F487302

General Info

Members Datasets Scaffolds Average Seq Length
978 380 977 175

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10707429|Ga0207676_107074291
Length 192
Sequence MSNMNKTFAAIITGLVLTVSVGASEAKITGVHLCCQSCVKGVEKAGELKVTLVPEVDASVDADGVTLTPRKDMERAAAMWGLSRSLVNNLVVGVTAGFSSKLEIQGVGYRAAVQGKNLNLQLGFSHDVAYPIPASITITAEKPTMLTIAGIDKQLVGQVAAEIRGYRPPEPYKGKGVRYEGEYVRRKEGKKK

Samples

Sample ID Description Type Environment
1 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
217 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
218 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
251 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
252 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
344 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
367 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
368 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.23
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 0.82
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001315 3300003214 Bacteria 14050
2 JGI25153J46596_10000830 3300003215 Bacteria 18874
3 rootH2_10048944 3300003320 Bacteria 1909
4 Ga0058859_10022480 3300004798 Bacteria 1971
5 Ga0058863_11970613 3300004799 Bacteria 1145
6 Ga0058862_11940969 3300004803 Bacteria 1024
7 Ga0070658_10045521 3300005327 Bacteria 3548
8 Ga0070658_11372238 3300005327 Bacteria 613
9 Ga0070676_10079075 3300005328 Bacteria 1990
10 Ga0070676_10302467 3300005328 Bacteria 1085
11 Ga0070683_100088671 3300005329 Bacteria 2902
12 Ga0070683_100187211 3300005329 Bacteria 1965
13 Ga0070690_100219016 3300005330 Bacteria 1333
14 Ga0070690_100294104 3300005330 Bacteria 1162
15 Ga0070690_100539086 3300005330 Bacteria 878
16 Ga0068869_100070091 3300005334 Bacteria 2593
17 Ga0068869_101415616 3300005334 Bacteria 616
18 Ga0070666_10007106 3300005335 Bacteria 6904
19 Ga0070666_10123583 3300005335 Bacteria 1795
20 Ga0070680_100002998 3300005336 Bacteria 12534
21 Ga0070680_100072787 3300005336 Bacteria 2825
22 Ga0070680_100078879 3300005336 Bacteria 2713
23 Ga0070680_100226414 3300005336 Bacteria 1579
24 Ga0070680_100255022 3300005336 Bacteria 1484
25 Ga0068868_100153898 3300005338 Bacteria 1895
26 Ga0068868_100397645 3300005338 Bacteria 1188
27 Ga0068868_101181538 3300005338 Bacteria 707
28 Ga0070660_100018276 3300005339 Bacteria 5121
29 Ga0070660_100069129 3300005339 Bacteria 2753
30 Ga0070660_100089034 3300005339 Bacteria 2432
31 Ga0070660_100108074 3300005339 Bacteria 2211
32 Ga0070660_100174288 3300005339 Bacteria 1739
33 Ga0070660_100477533 3300005339 Bacteria 1036
34 Ga0070689_100415195 3300005340 Bacteria 1140
35 Ga0070691_10000386 3300005341 Bacteria 16019
36 Ga0070691_10149346 3300005341 Bacteria 1197
37 Ga0070691_10155140 3300005341 Bacteria 1176
38 Ga0070691_10222565 3300005341 Bacteria 1001
39 Ga0070661_100005946 3300005344 Bacteria 8403
40 Ga0070661_100843647 3300005344 Bacteria 754
41 Ga0070675_101654718 3300005354 Bacteria 591
42 Ga0070671_100262784 3300005355 Bacteria 1467
43 Ga0070671_100563781 3300005355 Bacteria 983
44 Ga0070674_100041872 3300005356 Bacteria 3107
45 Ga0070688_100357639 3300005365 Bacteria 1071
46 Ga0070659_100012925 3300005366 Bacteria 6204
47 Ga0070659_100027373 3300005366 Bacteria 4393
48 Ga0070667_100061525 3300005367 Bacteria 3179
49 Ga0070667_100349423 3300005367 Bacteria 1338
50 Ga0070709_10003511 3300005434 Bacteria 8423
51 Ga0070709_10171867 3300005434 Bacteria 1515
52 Ga0070714_100000676 3300005435 Bacteria 24155
53 Ga0070714_100068815 3300005435 Bacteria 3056
54 Ga0070714_100109782 3300005435 Bacteria 2441
55 Ga0070714_100530839 3300005435 Bacteria 1125
56 Ga0070714_101124907 3300005435 Bacteria 766
57 Ga0070714_101188515 3300005435 Unclassified 744
58 Ga0070713_100000012 3300005436 Bacteria 137708
59 Ga0070713_100162144 3300005436 Bacteria 1997
60 Ga0070713_100213904 3300005436 Bacteria 1746
61 Ga0070713_100364268 3300005436 Bacteria 1344
62 Ga0070710_10040281 3300005437 Bacteria 2575
63 Ga0070710_10553255 3300005437 Bacteria 795
64 Ga0070711_100240856 3300005439 Bacteria 1414
65 Ga0070711_100351636 3300005439 Bacteria 1185
66 Ga0070711_100570669 3300005439 Bacteria 941
67 Ga0070694_100283260 3300005444 Bacteria 1264
68 Ga0070694_100340525 3300005444 Bacteria 1159
69 Ga0070663_100264255 3300005455 Bacteria 1366
70 Ga0070678_100013560 3300005456 Bacteria 5116
71 Ga0070678_100021125 3300005456 Bacteria 4286
72 Ga0070678_100069504 3300005456 Bacteria 2629
73 Ga0070678_100681426 3300005456 Bacteria 925
74 Ga0070681_10000037 3300005458 Bacteria 96087
75 Ga0070681_10034634 3300005458 Bacteria 5070
76 Ga0070681_10048475 3300005458 Bacteria 4244
77 Ga0070681_10160044 3300005458 Bacteria 2175
78 Ga0070681_10179316 3300005458 Bacteria 2040
79 Ga0070681_10237697 3300005458 Bacteria 1735
80 Ga0068867_100100755 3300005459 Bacteria 2205
81 Ga0068867_100540816 3300005459 Bacteria 1007
82 Ga0070707_101144481 3300005468 Bacteria 744
83 Ga0070699_100114998 3300005518 Bacteria 2364
84 Ga0070699_100215896 3300005518 Bacteria 1708
85 Ga0070679_100008411 3300005530 Bacteria 9712
86 Ga0070679_100064794 3300005530 Bacteria 3642
87 Ga0070679_100082939 3300005530 Bacteria 3195
88 Ga0070679_100335688 3300005530 Bacteria 1460
89 Ga0070684_100283884 3300005535 Bacteria 1517
90 Ga0068853_100002020 3300005539 Bacteria 15004
91 Ga0068853_100002660 3300005539 Bacteria 13466
92 Ga0068853_100237414 3300005539 Bacteria 1670
93 Ga0068853_100714452 3300005539 Bacteria 956
94 Ga0068853_101136376 3300005539 Bacteria 754
95 Ga0070686_100311002 3300005544 Bacteria 1172
96 Ga0070695_100019206 3300005545 Bacteria 4159
97 Ga0070696_101268626 3300005546 Bacteria 624
98 Ga0070693_100381808 3300005547 Bacteria 972
99 Ga0070665_100087868 3300005548 Bacteria 3114
100 Ga0070665_100093536 3300005548 Bacteria 3011
101 Ga0070665_100175548 3300005548 Bacteria 2143
102 Ga0070665_100264776 3300005548 Bacteria 1720
103 Ga0070665_100600604 3300005548 Bacteria 1113
104 Ga0070704_100029374 3300005549 Bacteria 3670
105 Ga0068855_100000385 3300005563 Bacteria 54304
106 Ga0068855_100034625 3300005563 Bacteria 6019
107 Ga0068855_100121416 3300005563 Bacteria 2990
108 Ga0068855_100161413 3300005563 Bacteria 2543
109 Ga0068855_100693807 3300005563 Bacteria 1090
110 Ga0068855_100953360 3300005563 Bacteria 904
111 Ga0068855_101722291 3300005563 Bacteria 639
112 Ga0068857_100007896 3300005577 Bacteria 9178
113 Ga0068857_100258522 3300005577 Bacteria 1598
114 Ga0068857_100361571 3300005577 Bacteria 1345
115 Ga0068857_100983381 3300005577 Bacteria 812
116 Ga0068854_100347723 3300005578 Bacteria 1213
117 Ga0068856_100001032 3300005614 Bacteria 29659
118 Ga0068856_100021325 3300005614 Bacteria 6296
119 Ga0068856_100155308 3300005614 Bacteria 2298
120 Ga0068856_100478045 3300005614 Bacteria 1267
121 Ga0068856_100685912 3300005614 Bacteria 1045
122 Ga0070702_100299022 3300005615 Bacteria 1112
123 Ga0068852_100063743 3300005616 Bacteria 3210
124 Ga0068852_100142311 3300005616 Bacteria 2221
125 Ga0068852_100187615 3300005616 Bacteria 1948
126 Ga0068852_100289160 3300005616 Bacteria 1583
127 Ga0068852_100393106 3300005616 Bacteria 1362
128 Ga0068864_100440435 3300005618 Bacteria 1245
129 Ga0068864_101611468 3300005618 Bacteria 653
130 Ga0068866_10072414 3300005718 Bacteria 1826
131 Ga0068866_10260834 3300005718 Bacteria 1065
132 Ga0068863_100043883 3300005841 Bacteria 4244
133 Ga0068863_101146006 3300005841 Bacteria 783
134 Ga0068858_100049282 3300005842 Bacteria 3900
135 Ga0068858_100477057 3300005842 Bacteria 1204
136 Ga0068860_100950609 3300005843 Bacteria 876
137 Ga0068860_101559447 3300005843 Bacteria 682
138 Ga0068862_100100297 3300005844 Bacteria 2532
139 Ga0081540_1008438 3300005983 Bacteria 7199
140 Ga0075365_10000030 3300006038 Bacteria 56932
141 Ga0075368_10095597 3300006042 Bacteria 1217
142 Ga0075363_100001020 3300006048 Bacteria 10057
143 Ga0075364_10000068 3300006051 Bacteria 39877
144 Ga0075364_10024136 3300006051 Bacteria 3857
145 Ga0070716_100211553 3300006173 Bacteria 1296
146 Ga0070716_100564291 3300006173 Bacteria 851
147 Ga0070712_100000902 3300006175 Bacteria 17764
148 Ga0070712_100004052 3300006175 Bacteria 8996
149 Ga0070712_100113045 3300006175 Bacteria 2030
150 Ga0070712_100317927 3300006175 Bacteria 1265
151 Ga0075367_10018355 3300006178 Bacteria 3858
152 Ga0075369_10000030 3300006186 Bacteria 39211
153 Ga0097621_100047344 3300006237 Bacteria 3484
154 Ga0097621_100106219 3300006237 Bacteria 2368
155 Ga0097621_100161557 3300006237 Bacteria 1926
156 Ga0097621_100227174 3300006237 Bacteria 1629
157 Ga0097621_100318759 3300006237 Bacteria 1376
158 Ga0097621_100402268 3300006237 Bacteria 1226
159 Ga0075370_10000042 3300006353 Bacteria 39566
160 Ga0068871_100019627 3300006358 Bacteria 5165
161 Ga0068871_100071528 3300006358 Bacteria 2853
162 Ga0068871_100162546 3300006358 Bacteria 1910
163 Ga0068871_100175438 3300006358 Bacteria 1840
164 Ga0068871_100301487 3300006358 Bacteria 1407
165 Ga0068871_100419656 3300006358 Bacteria 1194
166 Ga0068871_100839602 3300006358 Bacteria 849
167 Ga0075428_100000808 3300006844 Bacteria 32725
168 Ga0075430_100194948 3300006846 Bacteria 1683
169 Ga0075431_100116845 3300006847 Bacteria 2753
170 Ga0075431_101399219 3300006847 Bacteria 659
171 Ga0075433_10105346 3300006852 Bacteria 2499
172 Ga0075434_100176261 3300006871 Bacteria 2158
173 Ga0075434_100262322 3300006871 Bacteria 1747
174 Ga0075434_100441455 3300006871 Bacteria 1323
175 Ga0075429_100028322 3300006880 Bacteria 4864
176 Ga0075429_100043701 3300006880 Bacteria 3899
177 Ga0068865_100002505 3300006881 Bacteria 10873
178 Ga0075436_100000458 3300006914 Bacteria 26344
179 Ga0075436_100000862 3300006914 Bacteria 20155
180 Ga0075436_100002564 3300006914 Bacteria 12509
181 Ga0075436_100029529 3300006914 Bacteria 3771
182 Ga0075435_100006049 3300007076 Bacteria 8522
183 Ga0075435_100018960 3300007076 Bacteria 5244
184 Ga0075435_100609814 3300007076 Bacteria 947
185 Ga0105250_10440537 3300009092 Bacteria 583
186 Ga0105240_10004232 3300009093 Bacteria 21946
187 Ga0105240_10004696 3300009093 Bacteria 20647
188 Ga0105240_10017473 3300009093 Bacteria 9666
189 Ga0105240_10025381 3300009093 Bacteria 7788
190 Ga0105240_10150688 3300009093 Bacteria 2770
191 Ga0105240_10252800 3300009093 Bacteria 2037
192 Ga0105240_10571025 3300009093 Bacteria 1249
193 Ga0105240_10675787 3300009093 Bacteria 1129
194 Ga0105240_10722476 3300009093 Bacteria 1085
195 Ga0105240_11279886 3300009093 Bacteria 774
196 Ga0111539_10002099 3300009094 Bacteria 26631
197 Ga0111539_10023579 3300009094 Bacteria 7562
198 Ga0105245_10230243 3300009098 Bacteria 1792
199 Ga0105245_10538363 3300009098 Bacteria 1188
200 Ga0105247_10056711 3300009101 Bacteria 2420
201 Ga0114129_10070335 3300009147 Bacteria 4880
202 Ga0105243_10014172 3300009148 Bacteria 6032
203 Ga0105243_10222994 3300009148 Bacteria 1668
204 Ga0105241_10035275 3300009174 Bacteria 3762
205 Ga0105241_10116852 3300009174 Bacteria 2143
206 Ga0105241_10455114 3300009174 Bacteria 1133
207 Ga0105241_10469421 3300009174 Bacteria 1116
208 Ga0105241_10477193 3300009174 Bacteria 1108
209 Ga0105241_10731521 3300009174 Bacteria 906
210 Ga0105242_10123893 3300009176 Bacteria 2222
211 Ga0105242_10848595 3300009176 Bacteria 909
212 Ga0105242_10891180 3300009176 Bacteria 889
213 Ga0105248_10000005 3300009177 Bacteria 673111
214 Ga0105248_10047589 3300009177 Bacteria 4810
215 Ga0105248_10063706 3300009177 Bacteria 4138
216 Ga0105248_10408693 3300009177 Bacteria 1528
217 Ga0105237_10003253 3300009545 Bacteria 19420
218 Ga0105237_10181890 3300009545 Bacteria 2102
219 Ga0105237_10627975 3300009545 Bacteria 1081
220 Ga0105238_10001939 3300009551 Bacteria 20807
221 Ga0105238_10017491 3300009551 Bacteria 7288
222 Ga0105238_10055822 3300009551 Bacteria 3964
223 Ga0105238_10130022 3300009551 Bacteria 2496
224 Ga0105238_10179895 3300009551 Bacteria 2092
225 Ga0105238_10426203 3300009551 Bacteria 1322
226 Ga0105238_10826441 3300009551 Bacteria 943
227 Ga0105249_10348653 3300009553 Bacteria 1499
228 Ga0099796_10011720 3300010159 Bacteria 2455
229 Ga0105239_10005584 3300010375 Bacteria 14708
230 Ga0105239_10073553 3300010375 Bacteria 3757
231 Ga0105239_10077915 3300010375 Bacteria 3647
232 Ga0105239_10210784 3300010375 Bacteria 2178
233 Ga0105239_10243523 3300010375 Bacteria 2018
234 Ga0105239_10259863 3300010375 Bacteria 1951
235 Ga0105239_10377439 3300010375 Bacteria 1603
236 Ga0105239_12206314 3300010375 Bacteria 640
237 Ga0105246_10013218 3300011119 Bacteria 5169
238 Ga0105246_10062954 3300011119 Bacteria 2586
239 Ga0105246_10516333 3300011119 Bacteria 1017
240 Ga0105246_10563413 3300011119 Bacteria 978
241 Ga0157373_10000820 3300013100 Bacteria 24076
242 Ga0157373_10567405 3300013100 Bacteria 824
243 Ga0157371_10098586 3300013102 Bacteria 2072
244 Ga0157371_10655232 3300013102 Bacteria 784
245 Ga0157370_10003448 3300013104 Bacteria 18559
246 Ga0157370_10008323 3300013104 Bacteria 11186
247 Ga0157370_10035566 3300013104 Bacteria 4839
248 Ga0157370_10083851 3300013104 Bacteria 2996
249 Ga0157370_11614616 3300013104 Bacteria 582
250 Ga0157369_10001535 3300013105 Bacteria 28280
251 Ga0157369_10033188 3300013105 Bacteria 5675
252 Ga0157369_10345530 3300013105 Bacteria 1546
253 Ga0157369_10407520 3300013105 Bacteria 1410
254 Ga0157369_11085912 3300013105 Bacteria 818
255 Ga0157374_10377448 3300013296 Bacteria 1412
256 Ga0157378_10115850 3300013297 Bacteria 2464
257 Ga0157378_10232385 3300013297 Bacteria 1758
258 Ga0157378_10424647 3300013297 Bacteria 1314
259 Ga0157378_10549314 3300013297 Bacteria 1160
260 Ga0157378_10885088 3300013297 Bacteria 923
261 Ga0157378_10906097 3300013297 Bacteria 913
262 Ga0163162_10250500 3300013306 Bacteria 1903
263 Ga0163162_10446856 3300013306 Bacteria 1425
264 Ga0163162_11179552 3300013306 Bacteria 869
265 Ga0157372_10007016 3300013307 Bacteria 11997
266 Ga0157372_10008268 3300013307 Bacteria 11062
267 Ga0157372_10032489 3300013307 Bacteria 5724
268 Ga0157372_10037651 3300013307 Bacteria 5337
269 Ga0157372_10066383 3300013307 Bacteria 4053
270 Ga0157372_10327295 3300013307 Bacteria 1784
271 Ga0157375_10614872 3300013308 Bacteria 1245
272 Ga0163163_10008003 3300014325 Bacteria 9355
273 Ga0163163_10332968 3300014325 Bacteria 1573
274 Ga0163163_10915513 3300014325 Bacteria 940
275 Ga0157380_10294611 3300014326 Bacteria 1491
276 Ga0157379_10007681 3300014968 Bacteria 9336
277 Ga0157379_10010518 3300014968 Bacteria 8065
278 Ga0157379_10019718 3300014968 Bacteria 5958
279 Ga0157379_10052289 3300014968 Bacteria 3649
280 Ga0157379_10232957 3300014968 Bacteria 1670
281 Ga0157379_10428308 3300014968 Bacteria 1219
282 Ga0157376_10147364 3300014969 Bacteria 2119
283 Ga0157376_10291481 3300014969 Bacteria 1541
284 Ga0157376_10517483 3300014969 Bacteria 1175
285 Ga0163161_10646087 3300017792 Bacteria 876
286 Ga0213874_10002785 3300021377 Bacteria 3804
287 Ga0213874_10006777 3300021377 Bacteria 2724
288 Ga0213876_10000421 3300021384 Bacteria 35344
289 Ga0213876_10003189 3300021384 Bacteria 9433
290 Ga0213876_10027585 3300021384 Bacteria 2996
291 Ga0213876_10103540 3300021384 Bacteria 1509
292 Ga0209563_105604 3300025230 Bacteria 2249
293 Ga0209233_1000013 3300025261 Bacteria 1013785
294 Ga0209455_1020331 3300025272 Bacteria 1316
295 Ga0209758_1000013 3300025297 Bacteria 873003
296 Ga0209758_1152298 3300025297 Bacteria 585
297 Ga0207642_10017630 3300025899 Bacteria 2721
298 Ga0207680_10002564 3300025903 Bacteria 8470
299 Ga0207680_10106453 3300025903 Bacteria 1811
300 Ga0207699_10000164 3300025906 Bacteria 41177
301 Ga0207699_10037734 3300025906 Bacteria 2764
302 Ga0207645_10011392 3300025907 Bacteria 6075
303 Ga0207645_10473091 3300025907 Bacteria 847
304 Ga0207643_10030805 3300025908 Bacteria 2989
305 Ga0207643_10032595 3300025908 Bacteria 2911
306 Ga0207705_10000180 3300025909 Bacteria 66404
307 Ga0207705_10004720 3300025909 Bacteria 10265
308 Ga0207705_10194396 3300025909 Bacteria 1535
309 Ga0207705_10311673 3300025909 Bacteria 1208
310 Ga0207684_10294542 3300025910 Bacteria 1399
311 Ga0207654_10033200 3300025911 Bacteria 2859
312 Ga0207654_10063489 3300025911 Bacteria 2168
313 Ga0207654_10164797 3300025911 Bacteria 1434
314 Ga0207654_10428144 3300025911 Bacteria 925
315 Ga0207654_10803875 3300025911 Bacteria 679
316 Ga0207707_10000011 3300025912 Bacteria 282857
317 Ga0207707_10002715 3300025912 Bacteria 15806
318 Ga0207707_10048827 3300025912 Bacteria 3687
319 Ga0207707_10124122 3300025912 Bacteria 2258
320 Ga0207707_10267082 3300025912 Bacteria 1483
321 Ga0207707_10563709 3300025912 Bacteria 967
322 Ga0207695_10000018 3300025913 Bacteria 766611
323 Ga0207695_10028316 3300025913 Bacteria 6218
324 Ga0207695_10040352 3300025913 Bacteria 5007
325 Ga0207695_10128661 3300025913 Bacteria 2492
326 Ga0207695_10182399 3300025913 Bacteria 2020
327 Ga0207695_10217861 3300025913 Bacteria 1817
328 Ga0207695_10284139 3300025913 Bacteria 1548
329 Ga0207695_10284558 3300025913 Bacteria 1546
330 Ga0207695_10340402 3300025913 Bacteria 1388
331 Ga0207695_10383850 3300025913 Bacteria 1290
332 Ga0207671_10019547 3300025914 Bacteria 5178
333 Ga0207671_10049879 3300025914 Bacteria 3099
334 Ga0207671_10408901 3300025914 Bacteria 1079
335 Ga0207671_10499698 3300025914 Bacteria 970
336 Ga0207693_10001210 3300025915 Bacteria 23009
337 Ga0207693_10001929 3300025915 Bacteria 18163
338 Ga0207693_10054085 3300025915 Bacteria 3150
339 Ga0207693_10055946 3300025915 Bacteria 3093
340 Ga0207693_10266868 3300025915 Bacteria 1341
341 Ga0207693_10375640 3300025915 Bacteria 1112
342 Ga0207663_10015424 3300025916 Bacteria 4215
343 Ga0207663_10172408 3300025916 Bacteria 1538
344 Ga0207663_11098027 3300025916 Bacteria 639
345 Ga0207660_10000110 3300025917 Bacteria 46792
346 Ga0207660_10003537 3300025917 Bacteria 10180
347 Ga0207660_10069892 3300025917 Bacteria 2551
348 Ga0207660_10181434 3300025917 Bacteria 1635
349 Ga0207657_10000241 3300025919 Bacteria 57958
350 Ga0207657_10063406 3300025919 Bacteria 3160
351 Ga0207657_10196503 3300025919 Bacteria 1625
352 Ga0207657_10280758 3300025919 Bacteria 1322
353 Ga0207657_10734228 3300025919 Bacteria 766
354 Ga0207649_10000194 3300025920 Bacteria 50112
355 Ga0207652_10000824 3300025921 Bacteria 29561
356 Ga0207652_10007774 3300025921 Bacteria 8614
357 Ga0207652_10108322 3300025921 Bacteria 2462
358 Ga0207652_10115732 3300025921 Bacteria 2382
359 Ga0207694_10000010 3300025924 Bacteria 439722
360 Ga0207694_10025930 3300025924 Bacteria 4456
361 Ga0207694_10026889 3300025924 Bacteria 4381
362 Ga0207694_10221393 3300025924 Bacteria 1544
363 Ga0207694_10810215 3300025924 Bacteria 791
364 Ga0207694_10850182 3300025924 Bacteria 771
365 Ga0207694_10864858 3300025924 Bacteria 764
366 Ga0207694_10906379 3300025924 Bacteria 745
367 Ga0207650_10171098 3300025925 Bacteria 1726
368 Ga0207650_10536252 3300025925 Bacteria 980
369 Ga0207659_10166081 3300025926 Bacteria 1737
370 Ga0207687_10017844 3300025927 Bacteria 4682
371 Ga0207687_10085895 3300025927 Bacteria 2284
372 Ga0207687_10325007 3300025927 Bacteria 1246
373 Ga0207687_10390587 3300025927 Bacteria 1142
374 Ga0207700_10000295 3300025928 Bacteria 29631
375 Ga0207700_10130882 3300025928 Bacteria 2048
376 Ga0207664_10032838 3300025929 Bacteria 3982
377 Ga0207664_10073108 3300025929 Bacteria 2766
378 Ga0207664_10177988 3300025929 Bacteria 1825
379 Ga0207664_10312818 3300025929 Bacteria 1384
380 Ga0207664_10411486 3300025929 Bacteria 1204
381 Ga0207644_10562368 3300025931 Bacteria 945
382 Ga0207690_10346628 3300025932 Bacteria 1173
383 Ga0207686_10073147 3300025934 Bacteria 2211
384 Ga0207686_10163989 3300025934 Bacteria 1560
385 Ga0207709_10125051 3300025935 Bacteria 1743
386 Ga0207670_10845695 3300025936 Bacteria 764
387 Ga0207669_10280567 3300025937 Bacteria 1256
388 Ga0207704_10122838 3300025938 Bacteria 1781
389 Ga0207665_10241385 3300025939 Bacteria 1331
390 Ga0207665_10301672 3300025939 Bacteria 1197
391 Ga0207691_10325382 3300025940 Bacteria 1318
392 Ga0207711_10000002 3300025941 Bacteria 1228676
393 Ga0207711_10145656 3300025941 Bacteria 2134
394 Ga0207689_10127211 3300025942 Bacteria 2096
395 Ga0207689_10261962 3300025942 Bacteria 1430
396 Ga0207661_10144696 3300025944 Bacteria 2049
397 Ga0207661_10219381 3300025944 Bacteria 1680
398 Ga0207661_10500695 3300025944 Bacteria 1110
399 Ga0207679_10701601 3300025945 Bacteria 918
400 Ga0207667_10000388 3300025949 Bacteria 59263
401 Ga0207667_10031700 3300025949 Bacteria 5704
402 Ga0207667_10542855 3300025949 Bacteria 1176
403 Ga0207667_10582275 3300025949 Bacteria 1130
404 Ga0207651_10169073 3300025960 Bacteria 1722
405 Ga0207651_10727070 3300025960 Bacteria 876
406 Ga0207712_11134703 3300025961 Bacteria 696
407 Ga0207712_11399583 3300025961 Bacteria 626
408 Ga0207668_10971586 3300025972 Bacteria 758
409 Ga0207640_10040030 3300025981 Bacteria 2971
410 Ga0207658_10058513 3300025986 Bacteria 2868
411 Ga0207658_10134474 3300025986 Bacteria 1991
412 Ga0207703_10027678 3300026035 Bacteria 4464
413 Ga0207703_10064130 3300026035 Bacteria 3014
414 Ga0207639_10000867 3300026041 Bacteria 20545
415 Ga0207639_10059896 3300026041 Bacteria 2935
416 Ga0207639_10979110 3300026041 Bacteria 792
417 Ga0207639_11233052 3300026041 Bacteria 702
418 Ga0207639_11280022 3300026041 Bacteria 688
419 Ga0207678_10367816 3300026067 Bacteria 1242
420 Ga0207702_10000315 3300026078 Bacteria 55383
421 Ga0207702_10348694 3300026078 Bacteria 1416
422 Ga0207702_10583836 3300026078 Bacteria 1095
423 Ga0207702_10776759 3300026078 Bacteria 946
424 Ga0207702_11758665 3300026078 Bacteria 612
425 Ga0207641_10035109 3300026088 Bacteria 4175
426 Ga0207648_10154508 3300026089 Bacteria 2025
427 Ga0207648_10243653 3300026089 Bacteria 1601
428 Ga0207676_10707429 3300026095 Bacteria 977
429 Ga0207674_10001605 3300026116 Bacteria 29115
430 Ga0207674_10192958 3300026116 Bacteria 1987
431 Ga0207674_10291835 3300026116 Bacteria 1579
432 Ga0207674_11105553 3300026116 Bacteria 762
433 Ga0207675_100278079 3300026118 Bacteria 1626
434 Ga0207683_10018489 3300026121 Bacteria 5947
435 Ga0207683_10103171 3300026121 Bacteria 2547
436 Ga0207683_10264595 3300026121 Bacteria 1570
437 Ga0207683_10493868 3300026121 Bacteria 1130
438 Ga0207683_11029523 3300026121 Bacteria 764
439 Ga0207698_10042447 3300026142 Bacteria 3398
440 Ga0207698_10086858 3300026142 Bacteria 2545
441 Ga0207698_10144541 3300026142 Bacteria 2055
442 Ga0209995_1003999 3300027471 Bacteria 2354
443 Ga0209968_1004743 3300027526 Bacteria 2038
444 Ga0209970_1056276 3300027614 Bacteria 717
445 Ga0209971_1044728 3300027682 Bacteria 1067
446 Ga0209813_10045800 3300027866 Bacteria 1348
447 Ga0209813_10091394 3300027866 Bacteria 1022
448 Ga0209974_10060510 3300027876 Bacteria 1282
449 Ga0209974_10065728 3300027876 Bacteria 1232
450 Ga0207428_10002412 3300027907 Bacteria 18661
451 Ga0268266_10000557 3300028379 Bacteria 51935
452 Ga0268266_10055515 3300028379 Bacteria 3405
453 Ga0268266_10076582 3300028379 Bacteria 2907
454 Ga0268266_10092509 3300028379 Bacteria 2653
455 Ga0268266_10095842 3300028379 Bacteria 2606
456 Ga0268266_11207351 3300028379 Bacteria 731
457 Ga0268265_10295536 3300028380 Bacteria 1456
458 Ga0268264_10561069 3300028381 Bacteria 1121
459 Ga0268264_11168559 3300028381 Bacteria 779
460 Ga0265337_1001102 3300028556 Bacteria 13866
461 Ga0265334_10001106 3300028573 Bacteria 13201
462 Ga0265334_10116749 3300028573 Bacteria 956
463 Ga0265318_10000037 3300028577 Bacteria 138223
464 Ga0265318_10004788 3300028577 Bacteria 6480
465 Ga0265338_10000017 3300028800 Bacteria 344481
466 Ga0265338_10002896 3300028800 Bacteria 24981
467 Ga0265338_10005387 3300028800 Bacteria 16717
468 Ga0265338_10017000 3300028800 Bacteria 7869
469 Ga0265338_10038201 3300028800 Bacteria 4553
470 Ga0265338_10073797 3300028800 Bacteria 2906
471 Ga0265338_10106186 3300028800 Bacteria 2274
472 Ga0265338_10165948 3300028800 Bacteria 1700
473 Ga0265338_10203129 3300028800 Bacteria 1493
474 Ga0265338_10647847 3300028800 Bacteria 732
475 Ga0265324_10193448 3300029957 Bacteria 691
476 Ga0265324_10208133 3300029957 Bacteria 664
477 Ga0265330_10006774 3300031235 Bacteria 5647
478 Ga0265332_10017915 3300031238 Bacteria 3122
479 Ga0265332_10031083 3300031238 Bacteria 2330
480 Ga0265332_10071412 3300031238 Bacteria 1478
481 Ga0265332_10075392 3300031238 Bacteria 1434
482 Ga0265332_10197011 3300031238 Bacteria 838
483 Ga0265320_10002069 3300031240 Bacteria 14126
484 Ga0265320_10057577 3300031240 Bacteria 1864
485 Ga0265320_10375024 3300031240 Bacteria 628
486 Ga0265325_10000014 3300031241 Bacteria 131579
487 Ga0265325_10000782 3300031241 Bacteria 23019
488 Ga0265325_10001732 3300031241 Bacteria 15146
489 Ga0265325_10021041 3300031241 Bacteria 3590
490 Ga0265325_10026992 3300031241 Bacteria 3107
491 Ga0265325_10032967 3300031241 Bacteria 2763
492 Ga0265325_10194349 3300031241 Bacteria 939
493 Ga0265329_10025358 3300031242 Bacteria 1963
494 Ga0265329_10046592 3300031242 Bacteria 1385
495 Ga0265340_10001159 3300031247 Bacteria 15088
496 Ga0265340_10002869 3300031247 Bacteria 9812
497 Ga0265340_10007526 3300031247 Bacteria 5912
498 Ga0265340_10038201 3300031247 Bacteria 2376
499 Ga0265340_10042240 3300031247 Bacteria 2239
500 Ga0265340_10088506 3300031247 Bacteria 1450
501 Ga0265340_10092888 3300031247 Bacteria 1409
502 Ga0265339_10000256 3300031249 Bacteria 42839
503 Ga0265339_10004825 3300031249 Bacteria 9117
504 Ga0265339_10007379 3300031249 Bacteria 7114
505 Ga0265339_10342389 3300031249 Bacteria 706
506 Ga0265339_10485136 3300031249 Bacteria 572
507 Ga0265331_10000186 3300031250 Bacteria 76149
508 Ga0265331_10003502 3300031250 Bacteria 10110
509 Ga0265331_10013838 3300031250 Bacteria 4322
510 Ga0265331_10021847 3300031250 Bacteria 3269
511 Ga0265331_10022887 3300031250 Bacteria 3183
512 Ga0265331_10030688 3300031250 Bacteria 2675
513 Ga0265327_10000392 3300031251 Bacteria 82296
514 Ga0265327_10009609 3300031251 Bacteria 6946
515 Ga0265316_10021496 3300031344 Bacteria 5463
516 Ga0265316_10025355 3300031344 Bacteria 4950
517 Ga0265316_10026745 3300031344 Bacteria 4793
518 Ga0265316_10044806 3300031344 Bacteria 3516
519 Ga0265316_10086571 3300031344 Bacteria 2395
520 Ga0265316_10096460 3300031344 Bacteria 2252
521 Ga0265316_10148087 3300031344 Bacteria 1760
522 Ga0265316_10257932 3300031344 Bacteria 1279
523 Ga0265316_10284113 3300031344 Bacteria 1209
524 Ga0265316_10377952 3300031344 Bacteria 1022
525 Ga0307408_100051689 3300031548 Bacteria 2961
526 Ga0265313_10000800 3300031595 Bacteria 31814
527 Ga0265313_10006102 3300031595 Bacteria 8671
528 Ga0265313_10012941 3300031595 Bacteria 5055
529 Ga0265313_10016941 3300031595 Bacteria 4166
530 Ga0265313_10019748 3300031595 Bacteria 3739
531 Ga0265313_10025680 3300031595 Bacteria 3115
532 Ga0265313_10076276 3300031595 Bacteria 1532
533 Ga0265313_10089662 3300031595 Bacteria 1383
534 Ga0265313_10100614 3300031595 Bacteria 1284
535 Ga0265313_10207677 3300031595 Bacteria 812
536 Ga0316575_10000986 3300031665 Bacteria 8786
537 Ga0316575_10019455 3300031665 Bacteria 2597
538 Ga0316579_10005295 3300031691 Bacteria 5195
539 Ga0316579_10010128 3300031691 Bacteria 3978
540 Ga0265314_10000963 3300031711 Bacteria 33816
541 Ga0265314_10004460 3300031711 Bacteria 12990
542 Ga0265314_10024805 3300031711 Bacteria 4537
543 Ga0265314_10027129 3300031711 Bacteria 4292
544 Ga0265314_10041547 3300031711 Bacteria 3289
545 Ga0265314_10055387 3300031711 Bacteria 2738
546 Ga0265314_10056619 3300031711 Bacteria 2697
547 Ga0265314_10068911 3300031711 Bacteria 2376
548 Ga0265314_10107669 3300031711 Bacteria 1778
549 Ga0265314_10178064 3300031711 Bacteria 1277
550 Ga0265314_10213503 3300031711 Bacteria 1131
551 Ga0265342_10006333 3300031712 Bacteria 8824
552 Ga0265342_10021698 3300031712 Bacteria 4095
553 Ga0265342_10072247 3300031712 Bacteria 2009
554 Ga0265342_10090627 3300031712 Bacteria 1753
555 Ga0265342_10338731 3300031712 Bacteria 785
556 Ga0265342_10344967 3300031712 Bacteria 776
557 Ga0316576_10005834 3300031727 Bacteria 7592
558 Ga0316578_10039175 3300031728 Bacteria 2736
559 Ga0316578_10212536 3300031728 Bacteria 1163
560 Ga0307516_10054857 3300031730 Bacteria 3893
561 Ga0307516_10069198 3300031730 Bacteria 3396
562 Ga0307516_10507566 3300031730 Bacteria 860
563 Ga0307405_10008723 3300031731 Bacteria 5154
564 Ga0316577_10032670 3300031733 Bacteria 2907
565 Ga0316577_10043034 3300031733 Bacteria 2527
566 Ga0307413_10061509 3300031824 Bacteria 2317
567 Ga0307410_10138609 3300031852 Bacteria 1796
568 Ga0307410_10183150 3300031852 Bacteria 1587
569 Ga0307406_10072399 3300031901 Bacteria 2262
570 Ga0307407_10102413 3300031903 Bacteria 1780
571 Ga0307412_10046496 3300031911 Bacteria 2844
572 Ga0307409_100030160 3300031995 Bacteria 3892
573 Ga0307416_100005600 3300032002 Bacteria 7741
574 Ga0307416_100212504 3300032002 Bacteria 1847
575 Ga0307414_10939816 3300032004 Bacteria 794
576 Ga0307411_10103293 3300032005 Bacteria 2021
577 Ga0307411_11126293 3300032005 Unclassified 709
578 Ga0307415_100095913 3300032126 Bacteria 2160
579 Ga0316583_10000484 3300032133 Bacteria 11841
580 Ga0316583_10018653 3300032133 Bacteria 2491
581 Ga0316583_10069563 3300032133 Bacteria 1231
582 Ga0316585_10002061 3300032137 Bacteria 5391
583 Ga0316585_10058099 3300032137 Bacteria 1246
584 Ga0316580_10020547 3300032139 Bacteria 2034
585 Ga0316580_10021418 3300032139 Bacteria 1992
586 Ga0316580_10025904 3300032139 Bacteria 1813
587 Ga0316593_10000349 3300032168 Bacteria 8071
588 Ga0316593_10001237 3300032168 Bacteria 5509
589 Ga0316593_10054391 3300032168 Bacteria 1358
590 Ga0316592_1007100 3300033524 Bacteria 2177
591 Ga0316586_1000300 3300033527 Bacteria 4509
592 Ga0316588_1046158 3300033528 Bacteria 1050
593 Ga0316596_1000615 3300033541 Bacteria 6324
594 Ga0373944_0067559 3300035089 Bacteria 1158
595 Ga0373923_0032705 3300035111 Bacteria 2102
596 Ga0373923_0098301 3300035111 Bacteria 1288
597 Ga0373932_0201431 3300035112 Bacteria 708
598 Ga0373936_0008097 3300035113 Bacteria 3952
599 Ga0373939_0042238 3300035114 Bacteria 1378
600 Ga0373939_0081663 3300035114 Bacteria 1074
601 Ga0373945_0006653 3300035116 Bacteria 3735
602 Ga0373945_0078958 3300035116 Bacteria 1258
603 Ga0373953_0157382 3300035117 Bacteria 976
604 Ga0373956_0029348 3300035119 Bacteria 2398
605 Ga0373956_0248982 3300035119 Bacteria 845
606 Ga0373943_0007235 3300035170 Bacteria 4980
607 Ga0373943_0080948 3300035170 Bacteria 1665
608 Ga0373955_0005106 3300035172 Bacteria 5866
609 Ga0373955_0036549 3300035172 Bacteria 2607
610 Ga0373955_0246502 3300035172 Bacteria 1071
611 Ga0373942_0071250 3300035207 Bacteria 1015
612 Ga0373961_0048959 3300035241 Bacteria 1247
613 Ga0373961_0095359 3300035241 Bacteria 956
614 Ga0316574_0001643 3300035398 Bacteria 10749
615 Ga0316574_0008846 3300035398 Bacteria 5614
616 Ga0316574_0038291 3300035398 Bacteria 2943
617 Ga0316574_0203323 3300035398 Bacteria 1272
618 Ga0316574_0389410 3300035398 Bacteria 878
619 Ga0373931_0085845 3300035691 Bacteria 1745
620 Ga0373931_0111163 3300035691 Bacteria 1555
621 Ga0373931_0553263 3300035691 Bacteria 748
622 Ga0373935_0003403 3300035692 Bacteria 9238
623 Ga0373935_0084560 3300035692 Bacteria 2067
624 Ga0373935_0133269 3300035692 Bacteria 1672
625 Ga0373935_0934841 3300035692 Bacteria 643
626 Ga0373927_0064151 3300035695 Bacteria 2376
627 Ga0373927_0158783 3300035695 Bacteria 1481
628 Ga0373927_0167531 3300035695 Bacteria 1440
629 Ga0373933_0005271 3300035724 Bacteria 7048
630 Ga0373933_0043309 3300035724 Bacteria 2663
631 Ga0373933_0433396 3300035724 Bacteria 859
632 Ga0373947_0011709 3300035725 Bacteria 5027
633 Ga0373947_0407002 3300035725 Bacteria 918
634 Ga0373937_0003527 3300036401 Bacteria 13164
635 Ga0373937_0070199 3300036401 Bacteria 3231
636 Ga0373937_0104200 3300036401 Bacteria 2635
637 Ga0373937_0128743 3300036401 Bacteria 2363
638 Ga0373937_0190143 3300036401 Bacteria 1929
639 Ga0373937_0193416 3300036401 Bacteria 1912
640 Ga0373937_0198482 3300036401 Bacteria 1886
641 Ga0373937_0310051 3300036401 Bacteria 1492
642 Ga0373937_0777101 3300036401 Bacteria 905
643 Ga0316582_0012337 3300036647 Bacteria 4764
644 Ga0316582_0056650 3300036647 Bacteria 2501
645 Ga0316582_0243316 3300036647 Bacteria 1233
646 Ga0316584_0001849 3300036712 Bacteria 13108
647 Ga0373925_0002514 3300037068 Bacteria 14651
648 Ga0373925_0133491 3300037068 Bacteria 1937
649 Ga0373925_1342811 3300037068 Bacteria 586
650 Ga0395899_0004948 3300037312 Bacteria 10369
651 Ga0395899_0224824 3300037312 Bacteria 1299
652 Ga0395900_0062599 3300037418 Bacteria 3824
653 Ga0395900_0098142 3300037418 Bacteria 3010
654 Ga0395900_0618268 3300037418 Bacteria 1022
655 Ga0395898_0003055 3300037466 Bacteria 18965
656 Ga0395898_0079037 3300037466 Bacteria 3173
657 Ga0395898_0359028 3300037466 Bacteria 1389
658 Ga0316581_0008237 3300037588 Bacteria 2829
659 Ga0316581_0013780 3300037588 Bacteria 2296
660 Ga0395901_0012391 3300038443 Bacteria 8650
661 Ga0395901_0072035 3300038443 Bacteria 3601
662 Ga0400488_12334 3300038741 Bacteria 4329
663 Ga0400486_17540 3300038742 Bacteria 1091
664 Ga0400487_00820 3300039110 Bacteria 3258
665 Ga0436365_0480014 3300039437 Bacteria 887
666 Ga0436365_0544722 3300039437 Bacteria 16758
667 Ga0436365_0868084 3300039437 Bacteria 797
668 Ga0436365_1215018 3300039437 Bacteria 3685
669 Ga0436365_1239236 3300039437 Bacteria 18833
670 Ga0436365_1351612 3300039437 Bacteria 842
671 Ga0436365_1437117 3300039437 Bacteria 1434
672 Ga0436365_1584141 3300039437 Bacteria 579
673 Ga0436365_1637588 3300039437 Bacteria 49130
674 Ga0436360_0360048 3300039438 Bacteria 2053
675 Ga0436360_0449234 3300039438 Bacteria 1196
676 Ga0436360_0716296 3300039438 Bacteria 2775
677 Ga0436361_0767135 3300039447 Bacteria 1162
678 Ga0436363_0427400 3300039450 Bacteria 3997
679 Ga0436363_0896516 3300039450 Bacteria 1486
680 Ga0436363_1041884 3300039450 Bacteria 652
681 Ga0436363_1470856 3300039450 Bacteria 3937
682 Ga0451793_0170406 3300041452 Bacteria 796
683 Ga0451800_0024754 3300041459 Bacteria 869
684 Ga0451802_1407499 3300041460 Bacteria 735
685 Ga0439460_0224418 3300042461 Unclassified 645
686 Ga0451577_0743919 3300042876 Bacteria 887
687 Ga0453684_0000682 3300044712 Bacteria 121090
688 Ga0466957_0637262 3300044842 Bacteria 748
689 Ga0451576_0363162 3300045051 Bacteria 1516
690 Ga0466967_0059567 3300045976 Bacteria 3380
691 Ga0495592_0176228 3300046454 Bacteria 1460
692 Ga0495592_0423576 3300046454 Bacteria 839
693 Ga0495629_0083513 3300046459 Bacteria 2229
694 Ga0495651_0186790 3300046462 Bacteria 1462
695 Ga0495651_0385149 3300046462 Bacteria 919
696 Ga0495580_0003736 3300046472 Bacteria 12895
697 Ga0495580_0046288 3300046472 Bacteria 3087
698 Ga0495582_0043074 3300046473 Bacteria 2486
699 Ga0495582_0065981 3300046473 Bacteria 2000
700 Ga0495662_0112098 3300046476 Bacteria 1337
701 Ga0495664_0034829 3300046477 Bacteria 2963
702 Ga0495664_0225171 3300046477 Bacteria 1135
703 Ga0495664_0237404 3300046477 Bacteria 1103
704 Ga0495585_0181428 3300046492 Bacteria 1082
705 Ga0495606_0159747 3300046507 Bacteria 1316
706 Ga0495628_0328258 3300046516 Bacteria 1128
707 Ga0495631_0321349 3300046518 Bacteria 659
708 Ga0495632_0278674 3300046519 Bacteria 745
709 Ga0495652_0041688 3300046529 Bacteria 3961
710 Ga0495654_0052557 3300046530 Bacteria 1983
711 Ga0495665_0106424 3300046531 Bacteria 1472
712 Ga0495587_0050256 3300046536 Bacteria 2467
713 Ga0495587_0122784 3300046536 Bacteria 1487
714 Ga0495621_0007305 3300046539 Bacteria 3267
715 Ga0495645_0086993 3300046543 Bacteria 2236
716 Ga0495645_0219231 3300046543 Bacteria 1280
717 Ga0495622_0003379 3300046557 Bacteria 7527
718 Ga0495622_0149869 3300046557 Bacteria 1056
719 Ga0495633_0110090 3300046558 Bacteria 1277
720 Ga0495656_0173839 3300046615 Bacteria 1055
721 Ga0495625_0123475 3300046660 Bacteria 1760
722 Ga0495661_0198281 3300046665 Bacteria 1053
723 Ga0495657_0129487 3300046675 Bacteria 1582
724 Ga0495599_0306982 3300046678 Bacteria 957
725 Ga0495623_0165906 3300046679 Bacteria 1294
726 Ga0495658_0001492 3300046683 Bacteria 12268
727 Ga0495613_0442729 3300046689 Bacteria 881
728 Ga0495624_0413944 3300046690 Bacteria 809
729 Ga0495671_0298960 3300046692 Bacteria 774
730 Ga0495649_0106764 3300046694 Bacteria 1486
731 Ga0495649_0224280 3300046694 Bacteria 971
732 Ga0495589_0093052 3300046794 Bacteria 1463
733 Ga0495636_0324543 3300047318 Bacteria 723
734 Ga0495674_0687412 3300047319 Bacteria 804
735 Ga0495683_0134375 3300047323 Bacteria 1164
736 Ga0495675_0062651 3300047444 Bacteria 2354
737 Ga0495675_0256692 3300047444 Bacteria 1048
738 Ga0495673_0177677 3300047469 Bacteria 808
739 Ga0495681_0247614 3300047470 Bacteria 705
740 Ga0495684_0119581 3300047471 Bacteria 1985
741 Ga0495602_0035348 3300048088 Bacteria 4660
742 Ga0495602_0175950 3300048088 Bacteria 1656
743 Ga0495602_0308838 3300048088 Bacteria 1155
744 Ga0495602_0563739 3300048088 Bacteria 788
745 Ga0495615_0027787 3300048090 Bacteria 1331
746 Ga0495626_0026549 3300048091 Bacteria 2822
747 Ga0496100_0292146 3300048903 Bacteria 1218
748 Ga0496104_0414671 3300048907 Bacteria 1259
749 Ga0496107_0164931 3300048910 Bacteria 1642
750 Ga0496112_0440330 3300048915 Bacteria 1241
751 Ga0496115_0373355 3300048918 Bacteria 1161
752 Ga0496121_0006108 3300048924 Bacteria 15150
753 Ga0496126_0000480 3300048929 Bacteria 79257
754 Ga0496126_0077598 3300048929 Bacteria 2945
755 Ga0495682_0005207 3300049460 Bacteria 5432
756 Ga0501313_009732 3300049529 Bacteria 1086
757 Ga0501335_006385 3300049551 Bacteria 1073
758 Ga0501031_0037261 3300049568 Bacteria 3173
759 Ga0501031_0068962 3300049568 Bacteria 2303
760 Ga0501031_0094198 3300049568 Bacteria 1954
761 Ga0501031_0518639 3300049568 Bacteria 768
762 Ga0501032_0001267 3300049569 Bacteria 20244
763 Ga0501032_0004362 3300049569 Bacteria 10681
764 Ga0501032_0019862 3300049569 Bacteria 4691
765 Ga0501032_0020357 3300049569 Bacteria 4622
766 Ga0501032_0030051 3300049569 Bacteria 3727
767 Ga0501032_0178940 3300049569 Bacteria 1389
768 Ga0501032_0201791 3300049569 Bacteria 1298
769 Ga0501033_0005260 3300049570 Bacteria 10269
770 Ga0501033_0012240 3300049570 Bacteria 6548
771 Ga0501033_0012917 3300049570 Bacteria 6369
772 Ga0501033_0036296 3300049570 Bacteria 3693
773 Ga0501033_0175565 3300049570 Bacteria 1537
774 Ga0501033_0180575 3300049570 Bacteria 1513
775 Ga0501033_0245126 3300049570 Bacteria 1271
776 Ga0501033_0322472 3300049570 Bacteria 1085
777 Ga0501034_0000001 3300049571 Bacteria 2184493
778 Ga0501034_0010632 3300049571 Bacteria 9573
779 Ga0501034_0011194 3300049571 Bacteria 9312
780 Ga0501034_0027593 3300049571 Bacteria 5774
781 Ga0501034_0076662 3300049571 Bacteria 3350
782 Ga0501034_0076809 3300049571 Bacteria 3346
783 Ga0501034_0091835 3300049571 Bacteria 3033
784 Ga0501034_0133506 3300049571 Bacteria 2464
785 Ga0501034_0171039 3300049571 Bacteria 2140
786 Ga0501034_0251625 3300049571 Bacteria 1711
787 Ga0501034_1082268 3300049571 Bacteria 683
788 Ga0501036_0005653 3300049572 Bacteria 10145
789 Ga0501036_0005682 3300049572 Bacteria 10117
790 Ga0501036_0009536 3300049572 Bacteria 7983
791 Ga0501037_0024753 3300049573 Bacteria 4438
792 Ga0501037_0039814 3300049573 Bacteria 3459
793 Ga0501037_0091860 3300049573 Bacteria 2196
794 Ga0501037_0130333 3300049573 Bacteria 1803
795 Ga0501037_0314591 3300049573 Bacteria 1085
796 Ga0501037_0466743 3300049573 Bacteria 860
797 Ga0501038_0088134 3300049574 Bacteria 2605
798 Ga0501038_0116476 3300049574 Bacteria 2208
799 Ga0501038_0146861 3300049574 Bacteria 1925
800 Ga0501038_0147189 3300049574 Bacteria 1922
801 Ga0501038_0237262 3300049574 Bacteria 1449
802 Ga0501038_0240433 3300049574 Bacteria 1438
803 Ga0501038_0349287 3300049574 Bacteria 1152
804 Ga0501038_0681305 3300049574 Bacteria 772
805 Ga0501039_0000029 3300049575 Bacteria 131786
806 Ga0501039_0019053 3300049575 Bacteria 5264
807 Ga0501039_0168128 3300049575 Bacteria 1724
808 Ga0501039_0222759 3300049575 Bacteria 1483
809 Ga0501039_0349542 3300049575 Bacteria 1162
810 Ga0501039_1171961 3300049575 Bacteria 595
811 Ga0501042_0098300 3300049578 Bacteria 2105
812 Ga0501042_0392993 3300049578 Bacteria 1005
813 Ga0501043_0010388 3300049579 Bacteria 7296
814 Ga0501043_0014584 3300049579 Bacteria 6152
815 Ga0501043_0097012 3300049579 Bacteria 2317
816 Ga0501043_0198900 3300049579 Bacteria 1556
817 Ga0501043_0228594 3300049579 Bacteria 1437
818 Ga0501043_0369496 3300049579 Bacteria 1087
819 Ga0501043_0399659 3300049579 Bacteria 1038
820 Ga0501046_0005416 3300049580 Bacteria 11410
821 Ga0501046_0011762 3300049580 Bacteria 7472
822 Ga0501046_0012992 3300049580 Bacteria 7068
823 Ga0501047_0018715 3300049581 Bacteria 6641
824 Ga0501047_0025996 3300049581 Bacteria 5629
825 Ga0501047_0033976 3300049581 Bacteria 4923
826 Ga0501047_0065087 3300049581 Bacteria 3514
827 Ga0501047_0075405 3300049581 Bacteria 3245
828 Ga0501047_0131220 3300049581 Bacteria 2386
829 Ga0501047_0138742 3300049581 Bacteria 2310
830 Ga0501047_0160994 3300049581 Bacteria 2116
831 Ga0501047_0171826 3300049581 Bacteria 2036
832 Ga0501047_0176653 3300049581 Bacteria 2003
833 Ga0501047_0220930 3300049581 Bacteria 1751
834 Ga0501047_0251827 3300049581 Bacteria 1614
835 Ga0501047_0375584 3300049581 Bacteria 1256
836 Ga0501047_0441537 3300049581 Bacteria 1131
837 Ga0501047_0492805 3300049581 Bacteria 1052
838 Ga0501047_0559308 3300049581 Bacteria 968
839 Ga0501047_0798800 3300049581 Bacteria 758
840 Ga0501047_0883324 3300049581 Bacteria 707
841 Ga0501048_0023812 3300049582 Bacteria 4471
842 Ga0501048_0124442 3300049582 Bacteria 1823
843 Ga0501048_0209717 3300049582 Bacteria 1382
844 Ga0501048_0278719 3300049582 Bacteria 1189
845 Ga0501067_0001776 3300049583 Bacteria 11844
846 Ga0501067_0005578 3300049583 Bacteria 6979
847 Ga0501067_0022624 3300049583 Bacteria 3478
848 Ga0501068_0077512 3300049584 Bacteria 2035
849 Ga0501068_0601467 3300049584 Bacteria 716
850 Ga0501069_0022165 3300049585 Bacteria 3452
851 Ga0501069_0333797 3300049585 Bacteria 892
852 Ga0501070_0000481 3300049586 Bacteria 36249
853 Ga0501070_0003398 3300049586 Bacteria 13819
854 Ga0501070_0014964 3300049586 Bacteria 6527
855 Ga0501070_0143912 3300049586 Bacteria 1968
856 Ga0501070_0178515 3300049586 Bacteria 1748
857 Ga0501070_0309863 3300049586 Bacteria 1285
858 Ga0501070_0382617 3300049586 Bacteria 1140
859 Ga0501071_0135415 3300049587 Bacteria 1833
860 Ga0501071_0156932 3300049587 Bacteria 1699
861 Ga0501072_0015507 3300049588 Bacteria 5840
862 Ga0501073_0001669 3300049589 Bacteria 16438
863 Ga0501073_0004494 3300049589 Bacteria 10476
864 Ga0501073_0015128 3300049589 Bacteria 5597
865 Ga0501073_0059739 3300049589 Bacteria 2662
866 Ga0501073_0059886 3300049589 Bacteria 2658
867 Ga0501073_0061078 3300049589 Bacteria 2630
868 Ga0501073_0070275 3300049589 Bacteria 2439
869 Ga0501073_0987301 3300049589 Bacteria 579
870 Ga0501074_0004453 3300049590 Bacteria 10023
871 Ga0501074_0042382 3300049590 Bacteria 3293
872 Ga0501074_0079197 3300049590 Bacteria 2358
873 Ga0501077_0059400 3300049593 Bacteria 2427
874 Ga0501079_0001478 3300049741 Bacteria 16629
875 Ga0501079_0017836 3300049741 Bacteria 5421
876 Ga0501079_0140727 3300049741 Bacteria 1880
877 Ga0501079_0188192 3300049741 Bacteria 1611
878 Ga0501079_0330695 3300049741 Bacteria 1193
879 Ga0501080_0018079 3300049742 Bacteria 6526
880 Ga0501080_0040364 3300049742 Bacteria 4353
881 Ga0501080_0043846 3300049742 Bacteria 4165
882 Ga0501080_0062400 3300049742 Bacteria 3468
883 Ga0501080_0125187 3300049742 Bacteria 2380
884 Ga0501080_0179248 3300049742 Bacteria 1951
885 Ga0501080_0283362 3300049742 Bacteria 1506
886 Ga0501080_0628681 3300049742 Bacteria 951
887 Ga0501080_1069414 3300049742 Bacteria 697
888 Ga0501083_0077301 3300049744 Bacteria 2209
889 Ga0501083_0089262 3300049744 Bacteria 2037
890 Ga0501083_0117891 3300049744 Bacteria 1742
891 Ga0501083_0135923 3300049744 Bacteria 1611
892 Ga0501083_0275277 3300049744 Bacteria 1095
893 Ga0501083_0712658 3300049744 Bacteria 653
894 Ga0501280_000425 3300049776 Bacteria 10117
895 Ga0501282_002357 3300049778 Bacteria 2062
896 Ga0501035_0019622 3300049822 Bacteria 6212
897 Ga0501035_0037025 3300049822 Bacteria 4420
898 Ga0501035_0044851 3300049822 Bacteria 3979
899 Ga0501035_0048543 3300049822 Bacteria 3807
900 Ga0501035_0065562 3300049822 Bacteria 3225
901 Ga0501035_0085166 3300049822 Bacteria 2786
902 Ga0501035_0162505 3300049822 Bacteria 1932
903 Ga0501035_0190474 3300049822 Bacteria 1763
904 Ga0501035_0254054 3300049822 Bacteria 1492
905 Ga0501035_0283204 3300049822 Bacteria 1400
906 Ga0501035_0300904 3300049822 Bacteria 1351
907 Ga0501035_0914179 3300049822 Bacteria 694
908 Ga0501044_0015755 3300049823 Bacteria 8141
909 Ga0501044_0024878 3300049823 Bacteria 6351
910 Ga0501044_0032329 3300049823 Bacteria 5501
911 Ga0501044_0044540 3300049823 Bacteria 4604
912 Ga0501044_0099276 3300049823 Bacteria 2930
913 Ga0501044_0114803 3300049823 Bacteria 2698
914 Ga0501044_0129184 3300049823 Bacteria 2522
915 Ga0501044_0140739 3300049823 Bacteria 2401
916 Ga0501044_0161480 3300049823 Bacteria 2217
917 Ga0501044_0210012 3300049823 Bacteria 1901
918 Ga0501044_0504734 3300049823 Bacteria 1110
919 Ga0501044_0519482 3300049823 Bacteria 1090
920 Ga0501045_0128835 3300049824 Bacteria 1881
921 nmdc:mga03683_252067_c1 3300050489 Bacteria 820
922 nmdc:mga03n38_135_c1 3300050490 Bacteria 16000
923 nmdc:mga00v17_123_c1 3300050491 Bacteria 45547
924 nmdc:mga00v17_385_c1 3300050491 Bacteria 25012
925 nmdc:mga0yw44_265_c1 3300050492 Bacteria 17906
926 nmdc:mga06z11_3977_c1 3300050494 Bacteria 5765
927 nmdc:mga06z11_6666_c1 3300050494 Bacteria 4721
928 nmdc:mga04h51_108108_c1 3300050495 Bacteria 1022
929 nmdc:mga04h51_55057_c1 3300050495 Bacteria 1347
930 nmdc:mga07m45_68_c1 3300050496 Bacteria 39566
931 nmdc:mga05p37_167955_c1 3300050507 Bacteria 2677
932 nmdc:mga05p37_507131_c1 3300050507 Bacteria 1383
933 nmdc:mga09592_25742_c1 3300050508 Bacteria 4871
934 nmdc:mga09592_80345_c1 3300050508 Bacteria 2777
935 nmdc:mga0qj67_173986_c1 3300050509 Bacteria 1748
936 nmdc:mga0qj67_275124_c1 3300050509 Bacteria 1365
937 nmdc:mga08y16_19140_c1 3300050511 Bacteria 7214
938 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
939 nmdc:mga0n895_10772_c1 3300050512 Bacteria 8108
940 nmdc:mga0n895_17129_c1 3300050512 Bacteria 6675
941 nmdc:mga0n895_277025_c1 3300050512 Bacteria 1701
942 nmdc:mga0n895_789078_c1 3300050512 Bacteria 941
943 nmdc:mga0rr50_45774_c1 3300050513 Bacteria 3218
944 nmdc:mga0rr50_7934_c1 3300050513 Bacteria 6586
945 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
946 nmdc:mga08x19_2026_c1 3300050514 Bacteria 12425
947 nmdc:mga08x19_945_c1 3300050514 Bacteria 18277
948 nmdc:mga0a205_20420_c1 3300050515 Bacteria 6248
949 nmdc:mga0sz30_17_c1 3300050516 Bacteria 48963
950 Ga0495619_0184369 3300053085 Bacteria 1444
951 Ga0500643_000003 3300053087 Bacteria 876659
952 Ga0500566_0181241 3300053094 Bacteria 1080
953 Ga0500592_011077 3300053116 Bacteria 1441
954 Ga0500594_0012014 3300053118 Bacteria 2032
955 Ga0500595_001661 3300053119 Bacteria 11694
956 Ga0500595_101861 3300053119 Bacteria 822
957 Ga0500655_006392 3300053133 Bacteria 2121
958 Ga0500559_0020972 3300053136 Bacteria 2766
959 Ga0500568_0047421 3300053139 Bacteria 1702
960 Ga0500573_0000452 3300053140 Bacteria 17648
961 Ga0500619_043325 3300053154 Bacteria 1430
962 Ga0500639_087393 3300053163 Bacteria 1559
963 Ga0500576_168654 3300053725 Bacteria 791
964 Ga0500645_070785 3300053730 Bacteria 1001
965 Ga0500645_104061 3300053730 Bacteria 799
966 Ga0501084_0000175 3300054114 Bacteria 50123
967 Ga0501084_0007620 3300054114 Bacteria 8925
968 Ga0501084_0029906 3300054114 Bacteria 4556
969 Ga0501084_0074161 3300054114 Bacteria 2849
970 Ga0501084_0145505 3300054114 Bacteria 1996
971 Ga0501084_0363006 3300054114 Bacteria 1224
972 Ga0501082_0006964 3300060353 Bacteria 9766
973 Ga0501082_0039783 3300060353 Bacteria 4056
974 Ga0501082_0069701 3300060353 Bacteria 3028
975 Ga0501082_0107936 3300060353 Bacteria 2409
976 Ga0501082_0590704 3300060353 Bacteria 972
977 Ga0530510_0238077 3300061734 Bacteria 1355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10294542 Ga0207684_102945422 154
2 3300039437 Ga0436365_1584141 Ga0436365_1584141_12_476 154
3 3300005338 Ga0068868_100153898 Ga0068868_1001538981 156
4 3300005355 Ga0070671_100563781 Ga0070671_1005637812 156
5 3300005436 Ga0070713_100364268 Ga0070713_1003642682 156
6 3300005437 Ga0070710_10553255 Ga0070710_105532552 156
7 3300005455 Ga0070663_100264255 Ga0070663_1002642553 156
8 3300005578 Ga0068854_100347723 Ga0068854_1003477232 156
9 3300005615 Ga0070702_100299022 Ga0070702_1002990223 156
10 3300005718 Ga0068866_10072414 Ga0068866_100724143 156
11 3300005841 Ga0068863_101146006 Ga0068863_1011460062 156
12 3300009098 Ga0105245_10538363 Ga0105245_105383631 156
13 3300009545 Ga0105237_10627975 Ga0105237_106279753 156
14 3300011119 Ga0105246_10062954 Ga0105246_100629544 156
15 3300013297 Ga0157378_10115850 Ga0157378_101158504 156
16 3300014325 Ga0163163_10915513 Ga0163163_109155132 156
17 3300025899 Ga0207642_10017630 Ga0207642_100176303 156
18 3300025908 Ga0207643_10032595 Ga0207643_100325957 156
19 3300025911 Ga0207654_10063489 Ga0207654_100634894 156
20 3300025925 Ga0207650_10171098 Ga0207650_101710984 156
21 3300025927 Ga0207687_10325007 Ga0207687_103250072 156
22 3300026067 Ga0207678_10367816 Ga0207678_103678162 156
23 3300035172 Ga0373955_0246502 Ga0373955_0246502_446_979 156
24 3300035207 Ga0373942_0071250 Ga0373942_0071250_195_728 156
25 3300035692 Ga0373935_0133269 Ga0373935_0133269_1107_1640 156
26 3300005328 Ga0070676_10079075 Ga0070676_100790754 157
27 3300005334 Ga0068869_100070091 Ga0068869_1000700914 157
28 3300005459 Ga0068867_100540816 Ga0068867_1005408161 157
29 3300005577 Ga0068857_100361571 Ga0068857_1003615712 157
30 3300005718 Ga0068866_10260834 Ga0068866_102608342 157
31 3300009098 Ga0105245_10230243 Ga0105245_102302432 157
32 3300009148 Ga0105243_10014172 Ga0105243_100141726 157
33 3300009176 Ga0105242_10891180 Ga0105242_108911802 157
34 3300011119 Ga0105246_10563413 Ga0105246_105634131 157
35 3300025908 Ga0207643_10030805 Ga0207643_100308055 157
36 3300025926 Ga0207659_10166081 Ga0207659_101660812 157
37 3300025927 Ga0207687_10085895 Ga0207687_100858953 157
38 3300025934 Ga0207686_10073147 Ga0207686_100731472 157
39 3300025935 Ga0207709_10125051 Ga0207709_101250512 157
40 3300025936 Ga0207670_10845695 Ga0207670_108456951 157
41 3300025942 Ga0207689_10127211 Ga0207689_101272114 157
42 3300026089 Ga0207648_10154508 Ga0207648_101545082 157
43 3300035112 Ga0373932_0201431 Ga0373932_0201431_159_692 157
44 3300005435 Ga0070714_100000676 Ga0070714_1000006764 158
45 3300025919 Ga0207657_10734228 Ga0207657_107342282 158
46 3300025929 Ga0207664_10032838 Ga0207664_100328386 158
47 3300046539 Ga0495621_0007305 Ga0495621_0007305_1811_2332 158
48 3300026121 Ga0207683_11029523 Ga0207683_110295232 159
49 3300039450 Ga0436363_1041884 Ga0436363_1041884_46_579 159
50 3300049589 Ga0501073_0987301 Ga0501073_0987301_23_502 159
51 3300006237 Ga0097621_100047344 Ga0097621_1000473446 160
52 3300006358 Ga0068871_100162546 Ga0068871_1001625464 160
53 3300009148 Ga0105243_10222994 Ga0105243_102229943 160
54 3300013297 Ga0157378_10549314 Ga0157378_105493143 160
55 3300014968 Ga0157379_10052289 Ga0157379_100522894 160
56 3300026078 Ga0207702_11758665 Ga0207702_117586651 160
57 3300037068 Ga0373925_1342811 Ga0373925_1342811_26_508 160
58 3300006847 Ga0075431_100116845 Ga0075431_1001168453 161
59 3300014326 Ga0157380_10294611 Ga0157380_102946113 161
60 3300025931 Ga0207644_10562368 Ga0207644_105623681 161
61 3300039437 Ga0436365_1351612 Ga0436365_1351612_26_559 161
62 3300005341 Ga0070691_10222565 Ga0070691_102225651 162
63 3300005456 Ga0070678_100013560 Ga0070678_1000135602 162
64 3300005618 Ga0068864_100440435 Ga0068864_1004404352 162
65 3300010375 Ga0105239_12206314 Ga0105239_122063141 162
66 3300025925 Ga0207650_10536252 Ga0207650_105362522 162
67 3300025940 Ga0207691_10325382 Ga0207691_103253822 162
68 3300046492 Ga0495585_0181428 Ga0495585_0181428_499_1032 162
69 3300046558 Ga0495633_0110090 Ga0495633_0110090_557_1090 162
70 3300046665 Ga0495661_0198281 Ga0495661_0198281_317_850 162
71 3300005458 Ga0070681_10160044 Ga0070681_101600443 163
72 3300049581 Ga0501047_0220930 Ga0501047_0220930_466_999 163
73 3300009177 Ga0105248_10408693 Ga0105248_104086933 164
74 3300035691 Ga0373931_0111163 Ga0373931_0111163_249_782 164
75 3300005336 Ga0070680_100226414 Ga0070680_1002264142 165
76 3300005458 Ga0070681_10179316 Ga0070681_101793162 165
77 3300025912 Ga0207707_10124122 Ga0207707_101241222 165
78 3300049570 Ga0501033_0245126 Ga0501033_0245126_559_1092 165
79 3300028379 Ga0268266_11207351 Ga0268266_112073511 166
80 3300028577 Ga0265318_10004788 Ga0265318_100047884 166
81 3300031238 Ga0265332_10031083 Ga0265332_100310835 166
82 3300031240 Ga0265320_10057577 Ga0265320_100575773 166
83 3300031241 Ga0265325_10021041 Ga0265325_100210414 166
84 3300031250 Ga0265331_10021847 Ga0265331_100218476 166
85 3300031711 Ga0265314_10213503 Ga0265314_102135032 166
86 3300048918 Ga0496115_0373355 Ga0496115_0373355_93_626 166
87 3300048929 Ga0496126_0000480 Ga0496126_0000480_21158_21691 166
88 3300025915 Ga0207693_10054085 Ga0207693_100540854 167
89 3300031344 Ga0265316_10044806 Ga0265316_100448062 167
90 3300046459 Ga0495629_0083513 Ga0495629_0083513_1078_1611 167
91 3300047319 Ga0495674_0687412 Ga0495674_0687412_184_768 167
92 3300049551 Ga0501335_006385 Ga0501335_006385_551_1054 167
93 3300049581 Ga0501047_0033976 Ga0501047_0033976_1696_2229 167
94 3300049744 Ga0501083_0275277 Ga0501083_0275277_125_658 167
95 3300049822 Ga0501035_0283204 Ga0501035_0283204_821_1354 167
96 3300049823 Ga0501044_0114803 Ga0501044_0114803_1766_2299 167
97 3300005327 Ga0070658_11372238 Ga0070658_113722381 169
98 3300005339 Ga0070660_100174288 Ga0070660_1001742883 169
99 3300005435 Ga0070714_101124907 Ga0070714_1011249071 169
100 3300005458 Ga0070681_10034634 Ga0070681_100346345 169
101 3300005530 Ga0070679_100064794 Ga0070679_1000647944 169
102 3300005530 Ga0070679_100335688 Ga0070679_1003356883 169
103 3300005539 Ga0068853_100714452 Ga0068853_1007144521 169
104 3300005548 Ga0070665_100175548 Ga0070665_1001755485 169
105 3300005548 Ga0070665_100600604 Ga0070665_1006006042 169
106 3300005563 Ga0068855_100121416 Ga0068855_1001214164 169
107 3300005563 Ga0068855_100953360 Ga0068855_1009533602 169
108 3300005577 Ga0068857_100983381 Ga0068857_1009833812 169
109 3300006175 Ga0070712_100113045 Ga0070712_1001130453 169
110 3300006358 Ga0068871_100419656 Ga0068871_1004196562 169
111 3300009093 Ga0105240_10571025 Ga0105240_105710253 169
112 3300009174 Ga0105241_10455114 Ga0105241_104551142 169
113 3300009551 Ga0105238_10130022 Ga0105238_101300225 169
114 3300010375 Ga0105239_10243523 Ga0105239_102435235 169
115 3300010375 Ga0105239_10259863 Ga0105239_102598633 169
116 3300013105 Ga0157369_10345530 Ga0157369_103455302 169
117 3300025909 Ga0207705_10194396 Ga0207705_101943963 169
118 3300025913 Ga0207695_10128661 Ga0207695_101286615 169
119 3300025913 Ga0207695_10383850 Ga0207695_103838503 169
120 3300025914 Ga0207671_10408901 Ga0207671_104089012 169
121 3300025914 Ga0207671_10499698 Ga0207671_104996982 169
122 3300025924 Ga0207694_10026889 Ga0207694_100268893 169
123 3300025924 Ga0207694_10864858 Ga0207694_108648581 169
124 3300025929 Ga0207664_10411486 Ga0207664_104114863 169
125 3300025960 Ga0207651_10169073 Ga0207651_101690734 169
126 3300026116 Ga0207674_10192958 Ga0207674_101929584 169
127 3300037312 Ga0395899_0224824 Ga0395899_0224824_671_1204 169
128 3300037418 Ga0395900_0098142 Ga0395900_0098142_1328_1861 169
129 3300037466 Ga0395898_0359028 Ga0395898_0359028_663_1196 169
130 3300038443 Ga0395901_0072035 Ga0395901_0072035_2713_3246 169
131 3300046473 Ga0495582_0065981 Ga0495582_0065981_555_1088 169
132 3300046476 Ga0495662_0112098 Ga0495662_0112098_275_808 169
133 3300046477 Ga0495664_0237404 Ga0495664_0237404_552_1085 169
134 3300046536 Ga0495587_0122784 Ga0495587_0122784_347_880 169
135 3300047444 Ga0495675_0256692 Ga0495675_0256692_150_683 169
136 3300048088 Ga0495602_0175950 Ga0495602_0175950_1019_1552 169
137 3300049581 Ga0501047_0171826 Ga0501047_0171826_146_679 169
138 3300050507 nmdc:mga05p37_507131_c1 nmdc:mga05p37_507131_c1_170_679 169
139 3300050508 nmdc:mga09592_80345_c1 nmdc:mga09592_80345_c1_1954_2463 169
140 3300050511 nmdc:mga08y16_2559_c1 nmdc:mga08y16_2559_c1_12472_12981 169
141 3300053725 Ga0500576_168654 Ga0500576_168654_146_679 169
142 3300013306 Ga0163162_11179552 Ga0163162_111795522 170
143 3300014325 Ga0163163_10008003 Ga0163163_100080034 170
144 3300046507 Ga0495606_0159747 Ga0495606_0159747_104_637 170
145 3300046694 Ga0495649_0224280 Ga0495649_0224280_126_659 170
146 3300049529 Ga0501313_009732 Ga0501313_009732_152_667 171
147 iso_pu_bacteria 2739367655 2739613616 173
148 3300006038 Ga0075365_10000030 Ga0075365_1000003019 175
149 3300006042 Ga0075368_10095597 Ga0075368_100955973 175
150 3300006048 Ga0075363_100001020 Ga0075363_10000102015 175
151 3300006051 Ga0075364_10000068 Ga0075364_1000006832 175
152 3300006051 Ga0075364_10024136 Ga0075364_100241369 175
153 3300006178 Ga0075367_10018355 Ga0075367_100183559 175
154 3300006186 Ga0075369_10000030 Ga0075369_1000003013 175
155 3300006353 Ga0075370_10000042 Ga0075370_1000004231 175
156 3300006880 Ga0075429_100028322 Ga0075429_1000283224 175
157 3300009147 Ga0114129_10070335 Ga0114129_1007033510 175
158 3300025939 Ga0207665_10241385 Ga0207665_102413853 175
159 3300027866 Ga0209813_10045800 Ga0209813_100458002 175
160 3300027866 Ga0209813_10091394 Ga0209813_100913942 175
161 3300050489 nmdc:mga03683_252067_c1 nmdc:mga03683_252067_c1_21_551 175
162 3300050490 nmdc:mga03n38_135_c1 nmdc:mga03n38_135_c1_15065_15595 175
163 3300050491 nmdc:mga00v17_123_c1 nmdc:mga00v17_123_c1_33237_33767 175
164 3300050491 nmdc:mga00v17_385_c1 nmdc:mga00v17_385_c1_12577_13107 175
165 3300050492 nmdc:mga0yw44_265_c1 nmdc:mga0yw44_265_c1_13189_13719 175
166 3300050494 nmdc:mga06z11_3977_c1 nmdc:mga06z11_3977_c1_5135_5665 175
167 3300050494 nmdc:mga06z11_6666_c1 nmdc:mga06z11_6666_c1_3786_4316 175
168 3300050495 nmdc:mga04h51_108108_c1 nmdc:mga04h51_108108_c1_53_583 175
169 3300050495 nmdc:mga04h51_55057_c1 nmdc:mga04h51_55057_c1_445_975 175
170 3300050496 nmdc:mga07m45_68_c1 nmdc:mga07m45_68_c1_24002_24532 175
171 3300050507 nmdc:mga05p37_167955_c1 nmdc:mga05p37_167955_c1_1014_1541 175
172 3300050508 nmdc:mga09592_25742_c1 nmdc:mga09592_25742_c1_3196_3726 175
173 3300050512 nmdc:mga0n895_17129_c1 nmdc:mga0n895_17129_c1_5026_5556 175
174 3300050516 nmdc:mga0sz30_17_c1 nmdc:mga0sz30_17_c1_33378_33908 175
175 3300013297 Ga0157378_10232385 Ga0157378_102323853 176
176 3300042876 Ga0451577_0743919 Ga0451577_0743919_220_750 176
177 3300044712 Ga0453684_0000682 Ga0453684_0000682_112972_113502 176
178 3300045051 Ga0451576_0363162 Ga0451576_0363162_969_1499 176
179 3300003214 JGI25165J46597_1001315 JGI25165J46597_100131510 177
180 3300003215 JGI25153J46596_10000830 JGI25153J46596_1000083016 177
181 3300003320 rootH2_10048944 rootH2_100489443 177
182 3300004798 Ga0058859_10022480 Ga0058859_100224803 177
183 3300004799 Ga0058863_11970613 Ga0058863_119706132 177
184 3300004803 Ga0058862_11940969 Ga0058862_119409692 177
185 3300005327 Ga0070658_10045521 Ga0070658_100455212 177
186 3300005328 Ga0070676_10302467 Ga0070676_103024671 177
187 3300005329 Ga0070683_100088671 Ga0070683_1000886714 177
188 3300005329 Ga0070683_100187211 Ga0070683_1001872112 177
189 3300005330 Ga0070690_100219016 Ga0070690_1002190162 177
190 3300005330 Ga0070690_100294104 Ga0070690_1002941043 177
191 3300005330 Ga0070690_100539086 Ga0070690_1005390862 177
192 3300005334 Ga0068869_101415616 Ga0068869_1014156161 177
193 3300005335 Ga0070666_10007106 Ga0070666_100071068 177
194 3300005335 Ga0070666_10123583 Ga0070666_101235833 177
195 3300005336 Ga0070680_100002998 Ga0070680_10000299812 177
196 3300005336 Ga0070680_100072787 Ga0070680_1000727872 177
197 3300005336 Ga0070680_100078879 Ga0070680_1000788796 177
198 3300005336 Ga0070680_100255022 Ga0070680_1002550222 177
199 3300005338 Ga0068868_100397645 Ga0068868_1003976451 177
200 3300005338 Ga0068868_101181538 Ga0068868_1011815381 177
201 3300005339 Ga0070660_100018276 Ga0070660_10001827610 177
202 3300005339 Ga0070660_100069129 Ga0070660_1000691295 177
203 3300005339 Ga0070660_100089034 Ga0070660_1000890343 177
204 3300005339 Ga0070660_100108074 Ga0070660_1001080744 177
205 3300005339 Ga0070660_100477533 Ga0070660_1004775332 177
206 3300005340 Ga0070689_100415195 Ga0070689_1004151951 177
207 3300005341 Ga0070691_10000386 Ga0070691_1000038613 177
208 3300005341 Ga0070691_10149346 Ga0070691_101493461 177
209 3300005341 Ga0070691_10155140 Ga0070691_101551401 177
210 3300005344 Ga0070661_100005946 Ga0070661_1000059463 177
211 3300005344 Ga0070661_100843647 Ga0070661_1008436471 177
212 3300005354 Ga0070675_101654718 Ga0070675_1016547181 177
213 3300005355 Ga0070671_100262784 Ga0070671_1002627843 177
214 3300005356 Ga0070674_100041872 Ga0070674_1000418722 177
215 3300005365 Ga0070688_100357639 Ga0070688_1003576392 177
216 3300005366 Ga0070659_100012925 Ga0070659_10001292511 177
217 3300005366 Ga0070659_100027373 Ga0070659_1000273732 177
218 3300005367 Ga0070667_100061525 Ga0070667_1000615255 177
219 3300005367 Ga0070667_100349423 Ga0070667_1003494231 177
220 3300005434 Ga0070709_10003511 Ga0070709_1000351118 177
221 3300005434 Ga0070709_10171867 Ga0070709_101718673 177
222 3300005435 Ga0070714_100068815 Ga0070714_1000688153 177
223 3300005435 Ga0070714_100109782 Ga0070714_1001097823 177
224 3300005435 Ga0070714_100530839 Ga0070714_1005308392 177
225 3300005435 Ga0070714_101188515 Ga0070714_1011885151 177
226 3300005436 Ga0070713_100000012 Ga0070713_100000012131 177
227 3300005436 Ga0070713_100162144 Ga0070713_1001621442 177
228 3300005436 Ga0070713_100213904 Ga0070713_1002139042 177
229 3300005437 Ga0070710_10040281 Ga0070710_100402816 177
230 3300005439 Ga0070711_100240856 Ga0070711_1002408562 177
231 3300005439 Ga0070711_100351636 Ga0070711_1003516362 177
232 3300005439 Ga0070711_100570669 Ga0070711_1005706692 177
233 3300005444 Ga0070694_100283260 Ga0070694_1002832602 177
234 3300005444 Ga0070694_100340525 Ga0070694_1003405251 177
235 3300005456 Ga0070678_100021125 Ga0070678_1000211256 177
236 3300005456 Ga0070678_100069504 Ga0070678_1000695045 177
237 3300005456 Ga0070678_100681426 Ga0070678_1006814261 177
238 3300005458 Ga0070681_10000037 Ga0070681_1000003718 177
239 3300005458 Ga0070681_10048475 Ga0070681_100484756 177
240 3300005458 Ga0070681_10237697 Ga0070681_102376973 177
241 3300005459 Ga0068867_100100755 Ga0068867_1001007552 177
242 3300005468 Ga0070707_101144481 Ga0070707_1011444812 177
243 3300005518 Ga0070699_100114998 Ga0070699_1001149981 177
244 3300005518 Ga0070699_100215896 Ga0070699_1002158963 177
245 3300005530 Ga0070679_100008411 Ga0070679_10000841118 177
246 3300005530 Ga0070679_100082939 Ga0070679_1000829393 177
247 3300005535 Ga0070684_100283884 Ga0070684_1002838842 177
248 3300005539 Ga0068853_100002020 Ga0068853_10000202017 177
249 3300005539 Ga0068853_100002660 Ga0068853_1000026608 177
250 3300005539 Ga0068853_100237414 Ga0068853_1002374141 177
251 3300005539 Ga0068853_101136376 Ga0068853_1011363761 177
252 3300005544 Ga0070686_100311002 Ga0070686_1003110023 177
253 3300005545 Ga0070695_100019206 Ga0070695_1000192066 177
254 3300005546 Ga0070696_101268626 Ga0070696_1012686261 177
255 3300005547 Ga0070693_100381808 Ga0070693_1003818081 177
256 3300005548 Ga0070665_100087868 Ga0070665_1000878683 177
257 3300005548 Ga0070665_100093536 Ga0070665_1000935366 177
258 3300005548 Ga0070665_100264776 Ga0070665_1002647762 177
259 3300005549 Ga0070704_100029374 Ga0070704_1000293746 177
260 3300005563 Ga0068855_100000385 Ga0068855_1000003858 177
261 3300005563 Ga0068855_100034625 Ga0068855_1000346259 177
262 3300005563 Ga0068855_100161413 Ga0068855_1001614135 177
263 3300005563 Ga0068855_100693807 Ga0068855_1006938071 177
264 3300005563 Ga0068855_101722291 Ga0068855_1017222911 177
265 3300005577 Ga0068857_100007896 Ga0068857_1000078964 177
266 3300005577 Ga0068857_100258522 Ga0068857_1002585223 177
267 3300005614 Ga0068856_100001032 Ga0068856_10000103218 177
268 3300005614 Ga0068856_100021325 Ga0068856_1000213258 177
269 3300005614 Ga0068856_100155308 Ga0068856_1001553085 177
270 3300005614 Ga0068856_100478045 Ga0068856_1004780452 177
271 3300005614 Ga0068856_100685912 Ga0068856_1006859122 177
272 3300005616 Ga0068852_100063743 Ga0068852_1000637436 177
273 3300005616 Ga0068852_100142311 Ga0068852_1001423114 177
274 3300005616 Ga0068852_100187615 Ga0068852_1001876152 177
275 3300005616 Ga0068852_100289160 Ga0068852_1002891603 177
276 3300005616 Ga0068852_100393106 Ga0068852_1003931062 177
277 3300005618 Ga0068864_101611468 Ga0068864_1016114682 177
278 3300005841 Ga0068863_100043883 Ga0068863_1000438836 177
279 3300005842 Ga0068858_100049282 Ga0068858_1000492825 177
280 3300005842 Ga0068858_100477057 Ga0068858_1004770572 177
281 3300005843 Ga0068860_100950609 Ga0068860_1009506092 177
282 3300005843 Ga0068860_101559447 Ga0068860_1015594472 177
283 3300005844 Ga0068862_100100297 Ga0068862_1001002974 177
284 3300005983 Ga0081540_1008438 Ga0081540_10084383 177
285 3300006173 Ga0070716_100211553 Ga0070716_1002115533 177
286 3300006173 Ga0070716_100564291 Ga0070716_1005642912 177
287 3300006175 Ga0070712_100000902 Ga0070712_10000090217 177
288 3300006175 Ga0070712_100004052 Ga0070712_10000405218 177
289 3300006175 Ga0070712_100317927 Ga0070712_1003179272 177
290 3300006237 Ga0097621_100106219 Ga0097621_1001062195 177
291 3300006237 Ga0097621_100161557 Ga0097621_1001615574 177
292 3300006237 Ga0097621_100227174 Ga0097621_1002271744 177
293 3300006237 Ga0097621_100318759 Ga0097621_1003187591 177
294 3300006237 Ga0097621_100402268 Ga0097621_1004022682 177
295 3300006358 Ga0068871_100019627 Ga0068871_1000196278 177
296 3300006358 Ga0068871_100071528 Ga0068871_1000715285 177
297 3300006358 Ga0068871_100175438 Ga0068871_1001754382 177
298 3300006358 Ga0068871_100301487 Ga0068871_1003014872 177
299 3300006358 Ga0068871_100839602 Ga0068871_1008396021 177
300 3300006844 Ga0075428_100000808 Ga0075428_10000080818 177
301 3300006846 Ga0075430_100194948 Ga0075430_1001949482 177
302 3300006847 Ga0075431_101399219 Ga0075431_1013992192 177
303 3300006852 Ga0075433_10105346 Ga0075433_101053465 177
304 3300006871 Ga0075434_100176261 Ga0075434_1001762614 177
305 3300006871 Ga0075434_100262322 Ga0075434_1002623221 177
306 3300006871 Ga0075434_100441455 Ga0075434_1004414552 177
307 3300006880 Ga0075429_100043701 Ga0075429_1000437014 177
308 3300006881 Ga0068865_100002505 Ga0068865_1000025058 177
309 3300006914 Ga0075436_100000458 Ga0075436_10000045825 177
310 3300006914 Ga0075436_100000862 Ga0075436_10000086214 177
311 3300006914 Ga0075436_100002564 Ga0075436_1000025646 177
312 3300006914 Ga0075436_100029529 Ga0075436_1000295296 177
313 3300007076 Ga0075435_100006049 Ga0075435_10000604913 177
314 3300007076 Ga0075435_100018960 Ga0075435_1000189609 177
315 3300007076 Ga0075435_100609814 Ga0075435_1006098142 177
316 3300009092 Ga0105250_10440537 Ga0105250_104405371 177
317 3300009093 Ga0105240_10004232 Ga0105240_100042329 177
318 3300009093 Ga0105240_10004696 Ga0105240_1000469618 177
319 3300009093 Ga0105240_10017473 Ga0105240_1001747318 177
320 3300009093 Ga0105240_10025381 Ga0105240_100253813 177
321 3300009093 Ga0105240_10150688 Ga0105240_101506883 177
322 3300009093 Ga0105240_10252800 Ga0105240_102528003 177
323 3300009093 Ga0105240_10675787 Ga0105240_106757872 177
324 3300009093 Ga0105240_10722476 Ga0105240_107224762 177
325 3300009093 Ga0105240_11279886 Ga0105240_112798861 177
326 3300009094 Ga0111539_10002099 Ga0111539_1000209918 177
327 3300009094 Ga0111539_10023579 Ga0111539_100235798 177
328 3300009101 Ga0105247_10056711 Ga0105247_100567113 177
329 3300009174 Ga0105241_10035275 Ga0105241_100352757 177
330 3300009174 Ga0105241_10116852 Ga0105241_101168525 177
331 3300009174 Ga0105241_10469421 Ga0105241_104694212 177
332 3300009174 Ga0105241_10477193 Ga0105241_104771932 177
333 3300009174 Ga0105241_10731521 Ga0105241_107315212 177
334 3300009176 Ga0105242_10123893 Ga0105242_101238934 177
335 3300009176 Ga0105242_10848595 Ga0105242_108485952 177
336 3300009177 Ga0105248_10000005 Ga0105248_1000000518 177
337 3300009177 Ga0105248_10047589 Ga0105248_100475893 177
338 3300009177 Ga0105248_10063706 Ga0105248_100637067 177
339 3300009545 Ga0105237_10003253 Ga0105237_1000325322 177
340 3300009545 Ga0105237_10181890 Ga0105237_101818904 177
341 3300009551 Ga0105238_10001939 Ga0105238_1000193918 177
342 3300009551 Ga0105238_10017491 Ga0105238_100174917 177
343 3300009551 Ga0105238_10055822 Ga0105238_100558224 177
344 3300009551 Ga0105238_10179895 Ga0105238_101798952 177
345 3300009551 Ga0105238_10426203 Ga0105238_104262032 177
346 3300009551 Ga0105238_10826441 Ga0105238_108264411 177
347 3300009553 Ga0105249_10348653 Ga0105249_103486533 177
348 3300010159 Ga0099796_10011720 Ga0099796_100117204 177
349 3300010375 Ga0105239_10005584 Ga0105239_100055843 177
350 3300010375 Ga0105239_10073553 Ga0105239_100735535 177
351 3300010375 Ga0105239_10077915 Ga0105239_100779156 177
352 3300010375 Ga0105239_10210784 Ga0105239_102107845 177
353 3300010375 Ga0105239_10377439 Ga0105239_103774391 177
354 3300011119 Ga0105246_10013218 Ga0105246_100132188 177
355 3300011119 Ga0105246_10516333 Ga0105246_105163332 177
356 3300013100 Ga0157373_10000820 Ga0157373_1000082021 177
357 3300013100 Ga0157373_10567405 Ga0157373_105674052 177
358 3300013102 Ga0157371_10098586 Ga0157371_100985862 177
359 3300013102 Ga0157371_10655232 Ga0157371_106552322 177
360 3300013104 Ga0157370_10003448 Ga0157370_1000344815 177
361 3300013104 Ga0157370_10008323 Ga0157370_100083236 177
362 3300013104 Ga0157370_10035566 Ga0157370_100355669 177
363 3300013104 Ga0157370_10083851 Ga0157370_100838513 177
364 3300013104 Ga0157370_11614616 Ga0157370_116146161 177
365 3300013105 Ga0157369_10001535 Ga0157369_1000153518 177
366 3300013105 Ga0157369_10033188 Ga0157369_100331886 177
367 3300013105 Ga0157369_10407520 Ga0157369_104075203 177
368 3300013105 Ga0157369_11085912 Ga0157369_110859121 177
369 3300013296 Ga0157374_10377448 Ga0157374_103774482 177
370 3300013297 Ga0157378_10424647 Ga0157378_104246472 177
371 3300013297 Ga0157378_10885088 Ga0157378_108850882 177
372 3300013297 Ga0157378_10906097 Ga0157378_109060972 177
373 3300013306 Ga0163162_10250500 Ga0163162_102505003 177
374 3300013306 Ga0163162_10446856 Ga0163162_104468562 177
375 3300013307 Ga0157372_10007016 Ga0157372_100070169 177
376 3300013307 Ga0157372_10008268 Ga0157372_1000826816 177
377 3300013307 Ga0157372_10032489 Ga0157372_100324894 177
378 3300013307 Ga0157372_10037651 Ga0157372_100376518 177
379 3300013307 Ga0157372_10066383 Ga0157372_100663835 177
380 3300013307 Ga0157372_10327295 Ga0157372_103272951 177
381 3300013308 Ga0157375_10614872 Ga0157375_106148721 177
382 3300014325 Ga0163163_10332968 Ga0163163_103329682 177
383 3300014968 Ga0157379_10007681 Ga0157379_100076818 177
384 3300014968 Ga0157379_10010518 Ga0157379_1001051812 177
385 3300014968 Ga0157379_10019718 Ga0157379_100197184 177
386 3300014968 Ga0157379_10232957 Ga0157379_102329572 177
387 3300014968 Ga0157379_10428308 Ga0157379_104283082 177
388 3300014969 Ga0157376_10147364 Ga0157376_101473642 177
389 3300014969 Ga0157376_10291481 Ga0157376_102914812 177
390 3300014969 Ga0157376_10517483 Ga0157376_105174831 177
391 3300017792 Ga0163161_10646087 Ga0163161_106460871 177
392 3300021377 Ga0213874_10002785 Ga0213874_100027855 177
393 3300021377 Ga0213874_10006777 Ga0213874_100067772 177
394 3300021384 Ga0213876_10000421 Ga0213876_1000042119 177
395 3300021384 Ga0213876_10003189 Ga0213876_1000318918 177
396 3300021384 Ga0213876_10027585 Ga0213876_100275854 177
397 3300021384 Ga0213876_10103540 Ga0213876_101035401 177
398 3300025230 Ga0209563_105604 Ga0209563_1056043 177
399 3300025261 Ga0209233_1000013 Ga0209233_1000013742 177
400 3300025272 Ga0209455_1020331 Ga0209455_10203312 177
401 3300025297 Ga0209758_1000013 Ga0209758_1000013895 177
402 3300025297 Ga0209758_1152298 Ga0209758_11522981 177
403 3300025903 Ga0207680_10002564 Ga0207680_100025648 177
404 3300025903 Ga0207680_10106453 Ga0207680_101064533 177
405 3300025906 Ga0207699_10000164 Ga0207699_1000016422 177
406 3300025906 Ga0207699_10037734 Ga0207699_100377343 177
407 3300025907 Ga0207645_10011392 Ga0207645_100113927 177
408 3300025907 Ga0207645_10473091 Ga0207645_104730911 177
409 3300025909 Ga0207705_10000180 Ga0207705_1000018056 177
410 3300025909 Ga0207705_10004720 Ga0207705_1000472018 177
411 3300025909 Ga0207705_10311673 Ga0207705_103116733 177
412 3300025911 Ga0207654_10033200 Ga0207654_100332003 177
413 3300025911 Ga0207654_10164797 Ga0207654_101647973 177
414 3300025911 Ga0207654_10428144 Ga0207654_104281441 177
415 3300025911 Ga0207654_10803875 Ga0207654_108038752 177
416 3300025912 Ga0207707_10000011 Ga0207707_1000001118 177
417 3300025912 Ga0207707_10002715 Ga0207707_1000271518 177
418 3300025912 Ga0207707_10048827 Ga0207707_100488276 177
419 3300025912 Ga0207707_10267082 Ga0207707_102670822 177
420 3300025912 Ga0207707_10563709 Ga0207707_105637091 177
421 3300025913 Ga0207695_10000018 Ga0207695_1000001844 177
422 3300025913 Ga0207695_10028316 Ga0207695_100283167 177
423 3300025913 Ga0207695_10040352 Ga0207695_100403525 177
424 3300025913 Ga0207695_10182399 Ga0207695_101823992 177
425 3300025913 Ga0207695_10217861 Ga0207695_102178612 177
426 3300025913 Ga0207695_10284139 Ga0207695_102841392 177
427 3300025913 Ga0207695_10284558 Ga0207695_102845584 177
428 3300025913 Ga0207695_10340402 Ga0207695_103404022 177
429 3300025914 Ga0207671_10019547 Ga0207671_100195479 177
430 3300025914 Ga0207671_10049879 Ga0207671_100498792 177
431 3300025915 Ga0207693_10001210 Ga0207693_1000121019 177
432 3300025915 Ga0207693_10001929 Ga0207693_1000192915 177
433 3300025915 Ga0207693_10055946 Ga0207693_100559463 177
434 3300025915 Ga0207693_10266868 Ga0207693_102668683 177
435 3300025915 Ga0207693_10375640 Ga0207693_103756402 177
436 3300025916 Ga0207663_10015424 Ga0207663_100154245 177
437 3300025916 Ga0207663_10172408 Ga0207663_101724083 177
438 3300025916 Ga0207663_11098027 Ga0207663_110980271 177
439 3300025917 Ga0207660_10000110 Ga0207660_1000011026 177
440 3300025917 Ga0207660_10003537 Ga0207660_1000353718 177
441 3300025917 Ga0207660_10069892 Ga0207660_100698924 177
442 3300025917 Ga0207660_10181434 Ga0207660_101814342 177
443 3300025919 Ga0207657_10000241 Ga0207657_1000024129 177
444 3300025919 Ga0207657_10063406 Ga0207657_100634064 177
445 3300025919 Ga0207657_10196503 Ga0207657_101965031 177
446 3300025919 Ga0207657_10280758 Ga0207657_102807582 177
447 3300025920 Ga0207649_10000194 Ga0207649_1000019454 177
448 3300025921 Ga0207652_10000824 Ga0207652_1000082426 177
449 3300025921 Ga0207652_10007774 Ga0207652_1000777412 177
450 3300025921 Ga0207652_10108322 Ga0207652_101083224 177
451 3300025921 Ga0207652_10115732 Ga0207652_101157322 177
452 3300025924 Ga0207694_10000010 Ga0207694_10000010366 177
453 3300025924 Ga0207694_10025930 Ga0207694_100259309 177
454 3300025924 Ga0207694_10221393 Ga0207694_102213934 177
455 3300025924 Ga0207694_10810215 Ga0207694_108102151 177
456 3300025924 Ga0207694_10850182 Ga0207694_108501822 177
457 3300025924 Ga0207694_10906379 Ga0207694_109063791 177
458 3300025927 Ga0207687_10017844 Ga0207687_100178446 177
459 3300025927 Ga0207687_10390587 Ga0207687_103905871 177
460 3300025928 Ga0207700_10000295 Ga0207700_1000029518 177
461 3300025928 Ga0207700_10130882 Ga0207700_101308825 177
462 3300025929 Ga0207664_10073108 Ga0207664_100731085 177
463 3300025929 Ga0207664_10177988 Ga0207664_101779883 177
464 3300025929 Ga0207664_10312818 Ga0207664_103128183 177
465 3300025932 Ga0207690_10346628 Ga0207690_103466282 177
466 3300025934 Ga0207686_10163989 Ga0207686_101639893 177
467 3300025937 Ga0207669_10280567 Ga0207669_102805671 177
468 3300025938 Ga0207704_10122838 Ga0207704_101228383 177
469 3300025939 Ga0207665_10301672 Ga0207665_103016723 177
470 3300025941 Ga0207711_10000002 Ga0207711_1000000218 177
471 3300025941 Ga0207711_10145656 Ga0207711_101456563 177
472 3300025942 Ga0207689_10261962 Ga0207689_102619621 177
473 3300025944 Ga0207661_10144696 Ga0207661_101446964 177
474 3300025944 Ga0207661_10219381 Ga0207661_102193811 177
475 3300025944 Ga0207661_10500695 Ga0207661_105006952 177
476 3300025945 Ga0207679_10701601 Ga0207679_107016011 177
477 3300025949 Ga0207667_10000388 Ga0207667_1000038857 177
478 3300025949 Ga0207667_10031700 Ga0207667_1003170010 177
479 3300025949 Ga0207667_10542855 Ga0207667_105428552 177
480 3300025949 Ga0207667_10582275 Ga0207667_105822753 177
481 3300025960 Ga0207651_10727070 Ga0207651_107270702 177
482 3300025961 Ga0207712_11134703 Ga0207712_111347032 177
483 3300025961 Ga0207712_11399583 Ga0207712_113995831 177
484 3300025972 Ga0207668_10971586 Ga0207668_109715862 177
485 3300025981 Ga0207640_10040030 Ga0207640_100400301 177
486 3300025986 Ga0207658_10058513 Ga0207658_100585134 177
487 3300025986 Ga0207658_10134474 Ga0207658_101344742 177
488 3300026035 Ga0207703_10027678 Ga0207703_100276784 177
489 3300026035 Ga0207703_10064130 Ga0207703_100641303 177
490 3300026041 Ga0207639_10000867 Ga0207639_100008677 177
491 3300026041 Ga0207639_10059896 Ga0207639_100598962 177
492 3300026041 Ga0207639_10979110 Ga0207639_109791102 177
493 3300026041 Ga0207639_11233052 Ga0207639_112330522 177
494 3300026041 Ga0207639_11280022 Ga0207639_112800221 177
495 3300026078 Ga0207702_10000315 Ga0207702_1000031533 177
496 3300026078 Ga0207702_10348694 Ga0207702_103486942 177
497 3300026078 Ga0207702_10583836 Ga0207702_105838362 177
498 3300026078 Ga0207702_10776759 Ga0207702_107767592 177
499 3300026088 Ga0207641_10035109 Ga0207641_100351098 177
500 3300026089 Ga0207648_10243653 Ga0207648_102436533 177
501 3300026095 Ga0207676_10707429 Ga0207676_107074291 177
502 3300026116 Ga0207674_10001605 Ga0207674_1000160523 177
503 3300026116 Ga0207674_10291835 Ga0207674_102918353 177
504 3300026116 Ga0207674_11105553 Ga0207674_111055532 177
505 3300026118 Ga0207675_100278079 Ga0207675_1002780793 177
506 3300026121 Ga0207683_10018489 Ga0207683_100184897 177
507 3300026121 Ga0207683_10103171 Ga0207683_101031715 177
508 3300026121 Ga0207683_10264595 Ga0207683_102645952 177
509 3300026121 Ga0207683_10493868 Ga0207683_104938682 177
510 3300026142 Ga0207698_10042447 Ga0207698_100424476 177
511 3300026142 Ga0207698_10086858 Ga0207698_100868583 177
512 3300026142 Ga0207698_10144541 Ga0207698_101445412 177
513 3300027471 Ga0209995_1003999 Ga0209995_10039995 177
514 3300027526 Ga0209968_1004743 Ga0209968_10047432 177
515 3300027614 Ga0209970_1056276 Ga0209970_10562762 177
516 3300027682 Ga0209971_1044728 Ga0209971_10447282 177
517 3300027876 Ga0209974_10060510 Ga0209974_100605101 177
518 3300027876 Ga0209974_10065728 Ga0209974_100657281 177
519 3300027907 Ga0207428_10002412 Ga0207428_1000241213 177
520 3300028379 Ga0268266_10000557 Ga0268266_1000055718 177
521 3300028379 Ga0268266_10055515 Ga0268266_100555154 177
522 3300028379 Ga0268266_10076582 Ga0268266_100765825 177
523 3300028379 Ga0268266_10092509 Ga0268266_100925093 177
524 3300028379 Ga0268266_10095842 Ga0268266_100958424 177
525 3300028380 Ga0268265_10295536 Ga0268265_102955362 177
526 3300028381 Ga0268264_10561069 Ga0268264_105610692 177
527 3300028381 Ga0268264_11168559 Ga0268264_111685592 177
528 3300028556 Ga0265337_1001102 Ga0265337_100110213 177
529 3300028573 Ga0265334_10001106 Ga0265334_1000110617 177
530 3300028573 Ga0265334_10116749 Ga0265334_101167492 177
531 3300028577 Ga0265318_10000037 Ga0265318_1000003718 177
532 3300028800 Ga0265338_10000017 Ga0265338_10000017293 177
533 3300028800 Ga0265338_10002896 Ga0265338_1000289629 177
534 3300028800 Ga0265338_10005387 Ga0265338_1000538718 177
535 3300028800 Ga0265338_10017000 Ga0265338_1001700016 177
536 3300028800 Ga0265338_10038201 Ga0265338_1003820110 177
537 3300028800 Ga0265338_10073797 Ga0265338_100737975 177
538 3300028800 Ga0265338_10106186 Ga0265338_101061865 177
539 3300028800 Ga0265338_10165948 Ga0265338_101659483 177
540 3300028800 Ga0265338_10203129 Ga0265338_102031293 177
541 3300028800 Ga0265338_10647847 Ga0265338_106478471 177
542 3300029957 Ga0265324_10193448 Ga0265324_101934482 177
543 3300029957 Ga0265324_10208133 Ga0265324_102081331 177
544 3300031235 Ga0265330_10006774 Ga0265330_100067744 177
545 3300031238 Ga0265332_10017915 Ga0265332_100179156 177
546 3300031238 Ga0265332_10071412 Ga0265332_100714121 177
547 3300031238 Ga0265332_10075392 Ga0265332_100753923 177
548 3300031238 Ga0265332_10197011 Ga0265332_101970111 177
549 3300031240 Ga0265320_10002069 Ga0265320_1000206911 177
550 3300031240 Ga0265320_10375024 Ga0265320_103750241 177
551 3300031241 Ga0265325_10000014 Ga0265325_10000014136 177
552 3300031241 Ga0265325_10000782 Ga0265325_100007824 177
553 3300031241 Ga0265325_10001732 Ga0265325_1000173220 177
554 3300031241 Ga0265325_10026992 Ga0265325_100269926 177
555 3300031241 Ga0265325_10032967 Ga0265325_100329673 177
556 3300031241 Ga0265325_10194349 Ga0265325_101943491 177
557 3300031242 Ga0265329_10025358 Ga0265329_100253583 177
558 3300031242 Ga0265329_10046592 Ga0265329_100465923 177
559 3300031247 Ga0265340_10001159 Ga0265340_100011593 177
560 3300031247 Ga0265340_10002869 Ga0265340_1000286913 177
561 3300031247 Ga0265340_10007526 Ga0265340_1000752610 177
562 3300031247 Ga0265340_10038201 Ga0265340_100382012 177
563 3300031247 Ga0265340_10042240 Ga0265340_100422405 177
564 3300031247 Ga0265340_10088506 Ga0265340_100885063 177
565 3300031247 Ga0265340_10092888 Ga0265340_100928882 177
566 3300031249 Ga0265339_10000256 Ga0265339_1000025628 177
567 3300031249 Ga0265339_10004825 Ga0265339_1000482510 177
568 3300031249 Ga0265339_10007379 Ga0265339_1000737912 177
569 3300031249 Ga0265339_10342389 Ga0265339_103423891 177
570 3300031249 Ga0265339_10485136 Ga0265339_104851361 177
571 3300031250 Ga0265331_10000186 Ga0265331_1000018641 177
572 3300031250 Ga0265331_10003502 Ga0265331_1000350214 177
573 3300031250 Ga0265331_10013838 Ga0265331_100138387 177
574 3300031250 Ga0265331_10022887 Ga0265331_100228875 177
575 3300031250 Ga0265331_10030688 Ga0265331_100306885 177
576 3300031251 Ga0265327_10000392 Ga0265327_10000392120 177
577 3300031251 Ga0265327_10009609 Ga0265327_1000960915 177
578 3300031344 Ga0265316_10021496 Ga0265316_100214961 177
579 3300031344 Ga0265316_10025355 Ga0265316_100253552 177
580 3300031344 Ga0265316_10026745 Ga0265316_100267454 177
581 3300031344 Ga0265316_10086571 Ga0265316_100865715 177
582 3300031344 Ga0265316_10096460 Ga0265316_100964605 177
583 3300031344 Ga0265316_10148087 Ga0265316_101480873 177
584 3300031344 Ga0265316_10257932 Ga0265316_102579323 177
585 3300031344 Ga0265316_10284113 Ga0265316_102841131 177
586 3300031344 Ga0265316_10377952 Ga0265316_103779522 177
587 3300031548 Ga0307408_100051689 Ga0307408_1000516895 177
588 3300031595 Ga0265313_10000800 Ga0265313_1000080016 177
589 3300031595 Ga0265313_10006102 Ga0265313_100061027 177
590 3300031595 Ga0265313_10012941 Ga0265313_100129415 177
591 3300031595 Ga0265313_10016941 Ga0265313_100169416 177
592 3300031595 Ga0265313_10019748 Ga0265313_100197484 177
593 3300031595 Ga0265313_10025680 Ga0265313_100256803 177
594 3300031595 Ga0265313_10076276 Ga0265313_100762763 177
595 3300031595 Ga0265313_10089662 Ga0265313_100896623 177
596 3300031595 Ga0265313_10100614 Ga0265313_101006143 177
597 3300031595 Ga0265313_10207677 Ga0265313_102076772 177
598 3300031665 Ga0316575_10000986 Ga0316575_100009866 177
599 3300031665 Ga0316575_10019455 Ga0316575_100194555 177
600 3300031691 Ga0316579_10005295 Ga0316579_1000529513 177
601 3300031691 Ga0316579_10010128 Ga0316579_100101284 177
602 3300031711 Ga0265314_10000963 Ga0265314_100009632 177
603 3300031711 Ga0265314_10004460 Ga0265314_1000446019 177
604 3300031711 Ga0265314_10024805 Ga0265314_100248057 177
605 3300031711 Ga0265314_10027129 Ga0265314_1002712910 177
606 3300031711 Ga0265314_10041547 Ga0265314_100415471 177
607 3300031711 Ga0265314_10055387 Ga0265314_100553875 177
608 3300031711 Ga0265314_10056619 Ga0265314_100566192 177
609 3300031711 Ga0265314_10068911 Ga0265314_100689114 177
610 3300031711 Ga0265314_10107669 Ga0265314_101076694 177
611 3300031711 Ga0265314_10178064 Ga0265314_101780643 177
612 3300031712 Ga0265342_10006333 Ga0265342_100063336 177
613 3300031712 Ga0265342_10021698 Ga0265342_100216987 177
614 3300031712 Ga0265342_10072247 Ga0265342_100722473 177
615 3300031712 Ga0265342_10090627 Ga0265342_100906274 177
616 3300031712 Ga0265342_10338731 Ga0265342_103387311 177
617 3300031712 Ga0265342_10344967 Ga0265342_103449671 177
618 3300031727 Ga0316576_10005834 Ga0316576_1000583413 177
619 3300031728 Ga0316578_10039175 Ga0316578_100391752 177
620 3300031728 Ga0316578_10212536 Ga0316578_102125362 177
621 3300031730 Ga0307516_10054857 Ga0307516_100548573 177
622 3300031730 Ga0307516_10069198 Ga0307516_100691986 177
623 3300031730 Ga0307516_10507566 Ga0307516_105075662 177
624 3300031731 Ga0307405_10008723 Ga0307405_100087233 177
625 3300031733 Ga0316577_10032670 Ga0316577_100326702 177
626 3300031733 Ga0316577_10043034 Ga0316577_100430343 177
627 3300031824 Ga0307413_10061509 Ga0307413_100615095 177
628 3300031852 Ga0307410_10138609 Ga0307410_101386094 177
629 3300031852 Ga0307410_10183150 Ga0307410_101831502 177
630 3300031901 Ga0307406_10072399 Ga0307406_100723994 177
631 3300031903 Ga0307407_10102413 Ga0307407_101024134 177
632 3300031911 Ga0307412_10046496 Ga0307412_100464963 177
633 3300031995 Ga0307409_100030160 Ga0307409_1000301606 177
634 3300032002 Ga0307416_100005600 Ga0307416_10000560015 177
635 3300032002 Ga0307416_100212504 Ga0307416_1002125041 177
636 3300032004 Ga0307414_10939816 Ga0307414_109398161 177
637 3300032005 Ga0307411_10103293 Ga0307411_101032934 177
638 3300032005 Ga0307411_11126293 Ga0307411_111262931 177
639 3300032126 Ga0307415_100095913 Ga0307415_1000959133 177
640 3300032133 Ga0316583_10000484 Ga0316583_1000048414 177
641 3300032133 Ga0316583_10018653 Ga0316583_100186535 177
642 3300032133 Ga0316583_10069563 Ga0316583_100695632 177
643 3300032137 Ga0316585_10002061 Ga0316585_100020616 177
644 3300032137 Ga0316585_10058099 Ga0316585_100580992 177
645 3300032139 Ga0316580_10020547 Ga0316580_100205474 177
646 3300032139 Ga0316580_10021418 Ga0316580_100214182 177
647 3300032139 Ga0316580_10025904 Ga0316580_100259044 177
648 3300032168 Ga0316593_10000349 Ga0316593_100003493 177
649 3300032168 Ga0316593_10001237 Ga0316593_100012372 177
650 3300032168 Ga0316593_10054391 Ga0316593_100543912 177
651 3300033524 Ga0316592_1007100 Ga0316592_10071001 177
652 3300033527 Ga0316586_1000300 Ga0316586_10003002 177
653 3300033528 Ga0316588_1046158 Ga0316588_10461582 177
654 3300033541 Ga0316596_1000615 Ga0316596_100061512 177
655 3300035089 Ga0373944_0067559 Ga0373944_0067559_593_1126 177
656 3300035111 Ga0373923_0032705 Ga0373923_0032705_961_1497 177
657 3300035111 Ga0373923_0098301 Ga0373923_0098301_415_948 177
658 3300035113 Ga0373936_0008097 Ga0373936_0008097_798_1331 177
659 3300035114 Ga0373939_0042238 Ga0373939_0042238_721_1254 177
660 3300035114 Ga0373939_0081663 Ga0373939_0081663_282_815 177
661 3300035116 Ga0373945_0006653 Ga0373945_0006653_2715_3248 177
662 3300035116 Ga0373945_0078958 Ga0373945_0078958_471_1007 177
663 3300035117 Ga0373953_0157382 Ga0373953_0157382_55_588 177
664 3300035119 Ga0373956_0029348 Ga0373956_0029348_778_1314 177
665 3300035119 Ga0373956_0248982 Ga0373956_0248982_283_816 177
666 3300035170 Ga0373943_0007235 Ga0373943_0007235_3746_4279 177
667 3300035170 Ga0373943_0080948 Ga0373943_0080948_55_588 177
668 3300035172 Ga0373955_0005106 Ga0373955_0005106_4195_4731 177
669 3300035172 Ga0373955_0036549 Ga0373955_0036549_679_1212 177
670 3300035241 Ga0373961_0048959 Ga0373961_0048959_642_1175 177
671 3300035241 Ga0373961_0095359 Ga0373961_0095359_37_570 177
672 3300035398 Ga0316574_0001643 Ga0316574_0001643_2092_2625 177
673 3300035398 Ga0316574_0008846 Ga0316574_0008846_224_757 177
674 3300035398 Ga0316574_0038291 Ga0316574_0038291_1909_2442 177
675 3300035398 Ga0316574_0203323 Ga0316574_0203323_148_681 177
676 3300035398 Ga0316574_0389410 Ga0316574_0389410_182_715 177
677 3300035691 Ga0373931_0085845 Ga0373931_0085845_688_1221 177
678 3300035691 Ga0373931_0553263 Ga0373931_0553263_124_657 177
679 3300035692 Ga0373935_0003403 Ga0373935_0003403_7095_7628 177
680 3300035692 Ga0373935_0084560 Ga0373935_0084560_937_1473 177
681 3300035692 Ga0373935_0934841 Ga0373935_0934841_16_549 177
682 3300035695 Ga0373927_0064151 Ga0373927_0064151_1384_1917 177
683 3300035695 Ga0373927_0158783 Ga0373927_0158783_728_1264 177
684 3300035695 Ga0373927_0167531 Ga0373927_0167531_619_1152 177
685 3300035724 Ga0373933_0005271 Ga0373933_0005271_6394_6930 177
686 3300035724 Ga0373933_0043309 Ga0373933_0043309_1336_1872 177
687 3300035724 Ga0373933_0433396 Ga0373933_0433396_97_630 177
688 3300035725 Ga0373947_0011709 Ga0373947_0011709_2745_3278 177
689 3300035725 Ga0373947_0407002 Ga0373947_0407002_168_701 177
690 3300036401 Ga0373937_0003527 Ga0373937_0003527_8868_9404 177
691 3300036401 Ga0373937_0070199 Ga0373937_0070199_718_1254 177
692 3300036401 Ga0373937_0104200 Ga0373937_0104200_1566_2099 177
693 3300036401 Ga0373937_0128743 Ga0373937_0128743_1655_2188 177
694 3300036401 Ga0373937_0190143 Ga0373937_0190143_60_593 177
695 3300036401 Ga0373937_0193416 Ga0373937_0193416_1089_1622 177
696 3300036401 Ga0373937_0198482 Ga0373937_0198482_642_1175 177
697 3300036401 Ga0373937_0310051 Ga0373937_0310051_821_1357 177
698 3300036401 Ga0373937_0777101 Ga0373937_0777101_260_793 177
699 3300036647 Ga0316582_0012337 Ga0316582_0012337_1083_1616 177
700 3300036647 Ga0316582_0056650 Ga0316582_0056650_1820_2353 177
701 3300036647 Ga0316582_0243316 Ga0316582_0243316_262_795 177
702 3300036712 Ga0316584_0001849 Ga0316584_0001849_9673_10206 177
703 3300037068 Ga0373925_0002514 Ga0373925_0002514_9015_9548 177
704 3300037068 Ga0373925_0133491 Ga0373925_0133491_1248_1784 177
705 3300037312 Ga0395899_0004948 Ga0395899_0004948_7470_8003 177
706 3300037418 Ga0395900_0062599 Ga0395900_0062599_2456_2989 177
707 3300037418 Ga0395900_0618268 Ga0395900_0618268_278_811 177
708 3300037466 Ga0395898_0003055 Ga0395898_0003055_14694_15227 177
709 3300037466 Ga0395898_0079037 Ga0395898_0079037_1445_1978 177
710 3300037588 Ga0316581_0008237 Ga0316581_0008237_1074_1607 177
711 3300037588 Ga0316581_0013780 Ga0316581_0013780_509_1042 177
712 3300038443 Ga0395901_0012391 Ga0395901_0012391_2099_2632 177
713 3300038741 Ga0400488_12334 Ga0400488_12334_719_1252 177
714 3300038742 Ga0400486_17540 Ga0400486_17540_523_1056 177
715 3300039110 Ga0400487_00820 Ga0400487_00820_846_1379 177
716 3300039437 Ga0436365_0480014 Ga0436365_0480014_56_589 177
717 3300039437 Ga0436365_0544722 Ga0436365_0544722_3432_3965 177
718 3300039437 Ga0436365_0868084 Ga0436365_0868084_28_564 177
719 3300039437 Ga0436365_1215018 Ga0436365_1215018_1859_2392 177
720 3300039437 Ga0436365_1239236 Ga0436365_1239236_14632_15165 177
721 3300039437 Ga0436365_1437117 Ga0436365_1437117_720_1253 177
722 3300039437 Ga0436365_1637588 Ga0436365_1637588_24841_25374 177
723 3300039438 Ga0436360_0360048 Ga0436360_0360048_727_1260 177
724 3300039438 Ga0436360_0449234 Ga0436360_0449234_228_761 177
725 3300039438 Ga0436360_0716296 Ga0436360_0716296_967_1500 177
726 3300039447 Ga0436361_0767135 Ga0436361_0767135_208_741 177
727 3300039450 Ga0436363_0427400 Ga0436363_0427400_2004_2537 177
728 3300039450 Ga0436363_0896516 Ga0436363_0896516_126_659 177
729 3300039450 Ga0436363_1470856 Ga0436363_1470856_1402_1935 177
730 3300041452 Ga0451793_0170406 Ga0451793_0170406_239_772 177
731 3300041459 Ga0451800_0024754 Ga0451800_0024754_176_709 177
732 3300041460 Ga0451802_1407499 Ga0451802_1407499_49_582 177
733 3300042461 Ga0439460_0224418 Ga0439460_0224418_68_601 177
734 3300044842 Ga0466957_0637262 Ga0466957_0637262_29_562 177
735 3300045976 Ga0466967_0059567 Ga0466967_0059567_1481_2014 177
736 3300046454 Ga0495592_0176228 Ga0495592_0176228_650_1183 177
737 3300046454 Ga0495592_0423576 Ga0495592_0423576_17_550 177
738 3300046462 Ga0495651_0186790 Ga0495651_0186790_819_1352 177
739 3300046462 Ga0495651_0385149 Ga0495651_0385149_255_788 177
740 3300046472 Ga0495580_0003736 Ga0495580_0003736_4990_5523 177
741 3300046472 Ga0495580_0046288 Ga0495580_0046288_1218_1754 177
742 3300046473 Ga0495582_0043074 Ga0495582_0043074_1007_1540 177
743 3300046477 Ga0495664_0034829 Ga0495664_0034829_1730_2263 177
744 3300046477 Ga0495664_0225171 Ga0495664_0225171_422_955 177
745 3300046516 Ga0495628_0328258 Ga0495628_0328258_320_853 177
746 3300046518 Ga0495631_0321349 Ga0495631_0321349_43_576 177
747 3300046519 Ga0495632_0278674 Ga0495632_0278674_104_637 177
748 3300046529 Ga0495652_0041688 Ga0495652_0041688_2856_3389 177
749 3300046530 Ga0495654_0052557 Ga0495654_0052557_980_1513 177
750 3300046531 Ga0495665_0106424 Ga0495665_0106424_120_653 177
751 3300046536 Ga0495587_0050256 Ga0495587_0050256_1564_2097 177
752 3300046543 Ga0495645_0086993 Ga0495645_0086993_1141_1674 177
753 3300046543 Ga0495645_0219231 Ga0495645_0219231_465_998 177
754 3300046557 Ga0495622_0003379 Ga0495622_0003379_3211_3744 177
755 3300046557 Ga0495622_0149869 Ga0495622_0149869_118_651 177
756 3300046615 Ga0495656_0173839 Ga0495656_0173839_499_1032 177
757 3300046660 Ga0495625_0123475 Ga0495625_0123475_1063_1596 177
758 3300046675 Ga0495657_0129487 Ga0495657_0129487_229_762 177
759 3300046678 Ga0495599_0306982 Ga0495599_0306982_414_947 177
760 3300046679 Ga0495623_0165906 Ga0495623_0165906_223_759 177
761 3300046683 Ga0495658_0001492 Ga0495658_0001492_8969_9502 177
762 3300046689 Ga0495613_0442729 Ga0495613_0442729_15_548 177
763 3300046690 Ga0495624_0413944 Ga0495624_0413944_76_609 177
764 3300046692 Ga0495671_0298960 Ga0495671_0298960_125_658 177
765 3300046694 Ga0495649_0106764 Ga0495649_0106764_354_887 177
766 3300046794 Ga0495589_0093052 Ga0495589_0093052_542_1075 177
767 3300047318 Ga0495636_0324543 Ga0495636_0324543_100_633 177
768 3300047323 Ga0495683_0134375 Ga0495683_0134375_413_946 177
769 3300047444 Ga0495675_0062651 Ga0495675_0062651_1530_2063 177
770 3300047469 Ga0495673_0177677 Ga0495673_0177677_231_764 177
771 3300047470 Ga0495681_0247614 Ga0495681_0247614_14_547 177
772 3300047471 Ga0495684_0119581 Ga0495684_0119581_843_1379 177
773 3300048088 Ga0495602_0035348 Ga0495602_0035348_73_609 177
774 3300048088 Ga0495602_0308838 Ga0495602_0308838_215_748 177
775 3300048088 Ga0495602_0563739 Ga0495602_0563739_157_690 177
776 3300048090 Ga0495615_0027787 Ga0495615_0027787_470_1003 177
777 3300048091 Ga0495626_0026549 Ga0495626_0026549_73_606 177
778 3300048903 Ga0496100_0292146 Ga0496100_0292146_275_808 177
779 3300048907 Ga0496104_0414671 Ga0496104_0414671_160_696 177
780 3300048910 Ga0496107_0164931 Ga0496107_0164931_1017_1550 177
781 3300048915 Ga0496112_0440330 Ga0496112_0440330_151_684 177
782 3300048924 Ga0496121_0006108 Ga0496121_0006108_6035_6568 177
783 3300048929 Ga0496126_0077598 Ga0496126_0077598_1523_2056 177
784 3300049460 Ga0495682_0005207 Ga0495682_0005207_4497_5030 177
785 3300049568 Ga0501031_0037261 Ga0501031_0037261_442_987 177
786 3300049568 Ga0501031_0068962 Ga0501031_0068962_408_941 177
787 3300049568 Ga0501031_0094198 Ga0501031_0094198_338_871 177
788 3300049568 Ga0501031_0518639 Ga0501031_0518639_192_725 177
789 3300049569 Ga0501032_0001267 Ga0501032_0001267_8048_8593 177
790 3300049569 Ga0501032_0004362 Ga0501032_0004362_5952_6485 177
791 3300049569 Ga0501032_0019862 Ga0501032_0019862_1965_2498 177
792 3300049569 Ga0501032_0020357 Ga0501032_0020357_102_635 177
793 3300049569 Ga0501032_0030051 Ga0501032_0030051_1099_1632 177
794 3300049569 Ga0501032_0178940 Ga0501032_0178940_515_1048 177
795 3300049569 Ga0501032_0201791 Ga0501032_0201791_744_1277 177
796 3300049570 Ga0501033_0005260 Ga0501033_0005260_6557_7090 177
797 3300049570 Ga0501033_0012240 Ga0501033_0012240_2136_2669 177
798 3300049570 Ga0501033_0012917 Ga0501033_0012917_740_1273 177
799 3300049570 Ga0501033_0036296 Ga0501033_0036296_2713_3246 177
800 3300049570 Ga0501033_0175565 Ga0501033_0175565_971_1504 177
801 3300049570 Ga0501033_0180575 Ga0501033_0180575_188_733 177
802 3300049570 Ga0501033_0322472 Ga0501033_0322472_297_830 177
803 3300049571 Ga0501034_0000001 Ga0501034_0000001_122646_123191 177
804 3300049571 Ga0501034_0010632 Ga0501034_0010632_6834_7367 177
805 3300049571 Ga0501034_0011194 Ga0501034_0011194_1291_1824 177
806 3300049571 Ga0501034_0027593 Ga0501034_0027593_315_848 177
807 3300049571 Ga0501034_0076662 Ga0501034_0076662_2242_2775 177
808 3300049571 Ga0501034_0076809 Ga0501034_0076809_2571_3104 177
809 3300049571 Ga0501034_0091835 Ga0501034_0091835_2069_2602 177
810 3300049571 Ga0501034_0133506 Ga0501034_0133506_1103_1636 177
811 3300049571 Ga0501034_0171039 Ga0501034_0171039_1444_1977 177
812 3300049571 Ga0501034_0251625 Ga0501034_0251625_344_877 177
813 3300049571 Ga0501034_1082268 Ga0501034_1082268_20_553 177
814 3300049572 Ga0501036_0005653 Ga0501036_0005653_7421_7954 177
815 3300049572 Ga0501036_0005682 Ga0501036_0005682_7475_8020 177
816 3300049572 Ga0501036_0009536 Ga0501036_0009536_4150_4683 177
817 3300049573 Ga0501037_0024753 Ga0501037_0024753_2280_2813 177
818 3300049573 Ga0501037_0039814 Ga0501037_0039814_2644_3189 177
819 3300049573 Ga0501037_0091860 Ga0501037_0091860_85_618 177
820 3300049573 Ga0501037_0130333 Ga0501037_0130333_911_1444 177
821 3300049573 Ga0501037_0314591 Ga0501037_0314591_346_879 177
822 3300049573 Ga0501037_0466743 Ga0501037_0466743_274_819 177
823 3300049574 Ga0501038_0088134 Ga0501038_0088134_1628_2161 177
824 3300049574 Ga0501038_0116476 Ga0501038_0116476_1023_1556 177
825 3300049574 Ga0501038_0146861 Ga0501038_0146861_1296_1829 177
826 3300049574 Ga0501038_0147189 Ga0501038_0147189_667_1200 177
827 3300049574 Ga0501038_0237262 Ga0501038_0237262_134_667 177
828 3300049574 Ga0501038_0240433 Ga0501038_0240433_690_1223 177
829 3300049574 Ga0501038_0349287 Ga0501038_0349287_94_627 177
830 3300049574 Ga0501038_0681305 Ga0501038_0681305_122_655 177
831 3300049575 Ga0501039_0000029 Ga0501039_0000029_123194_123739 177
832 3300049575 Ga0501039_0019053 Ga0501039_0019053_4033_4566 177
833 3300049575 Ga0501039_0168128 Ga0501039_0168128_242_775 177
834 3300049575 Ga0501039_0222759 Ga0501039_0222759_643_1176 177
835 3300049575 Ga0501039_0349542 Ga0501039_0349542_310_843 177
836 3300049575 Ga0501039_1171961 Ga0501039_1171961_17_550 177
837 3300049578 Ga0501042_0098300 Ga0501042_0098300_613_1146 177
838 3300049578 Ga0501042_0392993 Ga0501042_0392993_319_852 177
839 3300049579 Ga0501043_0010388 Ga0501043_0010388_1726_2259 177
840 3300049579 Ga0501043_0014584 Ga0501043_0014584_4451_4984 177
841 3300049579 Ga0501043_0097012 Ga0501043_0097012_1040_1573 177
842 3300049579 Ga0501043_0198900 Ga0501043_0198900_347_880 177
843 3300049579 Ga0501043_0228594 Ga0501043_0228594_363_896 177
844 3300049579 Ga0501043_0369496 Ga0501043_0369496_34_567 177
845 3300049579 Ga0501043_0399659 Ga0501043_0399659_215_748 177
846 3300049580 Ga0501046_0005416 Ga0501046_0005416_5840_6373 177
847 3300049580 Ga0501046_0011762 Ga0501046_0011762_5317_5850 177
848 3300049580 Ga0501046_0012992 Ga0501046_0012992_5872_6405 177
849 3300049581 Ga0501047_0018715 Ga0501047_0018715_2248_2781 177
850 3300049581 Ga0501047_0025996 Ga0501047_0025996_952_1485 177
851 3300049581 Ga0501047_0065087 Ga0501047_0065087_2399_2932 177
852 3300049581 Ga0501047_0075405 Ga0501047_0075405_1343_1876 177
853 3300049581 Ga0501047_0131220 Ga0501047_0131220_868_1401 177
854 3300049581 Ga0501047_0138742 Ga0501047_0138742_1260_1793 177
855 3300049581 Ga0501047_0160994 Ga0501047_0160994_666_1199 177
856 3300049581 Ga0501047_0176653 Ga0501047_0176653_90_623 177
857 3300049581 Ga0501047_0251827 Ga0501047_0251827_930_1463 177
858 3300049581 Ga0501047_0375584 Ga0501047_0375584_44_577 177
859 3300049581 Ga0501047_0441537 Ga0501047_0441537_488_1021 177
860 3300049581 Ga0501047_0492805 Ga0501047_0492805_337_870 177
861 3300049581 Ga0501047_0559308 Ga0501047_0559308_147_680 177
862 3300049581 Ga0501047_0798800 Ga0501047_0798800_115_648 177
863 3300049581 Ga0501047_0883324 Ga0501047_0883324_19_552 177
864 3300049582 Ga0501048_0023812 Ga0501048_0023812_742_1275 177
865 3300049582 Ga0501048_0124442 Ga0501048_0124442_805_1338 177
866 3300049582 Ga0501048_0209717 Ga0501048_0209717_789_1322 177
867 3300049582 Ga0501048_0278719 Ga0501048_0278719_292_825 177
868 3300049583 Ga0501067_0001776 Ga0501067_0001776_3814_4347 177
869 3300049583 Ga0501067_0005578 Ga0501067_0005578_1676_2209 177
870 3300049583 Ga0501067_0022624 Ga0501067_0022624_543_1076 177
871 3300049584 Ga0501068_0077512 Ga0501068_0077512_73_606 177
872 3300049584 Ga0501068_0601467 Ga0501068_0601467_21_554 177
873 3300049585 Ga0501069_0022165 Ga0501069_0022165_1413_1946 177
874 3300049585 Ga0501069_0333797 Ga0501069_0333797_331_864 177
875 3300049586 Ga0501070_0000481 Ga0501070_0000481_31847_32380 177
876 3300049586 Ga0501070_0003398 Ga0501070_0003398_8137_8670 177
877 3300049586 Ga0501070_0014964 Ga0501070_0014964_2204_2737 177
878 3300049586 Ga0501070_0143912 Ga0501070_0143912_959_1492 177
879 3300049586 Ga0501070_0178515 Ga0501070_0178515_935_1468 177
880 3300049586 Ga0501070_0309863 Ga0501070_0309863_591_1124 177
881 3300049586 Ga0501070_0382617 Ga0501070_0382617_381_914 177
882 3300049587 Ga0501071_0135415 Ga0501071_0135415_1228_1761 177
883 3300049587 Ga0501071_0156932 Ga0501071_0156932_312_845 177
884 3300049588 Ga0501072_0015507 Ga0501072_0015507_4165_4698 177
885 3300049589 Ga0501073_0001669 Ga0501073_0001669_12000_12533 177
886 3300049589 Ga0501073_0004494 Ga0501073_0004494_2437_2970 177
887 3300049589 Ga0501073_0015128 Ga0501073_0015128_1646_2179 177
888 3300049589 Ga0501073_0059739 Ga0501073_0059739_1558_2091 177
889 3300049589 Ga0501073_0059886 Ga0501073_0059886_596_1129 177
890 3300049589 Ga0501073_0061078 Ga0501073_0061078_118_651 177
891 3300049589 Ga0501073_0070275 Ga0501073_0070275_1490_2023 177
892 3300049590 Ga0501074_0004453 Ga0501074_0004453_1265_1798 177
893 3300049590 Ga0501074_0042382 Ga0501074_0042382_1290_1823 177
894 3300049590 Ga0501074_0079197 Ga0501074_0079197_872_1405 177
895 3300049593 Ga0501077_0059400 Ga0501077_0059400_171_704 177
896 3300049741 Ga0501079_0001478 Ga0501079_0001478_7473_8006 177
897 3300049741 Ga0501079_0017836 Ga0501079_0017836_2554_3087 177
898 3300049741 Ga0501079_0140727 Ga0501079_0140727_1166_1699 177
899 3300049741 Ga0501079_0188192 Ga0501079_0188192_1049_1582 177
900 3300049741 Ga0501079_0330695 Ga0501079_0330695_119_652 177
901 3300049742 Ga0501080_0018079 Ga0501080_0018079_5217_5750 177
902 3300049742 Ga0501080_0040364 Ga0501080_0040364_919_1452 177
903 3300049742 Ga0501080_0043846 Ga0501080_0043846_975_1508 177
904 3300049742 Ga0501080_0062400 Ga0501080_0062400_1290_1823 177
905 3300049742 Ga0501080_0125187 Ga0501080_0125187_409_942 177
906 3300049742 Ga0501080_0179248 Ga0501080_0179248_1033_1566 177
907 3300049742 Ga0501080_0283362 Ga0501080_0283362_864_1397 177
908 3300049742 Ga0501080_0628681 Ga0501080_0628681_274_807 177
909 3300049742 Ga0501080_1069414 Ga0501080_1069414_79_612 177
910 3300049744 Ga0501083_0077301 Ga0501083_0077301_1096_1629 177
911 3300049744 Ga0501083_0089262 Ga0501083_0089262_973_1506 177
912 3300049744 Ga0501083_0117891 Ga0501083_0117891_1176_1709 177
913 3300049744 Ga0501083_0135923 Ga0501083_0135923_655_1188 177
914 3300049744 Ga0501083_0712658 Ga0501083_0712658_29_562 177
915 3300049776 Ga0501280_000425 Ga0501280_000425_6190_6723 177
916 3300049778 Ga0501282_002357 Ga0501282_002357_58_591 177
917 3300049822 Ga0501035_0019622 Ga0501035_0019622_3306_3839 177
918 3300049822 Ga0501035_0037025 Ga0501035_0037025_2430_2963 177
919 3300049822 Ga0501035_0044851 Ga0501035_0044851_2438_2971 177
920 3300049822 Ga0501035_0048543 Ga0501035_0048543_657_1190 177
921 3300049822 Ga0501035_0065562 Ga0501035_0065562_1231_1764 177
922 3300049822 Ga0501035_0085166 Ga0501035_0085166_1890_2423 177
923 3300049822 Ga0501035_0162505 Ga0501035_0162505_303_836 177
924 3300049822 Ga0501035_0190474 Ga0501035_0190474_98_631 177
925 3300049822 Ga0501035_0254054 Ga0501035_0254054_268_813 177
926 3300049822 Ga0501035_0300904 Ga0501035_0300904_397_930 177
927 3300049822 Ga0501035_0914179 Ga0501035_0914179_10_543 177
928 3300049823 Ga0501044_0015755 Ga0501044_0015755_2570_3103 177
929 3300049823 Ga0501044_0024878 Ga0501044_0024878_772_1305 177
930 3300049823 Ga0501044_0032329 Ga0501044_0032329_3192_3725 177
931 3300049823 Ga0501044_0044540 Ga0501044_0044540_769_1302 177
932 3300049823 Ga0501044_0099276 Ga0501044_0099276_78_611 177
933 3300049823 Ga0501044_0129184 Ga0501044_0129184_437_970 177
934 3300049823 Ga0501044_0140739 Ga0501044_0140739_1824_2357 177
935 3300049823 Ga0501044_0161480 Ga0501044_0161480_1219_1752 177
936 3300049823 Ga0501044_0210012 Ga0501044_0210012_787_1332 177
937 3300049823 Ga0501044_0504734 Ga0501044_0504734_559_1092 177
938 3300049823 Ga0501044_0519482 Ga0501044_0519482_24_557 177
939 3300049824 Ga0501045_0128835 Ga0501045_0128835_1213_1746 177
940 3300050509 nmdc:mga0qj67_173986_c1 nmdc:mga0qj67_173986_c1_922_1455 177
941 3300050509 nmdc:mga0qj67_275124_c1 nmdc:mga0qj67_275124_c1_477_1010 177
942 3300050511 nmdc:mga08y16_19140_c1 nmdc:mga08y16_19140_c1_3347_3880 177
943 3300050512 nmdc:mga0n895_10772_c1 nmdc:mga0n895_10772_c1_4138_4671 177
944 3300050512 nmdc:mga0n895_277025_c1 nmdc:mga0n895_277025_c1_761_1297 177
945 3300050512 nmdc:mga0n895_789078_c1 nmdc:mga0n895_789078_c1_15_548 177
946 3300050513 nmdc:mga0rr50_45774_c1 nmdc:mga0rr50_45774_c1_2043_2576 177
947 3300050513 nmdc:mga0rr50_7934_c1 nmdc:mga0rr50_7934_c1_5362_5895 177
948 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_14711_15244 177
949 3300050514 nmdc:mga08x19_2026_c1 nmdc:mga08x19_2026_c1_8616_9149 177
950 3300050514 nmdc:mga08x19_945_c1 nmdc:mga08x19_945_c1_7766_8299 177
951 3300050515 nmdc:mga0a205_20420_c1 nmdc:mga0a205_20420_c1_4769_5302 177
952 3300053085 Ga0495619_0184369 Ga0495619_0184369_701_1234 177
953 3300053087 Ga0500643_000003 Ga0500643_000003_29097_29630 177
954 3300053094 Ga0500566_0181241 Ga0500566_0181241_80_613 177
955 3300053116 Ga0500592_011077 Ga0500592_011077_435_968 177
956 3300053118 Ga0500594_0012014 Ga0500594_0012014_368_901 177
957 3300053119 Ga0500595_001661 Ga0500595_001661_1750_2283 177
958 3300053119 Ga0500595_101861 Ga0500595_101861_109_642 177
959 3300053133 Ga0500655_006392 Ga0500655_006392_552_1085 177
960 3300053136 Ga0500559_0020972 Ga0500559_0020972_1279_1812 177
961 3300053139 Ga0500568_0047421 Ga0500568_0047421_131_664 177
962 3300053140 Ga0500573_0000452 Ga0500573_0000452_9578_10111 177
963 3300053154 Ga0500619_043325 Ga0500619_043325_194_727 177
964 3300053163 Ga0500639_087393 Ga0500639_087393_110_643 177
965 3300053730 Ga0500645_070785 Ga0500645_070785_406_939 177
966 3300053730 Ga0500645_104061 Ga0500645_104061_136_669 177
967 3300054114 Ga0501084_0000175 Ga0501084_0000175_42140_42673 177
968 3300054114 Ga0501084_0007620 Ga0501084_0007620_3807_4340 177
969 3300054114 Ga0501084_0029906 Ga0501084_0029906_1256_1789 177
970 3300054114 Ga0501084_0074161 Ga0501084_0074161_348_881 177
971 3300054114 Ga0501084_0145505 Ga0501084_0145505_1330_1863 177
972 3300054114 Ga0501084_0363006 Ga0501084_0363006_224_757 177
973 3300060353 Ga0501082_0006964 Ga0501082_0006964_5928_6461 177
974 3300060353 Ga0501082_0039783 Ga0501082_0039783_2592_3125 177
975 3300060353 Ga0501082_0069701 Ga0501082_0069701_1530_2063 177
976 3300060353 Ga0501082_0107936 Ga0501082_0107936_43_576 177
977 3300060353 Ga0501082_0590704 Ga0501082_0590704_319_858 177
978 3300061734 Ga0530510_0238077 Ga0530510_0238077_711_1244 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

105

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9578 1 172
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9554 2 172
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9484 2 175
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.947 9 171
8cgv-assembly1.cif.gz_g tiamulin bound to the 50s subunit 0.9467 2 177
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9455 83 168 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9454 83 172 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9428 83 164 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9409 83 170 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9352 83 171 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2J1D431-F1-model_v4 deleted 0.9905 74 168
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9863 82 164
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9861 81 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9828 82 154 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9795 76 146

Feature Viewer

pLDDT pTM Quality
82.19 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map