F487001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 966 | 497 | 830 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0117860|Ga0466970_0117860_668_1336 |
| Length | 222 |
| Sequence | VATAAAAAGVAWRAIPTRADGHTRARTSFPKDEGRPVATTNDLKNGLVLNLDGQLWSVVEFQHVKPGKGGAFVRTKLKNVLSGKVVDRTFNAGTKVDTATVDKRDMQFLYKDGTDFVFMDSNTYDQLHIGADTVGDAANFLLENQEAIVAVHEGTPLYVELPTSVVLEITYTEPGLQGDRSTGGTKPATVETGYEIQVPLFLETGTKVKVDTRSGDYLGRVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 5 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 6 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 7 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 8 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 9 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 10 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 11 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 12 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 13 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 14 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 15 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 16 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 17 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 18 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 19 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 20 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 21 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 22 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 23 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 24 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 25 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 26 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 27 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 28 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 29 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 30 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 31 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 32 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 33 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 34 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 35 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 36 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 37 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 38 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 39 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 40 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 41 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 42 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 43 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 44 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 45 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 46 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 47 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 48 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 49 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 50 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 51 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 52 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 53 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 54 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 55 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 56 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 57 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 58 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 59 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 60 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 61 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 62 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 63 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 64 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 65 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 66 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 67 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 68 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 69 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 70 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 71 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 72 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 73 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 74 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 75 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 76 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 77 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 78 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 79 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 80 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 81 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 82 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 83 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 84 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 85 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 86 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 87 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 88 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 89 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 90 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 91 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 92 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 93 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 94 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 95 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 96 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 97 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 98 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 99 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 100 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 101 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 102 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 103 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 104 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 105 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 106 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 107 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 108 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 109 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 110 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 111 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 112 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 113 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 114 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 115 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 116 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 117 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 118 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 119 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 120 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 121 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 122 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 123 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 124 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 126 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 127 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 129 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 130 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 131 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 132 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 133 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 134 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 137 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 138 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 139 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 141 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 145 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 149 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 158 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 159 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 161 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 162 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 163 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 164 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 165 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 166 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 167 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 168 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 169 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 171 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 172 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 174 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 175 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 176 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 177 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 178 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 179 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 192 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 204 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 205 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 206 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 207 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 211 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 212 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 214 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 223 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 269 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 273 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 274 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 275 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 276 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 282 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 283 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 289 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 290 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 291 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 305 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 306 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 307 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 308 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 309 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 312 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 313 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 322 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 323 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 324 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 325 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 326 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 327 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 328 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 329 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 330 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 338 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 339 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 340 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 341 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 345 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 346 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 452 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 456 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 458 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 459 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 463 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 480 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 481 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 482 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 483 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 484 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 485 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 486 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 487 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 488 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 489 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 490 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 491 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 492 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 493 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 494 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 495 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 496 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 497 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.57 |
| Metatranscriptomes | 10.35 |
| Isolates | 14.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 6.11 |
| Nodule | 0.52 |
| Rhizoplane | 7.76 |
| Rhizosphere | 67.81 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 17.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10033890 | 3300001989 | Bacteria | 1743 |
| 2 | JGI24739J22299_10090630 | 3300001989 | Bacteria | 931 |
| 3 | JGI24739J22299_10095805 | 3300001989 | Bacteria | 899 |
| 4 | JGI24737J22298_10040121 | 3300001990 | Bacteria | 1438 |
| 5 | JGI24735J21928_10002346 | 3300002067 | Bacteria | 6599 |
| 6 | JGI24744J21845_10035085 | 3300002077 | Bacteria | 950 |
| 7 | JGI25164J39214_1000271 | 3300002772 | Bacteria | 38022 |
| 8 | JGI25406J46586_10016618 | 3300003203 | Bacteria | 3064 |
| 9 | JGI25406J46586_10068009 | 3300003203 | Bacteria | 1126 |
| 10 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 11 | Ga0006562J51391_1083570 | 3300003578 | Bacteria | 3480 |
| 12 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 13 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 14 | Ga0055525_1000840 | 3300003759 | Bacteria | 9211 |
| 15 | Ga0055525_1002311 | 3300003759 | Bacteria | 2037 |
| 16 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 17 | Ga0055529_1000018 | 3300003763 | Bacteria | 344344 |
| 18 | Ga0055541_1002301 | 3300003841 | Bacteria | 3849 |
| 19 | Ga0058859_11831639 | 3300004798 | Bacteria | 746 |
| 20 | Ga0058863_11873486 | 3300004799 | Bacteria | 737 |
| 21 | Ga0058861_10008255 | 3300004800 | Bacteria | 716 |
| 22 | Ga0058860_10023170 | 3300004801 | Bacteria | 750 |
| 23 | Ga0065714_10079860 | 3300005288 | Bacteria | 2482 |
| 24 | Ga0070683_100008380 | 3300005329 | Bacteria | 8778 |
| 25 | Ga0070683_100026298 | 3300005329 | Bacteria | 5238 |
| 26 | Ga0070683_100730310 | 3300005329 | Bacteria | 949 |
| 27 | Ga0070677_10317834 | 3300005333 | Bacteria | 797 |
| 28 | Ga0068869_100353197 | 3300005334 | Bacteria | 1199 |
| 29 | Ga0070680_100385350 | 3300005336 | Bacteria | 1194 |
| 30 | Ga0070682_100821590 | 3300005337 | Bacteria | 757 |
| 31 | Ga0070661_100006348 | 3300005344 | Bacteria | 8153 |
| 32 | Ga0070692_10053790 | 3300005345 | Bacteria | 2101 |
| 33 | Ga0070674_100114580 | 3300005356 | Bacteria | 1985 |
| 34 | Ga0070674_100541932 | 3300005356 | Bacteria | 975 |
| 35 | Ga0070659_100381787 | 3300005366 | Bacteria | 1187 |
| 36 | Ga0070714_100000039 | 3300005435 | Bacteria | 121007 |
| 37 | Ga0070713_100063477 | 3300005436 | Bacteria | 3097 |
| 38 | Ga0070713_100426104 | 3300005436 | Bacteria | 1243 |
| 39 | Ga0070710_10607510 | 3300005437 | Bacteria | 762 |
| 40 | Ga0070710_10650797 | 3300005437 | Bacteria | 739 |
| 41 | Ga0070678_100097557 | 3300005456 | Bacteria | 2270 |
| 42 | Ga0070678_100331914 | 3300005456 | Bacteria | 1302 |
| 43 | Ga0070678_100460285 | 3300005456 | Bacteria | 1116 |
| 44 | Ga0070678_100469852 | 3300005456 | Bacteria | 1105 |
| 45 | Ga0070679_100105114 | 3300005530 | Bacteria | 2810 |
| 46 | Ga0070679_100168603 | 3300005530 | Bacteria | 2162 |
| 47 | Ga0070679_100662200 | 3300005530 | Bacteria | 987 |
| 48 | Ga0070684_100064651 | 3300005535 | Bacteria | 3210 |
| 49 | Ga0070684_100992801 | 3300005535 | Bacteria | 788 |
| 50 | Ga0070696_100222559 | 3300005546 | Bacteria | 1416 |
| 51 | Ga0070693_100200871 | 3300005547 | Bacteria | 1295 |
| 52 | Ga0070693_100251022 | 3300005547 | Bacteria | 1173 |
| 53 | Ga0070665_100285998 | 3300005548 | Bacteria | 1651 |
| 54 | Ga0070664_100227321 | 3300005564 | Bacteria | 1671 |
| 55 | Ga0070664_101206516 | 3300005564 | Bacteria | 714 |
| 56 | Ga0068857_100070797 | 3300005577 | Bacteria | 3107 |
| 57 | Ga0068857_100211286 | 3300005577 | Bacteria | 1771 |
| 58 | Ga0068857_100381996 | 3300005577 | Bacteria | 1308 |
| 59 | Ga0068857_100627881 | 3300005577 | Bacteria | 1017 |
| 60 | Ga0068856_100731411 | 3300005614 | Bacteria | 1010 |
| 61 | Ga0070702_100039169 | 3300005615 | Bacteria | 2643 |
| 62 | Ga0070702_100457913 | 3300005615 | Bacteria | 927 |
| 63 | Ga0068852_100660166 | 3300005616 | Bacteria | 1054 |
| 64 | Ga0068866_10100878 | 3300005718 | Bacteria | 1592 |
| 65 | Ga0068861_100062449 | 3300005719 | Bacteria | 2862 |
| 66 | Ga0068861_100530824 | 3300005719 | Bacteria | 1069 |
| 67 | Ga0068851_10322449 | 3300005834 | Bacteria | 893 |
| 68 | Ga0068870_10181743 | 3300005840 | Bacteria | 1263 |
| 69 | Ga0068863_100180238 | 3300005841 | Bacteria | 2028 |
| 70 | Ga0068862_100545124 | 3300005844 | Bacteria | 1107 |
| 71 | Ga0081540_1008923 | 3300005983 | Bacteria | 6946 |
| 72 | Ga0081540_1123311 | 3300005983 | Bacteria | 1071 |
| 73 | Ga0081539_10000352 | 3300005985 | Bacteria | 100942 |
| 74 | Ga0081539_10007039 | 3300005985 | Bacteria | 10414 |
| 75 | Ga0081539_10032371 | 3300005985 | Bacteria | 3203 |
| 76 | Ga0081539_10286784 | 3300005985 | Bacteria | 714 |
| 77 | Ga0070717_10088157 | 3300006028 | Bacteria | 2615 |
| 78 | Ga0075365_10112988 | 3300006038 | Bacteria | 1868 |
| 79 | Ga0075364_10025537 | 3300006051 | Bacteria | 3761 |
| 80 | Ga0075364_10026800 | 3300006051 | Bacteria | 3679 |
| 81 | Ga0075364_10057541 | 3300006051 | Bacteria | 2547 |
| 82 | Ga0075364_10080926 | 3300006051 | Bacteria | 2147 |
| 83 | Ga0075364_10139526 | 3300006051 | Bacteria | 1630 |
| 84 | Ga0075364_10215791 | 3300006051 | Bacteria | 1301 |
| 85 | Ga0070712_100533463 | 3300006175 | Bacteria | 987 |
| 86 | Ga0075369_10101076 | 3300006186 | Bacteria | 1294 |
| 87 | Ga0075428_100115020 | 3300006844 | Bacteria | 2930 |
| 88 | Ga0075428_100216167 | 3300006844 | Bacteria | 2071 |
| 89 | Ga0075430_100055920 | 3300006846 | Bacteria | 3318 |
| 90 | Ga0075430_100114486 | 3300006846 | Bacteria | 2247 |
| 91 | Ga0075430_100124552 | 3300006846 | Bacteria | 2148 |
| 92 | Ga0075431_100109652 | 3300006847 | Bacteria | 2849 |
| 93 | Ga0075431_100144258 | 3300006847 | Bacteria | 2454 |
| 94 | Ga0075434_100675482 | 3300006871 | Bacteria | 1051 |
| 95 | Ga0075429_100088769 | 3300006880 | Bacteria | 2695 |
| 96 | Ga0105244_10041918 | 3300009036 | Bacteria | 2370 |
| 97 | Ga0105244_10047386 | 3300009036 | Bacteria | 2205 |
| 98 | Ga0105240_10369905 | 3300009093 | Bacteria | 1621 |
| 99 | Ga0111539_11473747 | 3300009094 | Bacteria | 789 |
| 100 | Ga0105245_10389792 | 3300009098 | Bacteria | 1389 |
| 101 | Ga0105245_10499134 | 3300009098 | Bacteria | 1233 |
| 102 | Ga0114129_10004855 | 3300009147 | Bacteria | 18971 |
| 103 | Ga0105243_10016689 | 3300009148 | Bacteria | 5551 |
| 104 | Ga0105243_10057279 | 3300009148 | Bacteria | 3102 |
| 105 | Ga0105243_10060196 | 3300009148 | Bacteria | 3033 |
| 106 | Ga0105243_10185209 | 3300009148 | Bacteria | 1814 |
| 107 | Ga0105242_10060957 | 3300009176 | Bacteria | 3102 |
| 108 | Ga0105242_10257820 | 3300009176 | Bacteria | 1574 |
| 109 | Ga0105248_10342412 | 3300009177 | Bacteria | 1683 |
| 110 | Ga0105248_10787119 | 3300009177 | Bacteria | 1073 |
| 111 | Ga0105238_10037839 | 3300009551 | Bacteria | 4902 |
| 112 | Ga0105238_10076535 | 3300009551 | Bacteria | 3337 |
| 113 | Ga0105238_10271205 | 3300009551 | Bacteria | 1677 |
| 114 | Ga0105249_10177166 | 3300009553 | Bacteria | 2071 |
| 115 | Ga0105249_11307442 | 3300009553 | Bacteria | 797 |
| 116 | Ga0105239_11107970 | 3300010375 | Bacteria | 911 |
| 117 | Ga0105239_11886250 | 3300010375 | Bacteria | 693 |
| 118 | Ga0105246_10128132 | 3300011119 | Bacteria | 1891 |
| 119 | Ga0105246_10991788 | 3300011119 | Bacteria | 760 |
| 120 | Ga0157319_1005725 | 3300012497 | Bacteria | 866 |
| 121 | Ga0157371_10002721 | 3300013102 | Bacteria | 16651 |
| 122 | Ga0157371_10256141 | 3300013102 | Bacteria | 1261 |
| 123 | Ga0157371_10538948 | 3300013102 | Bacteria | 864 |
| 124 | Ga0157370_10056690 | 3300013104 | Bacteria | 3729 |
| 125 | Ga0157370_10132584 | 3300013104 | Bacteria | 2324 |
| 126 | Ga0157370_10453141 | 3300013104 | Bacteria | 1179 |
| 127 | Ga0157370_10590283 | 3300013104 | Bacteria | 1017 |
| 128 | Ga0157369_10018556 | 3300013105 | Bacteria | 7797 |
| 129 | Ga0157369_10020802 | 3300013105 | Bacteria | 7334 |
| 130 | Ga0157369_10080708 | 3300013105 | Bacteria | 3482 |
| 131 | Ga0157369_10265963 | 3300013105 | Bacteria | 1788 |
| 132 | Ga0157369_10404765 | 3300013105 | Bacteria | 1416 |
| 133 | Ga0157378_10031377 | 3300013297 | Bacteria | 4695 |
| 134 | Ga0163162_10157520 | 3300013306 | Bacteria | 2391 |
| 135 | Ga0163162_10175534 | 3300013306 | Bacteria | 2268 |
| 136 | Ga0163162_10586181 | 3300013306 | Bacteria | 1242 |
| 137 | Ga0163162_10634250 | 3300013306 | Bacteria | 1193 |
| 138 | Ga0163162_10828628 | 3300013306 | Bacteria | 1041 |
| 139 | Ga0157372_10039598 | 3300013307 | Bacteria | 5202 |
| 140 | Ga0157372_10080461 | 3300013307 | Bacteria | 3686 |
| 141 | Ga0157372_10163231 | 3300013307 | Bacteria | 2575 |
| 142 | Ga0157372_10281506 | 3300013307 | Bacteria | 1933 |
| 143 | Ga0157375_10053337 | 3300013308 | Bacteria | 3978 |
| 144 | Ga0157375_10095249 | 3300013308 | Bacteria | 3047 |
| 145 | Ga0157375_10720030 | 3300013308 | Bacteria | 1151 |
| 146 | Ga0157375_10891900 | 3300013308 | Bacteria | 1034 |
| 147 | Ga0163163_10344685 | 3300014325 | Bacteria | 1545 |
| 148 | Ga0157380_10050189 | 3300014326 | Bacteria | 3294 |
| 149 | Ga0157380_10052971 | 3300014326 | Bacteria | 3215 |
| 150 | Ga0157380_10935208 | 3300014326 | Bacteria | 896 |
| 151 | Ga0157376_10408152 | 3300014969 | Bacteria | 1315 |
| 152 | Ga0163161_10080822 | 3300017792 | Bacteria | 2393 |
| 153 | Ga0197907_10125867 | 3300020069 | Bacteria | 1084 |
| 154 | Ga0197907_10190572 | 3300020069 | Bacteria | 1034 |
| 155 | Ga0197907_10258756 | 3300020069 | Bacteria | 1664 |
| 156 | Ga0197907_10761571 | 3300020069 | Bacteria | 1582 |
| 157 | Ga0197907_10932477 | 3300020069 | Bacteria | 916 |
| 158 | Ga0197907_11256546 | 3300020069 | Bacteria | 756 |
| 159 | Ga0197907_11383208 | 3300020069 | Bacteria | 861 |
| 160 | Ga0206356_10019973 | 3300020070 | Bacteria | 1589 |
| 161 | Ga0206356_10203588 | 3300020070 | Bacteria | 891 |
| 162 | Ga0206356_10500775 | 3300020070 | Bacteria | 1240 |
| 163 | Ga0206356_10717007 | 3300020070 | Bacteria | 1571 |
| 164 | Ga0206356_11624222 | 3300020070 | Bacteria | 864 |
| 165 | Ga0206356_11739052 | 3300020070 | Bacteria | 1499 |
| 166 | Ga0206349_1159386 | 3300020075 | Bacteria | 880 |
| 167 | Ga0206349_1368267 | 3300020075 | Bacteria | 932 |
| 168 | Ga0206349_1972671 | 3300020075 | Bacteria | 800 |
| 169 | Ga0206355_1412026 | 3300020076 | Bacteria | 764 |
| 170 | Ga0206355_1423249 | 3300020076 | Bacteria | 617 |
| 171 | Ga0206355_1611973 | 3300020076 | Bacteria | 948 |
| 172 | Ga0206351_10720129 | 3300020077 | Bacteria | 1032 |
| 173 | Ga0206351_10888382 | 3300020077 | Bacteria | 898 |
| 174 | Ga0206352_10057062 | 3300020078 | Bacteria | 1227 |
| 175 | Ga0206352_10058262 | 3300020078 | Bacteria | 847 |
| 176 | Ga0206352_11224977 | 3300020078 | Bacteria | 1571 |
| 177 | Ga0206350_11332409 | 3300020080 | Bacteria | 879 |
| 178 | Ga0206354_10434866 | 3300020081 | Bacteria | 965 |
| 179 | Ga0206354_10484737 | 3300020081 | Bacteria | 1154 |
| 180 | Ga0206354_10698463 | 3300020081 | Bacteria | 1043 |
| 181 | Ga0206354_10956684 | 3300020081 | Bacteria | 938 |
| 182 | Ga0206354_11270526 | 3300020081 | Bacteria | 1548 |
| 183 | Ga0206354_11591078 | 3300020081 | Bacteria | 1657 |
| 184 | Ga0206354_11686283 | 3300020081 | Bacteria | 2242 |
| 185 | Ga0206353_10147464 | 3300020082 | Bacteria | 1113 |
| 186 | Ga0206353_10432556 | 3300020082 | Bacteria | 959 |
| 187 | Ga0206353_10443024 | 3300020082 | Bacteria | 3658 |
| 188 | Ga0206353_10470645 | 3300020082 | Bacteria | 3622 |
| 189 | Ga0206353_10933407 | 3300020082 | Bacteria | 1748 |
| 190 | Ga0206353_11447911 | 3300020082 | Bacteria | 1210 |
| 191 | Ga0154015_1016208 | 3300020610 | Bacteria | 1535 |
| 192 | Ga0154015_1212596 | 3300020610 | Bacteria | 697 |
| 193 | Ga0154015_1565778 | 3300020610 | Bacteria | 680 |
| 194 | Ga0224712_10053013 | 3300022467 | Bacteria | 1586 |
| 195 | Ga0224712_10059957 | 3300022467 | Bacteria | 1513 |
| 196 | Ga0224712_10088721 | 3300022467 | Bacteria | 1291 |
| 197 | Ga0224712_10121937 | 3300022467 | Bacteria | 1130 |
| 198 | Ga0209566_100050 | 3300025225 | Bacteria | 234653 |
| 199 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 200 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 201 | Ga0209147_100486 | 3300025229 | Bacteria | 23814 |
| 202 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 203 | Ga0209563_100219 | 3300025230 | Bacteria | 28679 |
| 204 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 205 | Ga0209437_100989 | 3300025233 | Bacteria | 9967 |
| 206 | Ga0209258_101984 | 3300025242 | Bacteria | 5937 |
| 207 | Ga0209646_1000099 | 3300025246 | Bacteria | 180436 |
| 208 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 209 | Ga0209677_100187 | 3300025253 | Bacteria | 50389 |
| 210 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 211 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 212 | Ga0209233_1022852 | 3300025261 | Bacteria | 1593 |
| 213 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 214 | Ga0207655_1113449 | 3300025728 | Bacteria | 911 |
| 215 | Ga0207692_10470526 | 3300025898 | Bacteria | 794 |
| 216 | Ga0207642_10244373 | 3300025899 | Bacteria | 1015 |
| 217 | Ga0207688_10103113 | 3300025901 | Bacteria | 1650 |
| 218 | Ga0207688_10207532 | 3300025901 | Bacteria | 1176 |
| 219 | Ga0207688_10226292 | 3300025901 | Bacteria | 1128 |
| 220 | Ga0207647_10026839 | 3300025904 | Bacteria | 3762 |
| 221 | Ga0207647_10042282 | 3300025904 | Bacteria | 2859 |
| 222 | Ga0207647_10282682 | 3300025904 | Bacteria | 947 |
| 223 | Ga0207643_10175739 | 3300025908 | Bacteria | 1294 |
| 224 | Ga0207705_10029292 | 3300025909 | Bacteria | 3925 |
| 225 | Ga0207707_10430438 | 3300025912 | Bacteria | 1130 |
| 226 | Ga0207695_10258711 | 3300025913 | Bacteria | 1638 |
| 227 | Ga0207671_10506111 | 3300025914 | Bacteria | 963 |
| 228 | Ga0207660_11086500 | 3300025917 | Bacteria | 652 |
| 229 | Ga0207657_10196090 | 3300025919 | Bacteria | 1627 |
| 230 | Ga0207652_10141513 | 3300025921 | Bacteria | 2151 |
| 231 | Ga0207652_10298432 | 3300025921 | Bacteria | 1454 |
| 232 | Ga0207694_10298513 | 3300025924 | Bacteria | 1326 |
| 233 | Ga0207694_10909643 | 3300025924 | Bacteria | 744 |
| 234 | Ga0207650_10203250 | 3300025925 | Bacteria | 1588 |
| 235 | Ga0207659_10104232 | 3300025926 | Bacteria | 2145 |
| 236 | Ga0207659_10429085 | 3300025926 | Bacteria | 1110 |
| 237 | Ga0207687_10410149 | 3300025927 | Bacteria | 1116 |
| 238 | Ga0207687_10567454 | 3300025927 | Bacteria | 954 |
| 239 | Ga0207700_10299165 | 3300025928 | Bacteria | 1389 |
| 240 | Ga0207664_10001112 | 3300025929 | Bacteria | 17913 |
| 241 | Ga0207664_10030114 | 3300025929 | Bacteria | 4143 |
| 242 | Ga0207664_10159236 | 3300025929 | Bacteria | 1924 |
| 243 | Ga0207686_10184360 | 3300025934 | Bacteria | 1482 |
| 244 | Ga0207709_10046435 | 3300025935 | Bacteria | 2635 |
| 245 | Ga0207709_10064798 | 3300025935 | Bacteria | 2296 |
| 246 | Ga0207709_10113781 | 3300025935 | Bacteria | 1814 |
| 247 | Ga0207709_10115069 | 3300025935 | Bacteria | 1806 |
| 248 | Ga0207709_10270201 | 3300025935 | Bacteria | 1251 |
| 249 | Ga0207669_10129934 | 3300025937 | Bacteria | 1729 |
| 250 | Ga0207669_10728024 | 3300025937 | Bacteria | 817 |
| 251 | Ga0207704_10516697 | 3300025938 | Bacteria | 965 |
| 252 | Ga0207665_10056058 | 3300025939 | Bacteria | 2660 |
| 253 | Ga0207665_10664016 | 3300025939 | Bacteria | 818 |
| 254 | Ga0207691_10146806 | 3300025940 | Bacteria | 2076 |
| 255 | Ga0207689_10019688 | 3300025942 | Bacteria | 5687 |
| 256 | Ga0207689_10056449 | 3300025942 | Bacteria | 3232 |
| 257 | Ga0207661_10019379 | 3300025944 | Bacteria | 5071 |
| 258 | Ga0207661_10045354 | 3300025944 | Bacteria | 3479 |
| 259 | Ga0207661_10475707 | 3300025944 | Bacteria | 1140 |
| 260 | Ga0207679_10380897 | 3300025945 | Bacteria | 1237 |
| 261 | Ga0207667_10123116 | 3300025949 | Bacteria | 2672 |
| 262 | Ga0207712_10446151 | 3300025961 | Bacteria | 1096 |
| 263 | Ga0207668_10041772 | 3300025972 | Bacteria | 3102 |
| 264 | Ga0207668_10248899 | 3300025972 | Bacteria | 1442 |
| 265 | Ga0207639_10903985 | 3300026041 | Bacteria | 825 |
| 266 | Ga0207639_11109793 | 3300026041 | Bacteria | 742 |
| 267 | Ga0207678_10224375 | 3300026067 | Bacteria | 1609 |
| 268 | Ga0207702_10128137 | 3300026078 | Bacteria | 2281 |
| 269 | Ga0207702_10280248 | 3300026078 | Bacteria | 1576 |
| 270 | Ga0207702_10466897 | 3300026078 | Bacteria | 1227 |
| 271 | Ga0207648_10074086 | 3300026089 | Bacteria | 2967 |
| 272 | Ga0207648_10311790 | 3300026089 | Bacteria | 1412 |
| 273 | Ga0207648_10463244 | 3300026089 | Bacteria | 1156 |
| 274 | Ga0207674_10010641 | 3300026116 | Bacteria | 10402 |
| 275 | Ga0207674_10019369 | 3300026116 | Bacteria | 7372 |
| 276 | Ga0207674_10040969 | 3300026116 | Bacteria | 4793 |
| 277 | Ga0207674_10671918 | 3300026116 | Bacteria | 1000 |
| 278 | Ga0207675_100102916 | 3300026118 | Bacteria | 2691 |
| 279 | Ga0207675_100368196 | 3300026118 | Bacteria | 1411 |
| 280 | Ga0207675_101676294 | 3300026118 | Bacteria | 656 |
| 281 | Ga0207683_10069279 | 3300026121 | Bacteria | 3115 |
| 282 | Ga0207683_10128007 | 3300026121 | Bacteria | 2283 |
| 283 | Ga0207683_10407011 | 3300026121 | Bacteria | 1252 |
| 284 | Ga0207683_10467654 | 3300026121 | Bacteria | 1163 |
| 285 | Ga0207683_10941221 | 3300026121 | Bacteria | 802 |
| 286 | Ga0207698_10247904 | 3300026142 | Bacteria | 1628 |
| 287 | Ga0265334_10006588 | 3300028573 | Bacteria | 4998 |
| 288 | Ga0307515_10068581 | 3300028794 | Bacteria | 4869 |
| 289 | Ga0307515_10073868 | 3300028794 | Bacteria | 4573 |
| 290 | Ga0307515_10227573 | 3300028794 | Bacteria | 1666 |
| 291 | Ga0307515_10285124 | 3300028794 | Bacteria | 1354 |
| 292 | Ga0307515_10531742 | 3300028794 | Bacteria | 785 |
| 293 | Ga0316179_1041824 | 3300030734 | Bacteria | 2204 |
| 294 | Ga0316182_1203598 | 3300030745 | Bacteria | 1289 |
| 295 | Ga0316182_1275098 | 3300030745 | Bacteria | 915 |
| 296 | Ga0265340_10192404 | 3300031247 | Bacteria | 919 |
| 297 | Ga0307513_10000970 | 3300031456 | Bacteria | 41526 |
| 298 | Ga0307408_100707839 | 3300031548 | Bacteria | 906 |
| 299 | Ga0316575_10005797 | 3300031665 | Bacteria | 4412 |
| 300 | Ga0316579_10001539 | 3300031691 | Bacteria | 8412 |
| 301 | Ga0316579_10005432 | 3300031691 | Bacteria | 5145 |
| 302 | Ga0316576_10003688 | 3300031727 | Bacteria | 9035 |
| 303 | Ga0316576_10010721 | 3300031727 | Bacteria | 5969 |
| 304 | Ga0316576_10061212 | 3300031727 | Bacteria | 2758 |
| 305 | Ga0316578_10052248 | 3300031728 | Bacteria | 2394 |
| 306 | Ga0316578_10065307 | 3300031728 | Bacteria | 2148 |
| 307 | Ga0316578_10067718 | 3300031728 | Bacteria | 2110 |
| 308 | Ga0307405_10895140 | 3300031731 | Bacteria | 750 |
| 309 | Ga0316577_10072570 | 3300031733 | Bacteria | 1921 |
| 310 | Ga0307413_10377778 | 3300031824 | Bacteria | 1103 |
| 311 | Ga0307413_10826002 | 3300031824 | Bacteria | 781 |
| 312 | Ga0307410_10025624 | 3300031852 | Bacteria | 3703 |
| 313 | Ga0307410_10199382 | 3300031852 | Bacteria | 1527 |
| 314 | Ga0307406_10000108 | 3300031901 | Bacteria | 48095 |
| 315 | Ga0307406_10061840 | 3300031901 | Bacteria | 2420 |
| 316 | Ga0307406_10098155 | 3300031901 | Bacteria | 1988 |
| 317 | Ga0307406_10188774 | 3300031901 | Bacteria | 1507 |
| 318 | Ga0307406_10304407 | 3300031901 | Bacteria | 1226 |
| 319 | Ga0307406_10369382 | 3300031901 | Bacteria | 1127 |
| 320 | Ga0307407_10045016 | 3300031903 | Bacteria | 2491 |
| 321 | Ga0307407_10716056 | 3300031903 | Bacteria | 755 |
| 322 | Ga0307412_10050146 | 3300031911 | Bacteria | 2754 |
| 323 | Ga0307412_10053288 | 3300031911 | Bacteria | 2681 |
| 324 | Ga0307412_10173446 | 3300031911 | Bacteria | 1615 |
| 325 | Ga0307409_100064464 | 3300031995 | Bacteria | 2878 |
| 326 | Ga0307409_100092517 | 3300031995 | Bacteria | 2482 |
| 327 | Ga0307409_100204326 | 3300031995 | Bacteria | 1770 |
| 328 | Ga0307416_100094182 | 3300032002 | Bacteria | 2582 |
| 329 | Ga0307416_100137994 | 3300032002 | Bacteria | 2210 |
| 330 | Ga0307416_100385623 | 3300032002 | Bacteria | 1433 |
| 331 | Ga0307414_10135400 | 3300032004 | Bacteria | 1920 |
| 332 | Ga0307414_11034602 | 3300032004 | Bacteria | 757 |
| 333 | Ga0307411_10446978 | 3300032005 | Bacteria | 1080 |
| 334 | Ga0307415_100025820 | 3300032126 | Bacteria | 3695 |
| 335 | Ga0307415_100124925 | 3300032126 | Bacteria | 1937 |
| 336 | Ga0307415_100452608 | 3300032126 | Bacteria | 1110 |
| 337 | Ga0307415_100663420 | 3300032126 | Bacteria | 936 |
| 338 | Ga0316585_10013947 | 3300032137 | Bacteria | 2396 |
| 339 | Ga0316580_10017414 | 3300032139 | Bacteria | 2210 |
| 340 | Ga0316580_10034447 | 3300032139 | Bacteria | 1567 |
| 341 | Ga0316593_10043125 | 3300032168 | Bacteria | 1506 |
| 342 | Ga0316593_10273750 | 3300032168 | Bacteria | 635 |
| 343 | Ga0316592_1057024 | 3300033524 | Bacteria | 875 |
| 344 | Ga0316592_1096410 | 3300033524 | Bacteria | 679 |
| 345 | Ga0316588_1070652 | 3300033528 | Bacteria | 857 |
| 346 | Ga0316596_1019662 | 3300033541 | Bacteria | 1714 |
| 347 | Ga0316596_1033908 | 3300033541 | Bacteria | 1332 |
| 348 | Ga0373960_0142831 | 3300035121 | Bacteria | 812 |
| 349 | Ga0316574_0003174 | 3300035398 | Bacteria | 8412 |
| 350 | Ga0316574_0006251 | 3300035398 | Bacteria | 6417 |
| 351 | Ga0316574_0018303 | 3300035398 | Bacteria | 4114 |
| 352 | Ga0316574_0077584 | 3300035398 | Bacteria | 2105 |
| 353 | Ga0373931_0462877 | 3300035691 | Bacteria | 813 |
| 354 | Ga0373937_1225718 | 3300036401 | Bacteria | 699 |
| 355 | Ga0316582_0001733 | 3300036647 | Bacteria | 9811 |
| 356 | Ga0316582_0049547 | 3300036647 | Bacteria | 2657 |
| 357 | Ga0316582_0101695 | 3300036647 | Bacteria | 1904 |
| 358 | Ga0316582_0672790 | 3300036647 | Bacteria | 711 |
| 359 | Ga0316584_0069754 | 3300036712 | Bacteria | 2635 |
| 360 | Ga0316584_0110376 | 3300036712 | Bacteria | 2058 |
| 361 | Ga0316584_0169758 | 3300036712 | Bacteria | 1618 |
| 362 | Ga0316584_0606809 | 3300036712 | Bacteria | 758 |
| 363 | Ga0395899_0001589 | 3300037312 | Bacteria | 19099 |
| 364 | Ga0395899_0008073 | 3300037312 | Bacteria | 8106 |
| 365 | Ga0395899_0016290 | 3300037312 | Bacteria | 5666 |
| 366 | Ga0395899_0025982 | 3300037312 | Bacteria | 4419 |
| 367 | Ga0395899_0101263 | 3300037312 | Bacteria | 2079 |
| 368 | Ga0395900_0024033 | 3300037418 | Bacteria | 6235 |
| 369 | Ga0395900_0048256 | 3300037418 | Bacteria | 4386 |
| 370 | Ga0395900_0053242 | 3300037418 | Bacteria | 4165 |
| 371 | Ga0395900_0055561 | 3300037418 | Bacteria | 4077 |
| 372 | Ga0395900_0127183 | 3300037418 | Bacteria | 2613 |
| 373 | Ga0395900_0140387 | 3300037418 | Bacteria | 2474 |
| 374 | Ga0395900_0142025 | 3300037418 | Bacteria | 2458 |
| 375 | Ga0395900_0181777 | 3300037418 | Bacteria | 2137 |
| 376 | Ga0395900_0263204 | 3300037418 | Bacteria | 1721 |
| 377 | Ga0395900_0618887 | 3300037418 | Bacteria | 1022 |
| 378 | Ga0395900_0630041 | 3300037418 | Bacteria | 1011 |
| 379 | Ga0395898_0000131 | 3300037466 | Bacteria | 192369 |
| 380 | Ga0395898_0007362 | 3300037466 | Bacteria | 11684 |
| 381 | Ga0395898_0014196 | 3300037466 | Bacteria | 8191 |
| 382 | Ga0395898_0032980 | 3300037466 | Bacteria | 5169 |
| 383 | Ga0395898_0034838 | 3300037466 | Bacteria | 5011 |
| 384 | Ga0395898_0073982 | 3300037466 | Bacteria | 3292 |
| 385 | Ga0395898_0126923 | 3300037466 | Bacteria | 2444 |
| 386 | Ga0395905_0001103 | 3300037471 | Bacteria | 33927 |
| 387 | Ga0395905_0065536 | 3300037471 | Bacteria | 3401 |
| 388 | Ga0395905_0112062 | 3300037471 | Bacteria | 2562 |
| 389 | Ga0316581_0035049 | 3300037588 | Bacteria | 1520 |
| 390 | Ga0395901_0009293 | 3300038443 | Bacteria | 9964 |
| 391 | Ga0395901_0013369 | 3300038443 | Bacteria | 8340 |
| 392 | Ga0395901_0018977 | 3300038443 | Bacteria | 7031 |
| 393 | Ga0395901_0048147 | 3300038443 | Bacteria | 4427 |
| 394 | Ga0395901_0104376 | 3300038443 | Bacteria | 2975 |
| 395 | Ga0395901_0118903 | 3300038443 | Bacteria | 2776 |
| 396 | Ga0395901_0174201 | 3300038443 | Bacteria | 2257 |
| 397 | Ga0395901_0189786 | 3300038443 | Bacteria | 2155 |
| 398 | Ga0395901_0282214 | 3300038443 | Bacteria | 1725 |
| 399 | Ga0395901_0356711 | 3300038443 | Bacteria | 1508 |
| 400 | Ga0400485_01906 | 3300038735 | Bacteria | 55321 |
| 401 | Ga0400488_21867 | 3300038741 | Bacteria | 4428 |
| 402 | Ga0400486_20001 | 3300038742 | Bacteria | 106597 |
| 403 | Ga0436363_0475003 | 3300039450 | Bacteria | 1964 |
| 404 | Ga0436362_0058353 | 3300039453 | Bacteria | 671 |
| 405 | Ga0439466_0103961 | 3300041411 | Bacteria | 884 |
| 406 | Ga0451791_0360065 | 3300041451 | Bacteria | 992 |
| 407 | Ga0451791_1525161 | 3300041451 | Bacteria | 799 |
| 408 | Ga0451793_1114004 | 3300041452 | Bacteria | 1878 |
| 409 | Ga0451795_0152704 | 3300041456 | Bacteria | 948 |
| 410 | Ga0451798_0543836 | 3300041458 | Bacteria | 2137 |
| 411 | Ga0451800_0549017 | 3300041459 | Bacteria | 724 |
| 412 | Ga0451802_0181093 | 3300041460 | Bacteria | 849 |
| 413 | Ga0451804_0464391 | 3300041463 | Bacteria | 861 |
| 414 | Ga0451807_0200845 | 3300041486 | Bacteria | 1387 |
| 415 | Ga0451807_1080106 | 3300041486 | Bacteria | 858 |
| 416 | Ga0451835_0268814 | 3300041492 | Bacteria | 718 |
| 417 | Ga0451837_1272064 | 3300041494 | Bacteria | 2225 |
| 418 | Ga0451837_1312361 | 3300041494 | Bacteria | 722 |
| 419 | Ga0451849_0029660 | 3300041505 | Bacteria | 930 |
| 420 | Ga0451851_0154827 | 3300041507 | Bacteria | 2106 |
| 421 | Ga0451855_1012064 | 3300041511 | Bacteria | 716 |
| 422 | Ga0451853_0604592 | 3300041512 | Bacteria | 1192 |
| 423 | Ga0451853_0817060 | 3300041512 | Bacteria | 889 |
| 424 | Ga0439431_0044622 | 3300041997 | Bacteria | 1137 |
| 425 | Ga0439449_0078161 | 3300042007 | Bacteria | 1220 |
| 426 | Ga0439449_0124342 | 3300042007 | Bacteria | 958 |
| 427 | Ga0439446_0133797 | 3300042156 | Bacteria | 806 |
| 428 | Ga0450918_039104 | 3300042531 | Bacteria | 849 |
| 429 | Ga0466969_0247626 | 3300044656 | Bacteria | 808 |
| 430 | Ga0466972_0024228 | 3300044658 | Bacteria | 3012 |
| 431 | Ga0466972_0068242 | 3300044658 | Bacteria | 1698 |
| 432 | Ga0466972_0275783 | 3300044658 | Bacteria | 786 |
| 433 | Ga0466965_0005741 | 3300044683 | Bacteria | 5601 |
| 434 | Ga0466965_0048316 | 3300044683 | Bacteria | 2108 |
| 435 | Ga0466965_0053104 | 3300044683 | Bacteria | 2014 |
| 436 | Ga0466965_0074500 | 3300044683 | Bacteria | 1710 |
| 437 | Ga0466965_0177056 | 3300044683 | Bacteria | 1124 |
| 438 | Ga0466965_0519297 | 3300044683 | Bacteria | 670 |
| 439 | Ga0466966_0010911 | 3300044684 | Bacteria | 6034 |
| 440 | Ga0466961_0009823 | 3300044693 | Bacteria | 6092 |
| 441 | Ga0466961_0038827 | 3300044693 | Bacteria | 3053 |
| 442 | Ga0466963_0016854 | 3300044694 | Bacteria | 4549 |
| 443 | Ga0466963_0137935 | 3300044694 | Bacteria | 1688 |
| 444 | Ga0466963_0140704 | 3300044694 | Bacteria | 1672 |
| 445 | Ga0466964_0229806 | 3300044706 | Bacteria | 905 |
| 446 | Ga0466971_0032302 | 3300044719 | Bacteria | 2345 |
| 447 | Ga0466971_0064402 | 3300044719 | Bacteria | 1659 |
| 448 | Ga0466971_0121344 | 3300044719 | Bacteria | 1210 |
| 449 | Ga0466968_0070487 | 3300044735 | Bacteria | 1521 |
| 450 | Ga0466968_0217778 | 3300044735 | Bacteria | 898 |
| 451 | Ga0466970_0012124 | 3300044765 | Bacteria | 4401 |
| 452 | Ga0466970_0117860 | 3300044765 | Bacteria | 1453 |
| 453 | Ga0466970_0134122 | 3300044765 | Bacteria | 1361 |
| 454 | Ga0466970_0141194 | 3300044765 | Bacteria | 1327 |
| 455 | Ga0466970_0315851 | 3300044765 | Bacteria | 883 |
| 456 | Ga0466957_0089707 | 3300044842 | Bacteria | 1925 |
| 457 | Ga0466957_0106008 | 3300044842 | Bacteria | 1777 |
| 458 | Ga0466957_0132765 | 3300044842 | Bacteria | 1597 |
| 459 | Ga0466957_0168313 | 3300044842 | Bacteria | 1426 |
| 460 | Ga0466960_0003363 | 3300044901 | Bacteria | 6141 |
| 461 | Ga0466960_0011156 | 3300044901 | Bacteria | 3748 |
| 462 | Ga0466960_0073372 | 3300044901 | Bacteria | 1708 |
| 463 | Ga0466960_0086332 | 3300044901 | Bacteria | 1591 |
| 464 | Ga0466960_0180965 | 3300044901 | Bacteria | 1142 |
| 465 | Ga0466960_0405015 | 3300044901 | Bacteria | 786 |
| 466 | Ga0466959_0027280 | 3300045049 | Bacteria | 4236 |
| 467 | Ga0466959_0076146 | 3300045049 | Bacteria | 2423 |
| 468 | Ga0466959_0119059 | 3300045049 | Bacteria | 1879 |
| 469 | Ga0466958_0065933 | 3300045836 | Bacteria | 2210 |
| 470 | Ga0466958_0346350 | 3300045836 | Bacteria | 956 |
| 471 | Ga0466958_0423770 | 3300045836 | Bacteria | 860 |
| 472 | Ga0466967_0005856 | 3300045976 | Bacteria | 8602 |
| 473 | Ga0466967_0101057 | 3300045976 | Bacteria | 2635 |
| 474 | Ga0466967_0249316 | 3300045976 | Bacteria | 1696 |
| 475 | Ga0466967_0270336 | 3300045976 | Bacteria | 1629 |
| 476 | Ga0466967_0678802 | 3300045976 | Bacteria | 1020 |
| 477 | Ga0495627_001650 | 3300046453 | Bacteria | 12395 |
| 478 | Ga0495638_0019724 | 3300046460 | Bacteria | 4458 |
| 479 | Ga0495664_0153888 | 3300046477 | Bacteria | 1395 |
| 480 | Ga0495608_0399833 | 3300046511 | Bacteria | 840 |
| 481 | Ga0495644_0296643 | 3300046523 | Bacteria | 632 |
| 482 | Ga0495640_0061108 | 3300046533 | Bacteria | 2561 |
| 483 | Ga0495587_0149292 | 3300046536 | Bacteria | 1332 |
| 484 | Ga0495633_0106184 | 3300046558 | Bacteria | 1303 |
| 485 | Ga0495667_0049897 | 3300046559 | Bacteria | 2763 |
| 486 | Ga0495667_0181636 | 3300046559 | Bacteria | 1350 |
| 487 | Ga0495656_0027647 | 3300046615 | Bacteria | 2268 |
| 488 | Ga0495656_0141099 | 3300046615 | Bacteria | 1156 |
| 489 | Ga0495634_0121813 | 3300046642 | Bacteria | 1670 |
| 490 | Ga0495625_0100760 | 3300046660 | Bacteria | 1985 |
| 491 | Ga0495635_0087097 | 3300046663 | Bacteria | 2137 |
| 492 | Ga0495635_0232413 | 3300046663 | Bacteria | 1245 |
| 493 | Ga0495647_0051851 | 3300046681 | Bacteria | 1596 |
| 494 | Ga0495613_0258756 | 3300046689 | Bacteria | 1213 |
| 495 | Ga0495624_0416627 | 3300046690 | Bacteria | 806 |
| 496 | Ga0495649_0348421 | 3300046694 | Bacteria | 749 |
| 497 | Ga0495600_0281241 | 3300046809 | Bacteria | 1053 |
| 498 | Ga0495581_0057647 | 3300047315 | Bacteria | 2242 |
| 499 | Ga0495581_0444972 | 3300047315 | Bacteria | 755 |
| 500 | Ga0495674_0319214 | 3300047319 | Bacteria | 1266 |
| 501 | Ga0495674_0797331 | 3300047319 | Bacteria | 735 |
| 502 | Ga0495672_0017547 | 3300047320 | Bacteria | 4785 |
| 503 | Ga0495680_0280339 | 3300047322 | Bacteria | 1175 |
| 504 | Ga0495680_0588006 | 3300047322 | Bacteria | 746 |
| 505 | Ga0495675_0081054 | 3300047444 | Bacteria | 2044 |
| 506 | Ga0495675_0486394 | 3300047444 | Bacteria | 710 |
| 507 | Ga0495684_0533353 | 3300047471 | Bacteria | 802 |
| 508 | Ga0495686_0113671 | 3300047472 | Bacteria | 1621 |
| 509 | Ga0495686_0269684 | 3300047472 | Bacteria | 950 |
| 510 | Ga0495686_0380361 | 3300047472 | Bacteria | 762 |
| 511 | Ga0495686_0454040 | 3300047472 | Bacteria | 680 |
| 512 | Ga0495602_0082893 | 3300048088 | Bacteria | 2689 |
| 513 | Ga0496100_0055811 | 3300048903 | Bacteria | 2582 |
| 514 | Ga0496100_0086725 | 3300048903 | Bacteria | 2127 |
| 515 | Ga0496100_0208075 | 3300048903 | Bacteria | 1429 |
| 516 | Ga0496100_0231255 | 3300048903 | Bacteria | 1360 |
| 517 | Ga0496101_0025696 | 3300048904 | Bacteria | 4088 |
| 518 | Ga0496101_0043514 | 3300048904 | Bacteria | 3209 |
| 519 | Ga0496101_0108385 | 3300048904 | Bacteria | 2088 |
| 520 | Ga0496101_0237973 | 3300048904 | Bacteria | 1416 |
| 521 | Ga0496101_0292037 | 3300048904 | Bacteria | 1276 |
| 522 | Ga0496101_0553153 | 3300048904 | Bacteria | 910 |
| 523 | Ga0496101_0647089 | 3300048904 | Bacteria | 835 |
| 524 | Ga0496101_0688533 | 3300048904 | Bacteria | 807 |
| 525 | Ga0496102_0007945 | 3300048905 | Bacteria | 9066 |
| 526 | Ga0496102_0040977 | 3300048905 | Bacteria | 4192 |
| 527 | Ga0496102_0044215 | 3300048905 | Bacteria | 4041 |
| 528 | Ga0496103_0002549 | 3300048906 | Bacteria | 11411 |
| 529 | Ga0496103_0020679 | 3300048906 | Bacteria | 3956 |
| 530 | Ga0496103_0058136 | 3300048906 | Bacteria | 2402 |
| 531 | Ga0496104_0102883 | 3300048907 | Bacteria | 2736 |
| 532 | Ga0496104_0116043 | 3300048907 | Bacteria | 2569 |
| 533 | Ga0496104_0481771 | 3300048907 | Bacteria | 1152 |
| 534 | Ga0496104_0890207 | 3300048907 | Bacteria | 795 |
| 535 | Ga0496105_0007370 | 3300048908 | Bacteria | 8513 |
| 536 | Ga0496105_0035840 | 3300048908 | Bacteria | 4085 |
| 537 | Ga0496105_0252017 | 3300048908 | Bacteria | 1430 |
| 538 | Ga0496105_0261843 | 3300048908 | Bacteria | 1398 |
| 539 | Ga0496106_0054358 | 3300048909 | Bacteria | 3025 |
| 540 | Ga0496106_0388376 | 3300048909 | Bacteria | 1122 |
| 541 | Ga0496107_0055402 | 3300048910 | Bacteria | 2864 |
| 542 | Ga0496107_0142770 | 3300048910 | Bacteria | 1770 |
| 543 | Ga0496107_0170876 | 3300048910 | Bacteria | 1613 |
| 544 | Ga0496108_0074045 | 3300048911 | Bacteria | 2875 |
| 545 | Ga0496108_0448302 | 3300048911 | Bacteria | 1127 |
| 546 | Ga0496109_0123867 | 3300048912 | Bacteria | 2409 |
| 547 | Ga0496109_0145515 | 3300048912 | Bacteria | 2217 |
| 548 | Ga0496109_0277843 | 3300048912 | Bacteria | 1578 |
| 549 | Ga0496109_0304969 | 3300048912 | Bacteria | 1502 |
| 550 | Ga0496109_1278650 | 3300048912 | Bacteria | 670 |
| 551 | Ga0496109_1409733 | 3300048912 | Bacteria | 632 |
| 552 | Ga0496110_0003842 | 3300048913 | Bacteria | 11569 |
| 553 | Ga0496110_0075302 | 3300048913 | Bacteria | 2999 |
| 554 | Ga0496110_0075641 | 3300048913 | Bacteria | 2992 |
| 555 | Ga0496110_0227332 | 3300048913 | Bacteria | 1697 |
| 556 | Ga0496110_0485187 | 3300048913 | Bacteria | 1126 |
| 557 | Ga0496111_0037450 | 3300048914 | Bacteria | 3471 |
| 558 | Ga0496111_0817421 | 3300048914 | Bacteria | 674 |
| 559 | Ga0496112_0069265 | 3300048915 | Bacteria | 3485 |
| 560 | Ga0496112_0093514 | 3300048915 | Bacteria | 2977 |
| 561 | Ga0496112_0270044 | 3300048915 | Bacteria | 1649 |
| 562 | Ga0496113_0124755 | 3300048916 | Bacteria | 2016 |
| 563 | Ga0496113_0191257 | 3300048916 | Bacteria | 1624 |
| 564 | Ga0496113_0257422 | 3300048916 | Bacteria | 1394 |
| 565 | Ga0496113_0497806 | 3300048916 | Bacteria | 978 |
| 566 | Ga0496114_0021664 | 3300048917 | Bacteria | 5230 |
| 567 | Ga0496114_0023550 | 3300048917 | Bacteria | 5025 |
| 568 | Ga0496114_0040282 | 3300048917 | Bacteria | 3867 |
| 569 | Ga0496114_0081857 | 3300048917 | Bacteria | 2728 |
| 570 | Ga0496114_0173315 | 3300048917 | Bacteria | 1881 |
| 571 | Ga0496114_0195696 | 3300048917 | Bacteria | 1769 |
| 572 | Ga0496114_0253845 | 3300048917 | Bacteria | 1547 |
| 573 | Ga0496114_0429517 | 3300048917 | Bacteria | 1170 |
| 574 | Ga0496115_0074021 | 3300048918 | Bacteria | 2765 |
| 575 | Ga0496115_0312547 | 3300048918 | Bacteria | 1286 |
| 576 | Ga0496115_0414204 | 3300048918 | Bacteria | 1092 |
| 577 | Ga0496115_0526180 | 3300048918 | Bacteria | 948 |
| 578 | Ga0496116_0019712 | 3300048919 | Bacteria | 5155 |
| 579 | Ga0496116_0134225 | 3300048919 | Bacteria | 1405 |
| 580 | Ga0496117_0000468 | 3300048920 | Bacteria | 67418 |
| 581 | Ga0496117_0001642 | 3300048920 | Bacteria | 31427 |
| 582 | Ga0496117_0016338 | 3300048920 | Bacteria | 6266 |
| 583 | Ga0496117_0018386 | 3300048920 | Bacteria | 5789 |
| 584 | Ga0496117_0052644 | 3300048920 | Bacteria | 2866 |
| 585 | Ga0496117_0069032 | 3300048920 | Bacteria | 2382 |
| 586 | Ga0496117_0103701 | 3300048920 | Bacteria | 1792 |
| 587 | Ga0496117_0122293 | 3300048920 | Bacteria | 1596 |
| 588 | Ga0496117_0179138 | 3300048920 | Bacteria | 1220 |
| 589 | Ga0496117_0443444 | 3300048920 | Bacteria | 644 |
| 590 | Ga0496118_0004353 | 3300048921 | Bacteria | 16850 |
| 591 | Ga0496118_0011768 | 3300048921 | Bacteria | 8501 |
| 592 | Ga0496118_0017452 | 3300048921 | Bacteria | 6533 |
| 593 | Ga0496118_0058757 | 3300048921 | Bacteria | 2870 |
| 594 | Ga0496118_0082443 | 3300048921 | Bacteria | 2253 |
| 595 | Ga0496118_0210821 | 3300048921 | Bacteria | 1140 |
| 596 | Ga0496118_0356933 | 3300048921 | Bacteria | 776 |
| 597 | Ga0496118_0438540 | 3300048921 | Bacteria | 667 |
| 598 | Ga0496119_0001447 | 3300048922 | Bacteria | 28549 |
| 599 | Ga0496119_0002168 | 3300048922 | Bacteria | 22033 |
| 600 | Ga0496119_0002636 | 3300048922 | Bacteria | 19439 |
| 601 | Ga0496119_0003788 | 3300048922 | Bacteria | 15460 |
| 602 | Ga0496119_0008817 | 3300048922 | Bacteria | 8779 |
| 603 | Ga0496119_0015749 | 3300048922 | Bacteria | 5797 |
| 604 | Ga0496119_0105437 | 3300048922 | Bacteria | 1575 |
| 605 | Ga0496119_0202951 | 3300048922 | Bacteria | 1025 |
| 606 | Ga0496120_0000565 | 3300048923 | Bacteria | 56440 |
| 607 | Ga0496120_0032972 | 3300048923 | Bacteria | 3116 |
| 608 | Ga0496120_0086267 | 3300048923 | Bacteria | 1688 |
| 609 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 610 | Ga0496121_0083728 | 3300048924 | Bacteria | 2517 |
| 611 | Ga0496121_0202409 | 3300048924 | Bacteria | 1414 |
| 612 | Ga0496122_0000054 | 3300048925 | Bacteria | 259135 |
| 613 | Ga0496122_0000240 | 3300048925 | Bacteria | 123001 |
| 614 | Ga0496122_0004129 | 3300048925 | Bacteria | 18364 |
| 615 | Ga0496122_0004482 | 3300048925 | Bacteria | 17265 |
| 616 | Ga0496122_0044311 | 3300048925 | Bacteria | 3474 |
| 617 | Ga0496122_0054530 | 3300048925 | Bacteria | 3001 |
| 618 | Ga0496122_0153675 | 3300048925 | Bacteria | 1416 |
| 619 | Ga0496123_0000039 | 3300048926 | Bacteria | 259107 |
| 620 | Ga0496123_0000076 | 3300048926 | Bacteria | 194050 |
| 621 | Ga0496123_0006901 | 3300048926 | Bacteria | 10864 |
| 622 | Ga0496123_0007074 | 3300048926 | Bacteria | 10667 |
| 623 | Ga0496123_0120762 | 3300048926 | Bacteria | 1475 |
| 624 | Ga0496123_0148414 | 3300048926 | Bacteria | 1269 |
| 625 | Ga0496124_0002700 | 3300048927 | Bacteria | 22676 |
| 626 | Ga0496124_0002802 | 3300048927 | Bacteria | 22087 |
| 627 | Ga0496124_0003349 | 3300048927 | Bacteria | 19720 |
| 628 | Ga0496124_0103941 | 3300048927 | Bacteria | 2297 |
| 629 | Ga0496124_0110410 | 3300048927 | Bacteria | 2214 |
| 630 | Ga0496124_0365839 | 3300048927 | Bacteria | 1014 |
| 631 | Ga0496124_0415576 | 3300048927 | Bacteria | 929 |
| 632 | Ga0496125_0000061 | 3300048928 | Bacteria | 262739 |
| 633 | Ga0496125_0005037 | 3300048928 | Bacteria | 14911 |
| 634 | Ga0496125_0013256 | 3300048928 | Bacteria | 8113 |
| 635 | Ga0496125_0024358 | 3300048928 | Bacteria | 5567 |
| 636 | Ga0496125_0035020 | 3300048928 | Bacteria | 4414 |
| 637 | Ga0496125_0062145 | 3300048928 | Bacteria | 2989 |
| 638 | Ga0496125_0294691 | 3300048928 | Bacteria | 997 |
| 639 | Ga0496126_0003246 | 3300048929 | Bacteria | 20779 |
| 640 | Ga0496126_0006703 | 3300048929 | Bacteria | 12792 |
| 641 | Ga0496126_0008752 | 3300048929 | Bacteria | 10867 |
| 642 | Ga0496126_0017018 | 3300048929 | Bacteria | 7253 |
| 643 | Ga0496126_0075480 | 3300048929 | Bacteria | 2992 |
| 644 | Ga0496126_0082638 | 3300048929 | Bacteria | 2837 |
| 645 | Ga0496126_0088488 | 3300048929 | Bacteria | 2727 |
| 646 | Ga0496126_0428540 | 3300048929 | Bacteria | 1068 |
| 647 | Ga0496126_0621418 | 3300048929 | Bacteria | 849 |
| 648 | Ga0501306_032927 | 3300049127 | Bacteria | 778 |
| 649 | Ga0501306_033692 | 3300049127 | Bacteria | 771 |
| 650 | Ga0501306_050051 | 3300049127 | Bacteria | 668 |
| 651 | Ga0501309_014427 | 3300049129 | Bacteria | 1061 |
| 652 | Ga0501309_050139 | 3300049129 | Bacteria | 654 |
| 653 | Ga0501304_007091 | 3300049160 | Bacteria | 918 |
| 654 | Ga0501304_020910 | 3300049160 | Bacteria | 648 |
| 655 | Ga0501305_062041 | 3300049161 | Bacteria | 645 |
| 656 | Ga0501311_021168 | 3300049527 | Bacteria | 885 |
| 657 | Ga0501311_059086 | 3300049527 | Bacteria | 616 |
| 658 | Ga0501312_052982 | 3300049528 | Bacteria | 688 |
| 659 | Ga0501314_021815 | 3300049530 | Bacteria | 670 |
| 660 | Ga0501314_028252 | 3300049530 | Bacteria | 614 |
| 661 | Ga0501315_018264 | 3300049531 | Bacteria | 924 |
| 662 | Ga0501317_008631 | 3300049533 | Bacteria | 1178 |
| 663 | Ga0501317_021348 | 3300049533 | Bacteria | 879 |
| 664 | Ga0501317_033401 | 3300049533 | Bacteria | 757 |
| 665 | Ga0501317_033629 | 3300049533 | Bacteria | 755 |
| 666 | Ga0501318_004758 | 3300049534 | Bacteria | 1317 |
| 667 | Ga0501318_006907 | 3300049534 | Bacteria | 1172 |
| 668 | Ga0501318_012840 | 3300049534 | Bacteria | 966 |
| 669 | Ga0501319_010515 | 3300049535 | Bacteria | 737 |
| 670 | Ga0501319_019111 | 3300049535 | Bacteria | 604 |
| 671 | Ga0501321_009484 | 3300049537 | Bacteria | 1052 |
| 672 | Ga0501321_011536 | 3300049537 | Bacteria | 987 |
| 673 | Ga0501323_014682 | 3300049539 | Bacteria | 982 |
| 674 | Ga0501325_005801 | 3300049541 | Bacteria | 993 |
| 675 | Ga0501325_023591 | 3300049541 | Bacteria | 665 |
| 676 | Ga0501031_0012930 | 3300049568 | Bacteria | 5449 |
| 677 | Ga0501031_0014748 | 3300049568 | Bacteria | 5080 |
| 678 | Ga0501031_0108135 | 3300049568 | Bacteria | 1815 |
| 679 | Ga0501031_0172007 | 3300049568 | Bacteria | 1415 |
| 680 | Ga0501031_0191237 | 3300049568 | Bacteria | 1336 |
| 681 | Ga0501032_0002467 | 3300049569 | Bacteria | 14446 |
| 682 | Ga0501032_0016609 | 3300049569 | Bacteria | 5175 |
| 683 | Ga0501032_0083083 | 3300049569 | Bacteria | 2130 |
| 684 | Ga0501032_0137185 | 3300049569 | Bacteria | 1612 |
| 685 | Ga0501032_0145814 | 3300049569 | Bacteria | 1558 |
| 686 | Ga0501033_0038626 | 3300049570 | Bacteria | 3567 |
| 687 | Ga0501033_0232255 | 3300049570 | Bacteria | 1310 |
| 688 | Ga0501033_0324411 | 3300049570 | Bacteria | 1081 |
| 689 | Ga0501034_0002512 | 3300049571 | Bacteria | 22010 |
| 690 | Ga0501034_0003477 | 3300049571 | Bacteria | 17905 |
| 691 | Ga0501034_0019043 | 3300049571 | Bacteria | 7032 |
| 692 | Ga0501034_0050471 | 3300049571 | Bacteria | 4196 |
| 693 | Ga0501034_0064120 | 3300049571 | Bacteria | 3688 |
| 694 | Ga0501036_0036856 | 3300049572 | Bacteria | 4137 |
| 695 | Ga0501037_0001179 | 3300049573 | Bacteria | 19299 |
| 696 | Ga0501037_0271350 | 3300049573 | Bacteria | 1184 |
| 697 | Ga0501038_0015936 | 3300049574 | Bacteria | 6830 |
| 698 | Ga0501038_0021169 | 3300049574 | Bacteria | 5841 |
| 699 | Ga0501038_0061060 | 3300049574 | Bacteria | 3224 |
| 700 | Ga0501038_0080407 | 3300049574 | Bacteria | 2747 |
| 701 | Ga0501038_0089014 | 3300049574 | Bacteria | 2590 |
| 702 | Ga0501038_0174653 | 3300049574 | Bacteria | 1737 |
| 703 | Ga0501038_0483763 | 3300049574 | Bacteria | 948 |
| 704 | Ga0501038_0704007 | 3300049574 | Bacteria | 757 |
| 705 | Ga0501039_0000678 | 3300049575 | Bacteria | 24589 |
| 706 | Ga0501039_0155506 | 3300049575 | Bacteria | 1796 |
| 707 | Ga0501039_0155636 | 3300049575 | Bacteria | 1795 |
| 708 | Ga0501039_0575495 | 3300049575 | Bacteria | 883 |
| 709 | Ga0501040_0002965 | 3300049576 | Bacteria | 10987 |
| 710 | Ga0501040_0264941 | 3300049576 | Bacteria | 1226 |
| 711 | Ga0501040_0355930 | 3300049576 | Bacteria | 1049 |
| 712 | Ga0501040_0370668 | 3300049576 | Bacteria | 1027 |
| 713 | Ga0501041_0113126 | 3300049577 | Bacteria | 1684 |
| 714 | Ga0501041_0325976 | 3300049577 | Bacteria | 969 |
| 715 | Ga0501042_0119498 | 3300049578 | Bacteria | 1897 |
| 716 | Ga0501042_0121018 | 3300049578 | Bacteria | 1884 |
| 717 | Ga0501042_0184111 | 3300049578 | Bacteria | 1507 |
| 718 | Ga0501042_0754395 | 3300049578 | Bacteria | 708 |
| 719 | Ga0501042_0854212 | 3300049578 | Bacteria | 663 |
| 720 | Ga0501043_0014495 | 3300049579 | Bacteria | 6170 |
| 721 | Ga0501043_0032686 | 3300049579 | Bacteria | 4091 |
| 722 | Ga0501043_0037822 | 3300049579 | Bacteria | 3796 |
| 723 | Ga0501043_0161542 | 3300049579 | Bacteria | 1750 |
| 724 | Ga0501043_0197623 | 3300049579 | Bacteria | 1562 |
| 725 | Ga0501043_0268327 | 3300049579 | Bacteria | 1311 |
| 726 | Ga0501046_0005735 | 3300049580 | Bacteria | 11080 |
| 727 | Ga0501046_0005990 | 3300049580 | Bacteria | 10819 |
| 728 | Ga0501046_0915421 | 3300049580 | Bacteria | 611 |
| 729 | Ga0501047_0060896 | 3300049581 | Bacteria | 3641 |
| 730 | Ga0501047_0082971 | 3300049581 | Bacteria | 3081 |
| 731 | Ga0501047_0196700 | 3300049581 | Bacteria | 1878 |
| 732 | Ga0501047_0234502 | 3300049581 | Bacteria | 1687 |
| 733 | Ga0501048_0007529 | 3300049582 | Bacteria | 8251 |
| 734 | Ga0501048_0053519 | 3300049582 | Bacteria | 2870 |
| 735 | Ga0501067_0165315 | 3300049583 | Bacteria | 1232 |
| 736 | Ga0501068_0037663 | 3300049584 | Bacteria | 2895 |
| 737 | Ga0501068_0199775 | 3300049584 | Bacteria | 1268 |
| 738 | Ga0501070_0000198 | 3300049586 | Bacteria | 56232 |
| 739 | Ga0501070_0008288 | 3300049586 | Bacteria | 8785 |
| 740 | Ga0501070_0351961 | 3300049586 | Bacteria | 1195 |
| 741 | Ga0501070_0361877 | 3300049586 | Bacteria | 1177 |
| 742 | Ga0501071_0037112 | 3300049587 | Bacteria | 3478 |
| 743 | Ga0501071_0111922 | 3300049587 | Bacteria | 2018 |
| 744 | Ga0501072_0015828 | 3300049588 | Bacteria | 5783 |
| 745 | Ga0501072_0156811 | 3300049588 | Bacteria | 1815 |
| 746 | Ga0501073_0000029 | 3300049589 | Bacteria | 117147 |
| 747 | Ga0501073_0268591 | 3300049589 | Bacteria | 1177 |
| 748 | Ga0501074_0028586 | 3300049590 | Bacteria | 4041 |
| 749 | Ga0501074_0214328 | 3300049590 | Bacteria | 1371 |
| 750 | Ga0501075_0152142 | 3300049591 | Bacteria | 1763 |
| 751 | Ga0501076_0000795 | 3300049592 | Bacteria | 20413 |
| 752 | Ga0501076_0426341 | 3300049592 | Bacteria | 1091 |
| 753 | Ga0501079_0314149 | 3300049741 | Bacteria | 1226 |
| 754 | Ga0501080_0099182 | 3300049742 | Bacteria | 2703 |
| 755 | Ga0501080_0111243 | 3300049742 | Bacteria | 2539 |
| 756 | Ga0501080_0205219 | 3300049742 | Bacteria | 1808 |
| 757 | Ga0501081_0068380 | 3300049743 | Bacteria | 2473 |
| 758 | Ga0501083_0000003 | 3300049744 | Bacteria | 235949 |
| 759 | Ga0501083_0044350 | 3300049744 | Bacteria | 3010 |
| 760 | Ga0501035_0005688 | 3300049822 | Bacteria | 11765 |
| 761 | Ga0501035_0038886 | 3300049822 | Bacteria | 4307 |
| 762 | Ga0501035_0636661 | 3300049822 | Bacteria | 866 |
| 763 | Ga0501044_0001379 | 3300049823 | Bacteria | 28508 |
| 764 | Ga0501044_0025724 | 3300049823 | Bacteria | 6239 |
| 765 | Ga0501044_0036713 | 3300049823 | Bacteria | 5125 |
| 766 | Ga0501044_0395774 | 3300049823 | Bacteria | 1295 |
| 767 | Ga0501045_0071306 | 3300049824 | Bacteria | 2557 |
| 768 | Ga0501045_0106551 | 3300049824 | Bacteria | 2077 |
| 769 | Ga0501045_0130034 | 3300049824 | Bacteria | 1871 |
| 770 | nmdc:mga00v17_103909_c1 | 3300050491 | Bacteria | 1796 |
| 771 | nmdc:mga00v17_2023_c2 | 3300050491 | Bacteria | 10008 |
| 772 | nmdc:mga00v17_44017_c1 | 3300050491 | Bacteria | 2690 |
| 773 | nmdc:mga00v17_50861_c1 | 3300050491 | Bacteria | 2519 |
| 774 | nmdc:mga00v17_56106_c1 | 3300050491 | Bacteria | 2407 |
| 775 | nmdc:mga00v17_622889_c1 | 3300050491 | Bacteria | 695 |
| 776 | nmdc:mga00v17_623289_c1 | 3300050491 | Bacteria | 695 |
| 777 | nmdc:mga07m45_42585_c1 | 3300050496 | Bacteria | 2545 |
| 778 | nmdc:mga05p37_3914_c1 | 3300050507 | Bacteria | 17434 |
| 779 | nmdc:mga09592_1805_c1 | 3300050508 | Bacteria | 9814 |
| 780 | nmdc:mga0qj67_1059_c2 | 3300050509 | Bacteria | 10340 |
| 781 | nmdc:mga0qj67_206148_c1 | 3300050509 | Bacteria | 1597 |
| 782 | nmdc:mga0qj67_549494_c1 | 3300050509 | Bacteria | 926 |
| 783 | nmdc:mga06r32_1833_c2 | 3300050510 | Bacteria | 17582 |
| 784 | nmdc:mga06r32_392601_c1 | 3300050510 | Bacteria | 1370 |
| 785 | nmdc:mga0sz30_101031_c1 | 3300050516 | Bacteria | 1260 |
| 786 | nmdc:mga0sz30_184735_c1 | 3300050516 | Bacteria | 925 |
| 787 | nmdc:mga0sz30_3162_c1 | 3300050516 | Bacteria | 4539 |
| 788 | Ga0500635_0000012 | 3300053080 | Bacteria | 138781 |
| 789 | Ga0495655_0043362 | 3300053083 | Bacteria | 1159 |
| 790 | Ga0495619_0292551 | 3300053085 | Bacteria | 1128 |
| 791 | Ga0495619_0302488 | 3300053085 | Bacteria | 1108 |
| 792 | Ga0495619_0585344 | 3300053085 | Bacteria | 764 |
| 793 | Ga0500644_0005516 | 3300053088 | Bacteria | 3199 |
| 794 | Ga0500562_001128 | 3300053108 | Bacteria | 6577 |
| 795 | Ga0500559_0000194 | 3300053136 | Bacteria | 48792 |
| 796 | Ga0500559_0000264 | 3300053136 | Bacteria | 40984 |
| 797 | Ga0500559_0000565 | 3300053136 | Bacteria | 25683 |
| 798 | Ga0500559_0035365 | 3300053136 | Bacteria | 2157 |
| 799 | Ga0500568_0000064 | 3300053139 | Bacteria | 106056 |
| 800 | Ga0500568_0000534 | 3300053139 | Bacteria | 28043 |
| 801 | Ga0500568_0046973 | 3300053139 | Bacteria | 1711 |
| 802 | Ga0500573_0000017 | 3300053140 | Bacteria | 181426 |
| 803 | Ga0500573_0025610 | 3300053140 | Bacteria | 3392 |
| 804 | Ga0500604_0023186 | 3300053151 | Bacteria | 1769 |
| 805 | Ga0500616_0000553 | 3300053153 | Bacteria | 46504 |
| 806 | Ga0500616_0001343 | 3300053153 | Bacteria | 24047 |
| 807 | Ga0500616_0026369 | 3300053153 | Bacteria | 3218 |
| 808 | Ga0501084_0028089 | 3300054114 | Bacteria | 4701 |
| 809 | Ga0501084_0357771 | 3300054114 | Bacteria | 1233 |
| 810 | Ga0590075_043434 | 3300059424 | Bacteria | 1150 |
| 811 | Ga0587093_025631 | 3300059478 | Bacteria | 819 |
| 812 | Ga0587073_0153811 | 3300059492 | Bacteria | 653 |
| 813 | Ga0587090_068946 | 3300059510 | Bacteria | 687 |
| 814 | Ga0587092_030583 | 3300059512 | Bacteria | 888 |
| 815 | Ga0587094_058652 | 3300059513 | Bacteria | 669 |
| 816 | Ga0587098_045127 | 3300059604 | Bacteria | 653 |
| 817 | Ga0587106_040413 | 3300059605 | Bacteria | 789 |
| 818 | Ga0587101_006042 | 3300059623 | Bacteria | 1370 |
| 819 | Ga0587113_021139 | 3300059625 | Bacteria | 685 |
| 820 | Ga0587115_041102 | 3300059626 | Bacteria | 722 |
| 821 | Ga0587068_052078 | 3300059641 | Bacteria | 769 |
| 822 | Ga0587107_038675 | 3300059652 | Bacteria | 761 |
| 823 | Ga0587119_037768 | 3300059658 | Bacteria | 683 |
| 824 | Ga0587124_006163 | 3300059660 | Bacteria | 980 |
| 825 | Ga0587071_018327 | 3300060344 | Bacteria | 1257 |
| 826 | Ga0501082_0066814 | 3300060353 | Bacteria | 3096 |
| 827 | Ga0466962_0016187 | 3300061719 | Bacteria | 3597 |
| 828 | Ga0466962_0344707 | 3300061719 | Bacteria | 741 |
| 829 | Ga0530510_0086382 | 3300061734 | Bacteria | 2285 |
| 830 | Ga0530510_0093049 | 3300061734 | Bacteria | 2200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_10064798 | Ga0207709_100647982 | 168 |
| 2 | 3300025937 | Ga0207669_10728024 | Ga0207669_107280242 | 168 |
| 3 | 3300026121 | Ga0207683_10128007 | Ga0207683_101280072 | 168 |
| 4 | 3300030745 | Ga0316182_1275098 | Ga0316182_12750982 | 175 |
| 5 | 3300006844 | Ga0075428_100216167 | Ga0075428_1002161672 | 177 |
| 6 | 3300006846 | Ga0075430_100124552 | Ga0075430_1001245523 | 177 |
| 7 | 3300006847 | Ga0075431_100144258 | Ga0075431_1001442583 | 177 |
| 8 | 3300030734 | Ga0316179_1041824 | Ga0316179_10418243 | 177 |
| 9 | 3300031995 | Ga0307409_100204326 | Ga0307409_1002043262 | 177 |
| 10 | 3300037418 | Ga0395900_0263204 | Ga0395900_0263204_909_1472 | 177 |
| 11 | 3300037466 | Ga0395898_0073982 | Ga0395898_0073982_1731_2294 | 177 |
| 12 | 3300037471 | Ga0395905_0065536 | Ga0395905_0065536_1950_2513 | 177 |
| 13 | 3300038443 | Ga0395901_0356711 | Ga0395901_0356711_758_1321 | 177 |
| 14 | 3300041505 | Ga0451849_0029660 | Ga0451849_0029660_129_692 | 177 |
| 15 | 3300044683 | Ga0466965_0074500 | Ga0466965_0074500_456_1022 | 177 |
| 16 | 3300048912 | Ga0496109_1409733 | Ga0496109_1409733_46_609 | 177 |
| 17 | 3300048913 | Ga0496110_0485187 | Ga0496110_0485187_184_747 | 177 |
| 18 | 3300048915 | Ga0496112_0069265 | Ga0496112_0069265_1974_2537 | 177 |
| 19 | 3300049160 | Ga0501304_020910 | Ga0501304_020910_69_632 | 177 |
| 20 | 3300049533 | Ga0501317_021348 | Ga0501317_021348_73_636 | 177 |
| 21 | 3300050509 | nmdc:mga0qj67_206148_c1 | nmdc:mga0qj67_206148_c1_808_1368 | 177 |
| 22 | 3300050510 | nmdc:mga06r32_392601_c1 | nmdc:mga06r32_392601_c1_210_770 | 177 |
| 23 | 3300053083 | Ga0495655_0043362 | Ga0495655_0043362_179_742 | 177 |
| 24 | 3300059492 | Ga0587073_0153811 | Ga0587073_0153811_76_639 | 177 |
| 25 | 3300059604 | Ga0587098_045127 | Ga0587098_045127_68_631 | 177 |
| 26 | 3300059605 | Ga0587106_040413 | Ga0587106_040413_151_714 | 177 |
| 27 | 3300059623 | Ga0587101_006042 | Ga0587101_006042_242_805 | 177 |
| 28 | 3300059641 | Ga0587068_052078 | Ga0587068_052078_41_601 | 177 |
| 29 | 3300059658 | Ga0587119_037768 | Ga0587119_037768_45_608 | 177 |
| 30 | 3300060344 | Ga0587071_018327 | Ga0587071_018327_384_947 | 177 |
| 31 | 3300005356 | Ga0070674_100541932 | Ga0070674_1005419322 | 178 |
| 32 | 3300005456 | Ga0070678_100097557 | Ga0070678_1000975572 | 178 |
| 33 | 3300005547 | Ga0070693_100251022 | Ga0070693_1002510222 | 178 |
| 34 | 3300005615 | Ga0070702_100039169 | Ga0070702_1000391694 | 178 |
| 35 | 3300005718 | Ga0068866_10100878 | Ga0068866_101008782 | 178 |
| 36 | 3300009098 | Ga0105245_10499134 | Ga0105245_104991342 | 178 |
| 37 | 3300009148 | Ga0105243_10016689 | Ga0105243_100166896 | 178 |
| 38 | 3300009176 | Ga0105242_10257820 | Ga0105242_102578202 | 178 |
| 39 | 3300009551 | Ga0105238_10037839 | Ga0105238_100378393 | 178 |
| 40 | 3300013297 | Ga0157378_10031377 | Ga0157378_100313775 | 178 |
| 41 | 3300013306 | Ga0163162_10157520 | Ga0163162_101575204 | 178 |
| 42 | 3300013308 | Ga0157375_10053337 | Ga0157375_100533372 | 178 |
| 43 | 3300014326 | Ga0157380_10050189 | Ga0157380_100501895 | 178 |
| 44 | 3300025899 | Ga0207642_10244373 | Ga0207642_102443732 | 178 |
| 45 | 3300025924 | Ga0207694_10298513 | Ga0207694_102985132 | 178 |
| 46 | 3300025927 | Ga0207687_10410149 | Ga0207687_104101492 | 178 |
| 47 | 3300025949 | Ga0207667_10123116 | Ga0207667_101231163 | 178 |
| 48 | 3300025972 | Ga0207668_10041772 | Ga0207668_100417722 | 178 |
| 49 | 3300026089 | Ga0207648_10074086 | Ga0207648_100740864 | 178 |
| 50 | 3300031727 | Ga0316576_10003688 | Ga0316576_100036885 | 179 |
| 51 | 3300035398 | Ga0316574_0003174 | Ga0316574_0003174_883_1446 | 179 |
| 52 | 3300046511 | Ga0495608_0399833 | Ga0495608_0399833_88_648 | 179 |
| 53 | 3300005356 | Ga0070674_100114580 | Ga0070674_1001145802 | 180 |
| 54 | 3300005456 | Ga0070678_100331914 | Ga0070678_1003319142 | 180 |
| 55 | 3300005548 | Ga0070665_100285998 | Ga0070665_1002859983 | 180 |
| 56 | 3300005564 | Ga0070664_101206516 | Ga0070664_1012065161 | 180 |
| 57 | 3300005615 | Ga0070702_100457913 | Ga0070702_1004579132 | 180 |
| 58 | 3300009094 | Ga0111539_11473747 | Ga0111539_114737472 | 180 |
| 59 | 3300009148 | Ga0105243_10057279 | Ga0105243_100572794 | 180 |
| 60 | 3300009176 | Ga0105242_10060957 | Ga0105242_100609573 | 180 |
| 61 | 3300009177 | Ga0105248_10342412 | Ga0105248_103424122 | 180 |
| 62 | 3300009551 | Ga0105238_10076535 | Ga0105238_100765354 | 180 |
| 63 | 3300013102 | Ga0157371_10538948 | Ga0157371_105389482 | 180 |
| 64 | 3300013306 | Ga0163162_10586181 | Ga0163162_105861812 | 180 |
| 65 | 3300014326 | Ga0157380_10052971 | Ga0157380_100529713 | 180 |
| 66 | 3300020070 | Ga0206356_11624222 | Ga0206356_116242222 | 180 |
| 67 | 3300025901 | Ga0207688_10103113 | Ga0207688_101031132 | 180 |
| 68 | 3300025925 | Ga0207650_10203250 | Ga0207650_102032502 | 180 |
| 69 | 3300025926 | Ga0207659_10429085 | Ga0207659_104290852 | 180 |
| 70 | 3300025927 | Ga0207687_10567454 | Ga0207687_105674541 | 180 |
| 71 | 3300025934 | Ga0207686_10184360 | Ga0207686_101843602 | 180 |
| 72 | 3300025935 | Ga0207709_10270201 | Ga0207709_102702012 | 180 |
| 73 | 3300025937 | Ga0207669_10129934 | Ga0207669_101299342 | 180 |
| 74 | 3300025940 | Ga0207691_10146806 | Ga0207691_101468063 | 180 |
| 75 | 3300026089 | Ga0207648_10311790 | Ga0207648_103117902 | 180 |
| 76 | 3300026118 | Ga0207675_100368196 | Ga0207675_1003681962 | 180 |
| 77 | 3300026121 | Ga0207683_10069279 | Ga0207683_100692792 | 180 |
| 78 | 3300026142 | Ga0207698_10247904 | Ga0207698_102479043 | 180 |
| 79 | 3300041411 | Ga0439466_0103961 | Ga0439466_0103961_142_702 | 180 |
| 80 | 3300042007 | Ga0439449_0078161 | Ga0439449_0078161_81_641 | 180 |
| 81 | 3300046663 | Ga0495635_0087097 | Ga0495635_0087097_1289_1849 | 180 |
| 82 | 3300046681 | Ga0495647_0051851 | Ga0495647_0051851_391_951 | 180 |
| 83 | 3300048904 | Ga0496101_0647089 | Ga0496101_0647089_28_588 | 180 |
| 84 | 3300048909 | Ga0496106_0054358 | Ga0496106_0054358_379_939 | 180 |
| 85 | 3300048909 | Ga0496106_0388376 | Ga0496106_0388376_89_649 | 180 |
| 86 | 3300048911 | Ga0496108_0448302 | Ga0496108_0448302_385_945 | 180 |
| 87 | 3300048912 | Ga0496109_0277843 | Ga0496109_0277843_391_951 | 180 |
| 88 | 3300048917 | Ga0496114_0040282 | Ga0496114_0040282_2955_3515 | 180 |
| 89 | 3300048918 | Ga0496115_0414204 | Ga0496115_0414204_354_914 | 180 |
| 90 | iso_pu_bacteria | 2734482000 | 2734972130 | 180 |
| 91 | 3300025938 | Ga0207704_10516697 | Ga0207704_105166972 | 181 |
| 92 | iso_pu_bacteria | 2501939600 | 2501942775 | 181 |
| 93 | iso_pu_bacteria | 2515154088 | 2515494867 | 181 |
| 94 | iso_pu_bacteria | 2515154137 | 2515755530 | 181 |
| 95 | iso_pu_bacteria | 2515154155 | 2515851122 | 181 |
| 96 | iso_pu_bacteria | 2515154203 | 2516090169 | 181 |
| 97 | iso_pu_bacteria | 2772190715 | 2772643606 | 181 |
| 98 | iso_pu_bacteria | 2831935698 | 2831936657 | 181 |
| 99 | iso_pu_bacteria | 2832004796 | 2832008490 | 181 |
| 100 | iso_pu_bacteria | 2855670206 | 2855675226 | 181 |
| 101 | iso_pu_bacteria | 2855676851 | 2855682004 | 181 |
| 102 | iso_pu_bacteria | 2856858025 | 2856861999 | 181 |
| 103 | iso_pu_bacteria | 2857288857 | 2857292898 | 181 |
| 104 | iso_pu_bacteria | 2858848962 | 2858850057 | 181 |
| 105 | iso_pu_bacteria | 2858882152 | 2858883430 | 181 |
| 106 | iso_pu_bacteria | 2858888857 | 2858893813 | 181 |
| 107 | iso_pu_bacteria | 2858895516 | 2858899389 | 181 |
| 108 | iso_pu_bacteria | 2866065130 | 2866067608 | 181 |
| 109 | iso_pu_bacteria | 2867312974 | 2867319143 | 181 |
| 110 | iso_pu_bacteria | 2867319477 | 2867320148 | 181 |
| 111 | iso_pu_bacteria | 2867507094 | 2867508594 | 181 |
| 112 | iso_pu_bacteria | 2869048445 | 2869054810 | 181 |
| 113 | iso_pu_bacteria | 2869061728 | 2869066648 | 181 |
| 114 | iso_pu_bacteria | 2869068681 | 2869074103 | 181 |
| 115 | iso_pu_bacteria | 2880489317 | 2880492087 | 181 |
| 116 | iso_pu_bacteria | 2880495981 | 2880500211 | 181 |
| 117 | iso_pu_bacteria | 2929226422 | 2929228762 | 181 |
| 118 | iso_pu_bacteria | 2996221748 | 2996227928 | 181 |
| 119 | iso_pu_bacteria | 649633069 | 649812599 | 181 |
| 120 | iso_pu_bacteria | 8003830390 | 8003837089 | 181 |
| 121 | iso_pu_bacteria | 8003856774 | 8003857234 | 181 |
| 122 | iso_pu_bacteria | 8003870546 | 8003875670 | 181 |
| 123 | iso_pu_bacteria | 8053945823 | 8053947336 | 181 |
| 124 | iso_pu_bacteria | 8054704163 | 8054707110 | 181 |
| 125 | iso_pu_bacteria | 8054727385 | 8054731803 | 181 |
| 126 | iso_pu_bacteria | 8054734606 | 8054738359 | 181 |
| 127 | iso_pu_bacteria | 8057568493 | 8057568582 | 181 |
| 128 | iso_pu_bacteria | 2523533628 | 2524001447 | 182 |
| 129 | iso_pu_bacteria | 2537561592 | 2537898834 | 182 |
| 130 | iso_pu_bacteria | 2554235227 | 2555229927 | 182 |
| 131 | iso_pu_bacteria | 2585428094 | 2587862888 | 182 |
| 132 | iso_pu_bacteria | 2643221542 | 2643733678 | 182 |
| 133 | iso_pu_bacteria | 2643221546 | 2643752041 | 182 |
| 134 | iso_pu_bacteria | 2643221549 | 2643767825 | 182 |
| 135 | iso_pu_bacteria | 2643221553 | 2643785763 | 182 |
| 136 | iso_pu_bacteria | 2643221567 | 2643849657 | 182 |
| 137 | iso_pu_bacteria | 2643221572 | 2643875094 | 182 |
| 138 | iso_pu_bacteria | 2643221575 | 2643885549 | 182 |
| 139 | iso_pu_bacteria | 2643221576 | 2643891657 | 182 |
| 140 | iso_pu_bacteria | 2643221590 | 2643960705 | 182 |
| 141 | iso_pu_bacteria | 2643221597 | 2643995818 | 182 |
| 142 | iso_pu_bacteria | 2643221616 | 2644096191 | 182 |
| 143 | iso_pu_bacteria | 2643221619 | 2644111205 | 182 |
| 144 | iso_pu_bacteria | 2643221624 | 2644135658 | 182 |
| 145 | iso_pu_bacteria | 2643221630 | 2644170252 | 182 |
| 146 | iso_pu_bacteria | 2643221635 | 2644199247 | 182 |
| 147 | iso_pu_bacteria | 2643221649 | 2644280613 | 182 |
| 148 | iso_pu_bacteria | 2643221669 | 2644382150 | 182 |
| 149 | iso_pu_bacteria | 2643221679 | 2644445244 | 182 |
| 150 | iso_pu_bacteria | 2643221724 | 2644680175 | 182 |
| 151 | iso_pu_bacteria | 2654587600 | 2655032631 | 182 |
| 152 | iso_pu_bacteria | 2721755702 | 2723641978 | 182 |
| 153 | iso_pu_bacteria | 2728369276 | 2729904914 | 182 |
| 154 | iso_pu_bacteria | 2728369380 | 2730229625 | 182 |
| 155 | iso_pu_bacteria | 2731639228 | 2731906963 | 182 |
| 156 | iso_pu_bacteria | 2738541272 | 2738695685 | 182 |
| 157 | iso_pu_bacteria | 2738543027 | 2739326171 | 182 |
| 158 | iso_pu_bacteria | 2739367654 | 2739604989 | 182 |
| 159 | iso_pu_bacteria | 2747842429 | 2747951961 | 182 |
| 160 | iso_pu_bacteria | 2751185734 | 2753073925 | 182 |
| 161 | iso_pu_bacteria | 2758568522 | 2760308068 | 182 |
| 162 | iso_pu_bacteria | 2758568621 | 2760623310 | 182 |
| 163 | iso_pu_bacteria | 2773857759 | 2774384428 | 182 |
| 164 | iso_pu_bacteria | 2773857763 | 2774399623 | 182 |
| 165 | iso_pu_bacteria | 2784132109 | 2784472385 | 182 |
| 166 | iso_pu_bacteria | 2799112218 | 2799183976 | 182 |
| 167 | iso_pu_bacteria | 2808606365 | 2808874500 | 182 |
| 168 | iso_pu_bacteria | 2808606368 | 2808885561 | 182 |
| 169 | iso_pu_bacteria | 2808606372 | 2808901952 | 182 |
| 170 | iso_pu_bacteria | 2808606394 | 2809028196 | 182 |
| 171 | iso_pu_bacteria | 2808606447 | 2809227357 | 182 |
| 172 | iso_pu_bacteria | 2811994872 | 2812323022 | 182 |
| 173 | iso_pu_bacteria | 2811994882 | 2812375166 | 182 |
| 174 | iso_pu_bacteria | 2818991318 | 2819427907 | 182 |
| 175 | iso_pu_bacteria | 2818991462 | 2819691914 | 182 |
| 176 | iso_pu_bacteria | 2818991469 | 2819729302 | 182 |
| 177 | iso_pu_bacteria | 2821268502 | 2821269926 | 182 |
| 178 | iso_pu_bacteria | 2833709550 | 2833710860 | 182 |
| 179 | iso_pu_bacteria | 2835188231 | 2835188493 | 182 |
| 180 | iso_pu_bacteria | 2844841374 | 2844842599 | 182 |
| 181 | iso_pu_bacteria | 2844852863 | 2844855533 | 182 |
| 182 | iso_pu_bacteria | 2852632344 | 2852633265 | 182 |
| 183 | iso_pu_bacteria | 2852643534 | 2852645501 | 182 |
| 184 | iso_pu_bacteria | 2855386786 | 2855386932 | 182 |
| 185 | iso_pu_bacteria | 2857479173 | 2857480049 | 182 |
| 186 | iso_pu_bacteria | 2857481737 | 2857484643 | 182 |
| 187 | iso_pu_bacteria | 2857632687 | 2857633796 | 182 |
| 188 | iso_pu_bacteria | 2857723135 | 2857723772 | 182 |
| 189 | iso_pu_bacteria | 2857729791 | 2857732639 | 182 |
| 190 | iso_pu_bacteria | 2857733635 | 2857735707 | 182 |
| 191 | iso_pu_bacteria | 2862993130 | 2862996341 | 182 |
| 192 | iso_pu_bacteria | 2870628048 | 2870630267 | 182 |
| 193 | iso_pu_bacteria | 2870721527 | 2870725809 | 182 |
| 194 | iso_pu_bacteria | 2870801768 | 2870802381 | 182 |
| 195 | iso_pu_bacteria | 2870804320 | 2870804462 | 182 |
| 196 | iso_pu_bacteria | 2884763398 | 2884765567 | 182 |
| 197 | iso_pu_bacteria | 2887443736 | 2887446498 | 182 |
| 198 | iso_pu_bacteria | 2895660088 | 2895661221 | 182 |
| 199 | iso_pu_bacteria | 2904497146 | 2904498082 | 182 |
| 200 | iso_pu_bacteria | 2915358134 | 2915359677 | 182 |
| 201 | iso_pu_bacteria | 2919051321 | 2919055203 | 182 |
| 202 | iso_pu_bacteria | 2919055335 | 2919058283 | 182 |
| 203 | iso_pu_bacteria | 2919443155 | 2919446270 | 182 |
| 204 | iso_pu_bacteria | 2919446982 | 2919450634 | 182 |
| 205 | iso_pu_bacteria | 2919523602 | 2919524656 | 182 |
| 206 | iso_pu_bacteria | 2920879853 | 2920883793 | 182 |
| 207 | iso_pu_bacteria | 2928090899 | 2928092170 | 182 |
| 208 | iso_pu_bacteria | 2928121344 | 2928122980 | 182 |
| 209 | iso_pu_bacteria | 2928153084 | 2928156420 | 182 |
| 210 | iso_pu_bacteria | 2935409751 | 2935411329 | 182 |
| 211 | iso_pu_bacteria | 2946033335 | 2946033820 | 182 |
| 212 | iso_pu_bacteria | 2946041624 | 2946044193 | 182 |
| 213 | iso_pu_bacteria | 2964326757 | 2964329772 | 182 |
| 214 | iso_pu_bacteria | 2966921586 | 2966922834 | 182 |
| 215 | iso_pu_bacteria | 2984580707 | 2984581057 | 182 |
| 216 | iso_pu_bacteria | 2995726249 | 2995727915 | 182 |
| 217 | iso_pu_bacteria | 3001889506 | 3001891619 | 182 |
| 218 | iso_pu_bacteria | 8002811521 | 8002811879 | 182 |
| 219 | iso_pu_bacteria | 8004182704 | 8004185177 | 182 |
| 220 | iso_pu_bacteria | 8004212874 | 8004214212 | 182 |
| 221 | iso_pu_bacteria | 8046352972 | 8046352988 | 182 |
| 222 | iso_pu_bacteria | 8046352972 | 8046356495 | 182 |
| 223 | iso_pu_bacteria | 8054472261 | 8054474677 | 182 |
| 224 | iso_pu_bacteria | 8055034563 | 8055036101 | 182 |
| 225 | iso_pu_bacteria | 8055037949 | 8055038390 | 182 |
| 226 | iso_pu_bacteria | 8056579771 | 8056582228 | 182 |
| 227 | 3300005329 | Ga0070683_100008380 | Ga0070683_1000083806 | 185 |
| 228 | 3300005329 | Ga0070683_100026298 | Ga0070683_1000262986 | 185 |
| 229 | 3300005334 | Ga0068869_100353197 | Ga0068869_1003531972 | 185 |
| 230 | 3300005336 | Ga0070680_100385350 | Ga0070680_1003853501 | 185 |
| 231 | 3300005344 | Ga0070661_100006348 | Ga0070661_1000063488 | 185 |
| 232 | 3300005345 | Ga0070692_10053790 | Ga0070692_100537904 | 185 |
| 233 | 3300005436 | Ga0070713_100426104 | Ga0070713_1004261042 | 185 |
| 234 | 3300005456 | Ga0070678_100469852 | Ga0070678_1004698522 | 185 |
| 235 | 3300005530 | Ga0070679_100168603 | Ga0070679_1001686032 | 185 |
| 236 | 3300005535 | Ga0070684_100064651 | Ga0070684_1000646515 | 185 |
| 237 | 3300005564 | Ga0070664_100227321 | Ga0070664_1002273212 | 185 |
| 238 | 3300005577 | Ga0068857_100211286 | Ga0068857_1002112863 | 185 |
| 239 | 3300005983 | Ga0081540_1123311 | Ga0081540_11233111 | 185 |
| 240 | 3300006844 | Ga0075428_100115020 | Ga0075428_1001150203 | 185 |
| 241 | 3300006846 | Ga0075430_100055920 | Ga0075430_1000559202 | 185 |
| 242 | 3300006846 | Ga0075430_100114486 | Ga0075430_1001144863 | 185 |
| 243 | 3300006847 | Ga0075431_100109652 | Ga0075431_1001096525 | 185 |
| 244 | 3300006871 | Ga0075434_100675482 | Ga0075434_1006754822 | 185 |
| 245 | 3300006880 | Ga0075429_100088769 | Ga0075429_1000887694 | 185 |
| 246 | 3300009147 | Ga0114129_10004855 | Ga0114129_1000485517 | 185 |
| 247 | 3300010375 | Ga0105239_11886250 | Ga0105239_118862501 | 185 |
| 248 | 3300013104 | Ga0157370_10590283 | Ga0157370_105902832 | 185 |
| 249 | 3300013105 | Ga0157369_10020802 | Ga0157369_100208028 | 185 |
| 250 | 3300013307 | Ga0157372_10163231 | Ga0157372_101632312 | 185 |
| 251 | 3300014325 | Ga0163163_10344685 | Ga0163163_103446852 | 185 |
| 252 | 3300020069 | Ga0197907_10258756 | Ga0197907_102587563 | 185 |
| 253 | 3300020070 | Ga0206356_10717007 | Ga0206356_107170071 | 185 |
| 254 | 3300020075 | Ga0206349_1159386 | Ga0206349_11593861 | 185 |
| 255 | 3300020076 | Ga0206355_1423249 | Ga0206355_14232491 | 185 |
| 256 | 3300020078 | Ga0206352_11224977 | Ga0206352_112249771 | 185 |
| 257 | 3300020081 | Ga0206354_11686283 | Ga0206354_116862833 | 185 |
| 258 | 3300020082 | Ga0206353_10443024 | Ga0206353_104430245 | 185 |
| 259 | 3300022467 | Ga0224712_10053013 | Ga0224712_100530133 | 185 |
| 260 | 3300025909 | Ga0207705_10029292 | Ga0207705_100292922 | 185 |
| 261 | 3300025921 | Ga0207652_10141513 | Ga0207652_101415131 | 185 |
| 262 | 3300025929 | Ga0207664_10159236 | Ga0207664_101592362 | 185 |
| 263 | 3300025939 | Ga0207665_10056058 | Ga0207665_100560583 | 185 |
| 264 | 3300025944 | Ga0207661_10019379 | Ga0207661_100193792 | 185 |
| 265 | 3300025944 | Ga0207661_10045354 | Ga0207661_100453542 | 185 |
| 266 | 3300025944 | Ga0207661_10475707 | Ga0207661_104757072 | 185 |
| 267 | 3300025945 | Ga0207679_10380897 | Ga0207679_103808972 | 185 |
| 268 | 3300026078 | Ga0207702_10128137 | Ga0207702_101281372 | 185 |
| 269 | 3300026116 | Ga0207674_10010641 | Ga0207674_100106417 | 185 |
| 270 | 3300026116 | Ga0207674_10040969 | Ga0207674_100409695 | 185 |
| 271 | 3300026118 | Ga0207675_101676294 | Ga0207675_1016762941 | 185 |
| 272 | 3300026121 | Ga0207683_10407011 | Ga0207683_104070112 | 185 |
| 273 | 3300028794 | Ga0307515_10073868 | Ga0307515_100738681 | 185 |
| 274 | 3300031728 | Ga0316578_10065307 | Ga0316578_100653073 | 185 |
| 275 | 3300031824 | Ga0307413_10377778 | Ga0307413_103777782 | 185 |
| 276 | 3300031901 | Ga0307406_10188774 | Ga0307406_101887742 | 185 |
| 277 | 3300031901 | Ga0307406_10304407 | Ga0307406_103044072 | 185 |
| 278 | 3300031901 | Ga0307406_10369382 | Ga0307406_103693822 | 185 |
| 279 | 3300032126 | Ga0307415_100124925 | Ga0307415_1001249252 | 185 |
| 280 | 3300032139 | Ga0316580_10034447 | Ga0316580_100344472 | 185 |
| 281 | 3300032168 | Ga0316593_10273750 | Ga0316593_102737501 | 185 |
| 282 | 3300033524 | Ga0316592_1096410 | Ga0316592_10964101 | 185 |
| 283 | 3300033541 | Ga0316596_1033908 | Ga0316596_10339082 | 185 |
| 284 | 3300035398 | Ga0316574_0018303 | Ga0316574_0018303_1681_2244 | 185 |
| 285 | 3300036647 | Ga0316582_0101695 | Ga0316582_0101695_277_840 | 185 |
| 286 | 3300036712 | Ga0316584_0069754 | Ga0316584_0069754_1312_1875 | 185 |
| 287 | 3300037312 | Ga0395899_0025982 | Ga0395899_0025982_3513_4070 | 185 |
| 288 | 3300037418 | Ga0395900_0048256 | Ga0395900_0048256_823_1380 | 185 |
| 289 | 3300037466 | Ga0395898_0034838 | Ga0395898_0034838_803_1360 | 185 |
| 290 | 3300037471 | Ga0395905_0001103 | Ga0395905_0001103_32648_33205 | 185 |
| 291 | 3300038443 | Ga0395901_0009293 | Ga0395901_0009293_5819_6376 | 185 |
| 292 | 3300042156 | Ga0439446_0133797 | Ga0439446_0133797_209_766 | 185 |
| 293 | 3300044684 | Ga0466966_0010911 | Ga0466966_0010911_5175_5732 | 185 |
| 294 | 3300044693 | Ga0466961_0009823 | Ga0466961_0009823_105_662 | 185 |
| 295 | 3300044719 | Ga0466971_0032302 | Ga0466971_0032302_923_1480 | 185 |
| 296 | 3300044765 | Ga0466970_0134122 | Ga0466970_0134122_553_1110 | 185 |
| 297 | 3300045049 | Ga0466959_0027280 | Ga0466959_0027280_549_1106 | 185 |
| 298 | 3300047315 | Ga0495581_0444972 | Ga0495581_0444972_97_654 | 185 |
| 299 | 3300047319 | Ga0495674_0797331 | Ga0495674_0797331_147_704 | 185 |
| 300 | 3300047320 | Ga0495672_0017547 | Ga0495672_0017547_486_1043 | 185 |
| 301 | 3300047472 | Ga0495686_0380361 | Ga0495686_0380361_88_645 | 185 |
| 302 | 3300048915 | Ga0496112_0270044 | Ga0496112_0270044_848_1405 | 185 |
| 303 | 3300048929 | Ga0496126_0075480 | Ga0496126_0075480_108_665 | 185 |
| 304 | 3300049527 | Ga0501311_059086 | Ga0501311_059086_49_606 | 185 |
| 305 | 3300049569 | Ga0501032_0016609 | Ga0501032_0016609_659_1216 | 185 |
| 306 | 3300049569 | Ga0501032_0083083 | Ga0501032_0083083_1457_2014 | 185 |
| 307 | 3300049571 | Ga0501034_0050471 | Ga0501034_0050471_849_1406 | 185 |
| 308 | 3300049571 | Ga0501034_0064120 | Ga0501034_0064120_833_1390 | 185 |
| 309 | 3300049574 | Ga0501038_0061060 | Ga0501038_0061060_1647_2204 | 185 |
| 310 | 3300049574 | Ga0501038_0704007 | Ga0501038_0704007_97_654 | 185 |
| 311 | 3300049575 | Ga0501039_0575495 | Ga0501039_0575495_284_841 | 185 |
| 312 | 3300049580 | Ga0501046_0915421 | Ga0501046_0915421_44_601 | 185 |
| 313 | 3300049583 | Ga0501067_0165315 | Ga0501067_0165315_243_800 | 185 |
| 314 | 3300049586 | Ga0501070_0351961 | Ga0501070_0351961_185_742 | 185 |
| 315 | 3300049589 | Ga0501073_0000029 | Ga0501073_0000029_17842_18399 | 185 |
| 316 | 3300049742 | Ga0501080_0099182 | Ga0501080_0099182_778_1335 | 185 |
| 317 | 3300050507 | nmdc:mga05p37_3914_c1 | nmdc:mga05p37_3914_c1_703_1260 | 185 |
| 318 | 3300050508 | nmdc:mga09592_1805_c1 | nmdc:mga09592_1805_c1_845_1402 | 185 |
| 319 | 3300050509 | nmdc:mga0qj67_1059_c2 | nmdc:mga0qj67_1059_c2_976_1533 | 185 |
| 320 | 3300050509 | nmdc:mga0qj67_549494_c1 | nmdc:mga0qj67_549494_c1_149_727 | 185 |
| 321 | 3300050510 | nmdc:mga06r32_1833_c2 | nmdc:mga06r32_1833_c2_845_1402 | 185 |
| 322 | 3300053085 | Ga0495619_0302488 | Ga0495619_0302488_440_1000 | 185 |
| 323 | 3300053108 | Ga0500562_001128 | Ga0500562_001128_1193_1750 | 185 |
| 324 | 3300053139 | Ga0500568_0000064 | Ga0500568_0000064_21409_21966 | 185 |
| 325 | 3300053139 | Ga0500568_0000534 | Ga0500568_0000534_23960_24517 | 185 |
| 326 | 3300059510 | Ga0587090_068946 | Ga0587090_068946_113_670 | 185 |
| 327 | 3300059625 | Ga0587113_021139 | Ga0587113_021139_87_644 | 185 |
| 328 | 3300001989 | JGI24739J22299_10033890 | JGI24739J22299_100338902 | 186 |
| 329 | 3300001989 | JGI24739J22299_10090630 | JGI24739J22299_100906302 | 186 |
| 330 | 3300001989 | JGI24739J22299_10095805 | JGI24739J22299_100958052 | 186 |
| 331 | 3300001990 | JGI24737J22298_10040121 | JGI24737J22298_100401212 | 186 |
| 332 | 3300002067 | JGI24735J21928_10002346 | JGI24735J21928_100023462 | 186 |
| 333 | 3300002077 | JGI24744J21845_10035085 | JGI24744J21845_100350852 | 186 |
| 334 | 3300002772 | JGI25164J39214_1000271 | JGI25164J39214_100027110 | 186 |
| 335 | 3300003203 | JGI25406J46586_10016618 | JGI25406J46586_100166184 | 186 |
| 336 | 3300003203 | JGI25406J46586_10068009 | JGI25406J46586_100680091 | 186 |
| 337 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004569 | 186 |
| 338 | 3300003578 | Ga0006562J51391_1083570 | Ga0006562J51391_10835705 | 186 |
| 339 | 3300003752 | Ga0055539_1000008 | Ga0055539_1000008137 | 186 |
| 340 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001934 | 186 |
| 341 | 3300003759 | Ga0055525_1000840 | Ga0055525_10008409 | 186 |
| 342 | 3300003759 | Ga0055525_1002311 | Ga0055525_10023113 | 186 |
| 343 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001402 | 186 |
| 344 | 3300003763 | Ga0055529_1000018 | Ga0055529_100001894 | 186 |
| 345 | 3300003841 | Ga0055541_1002301 | Ga0055541_10023012 | 186 |
| 346 | 3300004798 | Ga0058859_11831639 | Ga0058859_118316391 | 186 |
| 347 | 3300004799 | Ga0058863_11873486 | Ga0058863_118734861 | 186 |
| 348 | 3300004800 | Ga0058861_10008255 | Ga0058861_100082551 | 186 |
| 349 | 3300004801 | Ga0058860_10023170 | Ga0058860_100231701 | 186 |
| 350 | 3300005288 | Ga0065714_10079860 | Ga0065714_100798602 | 186 |
| 351 | 3300005329 | Ga0070683_100730310 | Ga0070683_1007303101 | 186 |
| 352 | 3300005333 | Ga0070677_10317834 | Ga0070677_103178342 | 186 |
| 353 | 3300005337 | Ga0070682_100821590 | Ga0070682_1008215901 | 186 |
| 354 | 3300005366 | Ga0070659_100381787 | Ga0070659_1003817872 | 186 |
| 355 | 3300005435 | Ga0070714_100000039 | Ga0070714_10000003999 | 186 |
| 356 | 3300005436 | Ga0070713_100063477 | Ga0070713_1000634772 | 186 |
| 357 | 3300005437 | Ga0070710_10607510 | Ga0070710_106075101 | 186 |
| 358 | 3300005437 | Ga0070710_10650797 | Ga0070710_106507971 | 186 |
| 359 | 3300005456 | Ga0070678_100460285 | Ga0070678_1004602852 | 186 |
| 360 | 3300005530 | Ga0070679_100105114 | Ga0070679_1001051142 | 186 |
| 361 | 3300005530 | Ga0070679_100662200 | Ga0070679_1006622002 | 186 |
| 362 | 3300005535 | Ga0070684_100992801 | Ga0070684_1009928011 | 186 |
| 363 | 3300005546 | Ga0070696_100222559 | Ga0070696_1002225592 | 186 |
| 364 | 3300005547 | Ga0070693_100200871 | Ga0070693_1002008712 | 186 |
| 365 | 3300005577 | Ga0068857_100070797 | Ga0068857_1000707973 | 186 |
| 366 | 3300005577 | Ga0068857_100381996 | Ga0068857_1003819962 | 186 |
| 367 | 3300005577 | Ga0068857_100627881 | Ga0068857_1006278812 | 186 |
| 368 | 3300005614 | Ga0068856_100731411 | Ga0068856_1007314112 | 186 |
| 369 | 3300005616 | Ga0068852_100660166 | Ga0068852_1006601662 | 186 |
| 370 | 3300005719 | Ga0068861_100062449 | Ga0068861_1000624493 | 186 |
| 371 | 3300005719 | Ga0068861_100530824 | Ga0068861_1005308241 | 186 |
| 372 | 3300005834 | Ga0068851_10322449 | Ga0068851_103224492 | 186 |
| 373 | 3300005840 | Ga0068870_10181743 | Ga0068870_101817432 | 186 |
| 374 | 3300005841 | Ga0068863_100180238 | Ga0068863_1001802383 | 186 |
| 375 | 3300005844 | Ga0068862_100545124 | Ga0068862_1005451242 | 186 |
| 376 | 3300005983 | Ga0081540_1008923 | Ga0081540_10089236 | 186 |
| 377 | 3300005985 | Ga0081539_10000352 | Ga0081539_1000035274 | 186 |
| 378 | 3300005985 | Ga0081539_10007039 | Ga0081539_100070392 | 186 |
| 379 | 3300005985 | Ga0081539_10032371 | Ga0081539_100323715 | 186 |
| 380 | 3300005985 | Ga0081539_10286784 | Ga0081539_102867841 | 186 |
| 381 | 3300006028 | Ga0070717_10088157 | Ga0070717_100881574 | 186 |
| 382 | 3300006038 | Ga0075365_10112988 | Ga0075365_101129882 | 186 |
| 383 | 3300006051 | Ga0075364_10025537 | Ga0075364_100255373 | 186 |
| 384 | 3300006051 | Ga0075364_10026800 | Ga0075364_100268002 | 186 |
| 385 | 3300006051 | Ga0075364_10057541 | Ga0075364_100575413 | 186 |
| 386 | 3300006051 | Ga0075364_10080926 | Ga0075364_100809262 | 186 |
| 387 | 3300006051 | Ga0075364_10139526 | Ga0075364_101395263 | 186 |
| 388 | 3300006051 | Ga0075364_10215791 | Ga0075364_102157912 | 186 |
| 389 | 3300006175 | Ga0070712_100533463 | Ga0070712_1005334632 | 186 |
| 390 | 3300006186 | Ga0075369_10101076 | Ga0075369_101010762 | 186 |
| 391 | 3300009036 | Ga0105244_10041918 | Ga0105244_100419182 | 186 |
| 392 | 3300009036 | Ga0105244_10047386 | Ga0105244_100473863 | 186 |
| 393 | 3300009093 | Ga0105240_10369905 | Ga0105240_103699052 | 186 |
| 394 | 3300009098 | Ga0105245_10389792 | Ga0105245_103897922 | 186 |
| 395 | 3300009148 | Ga0105243_10060196 | Ga0105243_100601962 | 186 |
| 396 | 3300009148 | Ga0105243_10185209 | Ga0105243_101852092 | 186 |
| 397 | 3300009177 | Ga0105248_10787119 | Ga0105248_107871192 | 186 |
| 398 | 3300009551 | Ga0105238_10271205 | Ga0105238_102712052 | 186 |
| 399 | 3300009553 | Ga0105249_10177166 | Ga0105249_101771663 | 186 |
| 400 | 3300009553 | Ga0105249_11307442 | Ga0105249_113074421 | 186 |
| 401 | 3300010375 | Ga0105239_11107970 | Ga0105239_111079701 | 186 |
| 402 | 3300011119 | Ga0105246_10128132 | Ga0105246_101281323 | 186 |
| 403 | 3300011119 | Ga0105246_10991788 | Ga0105246_109917881 | 186 |
| 404 | 3300012497 | Ga0157319_1005725 | Ga0157319_10057251 | 186 |
| 405 | 3300013102 | Ga0157371_10002721 | Ga0157371_100027215 | 186 |
| 406 | 3300013102 | Ga0157371_10256141 | Ga0157371_102561412 | 186 |
| 407 | 3300013104 | Ga0157370_10056690 | Ga0157370_100566902 | 186 |
| 408 | 3300013104 | Ga0157370_10132584 | Ga0157370_101325842 | 186 |
| 409 | 3300013104 | Ga0157370_10453141 | Ga0157370_104531412 | 186 |
| 410 | 3300013105 | Ga0157369_10018556 | Ga0157369_100185564 | 186 |
| 411 | 3300013105 | Ga0157369_10080708 | Ga0157369_100807082 | 186 |
| 412 | 3300013105 | Ga0157369_10265963 | Ga0157369_102659632 | 186 |
| 413 | 3300013105 | Ga0157369_10404765 | Ga0157369_104047653 | 186 |
| 414 | 3300013306 | Ga0163162_10175534 | Ga0163162_101755345 | 186 |
| 415 | 3300013306 | Ga0163162_10634250 | Ga0163162_106342502 | 186 |
| 416 | 3300013306 | Ga0163162_10828628 | Ga0163162_108286282 | 186 |
| 417 | 3300013307 | Ga0157372_10039598 | Ga0157372_100395983 | 186 |
| 418 | 3300013307 | Ga0157372_10080461 | Ga0157372_100804615 | 186 |
| 419 | 3300013307 | Ga0157372_10281506 | Ga0157372_102815062 | 186 |
| 420 | 3300013308 | Ga0157375_10095249 | Ga0157375_100952491 | 186 |
| 421 | 3300013308 | Ga0157375_10720030 | Ga0157375_107200302 | 186 |
| 422 | 3300013308 | Ga0157375_10891900 | Ga0157375_108919002 | 186 |
| 423 | 3300014326 | Ga0157380_10935208 | Ga0157380_109352082 | 186 |
| 424 | 3300014969 | Ga0157376_10408152 | Ga0157376_104081521 | 186 |
| 425 | 3300017792 | Ga0163161_10080822 | Ga0163161_100808222 | 186 |
| 426 | 3300020069 | Ga0197907_10125867 | Ga0197907_101258671 | 186 |
| 427 | 3300020069 | Ga0197907_10190572 | Ga0197907_101905721 | 186 |
| 428 | 3300020069 | Ga0197907_10761571 | Ga0197907_107615711 | 186 |
| 429 | 3300020069 | Ga0197907_10932477 | Ga0197907_109324772 | 186 |
| 430 | 3300020069 | Ga0197907_11256546 | Ga0197907_112565461 | 186 |
| 431 | 3300020069 | Ga0197907_11383208 | Ga0197907_113832081 | 186 |
| 432 | 3300020070 | Ga0206356_10019973 | Ga0206356_100199731 | 186 |
| 433 | 3300020070 | Ga0206356_10203588 | Ga0206356_102035882 | 186 |
| 434 | 3300020070 | Ga0206356_10500775 | Ga0206356_105007751 | 186 |
| 435 | 3300020070 | Ga0206356_11739052 | Ga0206356_117390522 | 186 |
| 436 | 3300020075 | Ga0206349_1368267 | Ga0206349_13682672 | 186 |
| 437 | 3300020075 | Ga0206349_1972671 | Ga0206349_19726711 | 186 |
| 438 | 3300020076 | Ga0206355_1412026 | Ga0206355_14120261 | 186 |
| 439 | 3300020076 | Ga0206355_1611973 | Ga0206355_16119731 | 186 |
| 440 | 3300020077 | Ga0206351_10720129 | Ga0206351_107201292 | 186 |
| 441 | 3300020077 | Ga0206351_10888382 | Ga0206351_108883821 | 186 |
| 442 | 3300020078 | Ga0206352_10057062 | Ga0206352_100570621 | 186 |
| 443 | 3300020078 | Ga0206352_10058262 | Ga0206352_100582622 | 186 |
| 444 | 3300020080 | Ga0206350_11332409 | Ga0206350_113324092 | 186 |
| 445 | 3300020081 | Ga0206354_10434866 | Ga0206354_104348662 | 186 |
| 446 | 3300020081 | Ga0206354_10484737 | Ga0206354_104847371 | 186 |
| 447 | 3300020081 | Ga0206354_10698463 | Ga0206354_106984632 | 186 |
| 448 | 3300020081 | Ga0206354_10956684 | Ga0206354_109566842 | 186 |
| 449 | 3300020081 | Ga0206354_11270526 | Ga0206354_112705263 | 186 |
| 450 | 3300020081 | Ga0206354_11591078 | Ga0206354_115910783 | 186 |
| 451 | 3300020082 | Ga0206353_10147464 | Ga0206353_101474641 | 186 |
| 452 | 3300020082 | Ga0206353_10432556 | Ga0206353_104325562 | 186 |
| 453 | 3300020082 | Ga0206353_10470645 | Ga0206353_104706453 | 186 |
| 454 | 3300020082 | Ga0206353_10933407 | Ga0206353_109334072 | 186 |
| 455 | 3300020082 | Ga0206353_11447911 | Ga0206353_114479112 | 186 |
| 456 | 3300020610 | Ga0154015_1016208 | Ga0154015_10162083 | 186 |
| 457 | 3300020610 | Ga0154015_1212596 | Ga0154015_12125961 | 186 |
| 458 | 3300020610 | Ga0154015_1565778 | Ga0154015_15657781 | 186 |
| 459 | 3300022467 | Ga0224712_10059957 | Ga0224712_100599572 | 186 |
| 460 | 3300022467 | Ga0224712_10088721 | Ga0224712_100887212 | 186 |
| 461 | 3300022467 | Ga0224712_10121937 | Ga0224712_101219371 | 186 |
| 462 | 3300025225 | Ga0209566_100050 | Ga0209566_10005054 | 186 |
| 463 | 3300025226 | Ga0209674_100001 | Ga0209674_100001934 | 186 |
| 464 | 3300025228 | Ga0209672_100006 | Ga0209672_100006574 | 186 |
| 465 | 3300025229 | Ga0209147_100486 | Ga0209147_10048621 | 186 |
| 466 | 3300025230 | Ga0209563_100001 | Ga0209563_100001934 | 186 |
| 467 | 3300025230 | Ga0209563_100219 | Ga0209563_10021916 | 186 |
| 468 | 3300025231 | Ga0207427_100010 | Ga0207427_10001013 | 186 |
| 469 | 3300025233 | Ga0209437_100989 | Ga0209437_1009896 | 186 |
| 470 | 3300025242 | Ga0209258_101984 | Ga0209258_1019848 | 186 |
| 471 | 3300025246 | Ga0209646_1000099 | Ga0209646_100009939 | 186 |
| 472 | 3300025253 | Ga0209677_100001 | Ga0209677_100001934 | 186 |
| 473 | 3300025253 | Ga0209677_100187 | Ga0209677_10018750 | 186 |
| 474 | 3300025254 | Ga0209148_1000015 | Ga0209148_1000015418 | 186 |
| 475 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011937 | 186 |
| 476 | 3300025261 | Ga0209233_1022852 | Ga0209233_10228522 | 186 |
| 477 | 3300025272 | Ga0209455_1000013 | Ga0209455_1000013418 | 186 |
| 478 | 3300025728 | Ga0207655_1113449 | Ga0207655_11134492 | 186 |
| 479 | 3300025898 | Ga0207692_10470526 | Ga0207692_104705261 | 186 |
| 480 | 3300025901 | Ga0207688_10207532 | Ga0207688_102075322 | 186 |
| 481 | 3300025901 | Ga0207688_10226292 | Ga0207688_102262922 | 186 |
| 482 | 3300025904 | Ga0207647_10026839 | Ga0207647_100268395 | 186 |
| 483 | 3300025904 | Ga0207647_10042282 | Ga0207647_100422824 | 186 |
| 484 | 3300025904 | Ga0207647_10282682 | Ga0207647_102826821 | 186 |
| 485 | 3300025908 | Ga0207643_10175739 | Ga0207643_101757392 | 186 |
| 486 | 3300025912 | Ga0207707_10430438 | Ga0207707_104304382 | 186 |
| 487 | 3300025913 | Ga0207695_10258711 | Ga0207695_102587112 | 186 |
| 488 | 3300025914 | Ga0207671_10506111 | Ga0207671_105061111 | 186 |
| 489 | 3300025917 | Ga0207660_11086500 | Ga0207660_110865001 | 186 |
| 490 | 3300025919 | Ga0207657_10196090 | Ga0207657_101960902 | 186 |
| 491 | 3300025921 | Ga0207652_10298432 | Ga0207652_102984321 | 186 |
| 492 | 3300025924 | Ga0207694_10909643 | Ga0207694_109096431 | 186 |
| 493 | 3300025926 | Ga0207659_10104232 | Ga0207659_101042323 | 186 |
| 494 | 3300025928 | Ga0207700_10299165 | Ga0207700_102991652 | 186 |
| 495 | 3300025929 | Ga0207664_10001112 | Ga0207664_1000111218 | 186 |
| 496 | 3300025929 | Ga0207664_10030114 | Ga0207664_100301143 | 186 |
| 497 | 3300025935 | Ga0207709_10046435 | Ga0207709_100464352 | 186 |
| 498 | 3300025935 | Ga0207709_10113781 | Ga0207709_101137813 | 186 |
| 499 | 3300025935 | Ga0207709_10115069 | Ga0207709_101150692 | 186 |
| 500 | 3300025939 | Ga0207665_10664016 | Ga0207665_106640162 | 186 |
| 501 | 3300025942 | Ga0207689_10019688 | Ga0207689_100196888 | 186 |
| 502 | 3300025942 | Ga0207689_10056449 | Ga0207689_100564494 | 186 |
| 503 | 3300025961 | Ga0207712_10446151 | Ga0207712_104461512 | 186 |
| 504 | 3300025972 | Ga0207668_10248899 | Ga0207668_102488992 | 186 |
| 505 | 3300026041 | Ga0207639_10903985 | Ga0207639_109039852 | 186 |
| 506 | 3300026041 | Ga0207639_11109793 | Ga0207639_111097931 | 186 |
| 507 | 3300026067 | Ga0207678_10224375 | Ga0207678_102243751 | 186 |
| 508 | 3300026078 | Ga0207702_10280248 | Ga0207702_102802482 | 186 |
| 509 | 3300026078 | Ga0207702_10466897 | Ga0207702_104668972 | 186 |
| 510 | 3300026089 | Ga0207648_10463244 | Ga0207648_104632442 | 186 |
| 511 | 3300026116 | Ga0207674_10019369 | Ga0207674_100193698 | 186 |
| 512 | 3300026116 | Ga0207674_10671918 | Ga0207674_106719182 | 186 |
| 513 | 3300026118 | Ga0207675_100102916 | Ga0207675_1001029162 | 186 |
| 514 | 3300026121 | Ga0207683_10467654 | Ga0207683_104676542 | 186 |
| 515 | 3300026121 | Ga0207683_10941221 | Ga0207683_109412211 | 186 |
| 516 | 3300028573 | Ga0265334_10006588 | Ga0265334_100065885 | 186 |
| 517 | 3300028794 | Ga0307515_10068581 | Ga0307515_100685817 | 186 |
| 518 | 3300028794 | Ga0307515_10227573 | Ga0307515_102275731 | 186 |
| 519 | 3300028794 | Ga0307515_10285124 | Ga0307515_102851243 | 186 |
| 520 | 3300028794 | Ga0307515_10531742 | Ga0307515_105317421 | 186 |
| 521 | 3300030745 | Ga0316182_1203598 | Ga0316182_12035982 | 186 |
| 522 | 3300031247 | Ga0265340_10192404 | Ga0265340_101924041 | 186 |
| 523 | 3300031456 | Ga0307513_10000970 | Ga0307513_1000097034 | 186 |
| 524 | 3300031548 | Ga0307408_100707839 | Ga0307408_1007078392 | 186 |
| 525 | 3300031665 | Ga0316575_10005797 | Ga0316575_100057978 | 186 |
| 526 | 3300031691 | Ga0316579_10001539 | Ga0316579_100015396 | 186 |
| 527 | 3300031691 | Ga0316579_10005432 | Ga0316579_100054329 | 186 |
| 528 | 3300031727 | Ga0316576_10010721 | Ga0316576_100107219 | 186 |
| 529 | 3300031727 | Ga0316576_10061212 | Ga0316576_100612127 | 186 |
| 530 | 3300031728 | Ga0316578_10052248 | Ga0316578_100522481 | 186 |
| 531 | 3300031728 | Ga0316578_10067718 | Ga0316578_100677181 | 186 |
| 532 | 3300031731 | Ga0307405_10895140 | Ga0307405_108951402 | 186 |
| 533 | 3300031733 | Ga0316577_10072570 | Ga0316577_100725701 | 186 |
| 534 | 3300031824 | Ga0307413_10826002 | Ga0307413_108260022 | 186 |
| 535 | 3300031852 | Ga0307410_10025624 | Ga0307410_100256245 | 186 |
| 536 | 3300031852 | Ga0307410_10199382 | Ga0307410_101993822 | 186 |
| 537 | 3300031901 | Ga0307406_10000108 | Ga0307406_1000010818 | 186 |
| 538 | 3300031901 | Ga0307406_10061840 | Ga0307406_100618403 | 186 |
| 539 | 3300031901 | Ga0307406_10098155 | Ga0307406_100981553 | 186 |
| 540 | 3300031903 | Ga0307407_10045016 | Ga0307407_100450162 | 186 |
| 541 | 3300031903 | Ga0307407_10716056 | Ga0307407_107160561 | 186 |
| 542 | 3300031911 | Ga0307412_10050146 | Ga0307412_100501463 | 186 |
| 543 | 3300031911 | Ga0307412_10053288 | Ga0307412_100532882 | 186 |
| 544 | 3300031911 | Ga0307412_10173446 | Ga0307412_101734462 | 186 |
| 545 | 3300031995 | Ga0307409_100064464 | Ga0307409_1000644643 | 186 |
| 546 | 3300031995 | Ga0307409_100092517 | Ga0307409_1000925174 | 186 |
| 547 | 3300032002 | Ga0307416_100094182 | Ga0307416_1000941824 | 186 |
| 548 | 3300032002 | Ga0307416_100137994 | Ga0307416_1001379943 | 186 |
| 549 | 3300032002 | Ga0307416_100385623 | Ga0307416_1003856233 | 186 |
| 550 | 3300032004 | Ga0307414_10135400 | Ga0307414_101354002 | 186 |
| 551 | 3300032004 | Ga0307414_11034602 | Ga0307414_110346021 | 186 |
| 552 | 3300032005 | Ga0307411_10446978 | Ga0307411_104469782 | 186 |
| 553 | 3300032126 | Ga0307415_100025820 | Ga0307415_1000258203 | 186 |
| 554 | 3300032126 | Ga0307415_100452608 | Ga0307415_1004526082 | 186 |
| 555 | 3300032126 | Ga0307415_100663420 | Ga0307415_1006634202 | 186 |
| 556 | 3300032137 | Ga0316585_10013947 | Ga0316585_100139472 | 186 |
| 557 | 3300032139 | Ga0316580_10017414 | Ga0316580_100174144 | 186 |
| 558 | 3300032168 | Ga0316593_10043125 | Ga0316593_100431254 | 186 |
| 559 | 3300033524 | Ga0316592_1057024 | Ga0316592_10570242 | 186 |
| 560 | 3300033528 | Ga0316588_1070652 | Ga0316588_10706522 | 186 |
| 561 | 3300033541 | Ga0316596_1019662 | Ga0316596_10196625 | 186 |
| 562 | 3300035121 | Ga0373960_0142831 | Ga0373960_0142831_94_654 | 186 |
| 563 | 3300035398 | Ga0316574_0006251 | Ga0316574_0006251_1262_1822 | 186 |
| 564 | 3300035398 | Ga0316574_0077584 | Ga0316574_0077584_432_992 | 186 |
| 565 | 3300035691 | Ga0373931_0462877 | Ga0373931_0462877_172_732 | 186 |
| 566 | 3300036401 | Ga0373937_1225718 | Ga0373937_1225718_105_668 | 186 |
| 567 | 3300036647 | Ga0316582_0001733 | Ga0316582_0001733_6399_6959 | 186 |
| 568 | 3300036647 | Ga0316582_0049547 | Ga0316582_0049547_561_1121 | 186 |
| 569 | 3300036647 | Ga0316582_0672790 | Ga0316582_0672790_36_677 | 186 |
| 570 | 3300036712 | Ga0316584_0110376 | Ga0316584_0110376_195_755 | 186 |
| 571 | 3300036712 | Ga0316584_0169758 | Ga0316584_0169758_356_916 | 186 |
| 572 | 3300036712 | Ga0316584_0606809 | Ga0316584_0606809_122_682 | 186 |
| 573 | 3300037312 | Ga0395899_0001589 | Ga0395899_0001589_4569_5132 | 186 |
| 574 | 3300037312 | Ga0395899_0008073 | Ga0395899_0008073_3842_4498 | 186 |
| 575 | 3300037312 | Ga0395899_0016290 | Ga0395899_0016290_2550_3173 | 186 |
| 576 | 3300037312 | Ga0395899_0101263 | Ga0395899_0101263_1392_1955 | 186 |
| 577 | 3300037418 | Ga0395900_0024033 | Ga0395900_0024033_3904_4470 | 186 |
| 578 | 3300037418 | Ga0395900_0053242 | Ga0395900_0053242_408_1031 | 186 |
| 579 | 3300037418 | Ga0395900_0055561 | Ga0395900_0055561_1454_2017 | 186 |
| 580 | 3300037418 | Ga0395900_0127183 | Ga0395900_0127183_298_858 | 186 |
| 581 | 3300037418 | Ga0395900_0140387 | Ga0395900_0140387_1193_1756 | 186 |
| 582 | 3300037418 | Ga0395900_0142025 | Ga0395900_0142025_1700_2356 | 186 |
| 583 | 3300037418 | Ga0395900_0181777 | Ga0395900_0181777_511_1071 | 186 |
| 584 | 3300037418 | Ga0395900_0618887 | Ga0395900_0618887_169_729 | 186 |
| 585 | 3300037418 | Ga0395900_0630041 | Ga0395900_0630041_118_678 | 186 |
| 586 | 3300037466 | Ga0395898_0000131 | Ga0395898_0000131_187465_188088 | 186 |
| 587 | 3300037466 | Ga0395898_0007362 | Ga0395898_0007362_7627_8190 | 186 |
| 588 | 3300037466 | Ga0395898_0014196 | Ga0395898_0014196_4813_5373 | 186 |
| 589 | 3300037466 | Ga0395898_0032980 | Ga0395898_0032980_4176_4739 | 186 |
| 590 | 3300037466 | Ga0395898_0126923 | Ga0395898_0126923_1703_2359 | 186 |
| 591 | 3300037471 | Ga0395905_0112062 | Ga0395905_0112062_1552_2115 | 186 |
| 592 | 3300037588 | Ga0316581_0035049 | Ga0316581_0035049_712_1272 | 186 |
| 593 | 3300038443 | Ga0395901_0013369 | Ga0395901_0013369_2771_3331 | 186 |
| 594 | 3300038443 | Ga0395901_0018977 | Ga0395901_0018977_2650_3210 | 186 |
| 595 | 3300038443 | Ga0395901_0048147 | Ga0395901_0048147_3200_3763 | 186 |
| 596 | 3300038443 | Ga0395901_0104376 | Ga0395901_0104376_675_1241 | 186 |
| 597 | 3300038443 | Ga0395901_0118903 | Ga0395901_0118903_1705_2268 | 186 |
| 598 | 3300038443 | Ga0395901_0174201 | Ga0395901_0174201_56_616 | 186 |
| 599 | 3300038443 | Ga0395901_0189786 | Ga0395901_0189786_377_937 | 186 |
| 600 | 3300038443 | Ga0395901_0282214 | Ga0395901_0282214_672_1232 | 186 |
| 601 | 3300038735 | Ga0400485_01906 | Ga0400485_01906_30334_30897 | 186 |
| 602 | 3300038741 | Ga0400488_21867 | Ga0400488_21867_3467_4030 | 186 |
| 603 | 3300038742 | Ga0400486_20001 | Ga0400486_20001_91006_91569 | 186 |
| 604 | 3300039450 | Ga0436363_0475003 | Ga0436363_0475003_1275_1838 | 186 |
| 605 | 3300039453 | Ga0436362_0058353 | Ga0436362_0058353_95_655 | 186 |
| 606 | 3300041451 | Ga0451791_0360065 | Ga0451791_0360065_321_884 | 186 |
| 607 | 3300041451 | Ga0451791_1525161 | Ga0451791_1525161_203_763 | 186 |
| 608 | 3300041452 | Ga0451793_1114004 | Ga0451793_1114004_57_617 | 186 |
| 609 | 3300041456 | Ga0451795_0152704 | Ga0451795_0152704_333_893 | 186 |
| 610 | 3300041458 | Ga0451798_0543836 | Ga0451798_0543836_390_950 | 186 |
| 611 | 3300041459 | Ga0451800_0549017 | Ga0451800_0549017_18_578 | 186 |
| 612 | 3300041460 | Ga0451802_0181093 | Ga0451802_0181093_179_739 | 186 |
| 613 | 3300041463 | Ga0451804_0464391 | Ga0451804_0464391_255_818 | 186 |
| 614 | 3300041486 | Ga0451807_0200845 | Ga0451807_0200845_259_819 | 186 |
| 615 | 3300041486 | Ga0451807_1080106 | Ga0451807_1080106_277_840 | 186 |
| 616 | 3300041492 | Ga0451835_0268814 | Ga0451835_0268814_98_658 | 186 |
| 617 | 3300041494 | Ga0451837_1272064 | Ga0451837_1272064_1423_1983 | 186 |
| 618 | 3300041494 | Ga0451837_1312361 | Ga0451837_1312361_32_595 | 186 |
| 619 | 3300041507 | Ga0451851_0154827 | Ga0451851_0154827_1287_1847 | 186 |
| 620 | 3300041511 | Ga0451855_1012064 | Ga0451855_1012064_144_704 | 186 |
| 621 | 3300041512 | Ga0451853_0604592 | Ga0451853_0604592_433_993 | 186 |
| 622 | 3300041512 | Ga0451853_0817060 | Ga0451853_0817060_45_605 | 186 |
| 623 | 3300041997 | Ga0439431_0044622 | Ga0439431_0044622_195_758 | 186 |
| 624 | 3300042007 | Ga0439449_0124342 | Ga0439449_0124342_50_610 | 186 |
| 625 | 3300042531 | Ga0450918_039104 | Ga0450918_039104_132_692 | 186 |
| 626 | 3300044656 | Ga0466969_0247626 | Ga0466969_0247626_185_748 | 186 |
| 627 | 3300044658 | Ga0466972_0024228 | Ga0466972_0024228_1271_1897 | 186 |
| 628 | 3300044658 | Ga0466972_0068242 | Ga0466972_0068242_400_963 | 186 |
| 629 | 3300044658 | Ga0466972_0275783 | Ga0466972_0275783_26_589 | 186 |
| 630 | 3300044683 | Ga0466965_0005741 | Ga0466965_0005741_1673_2233 | 186 |
| 631 | 3300044683 | Ga0466965_0048316 | Ga0466965_0048316_999_1562 | 186 |
| 632 | 3300044683 | Ga0466965_0053104 | Ga0466965_0053104_957_1520 | 186 |
| 633 | 3300044683 | Ga0466965_0177056 | Ga0466965_0177056_142_705 | 186 |
| 634 | 3300044683 | Ga0466965_0519297 | Ga0466965_0519297_39_599 | 186 |
| 635 | 3300044693 | Ga0466961_0038827 | Ga0466961_0038827_2179_2835 | 186 |
| 636 | 3300044694 | Ga0466963_0016854 | Ga0466963_0016854_1851_2414 | 186 |
| 637 | 3300044694 | Ga0466963_0137935 | Ga0466963_0137935_1106_1669 | 186 |
| 638 | 3300044694 | Ga0466963_0140704 | Ga0466963_0140704_121_723 | 186 |
| 639 | 3300044706 | Ga0466964_0229806 | Ga0466964_0229806_118_720 | 186 |
| 640 | 3300044719 | Ga0466971_0064402 | Ga0466971_0064402_645_1301 | 186 |
| 641 | 3300044719 | Ga0466971_0121344 | Ga0466971_0121344_501_1061 | 186 |
| 642 | 3300044735 | Ga0466968_0070487 | Ga0466968_0070487_239_802 | 186 |
| 643 | 3300044735 | Ga0466968_0217778 | Ga0466968_0217778_215_775 | 186 |
| 644 | 3300044765 | Ga0466970_0012124 | Ga0466970_0012124_1300_1863 | 186 |
| 645 | 3300044765 | Ga0466970_0117860 | Ga0466970_0117860_668_1336 | 186 |
| 646 | 3300044765 | Ga0466970_0141194 | Ga0466970_0141194_367_927 | 186 |
| 647 | 3300044765 | Ga0466970_0315851 | Ga0466970_0315851_15_578 | 186 |
| 648 | 3300044842 | Ga0466957_0089707 | Ga0466957_0089707_692_1255 | 186 |
| 649 | 3300044842 | Ga0466957_0106008 | Ga0466957_0106008_246_809 | 186 |
| 650 | 3300044842 | Ga0466957_0132765 | Ga0466957_0132765_253_813 | 186 |
| 651 | 3300044842 | Ga0466957_0168313 | Ga0466957_0168313_799_1362 | 186 |
| 652 | 3300044901 | Ga0466960_0003363 | Ga0466960_0003363_3881_4441 | 186 |
| 653 | 3300044901 | Ga0466960_0011156 | Ga0466960_0011156_1283_1846 | 186 |
| 654 | 3300044901 | Ga0466960_0073372 | Ga0466960_0073372_543_1103 | 186 |
| 655 | 3300044901 | Ga0466960_0086332 | Ga0466960_0086332_74_634 | 186 |
| 656 | 3300044901 | Ga0466960_0180965 | Ga0466960_0180965_184_747 | 186 |
| 657 | 3300044901 | Ga0466960_0405015 | Ga0466960_0405015_163_723 | 186 |
| 658 | 3300045049 | Ga0466959_0076146 | Ga0466959_0076146_1588_2151 | 186 |
| 659 | 3300045049 | Ga0466959_0119059 | Ga0466959_0119059_1017_1577 | 186 |
| 660 | 3300045836 | Ga0466958_0065933 | Ga0466958_0065933_803_1366 | 186 |
| 661 | 3300045836 | Ga0466958_0346350 | Ga0466958_0346350_312_872 | 186 |
| 662 | 3300045836 | Ga0466958_0423770 | Ga0466958_0423770_254_817 | 186 |
| 663 | 3300045976 | Ga0466967_0005856 | Ga0466967_0005856_1677_2240 | 186 |
| 664 | 3300045976 | Ga0466967_0101057 | Ga0466967_0101057_1231_1794 | 186 |
| 665 | 3300045976 | Ga0466967_0249316 | Ga0466967_0249316_504_1067 | 186 |
| 666 | 3300045976 | Ga0466967_0270336 | Ga0466967_0270336_241_801 | 186 |
| 667 | 3300045976 | Ga0466967_0678802 | Ga0466967_0678802_288_848 | 186 |
| 668 | 3300046453 | Ga0495627_001650 | Ga0495627_001650_5156_5716 | 186 |
| 669 | 3300046460 | Ga0495638_0019724 | Ga0495638_0019724_1033_1596 | 186 |
| 670 | 3300046477 | Ga0495664_0153888 | Ga0495664_0153888_148_708 | 186 |
| 671 | 3300046523 | Ga0495644_0296643 | Ga0495644_0296643_17_577 | 186 |
| 672 | 3300046533 | Ga0495640_0061108 | Ga0495640_0061108_1518_2078 | 186 |
| 673 | 3300046536 | Ga0495587_0149292 | Ga0495587_0149292_446_1006 | 186 |
| 674 | 3300046558 | Ga0495633_0106184 | Ga0495633_0106184_180_743 | 186 |
| 675 | 3300046559 | Ga0495667_0049897 | Ga0495667_0049897_1566_2126 | 186 |
| 676 | 3300046559 | Ga0495667_0181636 | Ga0495667_0181636_23_586 | 186 |
| 677 | 3300046615 | Ga0495656_0027647 | Ga0495656_0027647_1155_1715 | 186 |
| 678 | 3300046615 | Ga0495656_0141099 | Ga0495656_0141099_285_848 | 186 |
| 679 | 3300046642 | Ga0495634_0121813 | Ga0495634_0121813_794_1354 | 186 |
| 680 | 3300046660 | Ga0495625_0100760 | Ga0495625_0100760_680_1240 | 186 |
| 681 | 3300046663 | Ga0495635_0232413 | Ga0495635_0232413_439_999 | 186 |
| 682 | 3300046689 | Ga0495613_0258756 | Ga0495613_0258756_173_733 | 186 |
| 683 | 3300046690 | Ga0495624_0416627 | Ga0495624_0416627_89_649 | 186 |
| 684 | 3300046694 | Ga0495649_0348421 | Ga0495649_0348421_64_624 | 186 |
| 685 | 3300046809 | Ga0495600_0281241 | Ga0495600_0281241_239_799 | 186 |
| 686 | 3300047315 | Ga0495581_0057647 | Ga0495581_0057647_437_997 | 186 |
| 687 | 3300047319 | Ga0495674_0319214 | Ga0495674_0319214_666_1226 | 186 |
| 688 | 3300047322 | Ga0495680_0280339 | Ga0495680_0280339_477_1037 | 186 |
| 689 | 3300047322 | Ga0495680_0588006 | Ga0495680_0588006_152_712 | 186 |
| 690 | 3300047444 | Ga0495675_0081054 | Ga0495675_0081054_910_1470 | 186 |
| 691 | 3300047444 | Ga0495675_0486394 | Ga0495675_0486394_27_590 | 186 |
| 692 | 3300047471 | Ga0495684_0533353 | Ga0495684_0533353_216_776 | 186 |
| 693 | 3300047472 | Ga0495686_0113671 | Ga0495686_0113671_862_1422 | 186 |
| 694 | 3300047472 | Ga0495686_0269684 | Ga0495686_0269684_234_794 | 186 |
| 695 | 3300047472 | Ga0495686_0454040 | Ga0495686_0454040_40_600 | 186 |
| 696 | 3300048088 | Ga0495602_0082893 | Ga0495602_0082893_1420_1980 | 186 |
| 697 | 3300048903 | Ga0496100_0055811 | Ga0496100_0055811_316_876 | 186 |
| 698 | 3300048903 | Ga0496100_0086725 | Ga0496100_0086725_64_624 | 186 |
| 699 | 3300048903 | Ga0496100_0208075 | Ga0496100_0208075_368_928 | 186 |
| 700 | 3300048903 | Ga0496100_0231255 | Ga0496100_0231255_771_1334 | 186 |
| 701 | 3300048904 | Ga0496101_0025696 | Ga0496101_0025696_2564_3124 | 186 |
| 702 | 3300048904 | Ga0496101_0043514 | Ga0496101_0043514_2131_2754 | 186 |
| 703 | 3300048904 | Ga0496101_0108385 | Ga0496101_0108385_1201_1764 | 186 |
| 704 | 3300048904 | Ga0496101_0237973 | Ga0496101_0237973_437_997 | 186 |
| 705 | 3300048904 | Ga0496101_0292037 | Ga0496101_0292037_573_1136 | 186 |
| 706 | 3300048904 | Ga0496101_0553153 | Ga0496101_0553153_51_611 | 186 |
| 707 | 3300048904 | Ga0496101_0688533 | Ga0496101_0688533_133_693 | 186 |
| 708 | 3300048905 | Ga0496102_0007945 | Ga0496102_0007945_6222_6782 | 186 |
| 709 | 3300048905 | Ga0496102_0040977 | Ga0496102_0040977_2343_2903 | 186 |
| 710 | 3300048905 | Ga0496102_0044215 | Ga0496102_0044215_2423_3046 | 186 |
| 711 | 3300048906 | Ga0496103_0002549 | Ga0496103_0002549_7856_8416 | 186 |
| 712 | 3300048906 | Ga0496103_0020679 | Ga0496103_0020679_364_924 | 186 |
| 713 | 3300048906 | Ga0496103_0058136 | Ga0496103_0058136_994_1617 | 186 |
| 714 | 3300048907 | Ga0496104_0102883 | Ga0496104_0102883_79_639 | 186 |
| 715 | 3300048907 | Ga0496104_0116043 | Ga0496104_0116043_351_911 | 186 |
| 716 | 3300048907 | Ga0496104_0481771 | Ga0496104_0481771_314_874 | 186 |
| 717 | 3300048907 | Ga0496104_0890207 | Ga0496104_0890207_167_727 | 186 |
| 718 | 3300048908 | Ga0496105_0007370 | Ga0496105_0007370_6343_6903 | 186 |
| 719 | 3300048908 | Ga0496105_0035840 | Ga0496105_0035840_1770_2393 | 186 |
| 720 | 3300048908 | Ga0496105_0252017 | Ga0496105_0252017_596_1156 | 186 |
| 721 | 3300048908 | Ga0496105_0261843 | Ga0496105_0261843_515_1075 | 186 |
| 722 | 3300048910 | Ga0496107_0055402 | Ga0496107_0055402_2002_2562 | 186 |
| 723 | 3300048910 | Ga0496107_0142770 | Ga0496107_0142770_388_1011 | 186 |
| 724 | 3300048910 | Ga0496107_0170876 | Ga0496107_0170876_165_725 | 186 |
| 725 | 3300048911 | Ga0496108_0074045 | Ga0496108_0074045_1793_2353 | 186 |
| 726 | 3300048912 | Ga0496109_0123867 | Ga0496109_0123867_1079_1639 | 186 |
| 727 | 3300048912 | Ga0496109_0145515 | Ga0496109_0145515_1273_1833 | 186 |
| 728 | 3300048912 | Ga0496109_0304969 | Ga0496109_0304969_488_1048 | 186 |
| 729 | 3300048912 | Ga0496109_1278650 | Ga0496109_1278650_91_651 | 186 |
| 730 | 3300048913 | Ga0496110_0003842 | Ga0496110_0003842_1131_1694 | 186 |
| 731 | 3300048913 | Ga0496110_0075302 | Ga0496110_0075302_1898_2458 | 186 |
| 732 | 3300048913 | Ga0496110_0075641 | Ga0496110_0075641_2413_2973 | 186 |
| 733 | 3300048913 | Ga0496110_0227332 | Ga0496110_0227332_712_1275 | 186 |
| 734 | 3300048914 | Ga0496111_0037450 | Ga0496111_0037450_793_1353 | 186 |
| 735 | 3300048914 | Ga0496111_0817421 | Ga0496111_0817421_29_589 | 186 |
| 736 | 3300048915 | Ga0496112_0093514 | Ga0496112_0093514_272_832 | 186 |
| 737 | 3300048916 | Ga0496113_0124755 | Ga0496113_0124755_643_1206 | 186 |
| 738 | 3300048916 | Ga0496113_0191257 | Ga0496113_0191257_1035_1598 | 186 |
| 739 | 3300048916 | Ga0496113_0257422 | Ga0496113_0257422_712_1275 | 186 |
| 740 | 3300048916 | Ga0496113_0497806 | Ga0496113_0497806_130_690 | 186 |
| 741 | 3300048917 | Ga0496114_0021664 | Ga0496114_0021664_2300_2860 | 186 |
| 742 | 3300048917 | Ga0496114_0023550 | Ga0496114_0023550_2715_3338 | 186 |
| 743 | 3300048917 | Ga0496114_0081857 | Ga0496114_0081857_1315_1875 | 186 |
| 744 | 3300048917 | Ga0496114_0173315 | Ga0496114_0173315_156_719 | 186 |
| 745 | 3300048917 | Ga0496114_0195696 | Ga0496114_0195696_447_1007 | 186 |
| 746 | 3300048917 | Ga0496114_0253845 | Ga0496114_0253845_599_1159 | 186 |
| 747 | 3300048917 | Ga0496114_0429517 | Ga0496114_0429517_14_577 | 186 |
| 748 | 3300048918 | Ga0496115_0074021 | Ga0496115_0074021_1412_1972 | 186 |
| 749 | 3300048918 | Ga0496115_0312547 | Ga0496115_0312547_236_796 | 186 |
| 750 | 3300048918 | Ga0496115_0526180 | Ga0496115_0526180_149_709 | 186 |
| 751 | 3300048919 | Ga0496116_0019712 | Ga0496116_0019712_900_1460 | 186 |
| 752 | 3300048919 | Ga0496116_0134225 | Ga0496116_0134225_566_1129 | 186 |
| 753 | 3300048920 | Ga0496117_0000468 | Ga0496117_0000468_64337_64897 | 186 |
| 754 | 3300048920 | Ga0496117_0001642 | Ga0496117_0001642_5361_5921 | 186 |
| 755 | 3300048920 | Ga0496117_0016338 | Ga0496117_0016338_19_579 | 186 |
| 756 | 3300048920 | Ga0496117_0018386 | Ga0496117_0018386_3036_3599 | 186 |
| 757 | 3300048920 | Ga0496117_0052644 | Ga0496117_0052644_142_765 | 186 |
| 758 | 3300048920 | Ga0496117_0069032 | Ga0496117_0069032_397_960 | 186 |
| 759 | 3300048920 | Ga0496117_0103701 | Ga0496117_0103701_1188_1748 | 186 |
| 760 | 3300048920 | Ga0496117_0122293 | Ga0496117_0122293_692_1252 | 186 |
| 761 | 3300048920 | Ga0496117_0179138 | Ga0496117_0179138_222_782 | 186 |
| 762 | 3300048920 | Ga0496117_0443444 | Ga0496117_0443444_31_594 | 186 |
| 763 | 3300048921 | Ga0496118_0004353 | Ga0496118_0004353_12662_13222 | 186 |
| 764 | 3300048921 | Ga0496118_0011768 | Ga0496118_0011768_1266_1826 | 186 |
| 765 | 3300048921 | Ga0496118_0017452 | Ga0496118_0017452_5435_5998 | 186 |
| 766 | 3300048921 | Ga0496118_0058757 | Ga0496118_0058757_1253_1813 | 186 |
| 767 | 3300048921 | Ga0496118_0082443 | Ga0496118_0082443_584_1207 | 186 |
| 768 | 3300048921 | Ga0496118_0210821 | Ga0496118_0210821_477_1040 | 186 |
| 769 | 3300048921 | Ga0496118_0356933 | Ga0496118_0356933_100_663 | 186 |
| 770 | 3300048921 | Ga0496118_0438540 | Ga0496118_0438540_26_586 | 186 |
| 771 | 3300048922 | Ga0496119_0001447 | Ga0496119_0001447_27872_28432 | 186 |
| 772 | 3300048922 | Ga0496119_0002168 | Ga0496119_0002168_16087_16647 | 186 |
| 773 | 3300048922 | Ga0496119_0002636 | Ga0496119_0002636_13589_14149 | 186 |
| 774 | 3300048922 | Ga0496119_0003788 | Ga0496119_0003788_439_999 | 186 |
| 775 | 3300048922 | Ga0496119_0008817 | Ga0496119_0008817_6068_6631 | 186 |
| 776 | 3300048922 | Ga0496119_0015749 | Ga0496119_0015749_2269_2832 | 186 |
| 777 | 3300048922 | Ga0496119_0105437 | Ga0496119_0105437_202_762 | 186 |
| 778 | 3300048922 | Ga0496119_0202951 | Ga0496119_0202951_201_836 | 186 |
| 779 | 3300048923 | Ga0496120_0000565 | Ga0496120_0000565_9536_10096 | 186 |
| 780 | 3300048923 | Ga0496120_0032972 | Ga0496120_0032972_1318_1878 | 186 |
| 781 | 3300048923 | Ga0496120_0086267 | Ga0496120_0086267_628_1251 | 186 |
| 782 | 3300048924 | Ga0496121_0000040 | Ga0496121_0000040_234671_235234 | 186 |
| 783 | 3300048924 | Ga0496121_0083728 | Ga0496121_0083728_540_1103 | 186 |
| 784 | 3300048924 | Ga0496121_0202409 | Ga0496121_0202409_284_907 | 186 |
| 785 | 3300048925 | Ga0496122_0000054 | Ga0496122_0000054_145416_145976 | 186 |
| 786 | 3300048925 | Ga0496122_0000240 | Ga0496122_0000240_63931_64491 | 186 |
| 787 | 3300048925 | Ga0496122_0004129 | Ga0496122_0004129_3483_4046 | 186 |
| 788 | 3300048925 | Ga0496122_0004482 | Ga0496122_0004482_15694_16254 | 186 |
| 789 | 3300048925 | Ga0496122_0044311 | Ga0496122_0044311_513_1073 | 186 |
| 790 | 3300048925 | Ga0496122_0054530 | Ga0496122_0054530_1642_2202 | 186 |
| 791 | 3300048925 | Ga0496122_0153675 | Ga0496122_0153675_427_987 | 186 |
| 792 | 3300048926 | Ga0496123_0000039 | Ga0496123_0000039_145416_145976 | 186 |
| 793 | 3300048926 | Ga0496123_0000076 | Ga0496123_0000076_1381_1941 | 186 |
| 794 | 3300048926 | Ga0496123_0006901 | Ga0496123_0006901_10089_10652 | 186 |
| 795 | 3300048926 | Ga0496123_0007074 | Ga0496123_0007074_3703_4263 | 186 |
| 796 | 3300048926 | Ga0496123_0120762 | Ga0496123_0120762_769_1329 | 186 |
| 797 | 3300048926 | Ga0496123_0148414 | Ga0496123_0148414_194_754 | 186 |
| 798 | 3300048927 | Ga0496124_0002700 | Ga0496124_0002700_17398_17958 | 186 |
| 799 | 3300048927 | Ga0496124_0002802 | Ga0496124_0002802_1644_2204 | 186 |
| 800 | 3300048927 | Ga0496124_0003349 | Ga0496124_0003349_10748_11308 | 186 |
| 801 | 3300048927 | Ga0496124_0103941 | Ga0496124_0103941_456_1016 | 186 |
| 802 | 3300048927 | Ga0496124_0110410 | Ga0496124_0110410_817_1377 | 186 |
| 803 | 3300048927 | Ga0496124_0365839 | Ga0496124_0365839_220_780 | 186 |
| 804 | 3300048927 | Ga0496124_0415576 | Ga0496124_0415576_271_831 | 186 |
| 805 | 3300048928 | Ga0496125_0000061 | Ga0496125_0000061_86402_86962 | 186 |
| 806 | 3300048928 | Ga0496125_0005037 | Ga0496125_0005037_11789_12349 | 186 |
| 807 | 3300048928 | Ga0496125_0013256 | Ga0496125_0013256_6716_7276 | 186 |
| 808 | 3300048928 | Ga0496125_0024358 | Ga0496125_0024358_1257_1817 | 186 |
| 809 | 3300048928 | Ga0496125_0035020 | Ga0496125_0035020_2959_3519 | 186 |
| 810 | 3300048928 | Ga0496125_0062145 | Ga0496125_0062145_2178_2738 | 186 |
| 811 | 3300048928 | Ga0496125_0294691 | Ga0496125_0294691_375_938 | 186 |
| 812 | 3300048929 | Ga0496126_0003246 | Ga0496126_0003246_13031_13591 | 186 |
| 813 | 3300048929 | Ga0496126_0006703 | Ga0496126_0006703_1877_2437 | 186 |
| 814 | 3300048929 | Ga0496126_0008752 | Ga0496126_0008752_5603_6163 | 186 |
| 815 | 3300048929 | Ga0496126_0017018 | Ga0496126_0017018_5719_6279 | 186 |
| 816 | 3300048929 | Ga0496126_0082638 | Ga0496126_0082638_1599_2222 | 186 |
| 817 | 3300048929 | Ga0496126_0088488 | Ga0496126_0088488_2062_2622 | 186 |
| 818 | 3300048929 | Ga0496126_0428540 | Ga0496126_0428540_274_834 | 186 |
| 819 | 3300048929 | Ga0496126_0621418 | Ga0496126_0621418_85_645 | 186 |
| 820 | 3300049127 | Ga0501306_032927 | Ga0501306_032927_155_715 | 186 |
| 821 | 3300049127 | Ga0501306_033692 | Ga0501306_033692_147_710 | 186 |
| 822 | 3300049127 | Ga0501306_050051 | Ga0501306_050051_23_586 | 186 |
| 823 | 3300049129 | Ga0501309_014427 | Ga0501309_014427_174_734 | 186 |
| 824 | 3300049129 | Ga0501309_050139 | Ga0501309_050139_37_600 | 186 |
| 825 | 3300049160 | Ga0501304_007091 | Ga0501304_007091_23_586 | 186 |
| 826 | 3300049161 | Ga0501305_062041 | Ga0501305_062041_18_581 | 186 |
| 827 | 3300049527 | Ga0501311_021168 | Ga0501311_021168_286_846 | 186 |
| 828 | 3300049528 | Ga0501312_052982 | Ga0501312_052982_67_630 | 186 |
| 829 | 3300049530 | Ga0501314_021815 | Ga0501314_021815_92_652 | 186 |
| 830 | 3300049530 | Ga0501314_028252 | Ga0501314_028252_32_595 | 186 |
| 831 | 3300049531 | Ga0501315_018264 | Ga0501315_018264_124_687 | 186 |
| 832 | 3300049533 | Ga0501317_008631 | Ga0501317_008631_312_875 | 186 |
| 833 | 3300049533 | Ga0501317_033401 | Ga0501317_033401_69_632 | 186 |
| 834 | 3300049533 | Ga0501317_033629 | Ga0501317_033629_179_739 | 186 |
| 835 | 3300049534 | Ga0501318_004758 | Ga0501318_004758_69_632 | 186 |
| 836 | 3300049534 | Ga0501318_006907 | Ga0501318_006907_306_869 | 186 |
| 837 | 3300049534 | Ga0501318_012840 | Ga0501318_012840_30_590 | 186 |
| 838 | 3300049535 | Ga0501319_010515 | Ga0501319_010515_129_692 | 186 |
| 839 | 3300049535 | Ga0501319_019111 | Ga0501319_019111_21_584 | 186 |
| 840 | 3300049537 | Ga0501321_009484 | Ga0501321_009484_267_830 | 186 |
| 841 | 3300049537 | Ga0501321_011536 | Ga0501321_011536_415_975 | 186 |
| 842 | 3300049539 | Ga0501323_014682 | Ga0501323_014682_378_938 | 186 |
| 843 | 3300049541 | Ga0501325_005801 | Ga0501325_005801_83_646 | 186 |
| 844 | 3300049541 | Ga0501325_023591 | Ga0501325_023591_83_643 | 186 |
| 845 | 3300049568 | Ga0501031_0012930 | Ga0501031_0012930_881_1444 | 186 |
| 846 | 3300049568 | Ga0501031_0014748 | Ga0501031_0014748_2390_2953 | 186 |
| 847 | 3300049568 | Ga0501031_0108135 | Ga0501031_0108135_476_1039 | 186 |
| 848 | 3300049568 | Ga0501031_0172007 | Ga0501031_0172007_385_945 | 186 |
| 849 | 3300049568 | Ga0501031_0191237 | Ga0501031_0191237_233_796 | 186 |
| 850 | 3300049569 | Ga0501032_0002467 | Ga0501032_0002467_2103_2666 | 186 |
| 851 | 3300049569 | Ga0501032_0137185 | Ga0501032_0137185_946_1509 | 186 |
| 852 | 3300049569 | Ga0501032_0145814 | Ga0501032_0145814_494_1057 | 186 |
| 853 | 3300049570 | Ga0501033_0038626 | Ga0501033_0038626_643_1206 | 186 |
| 854 | 3300049570 | Ga0501033_0232255 | Ga0501033_0232255_65_625 | 186 |
| 855 | 3300049570 | Ga0501033_0324411 | Ga0501033_0324411_14_577 | 186 |
| 856 | 3300049571 | Ga0501034_0002512 | Ga0501034_0002512_14996_15559 | 186 |
| 857 | 3300049571 | Ga0501034_0003477 | Ga0501034_0003477_14474_15034 | 186 |
| 858 | 3300049571 | Ga0501034_0019043 | Ga0501034_0019043_3087_3650 | 186 |
| 859 | 3300049572 | Ga0501036_0036856 | Ga0501036_0036856_1058_1618 | 186 |
| 860 | 3300049573 | Ga0501037_0001179 | Ga0501037_0001179_6310_6873 | 186 |
| 861 | 3300049573 | Ga0501037_0271350 | Ga0501037_0271350_86_649 | 186 |
| 862 | 3300049574 | Ga0501038_0015936 | Ga0501038_0015936_5386_5949 | 186 |
| 863 | 3300049574 | Ga0501038_0021169 | Ga0501038_0021169_5163_5726 | 186 |
| 864 | 3300049574 | Ga0501038_0080407 | Ga0501038_0080407_444_1004 | 186 |
| 865 | 3300049574 | Ga0501038_0089014 | Ga0501038_0089014_1251_1814 | 186 |
| 866 | 3300049574 | Ga0501038_0174653 | Ga0501038_0174653_548_1111 | 186 |
| 867 | 3300049574 | Ga0501038_0483763 | Ga0501038_0483763_205_765 | 186 |
| 868 | 3300049575 | Ga0501039_0000678 | Ga0501039_0000678_12907_13470 | 186 |
| 869 | 3300049575 | Ga0501039_0155506 | Ga0501039_0155506_70_630 | 186 |
| 870 | 3300049575 | Ga0501039_0155636 | Ga0501039_0155636_478_1041 | 186 |
| 871 | 3300049576 | Ga0501040_0002965 | Ga0501040_0002965_6577_7137 | 186 |
| 872 | 3300049576 | Ga0501040_0264941 | Ga0501040_0264941_555_1118 | 186 |
| 873 | 3300049576 | Ga0501040_0355930 | Ga0501040_0355930_460_1020 | 186 |
| 874 | 3300049576 | Ga0501040_0370668 | Ga0501040_0370668_148_708 | 186 |
| 875 | 3300049577 | Ga0501041_0113126 | Ga0501041_0113126_527_1087 | 186 |
| 876 | 3300049577 | Ga0501041_0325976 | Ga0501041_0325976_236_799 | 186 |
| 877 | 3300049578 | Ga0501042_0119498 | Ga0501042_0119498_889_1449 | 186 |
| 878 | 3300049578 | Ga0501042_0121018 | Ga0501042_0121018_876_1439 | 186 |
| 879 | 3300049578 | Ga0501042_0184111 | Ga0501042_0184111_230_793 | 186 |
| 880 | 3300049578 | Ga0501042_0754395 | Ga0501042_0754395_33_593 | 186 |
| 881 | 3300049578 | Ga0501042_0854212 | Ga0501042_0854212_32_592 | 186 |
| 882 | 3300049579 | Ga0501043_0014495 | Ga0501043_0014495_5556_6119 | 186 |
| 883 | 3300049579 | Ga0501043_0032686 | Ga0501043_0032686_1256_1816 | 186 |
| 884 | 3300049579 | Ga0501043_0037822 | Ga0501043_0037822_641_1204 | 186 |
| 885 | 3300049579 | Ga0501043_0161542 | Ga0501043_0161542_990_1553 | 186 |
| 886 | 3300049579 | Ga0501043_0197623 | Ga0501043_0197623_959_1522 | 186 |
| 887 | 3300049579 | Ga0501043_0268327 | Ga0501043_0268327_670_1233 | 186 |
| 888 | 3300049580 | Ga0501046_0005735 | Ga0501046_0005735_5712_6275 | 186 |
| 889 | 3300049580 | Ga0501046_0005990 | Ga0501046_0005990_10238_10798 | 186 |
| 890 | 3300049581 | Ga0501047_0060896 | Ga0501047_0060896_1447_2010 | 186 |
| 891 | 3300049581 | Ga0501047_0082971 | Ga0501047_0082971_2022_2585 | 186 |
| 892 | 3300049581 | Ga0501047_0196700 | Ga0501047_0196700_1298_1861 | 186 |
| 893 | 3300049581 | Ga0501047_0234502 | Ga0501047_0234502_1039_1602 | 186 |
| 894 | 3300049582 | Ga0501048_0007529 | Ga0501048_0007529_3502_4062 | 186 |
| 895 | 3300049582 | Ga0501048_0053519 | Ga0501048_0053519_1332_1895 | 186 |
| 896 | 3300049584 | Ga0501068_0037663 | Ga0501068_0037663_625_1188 | 186 |
| 897 | 3300049584 | Ga0501068_0199775 | Ga0501068_0199775_390_953 | 186 |
| 898 | 3300049586 | Ga0501070_0000198 | Ga0501070_0000198_51127_51750 | 186 |
| 899 | 3300049586 | Ga0501070_0008288 | Ga0501070_0008288_3475_4038 | 186 |
| 900 | 3300049586 | Ga0501070_0361877 | Ga0501070_0361877_235_798 | 186 |
| 901 | 3300049587 | Ga0501071_0037112 | Ga0501071_0037112_476_1036 | 186 |
| 902 | 3300049587 | Ga0501071_0111922 | Ga0501071_0111922_550_1113 | 186 |
| 903 | 3300049588 | Ga0501072_0015828 | Ga0501072_0015828_925_1488 | 186 |
| 904 | 3300049588 | Ga0501072_0156811 | Ga0501072_0156811_773_1333 | 186 |
| 905 | 3300049589 | Ga0501073_0268591 | Ga0501073_0268591_503_1066 | 186 |
| 906 | 3300049590 | Ga0501074_0028586 | Ga0501074_0028586_511_1074 | 186 |
| 907 | 3300049590 | Ga0501074_0214328 | Ga0501074_0214328_466_1026 | 186 |
| 908 | 3300049591 | Ga0501075_0152142 | Ga0501075_0152142_444_1004 | 186 |
| 909 | 3300049592 | Ga0501076_0000795 | Ga0501076_0000795_13272_13832 | 186 |
| 910 | 3300049592 | Ga0501076_0426341 | Ga0501076_0426341_486_1049 | 186 |
| 911 | 3300049741 | Ga0501079_0314149 | Ga0501079_0314149_420_980 | 186 |
| 912 | 3300049742 | Ga0501080_0111243 | Ga0501080_0111243_604_1167 | 186 |
| 913 | 3300049742 | Ga0501080_0205219 | Ga0501080_0205219_717_1277 | 186 |
| 914 | 3300049743 | Ga0501081_0068380 | Ga0501081_0068380_1393_1956 | 186 |
| 915 | 3300049744 | Ga0501083_0000003 | Ga0501083_0000003_178427_178990 | 186 |
| 916 | 3300049744 | Ga0501083_0044350 | Ga0501083_0044350_483_1046 | 186 |
| 917 | 3300049822 | Ga0501035_0005688 | Ga0501035_0005688_2020_2643 | 186 |
| 918 | 3300049822 | Ga0501035_0038886 | Ga0501035_0038886_2261_2824 | 186 |
| 919 | 3300049822 | Ga0501035_0636661 | Ga0501035_0636661_15_578 | 186 |
| 920 | 3300049823 | Ga0501044_0001379 | Ga0501044_0001379_11269_11832 | 186 |
| 921 | 3300049823 | Ga0501044_0025724 | Ga0501044_0025724_5211_5774 | 186 |
| 922 | 3300049823 | Ga0501044_0036713 | Ga0501044_0036713_1716_2279 | 186 |
| 923 | 3300049823 | Ga0501044_0395774 | Ga0501044_0395774_168_731 | 186 |
| 924 | 3300049824 | Ga0501045_0071306 | Ga0501045_0071306_1752_2315 | 186 |
| 925 | 3300049824 | Ga0501045_0106551 | Ga0501045_0106551_495_1058 | 186 |
| 926 | 3300049824 | Ga0501045_0130034 | Ga0501045_0130034_599_1159 | 186 |
| 927 | 3300050491 | nmdc:mga00v17_103909_c1 | nmdc:mga00v17_103909_c1_543_1103 | 186 |
| 928 | 3300050491 | nmdc:mga00v17_2023_c2 | nmdc:mga00v17_2023_c2_5399_5962 | 186 |
| 929 | 3300050491 | nmdc:mga00v17_44017_c1 | nmdc:mga00v17_44017_c1_1016_1576 | 186 |
| 930 | 3300050491 | nmdc:mga00v17_50861_c1 | nmdc:mga00v17_50861_c1_1546_2109 | 186 |
| 931 | 3300050491 | nmdc:mga00v17_56106_c1 | nmdc:mga00v17_56106_c1_287_850 | 186 |
| 932 | 3300050491 | nmdc:mga00v17_622889_c1 | nmdc:mga00v17_622889_c1_88_651 | 186 |
| 933 | 3300050491 | nmdc:mga00v17_623289_c1 | nmdc:mga00v17_623289_c1_22_582 | 186 |
| 934 | 3300050496 | nmdc:mga07m45_42585_c1 | nmdc:mga07m45_42585_c1_641_1201 | 186 |
| 935 | 3300050516 | nmdc:mga0sz30_101031_c1 | nmdc:mga0sz30_101031_c1_273_833 | 186 |
| 936 | 3300050516 | nmdc:mga0sz30_184735_c1 | nmdc:mga0sz30_184735_c1_308_868 | 186 |
| 937 | 3300050516 | nmdc:mga0sz30_3162_c1 | nmdc:mga0sz30_3162_c1_3184_3747 | 186 |
| 938 | 3300053080 | Ga0500635_0000012 | Ga0500635_0000012_100823_101386 | 186 |
| 939 | 3300053085 | Ga0495619_0292551 | Ga0495619_0292551_373_975 | 186 |
| 940 | 3300053085 | Ga0495619_0585344 | Ga0495619_0585344_72_632 | 186 |
| 941 | 3300053088 | Ga0500644_0005516 | Ga0500644_0005516_1348_1911 | 186 |
| 942 | 3300053136 | Ga0500559_0000194 | Ga0500559_0000194_14280_14846 | 186 |
| 943 | 3300053136 | Ga0500559_0000264 | Ga0500559_0000264_16174_16737 | 186 |
| 944 | 3300053136 | Ga0500559_0000565 | Ga0500559_0000565_21542_22102 | 186 |
| 945 | 3300053136 | Ga0500559_0035365 | Ga0500559_0035365_539_1099 | 186 |
| 946 | 3300053139 | Ga0500568_0046973 | Ga0500568_0046973_588_1223 | 186 |
| 947 | 3300053140 | Ga0500573_0000017 | Ga0500573_0000017_10439_11002 | 186 |
| 948 | 3300053140 | Ga0500573_0025610 | Ga0500573_0025610_184_747 | 186 |
| 949 | 3300053151 | Ga0500604_0023186 | Ga0500604_0023186_382_942 | 186 |
| 950 | 3300053153 | Ga0500616_0000553 | Ga0500616_0000553_15550_16110 | 186 |
| 951 | 3300053153 | Ga0500616_0001343 | Ga0500616_0001343_20901_21461 | 186 |
| 952 | 3300053153 | Ga0500616_0026369 | Ga0500616_0026369_1764_2327 | 186 |
| 953 | 3300054114 | Ga0501084_0028089 | Ga0501084_0028089_486_1046 | 186 |
| 954 | 3300054114 | Ga0501084_0357771 | Ga0501084_0357771_479_1042 | 186 |
| 955 | 3300059424 | Ga0590075_043434 | Ga0590075_043434_58_621 | 186 |
| 956 | 3300059478 | Ga0587093_025631 | Ga0587093_025631_216_776 | 186 |
| 957 | 3300059512 | Ga0587092_030583 | Ga0587092_030583_209_769 | 186 |
| 958 | 3300059513 | Ga0587094_058652 | Ga0587094_058652_38_601 | 186 |
| 959 | 3300059626 | Ga0587115_041102 | Ga0587115_041102_149_712 | 186 |
| 960 | 3300059652 | Ga0587107_038675 | Ga0587107_038675_69_629 | 186 |
| 961 | 3300059660 | Ga0587124_006163 | Ga0587124_006163_332_895 | 186 |
| 962 | 3300060353 | Ga0501082_0066814 | Ga0501082_0066814_315_875 | 186 |
| 963 | 3300061719 | Ga0466962_0016187 | Ga0466962_0016187_49_705 | 186 |
| 964 | 3300061719 | Ga0466962_0344707 | Ga0466962_0344707_24_584 | 186 |
| 965 | 3300061734 | Ga0530510_0086382 | Ga0530510_0086382_1198_1761 | 186 |
| 966 | 3300061734 | Ga0530510_0093049 | Ga0530510_0093049_457_1017 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ueb-assembly2.cif.gz_B | crystal structure of translation elongation factor p from thermus thermophilus hb8 | 0.953 | 1 | 185 |
| 1ueb-assembly2.cif.gz_B | crystal structure of translation elongation factor p from thermus thermophilus hb8 | 0.9479 | 1 | 185 |
| 1ueb-assembly1.cif.gz_A | crystal structure of translation elongation factor p from thermus thermophilus hb8 | 0.9313 | 1 | 185 |
| 3a5z-assembly2.cif.gz_F | crystal structure of escherichia coli genx in complex with elongation factor p | 0.931 | 1 | 59 |
| 4v6a-assembly2.cif.gz_CV | structure of ef-p bound to the 70s ribosome. | 0.9277 | 1 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9977 | 64 | 126 | 2.40.50.140 |
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9822 | 64 | 126 | 2.40.50.140 |
| af_Q2QYK4_39_108_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9796 | 2 | 63 | 2.30.30.30 |
| af_I1L709_116_178_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9787 | 64 | 126 | 2.40.50.140 |
| af_I1JVU1_64_124_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9742 | 2 | 61 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A543JMV3-F1-model_v4 | Elongation factor P (EF-P) | 0.9933 | 1 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A0Q7B5L2-F1-model_v4 | Elongation factor P (EF-P) | 0.9933 | 1 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A3N3ZSX0-F1-model_v4 | Elongation factor P (EF-P) | 0.9932 | 1 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A4TBX4-F1-model_v4 | Elongation factor P (EF-P) | 0.9931 | 1 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A1Q8JK81-F1-model_v4 | Elongation factor P (EF-P) | 0.9928 | 2 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar