 3300039437 | Ga0436365_0544722 | Ga0436365_0544722_3432_3965 | 177 |
| 718 | 3300039437 | Ga0436365_0868084 | Ga0436365_0868084_28_564 | 177 |
| 719 | 3300039437 | Ga0436365_1215018 | Ga0436365_1215018_1859_2392 | 177 |
| 720 | 3300039437 | Ga0436365_1239236 | Ga0436365_1239236_14632_15165 | 177 |
| 721 | 3300039437 | Ga0436365_1437117 | Ga0436365_1437117_720_1253 | 177 |
| 722 | 3300039437 | Ga0436365_1637588 | Ga0436365_1637588_24841_25374 | 177 |
| 723 | 3300039438 | Ga0436360_0360048 | Ga0436360_0360048_727_1260 | 177 |
| 724 | 3300039438 | Ga0436360_0449234 | Ga0436360_0449234_228_761 | 177 |
| 725 | 3300039438 | Ga0436360_0716296 | Ga0436360_0716296_967_1500 | 177 |
| 726 | 3300039447 | Ga0436361_0767135 | Ga0436361_0767135_208_741 | 177 |
| 727 | 3300039450 | Ga0436363_0427400 | Ga0436363_0427400_2004_2537 | 177 |
| 728 | 3300039450 | Ga0436363_0896516 | Ga0436363_0896516_126_659 | 177 |
| 729 | 3300039450 | Ga0436363_1470856 | Ga0436363_1470856_1402_1935 | 177 |
| 730 | 3300041452 | Ga0451793_0170406 | Ga0451793_0170406_239_772 | 177 |
| 731 | 3300041459 | Ga0451800_0024754 | Ga0451800_0024754_176_709 | 177 |
| 732 | 3300041460 | Ga0451802_1407499 | Ga0451802_1407499_49_582 | 177 |
| 733 | 3300042461 | Ga0439460_0224418 | Ga0439460_0224418_68_601 | 177 |
| 734 | 3300044842 | Ga0466957_0637262 | Ga0466957_0637262_29_562 | 177 |
| 735 | 3300045976 | Ga0466967_0059567 | Ga0466967_0059567_1481_2014 | 177 |
| 736 | 3300046454 | Ga0495592_0176228 | Ga0495592_0176228_650_1183 | 177 |
| 737 | 3300046454 | Ga0495592_0423576 | Ga0495592_0423576_17_550 | 177 |
| 738 | 3300046462 | Ga0495651_0186790 | Ga0495651_0186790_819_1352 | 177 |
| 739 | 3300046462 | Ga0495651_0385149 | Ga0495651_0385149_255_788 | 177 |
| 740 | 3300046472 | Ga0495580_0003736 | Ga0495580_0003736_4990_5523 | 177 |
| 741 | 3300046472 | Ga0495580_0046288 | Ga0495580_0046288_1218_1754 | 177 |
| 742 | 3300046473 | Ga0495582_0043074 | Ga0495582_0043074_1007_1540 | 177 |
| 743 | 3300046477 | Ga0495664_0034829 | Ga0495664_0034829_1730_2263 | 177 |
| 744 | 3300046477 | Ga0495664_0225171 | Ga0495664_0225171_422_955 | 177 |
| 745 | 3300046516 | Ga0495628_0328258 | Ga0495628_0328258_320_853 | 177 |
| 746 | 3300046518 | Ga0495631_0321349 | Ga0495631_0321349_43_576 | 177 |
| 747 | 3300046519 | Ga0495632_0278674 | Ga0495632_0278674_104_637 | 177 |
| 748 | 3300046529 | Ga0495652_0041688 | Ga0495652_0041688_2856_3389 | 177 |
| 749 | 3300046530 | Ga0495654_0052557 | Ga0495654_0052557_980_1513 | 177 |
| 750 | 3300046531 | Ga0495665_0106424 | Ga0495665_0106424_120_653 | 177 |
| 751 | 3300046536 | Ga0495587_0050256 | Ga0495587_0050256_1564_2097 | 177 |
| 752 | 3300046543 | Ga0495645_0086993 | Ga0495645_0086993_1141_1674 | 177 |
| 753 | 3300046543 | Ga0495645_0219231 | Ga0495645_0219231_465_998 | 177 |
| 754 | 3300046557 | Ga0495622_0003379 | Ga0495622_0003379_3211_3744 | 177 |
| 755 | 3300046557 | Ga0495622_0149869 | Ga0495622_0149869_118_651 | 177 |
| 756 | 3300046615 | Ga0495656_0173839 | Ga0495656_0173839_499_1032 | 177 |
| 757 | 3300046660 | Ga0495625_0123475 | Ga0495625_0123475_1063_1596 | 177 |
| 758 | 3300046675 | Ga0495657_0129487 | Ga0495657_0129487_229_762 | 177 |
| 759 | 3300046678 | Ga0495599_0306982 | Ga0495599_0306982_414_947 | 177 |
| 760 | 3300046679 | Ga0495623_0165906 | Ga0495623_0165906_223_759 | 177 |
| 761 | 3300046683 | Ga0495658_0001492 | Ga0495658_0001492_8969_9502 | 177 |
| 762 | 3300046689 | Ga0495613_0442729 | Ga0495613_0442729_15_548 | 177 |
| 763 | 3300046690 | Ga0495624_0413944 | Ga0495624_0413944_76_609 | 177 |
| 764 | 3300046692 | Ga0495671_0298960 | Ga0495671_0298960_125_658 | 177 |
| 765 | 3300046694 | Ga0495649_0106764 | Ga0495649_0106764_354_887 | 177 |
| 766 | 3300046794 | Ga0495589_0093052 | Ga0495589_0093052_542_1075 | 177 |
| 767 | 3300047318 | Ga0495636_0324543 | Ga0495636_0324543_100_633 | 177 |
| 768 | 3300047323 | Ga0495683_0134375 | Ga0495683_0134375_413_946 | 177 |
| 769 | 3300047444 | Ga0495675_0062651 | Ga0495675_0062651_1530_2063 | 177 |
| 770 | 3300047469 | Ga0495673_0177677 | Ga0495673_0177677_231_764 | 177 |
| 771 | 3300047470 | Ga0495681_0247614 | Ga0495681_0247614_14_547 | 177 |
| 772 | 3300047471 | Ga0495684_0119581 | Ga0495684_0119581_843_1379 | 177 |
| 773 | 3300048088 | Ga0495602_0035348 | Ga0495602_0035348_73_609 | 177 |
| 774 | 3300048088 | Ga0495602_0308838 | Ga0495602_0308838_215_748 | 177 |
| 775 | 3300048088 | Ga0495602_0563739 | Ga0495602_0563739_157_690 | 177 |
| 776 | 3300048090 | Ga0495615_0027787 | Ga0495615_0027787_470_1003 | 177 |
| 777 | 3300048091 | Ga0495626_0026549 | Ga0495626_0026549_73_606 | 177 |
| 778 | 3300048903 | Ga0496100_0292146 | Ga0496100_0292146_275_808 | 177 |
| 779 | 3300048907 | Ga0496104_0414671 | Ga0496104_0414671_160_696 | 177 |
| 780 | 3300048910 | Ga0496107_0164931 | Ga0496107_0164931_1017_1550 | 177 |
| 781 | 3300048915 | Ga0496112_0440330 | Ga0496112_0440330_151_684 | 177 |
| 782 | 3300048924 | Ga0496121_0006108 | Ga0496121_0006108_6035_6568 | 177 |
| 783 | 3300048929 | Ga0496126_0077598 | Ga0496126_0077598_1523_2056 | 177 |
| 784 | 3300049460 | Ga0495682_0005207 | Ga0495682_0005207_4497_5030 | 177 |
| 785 | 3300049568 | Ga0501031_0037261 | Ga0501031_0037261_442_987 | 177 |
| 786 | 3300049568 | Ga0501031_0068962 | Ga0501031_0068962_408_941 | 177 |
| 787 | 3300049568 | Ga0501031_0094198 | Ga0501031_0094198_338_871 | 177 |
| 788 | 3300049568 | Ga0501031_0518639 | Ga0501031_0518639_192_725 | 177 |
| 789 | 3300049569 | Ga0501032_0001267 | Ga0501032_0001267_8048_8593 | 177 |
| 790 | 3300049569 | Ga0501032_0004362 | Ga0501032_0004362_5952_6485 | 177 |
| 791 | 3300049569 | Ga0501032_0019862 | Ga0501032_0019862_1965_2498 | 177 |
| 792 | 3300049569 | Ga0501032_0020357 | Ga0501032_0020357_102_635 | 177 |
| 793 | 3300049569 | Ga0501032_0030051 | Ga0501032_0030051_1099_1632 | 177 |
| 794 | 3300049569 | Ga0501032_0178940 | Ga0501032_0178940_515_1048 | 177 |
| 795 | 3300049569 | Ga0501032_0201791 | Ga0501032_0201791_744_1277 | 177 |
| 796 | 3300049570 | Ga0501033_0005260 | Ga0501033_0005260_6557_7090 | 177 |
| 797 | 3300049570 | Ga0501033_0012240 | Ga0501033_0012240_2136_2669 | 177 |
| 798 | 3300049570 | Ga0501033_0012917 | Ga0501033_0012917_740_1273 | 177 |
| 799 | 3300049570 | Ga0501033_0036296 | Ga0501033_0036296_2713_3246 | 177 |
| 800 | 3300049570 | Ga0501033_0175565 | Ga0501033_0175565_971_1504 | 177 |
| 801 | 3300049570 | Ga0501033_0180575 | Ga0501033_0180575_188_733 | 177 |
| 802 | 3300049570 | Ga0501033_0322472 | Ga0501033_0322472_297_830 | 177 |
| 803 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_122646_123191 | 177 |
| 804 | 3300049571 | Ga0501034_0010632 | Ga0501034_0010632_6834_7367 | 177 |
| 805 | 3300049571 | Ga0501034_0011194 | Ga0501034_0011194_1291_1824 | 177 |
| 806 | 3300049571 | Ga0501034_0027593 | Ga0501034_0027593_315_848 | 177 |
| 807 | 3300049571 | Ga0501034_0076662 | Ga0501034_0076662_2242_2775 | 177 |
| 808 | 3300049571 | Ga0501034_0076809 | Ga0501034_0076809_2571_3104 | 177 |
| 809 | 3300049571 | Ga0501034_0091835 | Ga0501034_0091835_2069_2602 | 177 |
| 810 | 3300049571 | Ga0501034_0133506 | Ga0501034_0133506_1103_1636 | 177 |
| 811 | 3300049571 | Ga0501034_0171039 | Ga0501034_0171039_1444_1977 | 177 |
| 812 | 3300049571 | Ga0501034_0251625 | Ga0501034_0251625_344_877 | 177 |
| 813 | 3300049571 | Ga0501034_1082268 | Ga0501034_1082268_20_553 | 177 |
| 814 | 3300049572 | Ga0501036_0005653 | Ga0501036_0005653_7421_7954 | 177 |
| 815 | 3300049572 | Ga0501036_0005682 | Ga0501036_0005682_7475_8020 | 177 |
| 816 | 3300049572 | Ga0501036_0009536 | Ga0501036_0009536_4150_4683 | 177 |
| 817 | 3300049573 | Ga0501037_0024753 | Ga0501037_0024753_2280_2813 | 177 |
| 818 | 3300049573 | Ga0501037_0039814 | Ga0501037_0039814_2644_3189 | 177 |
| 819 | 3300049573 | Ga0501037_0091860 | Ga0501037_0091860_85_618 | 177 |
| 820 | 3300049573 | Ga0501037_0130333 | Ga0501037_0130333_911_1444 | 177 |
| 821 | 3300049573 | Ga0501037_0314591 | Ga0501037_0314591_346_879 | 177 |
| 822 | 3300049573 | Ga0501037_0466743 | Ga0501037_0466743_274_819 | 177 |
| 823 | 3300049574 | Ga0501038_0088134 | Ga0501038_0088134_1628_2161 | 177 |
| 824 | 3300049574 | Ga0501038_0116476 | Ga0501038_0116476_1023_1556 | 177 |
| 825 | 3300049574 | Ga0501038_0146861 | Ga0501038_0146861_1296_1829 | 177 |
| 826 | 3300049574 | Ga0501038_0147189 | Ga0501038_0147189_667_1200 | 177 |
| 827 | 3300049574 | Ga0501038_0237262 | Ga0501038_0237262_134_667 | 177 |
| 828 | 3300049574 | Ga0501038_0240433 | Ga0501038_0240433_690_1223 | 177 |
| 829 | 3300049574 | Ga0501038_0349287 | Ga0501038_0349287_94_627 | 177 |
| 830 | 3300049574 | Ga0501038_0681305 | Ga0501038_0681305_122_655 | 177 |
| 831 | 3300049575 | Ga0501039_0000029 | Ga0501039_0000029_123194_123739 | 177 |
| 832 | 3300049575 | Ga0501039_0019053 | Ga0501039_0019053_4033_4566 | 177 |
| 833 | 3300049575 | Ga0501039_0168128 | Ga0501039_0168128_242_775 | 177 |
| 834 | 3300049575 | Ga0501039_0222759 | Ga0501039_0222759_643_1176 | 177 |
| 835 | 3300049575 | Ga0501039_0349542 | Ga0501039_0349542_310_843 | 177 |
| 836 | 3300049575 | Ga0501039_1171961 | Ga0501039_1171961_17_550 | 177 |
| 837 | 3300049578 | Ga0501042_0098300 | Ga0501042_0098300_613_1146 | 177 |
| 838 | 3300049578 | Ga0501042_0392993 | Ga0501042_0392993_319_852 | 177 |
| 839 | 3300049579 | Ga0501043_0010388 | Ga0501043_0010388_1726_2259 | 177 |
| 840 | 3300049579 | Ga0501043_0014584 | Ga0501043_0014584_4451_4984 | 177 |
| 841 | 3300049579 | Ga0501043_0097012 | Ga0501043_0097012_1040_1573 | 177 |
| 842 | 3300049579 | Ga0501043_0198900 | Ga0501043_0198900_347_880 | 177 |
| 843 | 3300049579 | Ga0501043_0228594 | Ga0501043_0228594_363_896 | 177 |
| 844 | 3300049579 | Ga0501043_0369496 | Ga0501043_0369496_34_567 | 177 |
| 845 | 3300049579 | Ga0501043_0399659 | Ga0501043_0399659_215_748 | 177 |
| 846 | 3300049580 | Ga0501046_0005416 | Ga0501046_0005416_5840_6373 | 177 |
| 847 | 3300049580 | Ga0501046_0011762 | Ga0501046_0011762_5317_5850 | 177 |
| 848 | 3300049580 | Ga0501046_0012992 | Ga0501046_0012992_5872_6405 | 177 |
| 849 | 3300049581 | Ga0501047_0018715 | Ga0501047_0018715_2248_2781 | 177 |
| 850 | 3300049581 | Ga0501047_0025996 | Ga0501047_0025996_952_1485 | 177 |
| 851 | 3300049581 | Ga0501047_0065087 | Ga0501047_0065087_2399_2932 | 177 |
| 852 | 3300049581 | Ga0501047_0075405 | Ga0501047_0075405_1343_1876 | 177 |
| 853 | 3300049581 | Ga0501047_0131220 | Ga0501047_0131220_868_1401 | 177 |
| 854 | 3300049581 | Ga0501047_0138742 | Ga0501047_0138742_1260_1793 | 177 |
| 855 | 3300049581 | Ga0501047_0160994 | Ga0501047_0160994_666_1199 | 177 |
| 856 | 3300049581 | Ga0501047_0176653 | Ga0501047_0176653_90_623 | 177 |
| 857 | 3300049581 | Ga0501047_0251827 | Ga0501047_0251827_930_1463 | 177 |
| 858 | 3300049581 | Ga0501047_0375584 | Ga0501047_0375584_44_577 | 177 |
| 859 | 3300049581 | Ga0501047_0441537 | Ga0501047_0441537_488_1021 | 177 |
| 860 | 3300049581 | Ga0501047_0492805 | Ga0501047_0492805_337_870 | 177 |
| 861 | 3300049581 | Ga0501047_0559308 | Ga0501047_0559308_147_680 | 177 |
| 862 | 3300049581 | Ga0501047_0798800 | Ga0501047_0798800_115_648 | 177 |
| 863 | 3300049581 | Ga0501047_0883324 | Ga0501047_0883324_19_552 | 177 |
| 864 | 3300049582 | Ga0501048_0023812 | Ga0501048_0023812_742_1275 | 177 |
| 865 | 3300049582 | Ga0501048_0124442 | Ga0501048_0124442_805_1338 | 177 |
| 866 | 3300049582 | Ga0501048_0209717 | Ga0501048_0209717_789_1322 | 177 |
| 867 | 3300049582 | Ga0501048_0278719 | Ga0501048_0278719_292_825 | 177 |
| 868 | 3300049583 | Ga0501067_0001776 | Ga0501067_0001776_3814_4347 | 177 |
| 869 | 3300049583 | Ga0501067_0005578 | Ga0501067_0005578_1676_2209 | 177 |
| 870 | 3300049583 | Ga0501067_0022624 | Ga0501067_0022624_543_1076 | 177 |
| 871 | 3300049584 | Ga0501068_0077512 | Ga0501068_0077512_73_606 | 177 |
| 872 | 3300049584 | Ga0501068_0601467 | Ga0501068_0601467_21_554 | 177 |
| 873 | 3300049585 | Ga0501069_0022165 | Ga0501069_0022165_1413_1946 | 177 |
| 874 | 3300049585 | Ga0501069_0333797 | Ga0501069_0333797_331_864 | 177 |
| 875 | 3300049586 | Ga0501070_0000481 | Ga0501070_0000481_31847_32380 | 177 |
| 876 | 3300049586 | Ga0501070_0003398 | Ga0501070_0003398_8137_8670 | 177 |
| 877 | 3300049586 | Ga0501070_0014964 | Ga0501070_0014964_2204_2737 | 177 |
| 878 | 3300049586 | Ga0501070_0143912 | Ga0501070_0143912_959_1492 | 177 |
| 879 | 3300049586 | Ga0501070_0178515 | Ga0501070_0178515_935_1468 | 177 |
| 880 | 3300049586 | Ga0501070_0309863 | Ga0501070_0309863_591_1124 | 177 |
| 881 | 3300049586 | Ga0501070_0382617 | Ga0501070_0382617_381_914 | 177 |
| 882 | 3300049587 | Ga0501071_0135415 | Ga0501071_0135415_1228_1761 | 177 |
| 883 | 3300049587 | Ga0501071_0156932 | Ga0501071_0156932_312_845 | 177 |
| 884 | 3300049588 | Ga0501072_0015507 | Ga0501072_0015507_4165_4698 | 177 |
| 885 | 3300049589 | Ga0501073_0001669 | Ga0501073_0001669_12000_12533 | 177 |
| 886 | 3300049589 | Ga0501073_0004494 | Ga0501073_0004494_2437_2970 | 177 |
| 887 | 3300049589 | Ga0501073_0015128 | Ga0501073_0015128_1646_2179 | 177 |
| 888 | 3300049589 | Ga0501073_0059739 | Ga0501073_0059739_1558_2091 | 177 |
| 889 | 3300049589 | Ga0501073_0059886 | Ga0501073_0059886_596_1129 | 177 |
| 890 | 3300049589 | Ga0501073_0061078 | Ga0501073_0061078_118_651 | 177 |
| 891 | 3300049589 | Ga0501073_0070275 | Ga0501073_0070275_1490_2023 | 177 |
| 892 | 3300049590 | Ga0501074_0004453 | Ga0501074_0004453_1265_1798 | 177 |
| 893 | 3300049590 | Ga0501074_0042382 | Ga0501074_0042382_1290_1823 | 177 |
| 894 | 3300049590 | Ga0501074_0079197 | Ga0501074_0079197_872_1405 | 177 |
| 895 | 3300049593 | Ga0501077_0059400 | Ga0501077_0059400_171_704 | 177 |
| 896 | 3300049741 | Ga0501079_0001478 | Ga0501079_0001478_7473_8006 | 177 |
| 897 | 3300049741 | Ga0501079_0017836 | Ga0501079_0017836_2554_3087 | 177 |
| 898 | 3300049741 | Ga0501079_0140727 | Ga0501079_0140727_1166_1699 | 177 |
| 899 | 3300049741 | Ga0501079_0188192 | Ga0501079_0188192_1049_1582 | 177 |
| 900 | 3300049741 | Ga0501079_0330695 | Ga0501079_0330695_119_652 | 177 |
| 901 | 3300049742 | Ga0501080_0018079 | Ga0501080_0018079_5217_5750 | 177 |
| 902 | 3300049742 | Ga0501080_0040364 | Ga0501080_0040364_919_1452 | 177 |
| 903 | 3300049742 | Ga0501080_0043846 | Ga0501080_0043846_975_1508 | 177 |
| 904 | 3300049742 | Ga0501080_0062400 | Ga0501080_0062400_1290_1823 | 177 |
| 905 | 3300049742 | Ga0501080_0125187 | Ga0501080_0125187_409_942 | 177 |
| 906 | 3300049742 | Ga0501080_0179248 | Ga0501080_0179248_1033_1566 | 177 |
| 907 | 3300049742 | Ga0501080_0283362 | Ga0501080_0283362_864_1397 | 177 |
| 908 | 3300049742 | Ga0501080_0628681 | Ga0501080_0628681_274_807 | 177 |
| 909 | 3300049742 | Ga0501080_1069414 | Ga0501080_1069414_79_612 | 177 |
| 910 | 3300049744 | Ga0501083_0077301 | Ga0501083_0077301_1096_1629 | 177 |
| 911 | 3300049744 | Ga0501083_0089262 | Ga0501083_0089262_973_1506 | 177 |
| 912 | 3300049744 | Ga0501083_0117891 | Ga0501083_0117891_1176_1709 | 177 |
| 913 | 3300049744 | Ga0501083_0135923 | Ga0501083_0135923_655_1188 | 177 |
| 914 | 3300049744 | Ga0501083_0712658 | Ga0501083_0712658_29_562 | 177 |
| 915 | 3300049776 | Ga0501280_000425 | Ga0501280_000425_6190_6723 | 177 |
| 916 | 3300049778 | Ga0501282_002357 | Ga0501282_002357_58_591 | 177 |
| 917 | 3300049822 | Ga0501035_0019622 | Ga0501035_0019622_3306_3839 | 177 |
| 918 | 3300049822 | Ga0501035_0037025 | Ga0501035_0037025_2430_2963 | 177 |
| 919 | 3300049822 | Ga0501035_0044851 | Ga0501035_0044851_2438_2971 | 177 |
| 920 | 3300049822 | Ga0501035_0048543 | Ga0501035_0048543_657_1190 | 177 |
| 921 | 3300049822 | Ga0501035_0065562 | Ga0501035_0065562_1231_1764 | 177 |
| 922 | 3300049822 | Ga0501035_0085166 | Ga0501035_0085166_1890_2423 | 177 |
| 923 | 3300049822 | Ga0501035_0162505 | Ga0501035_0162505_303_836 | 177 |
| 924 | 3300049822 | Ga0501035_0190474 | Ga0501035_0190474_98_631 | 177 |
| 925 | 3300049822 | Ga0501035_0254054 | Ga0501035_0254054_268_813 | 177 |
| 926 | 3300049822 | Ga0501035_0300904 | Ga0501035_0300904_397_930 | 177 |
| 927 | 3300049822 | Ga0501035_0914179 | Ga0501035_0914179_10_543 | 177 |
| 928 | 3300049823 | Ga0501044_0015755 | Ga0501044_0015755_2570_3103 | 177 |
| 929 | 3300049823 | Ga0501044_0024878 | Ga0501044_0024878_772_1305 | 177 |
| 930 | 3300049823 | Ga0501044_0032329 | Ga0501044_0032329_3192_3725 | 177 |
| 931 | 3300049823 | Ga0501044_0044540 | Ga0501044_0044540_769_1302 | 177 |
| 932 | 3300049823 | Ga0501044_0099276 | Ga0501044_0099276_78_611 | 177 |
| 933 | 3300049823 | Ga0501044_0129184 | Ga0501044_0129184_437_970 | 177 |
| 934 | 3300049823 | Ga0501044_0140739 | Ga0501044_0140739_1824_2357 | 177 |
| 935 | 3300049823 | Ga0501044_0161480 | Ga0501044_0161480_1219_1752 | 177 |
| 936 | 3300049823 | Ga0501044_0210012 | Ga0501044_0210012_787_1332 | 177 |
| 937 | 3300049823 | Ga0501044_0504734 | Ga0501044_0504734_559_1092 | 177 |
| 938 | 3300049823 | Ga0501044_0519482 | Ga0501044_0519482_24_557 | 177 |
| 939 | 3300049824 | Ga0501045_0128835 | Ga0501045_0128835_1213_1746 | 177 |
| 940 | 3300050509 | nmdc:mga0qj67_173986_c1 | nmdc:mga0qj67_173986_c1_922_1455 | 177 |
| 941 | 3300050509 | nmdc:mga0qj67_275124_c1 | nmdc:mga0qj67_275124_c1_477_1010 | 177 |
| 942 | 3300050511 | nmdc:mga08y16_19140_c1 | nmdc:mga08y16_19140_c1_3347_3880 | 177 |
| 943 | 3300050512 | nmdc:mga0n895_10772_c1 | nmdc:mga0n895_10772_c1_4138_4671 | 177 |
| 944 | 3300050512 | nmdc:mga0n895_277025_c1 | nmdc:mga0n895_277025_c1_761_1297 | 177 |
| 945 | 3300050512 | nmdc:mga0n895_789078_c1 | nmdc:mga0n895_789078_c1_15_548 | 177 |
| 946 | 3300050513 | nmdc:mga0rr50_45774_c1 | nmdc:mga0rr50_45774_c1_2043_2576 | 177 |
| 947 | 3300050513 | nmdc:mga0rr50_7934_c1 | nmdc:mga0rr50_7934_c1_5362_5895 | 177 |
| 948 | 3300050514 | nmdc:mga08x19_177_c1 | nmdc:mga08x19_177_c1_14711_15244 | 177 |
| 949 | 3300050514 | nmdc:mga08x19_2026_c1 | nmdc:mga08x19_2026_c1_8616_9149 | 177 |
| 950 | 3300050514 | nmdc:mga08x19_945_c1 | nmdc:mga08x19_945_c1_7766_8299 | 177 |
| 951 | 3300050515 | nmdc:mga0a205_20420_c1 | nmdc:mga0a205_20420_c1_4769_5302 | 177 |
| 952 | 3300053085 | Ga0495619_0184369 | Ga0495619_0184369_701_1234 | 177 |
| 953 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_29097_29630 | 177 |
| 954 | 3300053094 | Ga0500566_0181241 | Ga0500566_0181241_80_613 | 177 |
| 955 | 3300053116 | Ga0500592_011077 | Ga0500592_011077_435_968 | 177 |
| 956 | 3300053118 | Ga0500594_0012014 | Ga0500594_0012014_368_901 | 177 |
| 957 | 3300053119 | Ga0500595_001661 | Ga0500595_001661_1750_2283 | 177 |
| 958 | 3300053119 | Ga0500595_101861 | Ga0500595_101861_109_642 | 177 |
| 959 | 3300053133 | Ga0500655_006392 | Ga0500655_006392_552_1085 | 177 |
| 960 | 3300053136 | Ga0500559_0020972 | Ga0500559_0020972_1279_1812 | 177 |
| 961 | 3300053139 | Ga0500568_0047421 | Ga0500568_0047421_131_664 | 177 |
| 962 | 3300053140 | Ga0500573_0000452 | Ga0500573_0000452_9578_10111 | 177 |
| 963 | 3300053154 | Ga0500619_043325 | Ga0500619_043325_194_727 | 177 |
| 964 | 3300053163 | Ga0500639_087393 | Ga0500639_087393_110_643 | 177 |
| 965 | 3300053730 | Ga0500645_070785 | Ga0500645_070785_406_939 | 177 |
| 966 | 3300053730 | Ga0500645_104061 | Ga0500645_104061_136_669 | 177 |
| 967 | 3300054114 | Ga0501084_0000175 | Ga0501084_0000175_42140_42673 | 177 |
| 968 | 3300054114 | Ga0501084_0007620 | Ga0501084_0007620_3807_4340 | 177 |
| 969 | 3300054114 | Ga0501084_0029906 | Ga0501084_0029906_1256_1789 | 177 |
| 970 | 3300054114 | Ga0501084_0074161 | Ga0501084_0074161_348_881 | 177 |
| 971 | 3300054114 | Ga0501084_0145505 | Ga0501084_0145505_1330_1863 | 177 |
| 972 | 3300054114 | Ga0501084_0363006 | Ga0501084_0363006_224_757 | 177 |
| 973 | 3300060353 | Ga0501082_0006964 | Ga0501082_0006964_5928_6461 | 177 |
| 974 | 3300060353 | Ga0501082_0039783 | Ga0501082_0039783_2592_3125 | 177 |
| 975 | 3300060353 | Ga0501082_0069701 | Ga0501082_0069701_1530_2063 | 177 |
| 976 | 3300060353 | Ga0501082_0107936 | Ga0501082_0107936_43_576 | 177 |
| 977 | 3300060353 | Ga0501082_0590704 | Ga0501082_0590704_319_858 | 177 |
| 978 | 3300061734 | Ga0530510_0238077 | Ga0530510_0238077_711_1244 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fn2-assembly1.cif.gz_H | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9578 | 1 | 172 |
| 8cgk-assembly1.cif.gz_g | lincomycin and avilamycin bound to the 50s subunit | 0.9554 | 2 | 172 |
| 8ceu-assembly1.cif.gz_g | retapamulin and capreomycin bound to the 50s subunit | 0.9484 | 2 | 175 |
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.947 | 9 | 171 |
| 8cgv-assembly1.cif.gz_g | tiamulin bound to the 50s subunit | 0.9467 | 2 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9455 | 83 | 168 | 3.90.930.12 |
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9454 | 83 | 172 | 3.90.930.12 |
| af_Q25814_82_167_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9428 | 83 | 164 | 3.90.930.12 |
| 4g5lH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9409 | 83 | 170 | 3.90.930.12 |
| 1vw4F02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9352 | 83 | 171 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J1D431-F1-model_v4 | deleted | 0.9905 | 74 | 168 |
|
| AF-A0A2J6L7U4-F1-model_v4 | deleted | 0.9863 | 82 | 164 |
|
| AF-A0A358FVP3-F1-model_v4 | 50S ribosomal protein L6 | 0.9861 | 81 | 161 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-X1G5X1-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9828 | 82 | 154 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A1V4GKA1-F1-model_v4 | deleted | 0.9795 | 76 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar