F487001

General Info

Members Datasets Scaffolds Average Seq Length
966 497 830 186

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0117860|Ga0466970_0117860_668_1336
Length 222
Sequence VATAAAAAGVAWRAIPTRADGHTRARTSFPKDEGRPVATTNDLKNGLVLNLDGQLWSVVEFQHVKPGKGGAFVRTKLKNVLSGKVVDRTFNAGTKVDTATVDKRDMQFLYKDGTDFVFMDSNTYDQLHIGADTVGDAANFLLENQEAIVAVHEGTPLYVELPTSVVLEITYTEPGLQGDRSTGGTKPATVETGYEIQVPLFLETGTKVKVDTRSGDYLGRVS

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
7 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
8 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
9 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
10 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
11 2643221546 Microbacterium sp. Root53 Isolate Unclassified
12 2643221549 Agromyces sp. Root1464 Isolate Unclassified
13 2643221553 Microbacterium sp. Root553 Isolate Unclassified
14 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
15 2643221572 Leifsonia sp. Root60 Isolate Unclassified
16 2643221575 Microbacterium sp. Root61 Isolate Unclassified
17 2643221576 Nocardioides sp. Root614 Isolate Unclassified
18 2643221590 Nocardioides sp. Root682 Isolate Unclassified
19 2643221597 Microbacterium sp. Root180 Isolate Unclassified
20 2643221616 Leifsonia sp. Root227 Isolate Unclassified
21 2643221619 Agromyces sp. Root81 Isolate Unclassified
22 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
23 2643221630 Microbacterium sp. Root322 Isolate Unclassified
24 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
25 2643221649 Leifsonia sp. Root4 Isolate Unclassified
26 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
27 2643221679 Angustibacter sp. Root456 Isolate Unclassified
28 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
29 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
30 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
31 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
32 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
33 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
34 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
35 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
36 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
37 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
38 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
39 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
40 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
41 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
42 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
43 2773857759 Microbacterium sp. 1294 Isolate Unclassified
44 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
45 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
46 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
47 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
48 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
49 2808606372 Agromyces sp. 23-23 Isolate Unclassified
50 2808606394 Promicromonospora sp. C35 Isolate Unclassified
51 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
52 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
53 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
54 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
55 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
56 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
57 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
58 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
59 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
60 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
61 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
62 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
63 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
64 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
65 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
66 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
67 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
68 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
69 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
70 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
71 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
72 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
73 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
74 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
75 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
76 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
77 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
78 2858882152 Micromonospora noduli MED15 Isolate Nodule
79 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
80 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
81 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
82 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
83 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
84 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
85 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
86 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
87 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
88 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
89 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
90 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
91 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
92 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
93 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
94 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
95 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
96 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
97 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
98 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
99 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
100 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
101 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
102 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
103 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
104 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
105 2920879853 Kocuria salina CV6 Isolate Unclassified
106 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
107 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
108 2928153084 Leifsonia sp. 563 Isolate Unclassified
109 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
110 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
111 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
112 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
113 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
114 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
115 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
116 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
117 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
118 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
119 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
120 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
121 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
122 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
123 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
124 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
126 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
127 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
128 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
129 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
130 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
131 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
132 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
133 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
134 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
138 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
139 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
140 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
141 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
142 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
143 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
144 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
145 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
146 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
147 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
148 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
149 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
150 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
157 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
158 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
159 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
162 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
163 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
164 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
165 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
166 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
167 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
168 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
169 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
170 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
171 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
172 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
173 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
174 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
175 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
176 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
177 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
178 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
179 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
183 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
186 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
191 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
199 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
200 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
207 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
221 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
223 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
226 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
269 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
274 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
275 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
276 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
290 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
291 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
296 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
308 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
309 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
313 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
316 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
317 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
318 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
319 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
324 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
325 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
328 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
329 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
330 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
338 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
341 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
345 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
346 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
354 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
355 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
361 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
431 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
432 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
433 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
434 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
435 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
436 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
437 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
438 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
439 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
440 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
457 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
458 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
459 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
463 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 649633069 Micromonospora sp. L5 Isolate Unclassified
482 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
483 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
484 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
485 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
486 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
487 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
488 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
489 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
490 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
491 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
492 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
493 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
494 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
495 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
496 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
497 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.57
Metatranscriptomes 10.35
Isolates 14.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 6.11
Nodule 0.52
Rhizoplane 7.76
Rhizosphere 67.81
Stem 0
Stem Tuber 0.1
Unclassified 17.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10033890 3300001989 Bacteria 1743
2 JGI24739J22299_10090630 3300001989 Bacteria 931
3 JGI24739J22299_10095805 3300001989 Bacteria 899
4 JGI24737J22298_10040121 3300001990 Bacteria 1438
5 JGI24735J21928_10002346 3300002067 Bacteria 6599
6 JGI24744J21845_10035085 3300002077 Bacteria 950
7 JGI25164J39214_1000271 3300002772 Bacteria 38022
8 JGI25406J46586_10016618 3300003203 Bacteria 3064
9 JGI25406J46586_10068009 3300003203 Bacteria 1126
10 JGI25165J46597_1000004 3300003214 Bacteria 667510
11 Ga0006562J51391_1083570 3300003578 Bacteria 3480
12 Ga0055539_1000008 3300003752 Bacteria 537665
13 Ga0055533_1000001 3300003756 Bacteria 1863437
14 Ga0055525_1000840 3300003759 Bacteria 9211
15 Ga0055525_1002311 3300003759 Bacteria 2037
16 Ga0055527_1000001 3300003760 Bacteria 850044
17 Ga0055529_1000018 3300003763 Bacteria 344344
18 Ga0055541_1002301 3300003841 Bacteria 3849
19 Ga0058859_11831639 3300004798 Bacteria 746
20 Ga0058863_11873486 3300004799 Bacteria 737
21 Ga0058861_10008255 3300004800 Bacteria 716
22 Ga0058860_10023170 3300004801 Bacteria 750
23 Ga0065714_10079860 3300005288 Bacteria 2482
24 Ga0070683_100008380 3300005329 Bacteria 8778
25 Ga0070683_100026298 3300005329 Bacteria 5238
26 Ga0070683_100730310 3300005329 Bacteria 949
27 Ga0070677_10317834 3300005333 Bacteria 797
28 Ga0068869_100353197 3300005334 Bacteria 1199
29 Ga0070680_100385350 3300005336 Bacteria 1194
30 Ga0070682_100821590 3300005337 Bacteria 757
31 Ga0070661_100006348 3300005344 Bacteria 8153
32 Ga0070692_10053790 3300005345 Bacteria 2101
33 Ga0070674_100114580 3300005356 Bacteria 1985
34 Ga0070674_100541932 3300005356 Bacteria 975
35 Ga0070659_100381787 3300005366 Bacteria 1187
36 Ga0070714_100000039 3300005435 Bacteria 121007
37 Ga0070713_100063477 3300005436 Bacteria 3097
38 Ga0070713_100426104 3300005436 Bacteria 1243
39 Ga0070710_10607510 3300005437 Bacteria 762
40 Ga0070710_10650797 3300005437 Bacteria 739
41 Ga0070678_100097557 3300005456 Bacteria 2270
42 Ga0070678_100331914 3300005456 Bacteria 1302
43 Ga0070678_100460285 3300005456 Bacteria 1116
44 Ga0070678_100469852 3300005456 Bacteria 1105
45 Ga0070679_100105114 3300005530 Bacteria 2810
46 Ga0070679_100168603 3300005530 Bacteria 2162
47 Ga0070679_100662200 3300005530 Bacteria 987
48 Ga0070684_100064651 3300005535 Bacteria 3210
49 Ga0070684_100992801 3300005535 Bacteria 788
50 Ga0070696_100222559 3300005546 Bacteria 1416
51 Ga0070693_100200871 3300005547 Bacteria 1295
52 Ga0070693_100251022 3300005547 Bacteria 1173
53 Ga0070665_100285998 3300005548 Bacteria 1651
54 Ga0070664_100227321 3300005564 Bacteria 1671
55 Ga0070664_101206516 3300005564 Bacteria 714
56 Ga0068857_100070797 3300005577 Bacteria 3107
57 Ga0068857_100211286 3300005577 Bacteria 1771
58 Ga0068857_100381996 3300005577 Bacteria 1308
59 Ga0068857_100627881 3300005577 Bacteria 1017
60 Ga0068856_100731411 3300005614 Bacteria 1010
61 Ga0070702_100039169 3300005615 Bacteria 2643
62 Ga0070702_100457913 3300005615 Bacteria 927
63 Ga0068852_100660166 3300005616 Bacteria 1054
64 Ga0068866_10100878 3300005718 Bacteria 1592
65 Ga0068861_100062449 3300005719 Bacteria 2862
66 Ga0068861_100530824 3300005719 Bacteria 1069
67 Ga0068851_10322449 3300005834 Bacteria 893
68 Ga0068870_10181743 3300005840 Bacteria 1263
69 Ga0068863_100180238 3300005841 Bacteria 2028
70 Ga0068862_100545124 3300005844 Bacteria 1107
71 Ga0081540_1008923 3300005983 Bacteria 6946
72 Ga0081540_1123311 3300005983 Bacteria 1071
73 Ga0081539_10000352 3300005985 Bacteria 100942
74 Ga0081539_10007039 3300005985 Bacteria 10414
75 Ga0081539_10032371 3300005985 Bacteria 3203
76 Ga0081539_10286784 3300005985 Bacteria 714
77 Ga0070717_10088157 3300006028 Bacteria 2615
78 Ga0075365_10112988 3300006038 Bacteria 1868
79 Ga0075364_10025537 3300006051 Bacteria 3761
80 Ga0075364_10026800 3300006051 Bacteria 3679
81 Ga0075364_10057541 3300006051 Bacteria 2547
82 Ga0075364_10080926 3300006051 Bacteria 2147
83 Ga0075364_10139526 3300006051 Bacteria 1630
84 Ga0075364_10215791 3300006051 Bacteria 1301
85 Ga0070712_100533463 3300006175 Bacteria 987
86 Ga0075369_10101076 3300006186 Bacteria 1294
87 Ga0075428_100115020 3300006844 Bacteria 2930
88 Ga0075428_100216167 3300006844 Bacteria 2071
89 Ga0075430_100055920 3300006846 Bacteria 3318
90 Ga0075430_100114486 3300006846 Bacteria 2247
91 Ga0075430_100124552 3300006846 Bacteria 2148
92 Ga0075431_100109652 3300006847 Bacteria 2849
93 Ga0075431_100144258 3300006847 Bacteria 2454
94 Ga0075434_100675482 3300006871 Bacteria 1051
95 Ga0075429_100088769 3300006880 Bacteria 2695
96 Ga0105244_10041918 3300009036 Bacteria 2370
97 Ga0105244_10047386 3300009036 Bacteria 2205
98 Ga0105240_10369905 3300009093 Bacteria 1621
99 Ga0111539_11473747 3300009094 Bacteria 789
100 Ga0105245_10389792 3300009098 Bacteria 1389
101 Ga0105245_10499134 3300009098 Bacteria 1233
102 Ga0114129_10004855 3300009147 Bacteria 18971
103 Ga0105243_10016689 3300009148 Bacteria 5551
104 Ga0105243_10057279 3300009148 Bacteria 3102
105 Ga0105243_10060196 3300009148 Bacteria 3033
106 Ga0105243_10185209 3300009148 Bacteria 1814
107 Ga0105242_10060957 3300009176 Bacteria 3102
108 Ga0105242_10257820 3300009176 Bacteria 1574
109 Ga0105248_10342412 3300009177 Bacteria 1683
110 Ga0105248_10787119 3300009177 Bacteria 1073
111 Ga0105238_10037839 3300009551 Bacteria 4902
112 Ga0105238_10076535 3300009551 Bacteria 3337
113 Ga0105238_10271205 3300009551 Bacteria 1677
114 Ga0105249_10177166 3300009553 Bacteria 2071
115 Ga0105249_11307442 3300009553 Bacteria 797
116 Ga0105239_11107970 3300010375 Bacteria 911
117 Ga0105239_11886250 3300010375 Bacteria 693
118 Ga0105246_10128132 3300011119 Bacteria 1891
119 Ga0105246_10991788 3300011119 Bacteria 760
120 Ga0157319_1005725 3300012497 Bacteria 866
121 Ga0157371_10002721 3300013102 Bacteria 16651
122 Ga0157371_10256141 3300013102 Bacteria 1261
123 Ga0157371_10538948 3300013102 Bacteria 864
124 Ga0157370_10056690 3300013104 Bacteria 3729
125 Ga0157370_10132584 3300013104 Bacteria 2324
126 Ga0157370_10453141 3300013104 Bacteria 1179
127 Ga0157370_10590283 3300013104 Bacteria 1017
128 Ga0157369_10018556 3300013105 Bacteria 7797
129 Ga0157369_10020802 3300013105 Bacteria 7334
130 Ga0157369_10080708 3300013105 Bacteria 3482
131 Ga0157369_10265963 3300013105 Bacteria 1788
132 Ga0157369_10404765 3300013105 Bacteria 1416
133 Ga0157378_10031377 3300013297 Bacteria 4695
134 Ga0163162_10157520 3300013306 Bacteria 2391
135 Ga0163162_10175534 3300013306 Bacteria 2268
136 Ga0163162_10586181 3300013306 Bacteria 1242
137 Ga0163162_10634250 3300013306 Bacteria 1193
138 Ga0163162_10828628 3300013306 Bacteria 1041
139 Ga0157372_10039598 3300013307 Bacteria 5202
140 Ga0157372_10080461 3300013307 Bacteria 3686
141 Ga0157372_10163231 3300013307 Bacteria 2575
142 Ga0157372_10281506 3300013307 Bacteria 1933
143 Ga0157375_10053337 3300013308 Bacteria 3978
144 Ga0157375_10095249 3300013308 Bacteria 3047
145 Ga0157375_10720030 3300013308 Bacteria 1151
146 Ga0157375_10891900 3300013308 Bacteria 1034
147 Ga0163163_10344685 3300014325 Bacteria 1545
148 Ga0157380_10050189 3300014326 Bacteria 3294
149 Ga0157380_10052971 3300014326 Bacteria 3215
150 Ga0157380_10935208 3300014326 Bacteria 896
151 Ga0157376_10408152 3300014969 Bacteria 1315
152 Ga0163161_10080822 3300017792 Bacteria 2393
153 Ga0197907_10125867 3300020069 Bacteria 1084
154 Ga0197907_10190572 3300020069 Bacteria 1034
155 Ga0197907_10258756 3300020069 Bacteria 1664
156 Ga0197907_10761571 3300020069 Bacteria 1582
157 Ga0197907_10932477 3300020069 Bacteria 916
158 Ga0197907_11256546 3300020069 Bacteria 756
159 Ga0197907_11383208 3300020069 Bacteria 861
160 Ga0206356_10019973 3300020070 Bacteria 1589
161 Ga0206356_10203588 3300020070 Bacteria 891
162 Ga0206356_10500775 3300020070 Bacteria 1240
163 Ga0206356_10717007 3300020070 Bacteria 1571
164 Ga0206356_11624222 3300020070 Bacteria 864
165 Ga0206356_11739052 3300020070 Bacteria 1499
166 Ga0206349_1159386 3300020075 Bacteria 880
167 Ga0206349_1368267 3300020075 Bacteria 932
168 Ga0206349_1972671 3300020075 Bacteria 800
169 Ga0206355_1412026 3300020076 Bacteria 764
170 Ga0206355_1423249 3300020076 Bacteria 617
171 Ga0206355_1611973 3300020076 Bacteria 948
172 Ga0206351_10720129 3300020077 Bacteria 1032
173 Ga0206351_10888382 3300020077 Bacteria 898
174 Ga0206352_10057062 3300020078 Bacteria 1227
175 Ga0206352_10058262 3300020078 Bacteria 847
176 Ga0206352_11224977 3300020078 Bacteria 1571
177 Ga0206350_11332409 3300020080 Bacteria 879
178 Ga0206354_10434866 3300020081 Bacteria 965
179 Ga0206354_10484737 3300020081 Bacteria 1154
180 Ga0206354_10698463 3300020081 Bacteria 1043
181 Ga0206354_10956684 3300020081 Bacteria 938
182 Ga0206354_11270526 3300020081 Bacteria 1548
183 Ga0206354_11591078 3300020081 Bacteria 1657
184 Ga0206354_11686283 3300020081 Bacteria 2242
185 Ga0206353_10147464 3300020082 Bacteria 1113
186 Ga0206353_10432556 3300020082 Bacteria 959
187 Ga0206353_10443024 3300020082 Bacteria 3658
188 Ga0206353_10470645 3300020082 Bacteria 3622
189 Ga0206353_10933407 3300020082 Bacteria 1748
190 Ga0206353_11447911 3300020082 Bacteria 1210
191 Ga0154015_1016208 3300020610 Bacteria 1535
192 Ga0154015_1212596 3300020610 Bacteria 697
193 Ga0154015_1565778 3300020610 Bacteria 680
194 Ga0224712_10053013 3300022467 Bacteria 1586
195 Ga0224712_10059957 3300022467 Bacteria 1513
196 Ga0224712_10088721 3300022467 Bacteria 1291
197 Ga0224712_10121937 3300022467 Bacteria 1130
198 Ga0209566_100050 3300025225 Bacteria 234653
199 Ga0209674_100001 3300025226 Bacteria 4013750
200 Ga0209672_100006 3300025228 Bacteria 1004497
201 Ga0209147_100486 3300025229 Bacteria 23814
202 Ga0209563_100001 3300025230 Bacteria 4013775
203 Ga0209563_100219 3300025230 Bacteria 28679
204 Ga0207427_100010 3300025231 Bacteria 648610
205 Ga0209437_100989 3300025233 Bacteria 9967
206 Ga0209258_101984 3300025242 Bacteria 5937
207 Ga0209646_1000099 3300025246 Bacteria 180436
208 Ga0209677_100001 3300025253 Bacteria 4013787
209 Ga0209677_100187 3300025253 Bacteria 50389
210 Ga0209148_1000015 3300025254 Bacteria 850103
211 Ga0209233_1000001 3300025261 Bacteria 2992747
212 Ga0209233_1022852 3300025261 Bacteria 1593
213 Ga0209455_1000013 3300025272 Bacteria 850103
214 Ga0207655_1113449 3300025728 Bacteria 911
215 Ga0207692_10470526 3300025898 Bacteria 794
216 Ga0207642_10244373 3300025899 Bacteria 1015
217 Ga0207688_10103113 3300025901 Bacteria 1650
218 Ga0207688_10207532 3300025901 Bacteria 1176
219 Ga0207688_10226292 3300025901 Bacteria 1128
220 Ga0207647_10026839 3300025904 Bacteria 3762
221 Ga0207647_10042282 3300025904 Bacteria 2859
222 Ga0207647_10282682 3300025904 Bacteria 947
223 Ga0207643_10175739 3300025908 Bacteria 1294
224 Ga0207705_10029292 3300025909 Bacteria 3925
225 Ga0207707_10430438 3300025912 Bacteria 1130
226 Ga0207695_10258711 3300025913 Bacteria 1638
227 Ga0207671_10506111 3300025914 Bacteria 963
228 Ga0207660_11086500 3300025917 Bacteria 652
229 Ga0207657_10196090 3300025919 Bacteria 1627
230 Ga0207652_10141513 3300025921 Bacteria 2151
231 Ga0207652_10298432 3300025921 Bacteria 1454
232 Ga0207694_10298513 3300025924 Bacteria 1326
233 Ga0207694_10909643 3300025924 Bacteria 744
234 Ga0207650_10203250 3300025925 Bacteria 1588
235 Ga0207659_10104232 3300025926 Bacteria 2145
236 Ga0207659_10429085 3300025926 Bacteria 1110
237 Ga0207687_10410149 3300025927 Bacteria 1116
238 Ga0207687_10567454 3300025927 Bacteria 954
239 Ga0207700_10299165 3300025928 Bacteria 1389
240 Ga0207664_10001112 3300025929 Bacteria 17913
241 Ga0207664_10030114 3300025929 Bacteria 4143
242 Ga0207664_10159236 3300025929 Bacteria 1924
243 Ga0207686_10184360 3300025934 Bacteria 1482
244 Ga0207709_10046435 3300025935 Bacteria 2635
245 Ga0207709_10064798 3300025935 Bacteria 2296
246 Ga0207709_10113781 3300025935 Bacteria 1814
247 Ga0207709_10115069 3300025935 Bacteria 1806
248 Ga0207709_10270201 3300025935 Bacteria 1251
249 Ga0207669_10129934 3300025937 Bacteria 1729
250 Ga0207669_10728024 3300025937 Bacteria 817
251 Ga0207704_10516697 3300025938 Bacteria 965
252 Ga0207665_10056058 3300025939 Bacteria 2660
253 Ga0207665_10664016 3300025939 Bacteria 818
254 Ga0207691_10146806 3300025940 Bacteria 2076
255 Ga0207689_10019688 3300025942 Bacteria 5687
256 Ga0207689_10056449 3300025942 Bacteria 3232
257 Ga0207661_10019379 3300025944 Bacteria 5071
258 Ga0207661_10045354 3300025944 Bacteria 3479
259 Ga0207661_10475707 3300025944 Bacteria 1140
260 Ga0207679_10380897 3300025945 Bacteria 1237
261 Ga0207667_10123116 3300025949 Bacteria 2672
262 Ga0207712_10446151 3300025961 Bacteria 1096
263 Ga0207668_10041772 3300025972 Bacteria 3102
264 Ga0207668_10248899 3300025972 Bacteria 1442
265 Ga0207639_10903985 3300026041 Bacteria 825
266 Ga0207639_11109793 3300026041 Bacteria 742
267 Ga0207678_10224375 3300026067 Bacteria 1609
268 Ga0207702_10128137 3300026078 Bacteria 2281
269 Ga0207702_10280248 3300026078 Bacteria 1576
270 Ga0207702_10466897 3300026078 Bacteria 1227
271 Ga0207648_10074086 3300026089 Bacteria 2967
272 Ga0207648_10311790 3300026089 Bacteria 1412
273 Ga0207648_10463244 3300026089 Bacteria 1156
274 Ga0207674_10010641 3300026116 Bacteria 10402
275 Ga0207674_10019369 3300026116 Bacteria 7372
276 Ga0207674_10040969 3300026116 Bacteria 4793
277 Ga0207674_10671918 3300026116 Bacteria 1000
278 Ga0207675_100102916 3300026118 Bacteria 2691
279 Ga0207675_100368196 3300026118 Bacteria 1411
280 Ga0207675_101676294 3300026118 Bacteria 656
281 Ga0207683_10069279 3300026121 Bacteria 3115
282 Ga0207683_10128007 3300026121 Bacteria 2283
283 Ga0207683_10407011 3300026121 Bacteria 1252
284 Ga0207683_10467654 3300026121 Bacteria 1163
285 Ga0207683_10941221 3300026121 Bacteria 802
286 Ga0207698_10247904 3300026142 Bacteria 1628
287 Ga0265334_10006588 3300028573 Bacteria 4998
288 Ga0307515_10068581 3300028794 Bacteria 4869
289 Ga0307515_10073868 3300028794 Bacteria 4573
290 Ga0307515_10227573 3300028794 Bacteria 1666
291 Ga0307515_10285124 3300028794 Bacteria 1354
292 Ga0307515_10531742 3300028794 Bacteria 785
293 Ga0316179_1041824 3300030734 Bacteria 2204
294 Ga0316182_1203598 3300030745 Bacteria 1289
295 Ga0316182_1275098 3300030745 Bacteria 915
296 Ga0265340_10192404 3300031247 Bacteria 919
297 Ga0307513_10000970 3300031456 Bacteria 41526
298 Ga0307408_100707839 3300031548 Bacteria 906
299 Ga0316575_10005797 3300031665 Bacteria 4412
300 Ga0316579_10001539 3300031691 Bacteria 8412
301 Ga0316579_10005432 3300031691 Bacteria 5145
302 Ga0316576_10003688 3300031727 Bacteria 9035
303 Ga0316576_10010721 3300031727 Bacteria 5969
304 Ga0316576_10061212 3300031727 Bacteria 2758
305 Ga0316578_10052248 3300031728 Bacteria 2394
306 Ga0316578_10065307 3300031728 Bacteria 2148
307 Ga0316578_10067718 3300031728 Bacteria 2110
308 Ga0307405_10895140 3300031731 Bacteria 750
309 Ga0316577_10072570 3300031733 Bacteria 1921
310 Ga0307413_10377778 3300031824 Bacteria 1103
311 Ga0307413_10826002 3300031824 Bacteria 781
312 Ga0307410_10025624 3300031852 Bacteria 3703
313 Ga0307410_10199382 3300031852 Bacteria 1527
314 Ga0307406_10000108 3300031901 Bacteria 48095
315 Ga0307406_10061840 3300031901 Bacteria 2420
316 Ga0307406_10098155 3300031901 Bacteria 1988
317 Ga0307406_10188774 3300031901 Bacteria 1507
318 Ga0307406_10304407 3300031901 Bacteria 1226
319 Ga0307406_10369382 3300031901 Bacteria 1127
320 Ga0307407_10045016 3300031903 Bacteria 2491
321 Ga0307407_10716056 3300031903 Bacteria 755
322 Ga0307412_10050146 3300031911 Bacteria 2754
323 Ga0307412_10053288 3300031911 Bacteria 2681
324 Ga0307412_10173446 3300031911 Bacteria 1615
325 Ga0307409_100064464 3300031995 Bacteria 2878
326 Ga0307409_100092517 3300031995 Bacteria 2482
327 Ga0307409_100204326 3300031995 Bacteria 1770
328 Ga0307416_100094182 3300032002 Bacteria 2582
329 Ga0307416_100137994 3300032002 Bacteria 2210
330 Ga0307416_100385623 3300032002 Bacteria 1433
331 Ga0307414_10135400 3300032004 Bacteria 1920
332 Ga0307414_11034602 3300032004 Bacteria 757
333 Ga0307411_10446978 3300032005 Bacteria 1080
334 Ga0307415_100025820 3300032126 Bacteria 3695
335 Ga0307415_100124925 3300032126 Bacteria 1937
336 Ga0307415_100452608 3300032126 Bacteria 1110
337 Ga0307415_100663420 3300032126 Bacteria 936
338 Ga0316585_10013947 3300032137 Bacteria 2396
339 Ga0316580_10017414 3300032139 Bacteria 2210
340 Ga0316580_10034447 3300032139 Bacteria 1567
341 Ga0316593_10043125 3300032168 Bacteria 1506
342 Ga0316593_10273750 3300032168 Bacteria 635
343 Ga0316592_1057024 3300033524 Bacteria 875
344 Ga0316592_1096410 3300033524 Bacteria 679
345 Ga0316588_1070652 3300033528 Bacteria 857
346 Ga0316596_1019662 3300033541 Bacteria 1714
347 Ga0316596_1033908 3300033541 Bacteria 1332
348 Ga0373960_0142831 3300035121 Bacteria 812
349 Ga0316574_0003174 3300035398 Bacteria 8412
350 Ga0316574_0006251 3300035398 Bacteria 6417
351 Ga0316574_0018303 3300035398 Bacteria 4114
352 Ga0316574_0077584 3300035398 Bacteria 2105
353 Ga0373931_0462877 3300035691 Bacteria 813
354 Ga0373937_1225718 3300036401 Bacteria 699
355 Ga0316582_0001733 3300036647 Bacteria 9811
356 Ga0316582_0049547 3300036647 Bacteria 2657
357 Ga0316582_0101695 3300036647 Bacteria 1904
358 Ga0316582_0672790 3300036647 Bacteria 711
359 Ga0316584_0069754 3300036712 Bacteria 2635
360 Ga0316584_0110376 3300036712 Bacteria 2058
361 Ga0316584_0169758 3300036712 Bacteria 1618
362 Ga0316584_0606809 3300036712 Bacteria 758
363 Ga0395899_0001589 3300037312 Bacteria 19099
364 Ga0395899_0008073 3300037312 Bacteria 8106
365 Ga0395899_0016290 3300037312 Bacteria 5666
366 Ga0395899_0025982 3300037312 Bacteria 4419
367 Ga0395899_0101263 3300037312 Bacteria 2079
368 Ga0395900_0024033 3300037418 Bacteria 6235
369 Ga0395900_0048256 3300037418 Bacteria 4386
370 Ga0395900_0053242 3300037418 Bacteria 4165
371 Ga0395900_0055561 3300037418 Bacteria 4077
372 Ga0395900_0127183 3300037418 Bacteria 2613
373 Ga0395900_0140387 3300037418 Bacteria 2474
374 Ga0395900_0142025 3300037418 Bacteria 2458
375 Ga0395900_0181777 3300037418 Bacteria 2137
376 Ga0395900_0263204 3300037418 Bacteria 1721
377 Ga0395900_0618887 3300037418 Bacteria 1022
378 Ga0395900_0630041 3300037418 Bacteria 1011
379 Ga0395898_0000131 3300037466 Bacteria 192369
380 Ga0395898_0007362 3300037466 Bacteria 11684
381 Ga0395898_0014196 3300037466 Bacteria 8191
382 Ga0395898_0032980 3300037466 Bacteria 5169
383 Ga0395898_0034838 3300037466 Bacteria 5011
384 Ga0395898_0073982 3300037466 Bacteria 3292
385 Ga0395898_0126923 3300037466 Bacteria 2444
386 Ga0395905_0001103 3300037471 Bacteria 33927
387 Ga0395905_0065536 3300037471 Bacteria 3401
388 Ga0395905_0112062 3300037471 Bacteria 2562
389 Ga0316581_0035049 3300037588 Bacteria 1520
390 Ga0395901_0009293 3300038443 Bacteria 9964
391 Ga0395901_0013369 3300038443 Bacteria 8340
392 Ga0395901_0018977 3300038443 Bacteria 7031
393 Ga0395901_0048147 3300038443 Bacteria 4427
394 Ga0395901_0104376 3300038443 Bacteria 2975
395 Ga0395901_0118903 3300038443 Bacteria 2776
396 Ga0395901_0174201 3300038443 Bacteria 2257
397 Ga0395901_0189786 3300038443 Bacteria 2155
398 Ga0395901_0282214 3300038443 Bacteria 1725
399 Ga0395901_0356711 3300038443 Bacteria 1508
400 Ga0400485_01906 3300038735 Bacteria 55321
401 Ga0400488_21867 3300038741 Bacteria 4428
402 Ga0400486_20001 3300038742 Bacteria 106597
403 Ga0436363_0475003 3300039450 Bacteria 1964
404 Ga0436362_0058353 3300039453 Bacteria 671
405 Ga0439466_0103961 3300041411 Bacteria 884
406 Ga0451791_0360065 3300041451 Bacteria 992
407 Ga0451791_1525161 3300041451 Bacteria 799
408 Ga0451793_1114004 3300041452 Bacteria 1878
409 Ga0451795_0152704 3300041456 Bacteria 948
410 Ga0451798_0543836 3300041458 Bacteria 2137
411 Ga0451800_0549017 3300041459 Bacteria 724
412 Ga0451802_0181093 3300041460 Bacteria 849
413 Ga0451804_0464391 3300041463 Bacteria 861
414 Ga0451807_0200845 3300041486 Bacteria 1387
415 Ga0451807_1080106 3300041486 Bacteria 858
416 Ga0451835_0268814 3300041492 Bacteria 718
417 Ga0451837_1272064 3300041494 Bacteria 2225
418 Ga0451837_1312361 3300041494 Bacteria 722
419 Ga0451849_0029660 3300041505 Bacteria 930
420 Ga0451851_0154827 3300041507 Bacteria 2106
421 Ga0451855_1012064 3300041511 Bacteria 716
422 Ga0451853_0604592 3300041512 Bacteria 1192
423 Ga0451853_0817060 3300041512 Bacteria 889
424 Ga0439431_0044622 3300041997 Bacteria 1137
425 Ga0439449_0078161 3300042007 Bacteria 1220
426 Ga0439449_0124342 3300042007 Bacteria 958
427 Ga0439446_0133797 3300042156 Bacteria 806
428 Ga0450918_039104 3300042531 Bacteria 849
429 Ga0466969_0247626 3300044656 Bacteria 808
430 Ga0466972_0024228 3300044658 Bacteria 3012
431 Ga0466972_0068242 3300044658 Bacteria 1698
432 Ga0466972_0275783 3300044658 Bacteria 786
433 Ga0466965_0005741 3300044683 Bacteria 5601
434 Ga0466965_0048316 3300044683 Bacteria 2108
435 Ga0466965_0053104 3300044683 Bacteria 2014
436 Ga0466965_0074500 3300044683 Bacteria 1710
437 Ga0466965_0177056 3300044683 Bacteria 1124
438 Ga0466965_0519297 3300044683 Bacteria 670
439 Ga0466966_0010911 3300044684 Bacteria 6034
440 Ga0466961_0009823 3300044693 Bacteria 6092
441 Ga0466961_0038827 3300044693 Bacteria 3053
442 Ga0466963_0016854 3300044694 Bacteria 4549
443 Ga0466963_0137935 3300044694 Bacteria 1688
444 Ga0466963_0140704 3300044694 Bacteria 1672
445 Ga0466964_0229806 3300044706 Bacteria 905
446 Ga0466971_0032302 3300044719 Bacteria 2345
447 Ga0466971_0064402 3300044719 Bacteria 1659
448 Ga0466971_0121344 3300044719 Bacteria 1210
449 Ga0466968_0070487 3300044735 Bacteria 1521
450 Ga0466968_0217778 3300044735 Bacteria 898
451 Ga0466970_0012124 3300044765 Bacteria 4401
452 Ga0466970_0117860 3300044765 Bacteria 1453
453 Ga0466970_0134122 3300044765 Bacteria 1361
454 Ga0466970_0141194 3300044765 Bacteria 1327
455 Ga0466970_0315851 3300044765 Bacteria 883
456 Ga0466957_0089707 3300044842 Bacteria 1925
457 Ga0466957_0106008 3300044842 Bacteria 1777
458 Ga0466957_0132765 3300044842 Bacteria 1597
459 Ga0466957_0168313 3300044842 Bacteria 1426
460 Ga0466960_0003363 3300044901 Bacteria 6141
461 Ga0466960_0011156 3300044901 Bacteria 3748
462 Ga0466960_0073372 3300044901 Bacteria 1708
463 Ga0466960_0086332 3300044901 Bacteria 1591
464 Ga0466960_0180965 3300044901 Bacteria 1142
465 Ga0466960_0405015 3300044901 Bacteria 786
466 Ga0466959_0027280 3300045049 Bacteria 4236
467 Ga0466959_0076146 3300045049 Bacteria 2423
468 Ga0466959_0119059 3300045049 Bacteria 1879
469 Ga0466958_0065933 3300045836 Bacteria 2210
470 Ga0466958_0346350 3300045836 Bacteria 956
471 Ga0466958_0423770 3300045836 Bacteria 860
472 Ga0466967_0005856 3300045976 Bacteria 8602
473 Ga0466967_0101057 3300045976 Bacteria 2635
474 Ga0466967_0249316 3300045976 Bacteria 1696
475 Ga0466967_0270336 3300045976 Bacteria 1629
476 Ga0466967_0678802 3300045976 Bacteria 1020
477 Ga0495627_001650 3300046453 Bacteria 12395
478 Ga0495638_0019724 3300046460 Bacteria 4458
479 Ga0495664_0153888 3300046477 Bacteria 1395
480 Ga0495608_0399833 3300046511 Bacteria 840
481 Ga0495644_0296643 3300046523 Bacteria 632
482 Ga0495640_0061108 3300046533 Bacteria 2561
483 Ga0495587_0149292 3300046536 Bacteria 1332
484 Ga0495633_0106184 3300046558 Bacteria 1303
485 Ga0495667_0049897 3300046559 Bacteria 2763
486 Ga0495667_0181636 3300046559 Bacteria 1350
487 Ga0495656_0027647 3300046615 Bacteria 2268
488 Ga0495656_0141099 3300046615 Bacteria 1156
489 Ga0495634_0121813 3300046642 Bacteria 1670
490 Ga0495625_0100760 3300046660 Bacteria 1985
491 Ga0495635_0087097 3300046663 Bacteria 2137
492 Ga0495635_0232413 3300046663 Bacteria 1245
493 Ga0495647_0051851 3300046681 Bacteria 1596
494 Ga0495613_0258756 3300046689 Bacteria 1213
495 Ga0495624_0416627 3300046690 Bacteria 806
496 Ga0495649_0348421 3300046694 Bacteria 749
497 Ga0495600_0281241 3300046809 Bacteria 1053
498 Ga0495581_0057647 3300047315 Bacteria 2242
499 Ga0495581_0444972 3300047315 Bacteria 755
500 Ga0495674_0319214 3300047319 Bacteria 1266
501 Ga0495674_0797331 3300047319 Bacteria 735
502 Ga0495672_0017547 3300047320 Bacteria 4785
503 Ga0495680_0280339 3300047322 Bacteria 1175
504 Ga0495680_0588006 3300047322 Bacteria 746
505 Ga0495675_0081054 3300047444 Bacteria 2044
506 Ga0495675_0486394 3300047444 Bacteria 710
507 Ga0495684_0533353 3300047471 Bacteria 802
508 Ga0495686_0113671 3300047472 Bacteria 1621
509 Ga0495686_0269684 3300047472 Bacteria 950
510 Ga0495686_0380361 3300047472 Bacteria 762
511 Ga0495686_0454040 3300047472 Bacteria 680
512 Ga0495602_0082893 3300048088 Bacteria 2689
513 Ga0496100_0055811 3300048903 Bacteria 2582
514 Ga0496100_0086725 3300048903 Bacteria 2127
515 Ga0496100_0208075 3300048903 Bacteria 1429
516 Ga0496100_0231255 3300048903 Bacteria 1360
517 Ga0496101_0025696 3300048904 Bacteria 4088
518 Ga0496101_0043514 3300048904 Bacteria 3209
519 Ga0496101_0108385 3300048904 Bacteria 2088
520 Ga0496101_0237973 3300048904 Bacteria 1416
521 Ga0496101_0292037 3300048904 Bacteria 1276
522 Ga0496101_0553153 3300048904 Bacteria 910
523 Ga0496101_0647089 3300048904 Bacteria 835
524 Ga0496101_0688533 3300048904 Bacteria 807
525 Ga0496102_0007945 3300048905 Bacteria 9066
526 Ga0496102_0040977 3300048905 Bacteria 4192
527 Ga0496102_0044215 3300048905 Bacteria 4041
528 Ga0496103_0002549 3300048906 Bacteria 11411
529 Ga0496103_0020679 3300048906 Bacteria 3956
530 Ga0496103_0058136 3300048906 Bacteria 2402
531 Ga0496104_0102883 3300048907 Bacteria 2736
532 Ga0496104_0116043 3300048907 Bacteria 2569
533 Ga0496104_0481771 3300048907 Bacteria 1152
534 Ga0496104_0890207 3300048907 Bacteria 795
535 Ga0496105_0007370 3300048908 Bacteria 8513
536 Ga0496105_0035840 3300048908 Bacteria 4085
537 Ga0496105_0252017 3300048908 Bacteria 1430
538 Ga0496105_0261843 3300048908 Bacteria 1398
539 Ga0496106_0054358 3300048909 Bacteria 3025
540 Ga0496106_0388376 3300048909 Bacteria 1122
541 Ga0496107_0055402 3300048910 Bacteria 2864
542 Ga0496107_0142770 3300048910 Bacteria 1770
543 Ga0496107_0170876 3300048910 Bacteria 1613
544 Ga0496108_0074045 3300048911 Bacteria 2875
545 Ga0496108_0448302 3300048911 Bacteria 1127
546 Ga0496109_0123867 3300048912 Bacteria 2409
547 Ga0496109_0145515 3300048912 Bacteria 2217
548 Ga0496109_0277843 3300048912 Bacteria 1578
549 Ga0496109_0304969 3300048912 Bacteria 1502
550 Ga0496109_1278650 3300048912 Bacteria 670
551 Ga0496109_1409733 3300048912 Bacteria 632
552 Ga0496110_0003842 3300048913 Bacteria 11569
553 Ga0496110_0075302 3300048913 Bacteria 2999
554 Ga0496110_0075641 3300048913 Bacteria 2992
555 Ga0496110_0227332 3300048913 Bacteria 1697
556 Ga0496110_0485187 3300048913 Bacteria 1126
557 Ga0496111_0037450 3300048914 Bacteria 3471
558 Ga0496111_0817421 3300048914 Bacteria 674
559 Ga0496112_0069265 3300048915 Bacteria 3485
560 Ga0496112_0093514 3300048915 Bacteria 2977
561 Ga0496112_0270044 3300048915 Bacteria 1649
562 Ga0496113_0124755 3300048916 Bacteria 2016
563 Ga0496113_0191257 3300048916 Bacteria 1624
564 Ga0496113_0257422 3300048916 Bacteria 1394
565 Ga0496113_0497806 3300048916 Bacteria 978
566 Ga0496114_0021664 3300048917 Bacteria 5230
567 Ga0496114_0023550 3300048917 Bacteria 5025
568 Ga0496114_0040282 3300048917 Bacteria 3867
569 Ga0496114_0081857 3300048917 Bacteria 2728
570 Ga0496114_0173315 3300048917 Bacteria 1881
571 Ga0496114_0195696 3300048917 Bacteria 1769
572 Ga0496114_0253845 3300048917 Bacteria 1547
573 Ga0496114_0429517 3300048917 Bacteria 1170
574 Ga0496115_0074021 3300048918 Bacteria 2765
575 Ga0496115_0312547 3300048918 Bacteria 1286
576 Ga0496115_0414204 3300048918 Bacteria 1092
577 Ga0496115_0526180 3300048918 Bacteria 948
578 Ga0496116_0019712 3300048919 Bacteria 5155
579 Ga0496116_0134225 3300048919 Bacteria 1405
580 Ga0496117_0000468 3300048920 Bacteria 67418
581 Ga0496117_0001642 3300048920 Bacteria 31427
582 Ga0496117_0016338 3300048920 Bacteria 6266
583 Ga0496117_0018386 3300048920 Bacteria 5789
584 Ga0496117_0052644 3300048920 Bacteria 2866
585 Ga0496117_0069032 3300048920 Bacteria 2382
586 Ga0496117_0103701 3300048920 Bacteria 1792
587 Ga0496117_0122293 3300048920 Bacteria 1596
588 Ga0496117_0179138 3300048920 Bacteria 1220
589 Ga0496117_0443444 3300048920 Bacteria 644
590 Ga0496118_0004353 3300048921 Bacteria 16850
591 Ga0496118_0011768 3300048921 Bacteria 8501
592 Ga0496118_0017452 3300048921 Bacteria 6533
593 Ga0496118_0058757 3300048921 Bacteria 2870
594 Ga0496118_0082443 3300048921 Bacteria 2253
595 Ga0496118_0210821 3300048921 Bacteria 1140
596 Ga0496118_0356933 3300048921 Bacteria 776
597 Ga0496118_0438540 3300048921 Bacteria 667
598 Ga0496119_0001447 3300048922 Bacteria 28549
599 Ga0496119_0002168 3300048922 Bacteria 22033
600 Ga0496119_0002636 3300048922 Bacteria 19439
601 Ga0496119_0003788 3300048922 Bacteria 15460
602 Ga0496119_0008817 3300048922 Bacteria 8779
603 Ga0496119_0015749 3300048922 Bacteria 5797
604 Ga0496119_0105437 3300048922 Bacteria 1575
605 Ga0496119_0202951 3300048922 Bacteria 1025
606 Ga0496120_0000565 3300048923 Bacteria 56440
607 Ga0496120_0032972 3300048923 Bacteria 3116
608 Ga0496120_0086267 3300048923 Bacteria 1688
609 Ga0496121_0000040 3300048924 Bacteria 348494
610 Ga0496121_0083728 3300048924 Bacteria 2517
611 Ga0496121_0202409 3300048924 Bacteria 1414
612 Ga0496122_0000054 3300048925 Bacteria 259135
613 Ga0496122_0000240 3300048925 Bacteria 123001
614 Ga0496122_0004129 3300048925 Bacteria 18364
615 Ga0496122_0004482 3300048925 Bacteria 17265
616 Ga0496122_0044311 3300048925 Bacteria 3474
617 Ga0496122_0054530 3300048925 Bacteria 3001
618 Ga0496122_0153675 3300048925 Bacteria 1416
619 Ga0496123_0000039 3300048926 Bacteria 259107
620 Ga0496123_0000076 3300048926 Bacteria 194050
621 Ga0496123_0006901 3300048926 Bacteria 10864
622 Ga0496123_0007074 3300048926 Bacteria 10667
623 Ga0496123_0120762 3300048926 Bacteria 1475
624 Ga0496123_0148414 3300048926 Bacteria 1269
625 Ga0496124_0002700 3300048927 Bacteria 22676
626 Ga0496124_0002802 3300048927 Bacteria 22087
627 Ga0496124_0003349 3300048927 Bacteria 19720
628 Ga0496124_0103941 3300048927 Bacteria 2297
629 Ga0496124_0110410 3300048927 Bacteria 2214
630 Ga0496124_0365839 3300048927 Bacteria 1014
631 Ga0496124_0415576 3300048927 Bacteria 929
632 Ga0496125_0000061 3300048928 Bacteria 262739
633 Ga0496125_0005037 3300048928 Bacteria 14911
634 Ga0496125_0013256 3300048928 Bacteria 8113
635 Ga0496125_0024358 3300048928 Bacteria 5567
636 Ga0496125_0035020 3300048928 Bacteria 4414
637 Ga0496125_0062145 3300048928 Bacteria 2989
638 Ga0496125_0294691 3300048928 Bacteria 997
639 Ga0496126_0003246 3300048929 Bacteria 20779
640 Ga0496126_0006703 3300048929 Bacteria 12792
641 Ga0496126_0008752 3300048929 Bacteria 10867
642 Ga0496126_0017018 3300048929 Bacteria 7253
643 Ga0496126_0075480 3300048929 Bacteria 2992
644 Ga0496126_0082638 3300048929 Bacteria 2837
645 Ga0496126_0088488 3300048929 Bacteria 2727
646 Ga0496126_0428540 3300048929 Bacteria 1068
647 Ga0496126_0621418 3300048929 Bacteria 849
648 Ga0501306_032927 3300049127 Bacteria 778
649 Ga0501306_033692 3300049127 Bacteria 771
650 Ga0501306_050051 3300049127 Bacteria 668
651 Ga0501309_014427 3300049129 Bacteria 1061
652 Ga0501309_050139 3300049129 Bacteria 654
653 Ga0501304_007091 3300049160 Bacteria 918
654 Ga0501304_020910 3300049160 Bacteria 648
655 Ga0501305_062041 3300049161 Bacteria 645
656 Ga0501311_021168 3300049527 Bacteria 885
657 Ga0501311_059086 3300049527 Bacteria 616
658 Ga0501312_052982 3300049528 Bacteria 688
659 Ga0501314_021815 3300049530 Bacteria 670
660 Ga0501314_028252 3300049530 Bacteria 614
661 Ga0501315_018264 3300049531 Bacteria 924
662 Ga0501317_008631 3300049533 Bacteria 1178
663 Ga0501317_021348 3300049533 Bacteria 879
664 Ga0501317_033401 3300049533 Bacteria 757
665 Ga0501317_033629 3300049533 Bacteria 755
666 Ga0501318_004758 3300049534 Bacteria 1317
667 Ga0501318_006907 3300049534 Bacteria 1172
668 Ga0501318_012840 3300049534 Bacteria 966
669 Ga0501319_010515 3300049535 Bacteria 737
670 Ga0501319_019111 3300049535 Bacteria 604
671 Ga0501321_009484 3300049537 Bacteria 1052
672 Ga0501321_011536 3300049537 Bacteria 987
673 Ga0501323_014682 3300049539 Bacteria 982
674 Ga0501325_005801 3300049541 Bacteria 993
675 Ga0501325_023591 3300049541 Bacteria 665
676 Ga0501031_0012930 3300049568 Bacteria 5449
677 Ga0501031_0014748 3300049568 Bacteria 5080
678 Ga0501031_0108135 3300049568 Bacteria 1815
679 Ga0501031_0172007 3300049568 Bacteria 1415
680 Ga0501031_0191237 3300049568 Bacteria 1336
681 Ga0501032_0002467 3300049569 Bacteria 14446
682 Ga0501032_0016609 3300049569 Bacteria 5175
683 Ga0501032_0083083 3300049569 Bacteria 2130
684 Ga0501032_0137185 3300049569 Bacteria 1612
685 Ga0501032_0145814 3300049569 Bacteria 1558
686 Ga0501033_0038626 3300049570 Bacteria 3567
687 Ga0501033_0232255 3300049570 Bacteria 1310
688 Ga0501033_0324411 3300049570 Bacteria 1081
689 Ga0501034_0002512 3300049571 Bacteria 22010
690 Ga0501034_0003477 3300049571 Bacteria 17905
691 Ga0501034_0019043 3300049571 Bacteria 7032
692 Ga0501034_0050471 3300049571 Bacteria 4196
693 Ga0501034_0064120 3300049571 Bacteria 3688
694 Ga0501036_0036856 3300049572 Bacteria 4137
695 Ga0501037_0001179 3300049573 Bacteria 19299
696 Ga0501037_0271350 3300049573 Bacteria 1184
697 Ga0501038_0015936 3300049574 Bacteria 6830
698 Ga0501038_0021169 3300049574 Bacteria 5841
699 Ga0501038_0061060 3300049574 Bacteria 3224
700 Ga0501038_0080407 3300049574 Bacteria 2747
701 Ga0501038_0089014 3300049574 Bacteria 2590
702 Ga0501038_0174653 3300049574 Bacteria 1737
703 Ga0501038_0483763 3300049574 Bacteria 948
704 Ga0501038_0704007 3300049574 Bacteria 757
705 Ga0501039_0000678 3300049575 Bacteria 24589
706 Ga0501039_0155506 3300049575 Bacteria 1796
707 Ga0501039_0155636 3300049575 Bacteria 1795
708 Ga0501039_0575495 3300049575 Bacteria 883
709 Ga0501040_0002965 3300049576 Bacteria 10987
710 Ga0501040_0264941 3300049576 Bacteria 1226
711 Ga0501040_0355930 3300049576 Bacteria 1049
712 Ga0501040_0370668 3300049576 Bacteria 1027
713 Ga0501041_0113126 3300049577 Bacteria 1684
714 Ga0501041_0325976 3300049577 Bacteria 969
715 Ga0501042_0119498 3300049578 Bacteria 1897
716 Ga0501042_0121018 3300049578 Bacteria 1884
717 Ga0501042_0184111 3300049578 Bacteria 1507
718 Ga0501042_0754395 3300049578 Bacteria 708
719 Ga0501042_0854212 3300049578 Bacteria 663
720 Ga0501043_0014495 3300049579 Bacteria 6170
721 Ga0501043_0032686 3300049579 Bacteria 4091
722 Ga0501043_0037822 3300049579 Bacteria 3796
723 Ga0501043_0161542 3300049579 Bacteria 1750
724 Ga0501043_0197623 3300049579 Bacteria 1562
725 Ga0501043_0268327 3300049579 Bacteria 1311
726 Ga0501046_0005735 3300049580 Bacteria 11080
727 Ga0501046_0005990 3300049580 Bacteria 10819
728 Ga0501046_0915421 3300049580 Bacteria 611
729 Ga0501047_0060896 3300049581 Bacteria 3641
730 Ga0501047_0082971 3300049581 Bacteria 3081
731 Ga0501047_0196700 3300049581 Bacteria 1878
732 Ga0501047_0234502 3300049581 Bacteria 1687
733 Ga0501048_0007529 3300049582 Bacteria 8251
734 Ga0501048_0053519 3300049582 Bacteria 2870
735 Ga0501067_0165315 3300049583 Bacteria 1232
736 Ga0501068_0037663 3300049584 Bacteria 2895
737 Ga0501068_0199775 3300049584 Bacteria 1268
738 Ga0501070_0000198 3300049586 Bacteria 56232
739 Ga0501070_0008288 3300049586 Bacteria 8785
740 Ga0501070_0351961 3300049586 Bacteria 1195
741 Ga0501070_0361877 3300049586 Bacteria 1177
742 Ga0501071_0037112 3300049587 Bacteria 3478
743 Ga0501071_0111922 3300049587 Bacteria 2018
744 Ga0501072_0015828 3300049588 Bacteria 5783
745 Ga0501072_0156811 3300049588 Bacteria 1815
746 Ga0501073_0000029 3300049589 Bacteria 117147
747 Ga0501073_0268591 3300049589 Bacteria 1177
748 Ga0501074_0028586 3300049590 Bacteria 4041
749 Ga0501074_0214328 3300049590 Bacteria 1371
750 Ga0501075_0152142 3300049591 Bacteria 1763
751 Ga0501076_0000795 3300049592 Bacteria 20413
752 Ga0501076_0426341 3300049592 Bacteria 1091
753 Ga0501079_0314149 3300049741 Bacteria 1226
754 Ga0501080_0099182 3300049742 Bacteria 2703
755 Ga0501080_0111243 3300049742 Bacteria 2539
756 Ga0501080_0205219 3300049742 Bacteria 1808
757 Ga0501081_0068380 3300049743 Bacteria 2473
758 Ga0501083_0000003 3300049744 Bacteria 235949
759 Ga0501083_0044350 3300049744 Bacteria 3010
760 Ga0501035_0005688 3300049822 Bacteria 11765
761 Ga0501035_0038886 3300049822 Bacteria 4307
762 Ga0501035_0636661 3300049822 Bacteria 866
763 Ga0501044_0001379 3300049823 Bacteria 28508
764 Ga0501044_0025724 3300049823 Bacteria 6239
765 Ga0501044_0036713 3300049823 Bacteria 5125
766 Ga0501044_0395774 3300049823 Bacteria 1295
767 Ga0501045_0071306 3300049824 Bacteria 2557
768 Ga0501045_0106551 3300049824 Bacteria 2077
769 Ga0501045_0130034 3300049824 Bacteria 1871
770 nmdc:mga00v17_103909_c1 3300050491 Bacteria 1796
771 nmdc:mga00v17_2023_c2 3300050491 Bacteria 10008
772 nmdc:mga00v17_44017_c1 3300050491 Bacteria 2690
773 nmdc:mga00v17_50861_c1 3300050491 Bacteria 2519
774 nmdc:mga00v17_56106_c1 3300050491 Bacteria 2407
775 nmdc:mga00v17_622889_c1 3300050491 Bacteria 695
776 nmdc:mga00v17_623289_c1 3300050491 Bacteria 695
777 nmdc:mga07m45_42585_c1 3300050496 Bacteria 2545
778 nmdc:mga05p37_3914_c1 3300050507 Bacteria 17434
779 nmdc:mga09592_1805_c1 3300050508 Bacteria 9814
780 nmdc:mga0qj67_1059_c2 3300050509 Bacteria 10340
781 nmdc:mga0qj67_206148_c1 3300050509 Bacteria 1597
782 nmdc:mga0qj67_549494_c1 3300050509 Bacteria 926
783 nmdc:mga06r32_1833_c2 3300050510 Bacteria 17582
784 nmdc:mga06r32_392601_c1 3300050510 Bacteria 1370
785 nmdc:mga0sz30_101031_c1 3300050516 Bacteria 1260
786 nmdc:mga0sz30_184735_c1 3300050516 Bacteria 925
787 nmdc:mga0sz30_3162_c1 3300050516 Bacteria 4539
788 Ga0500635_0000012 3300053080 Bacteria 138781
789 Ga0495655_0043362 3300053083 Bacteria 1159
790 Ga0495619_0292551 3300053085 Bacteria 1128
791 Ga0495619_0302488 3300053085 Bacteria 1108
792 Ga0495619_0585344 3300053085 Bacteria 764
793 Ga0500644_0005516 3300053088 Bacteria 3199
794 Ga0500562_001128 3300053108 Bacteria 6577
795 Ga0500559_0000194 3300053136 Bacteria 48792
796 Ga0500559_0000264 3300053136 Bacteria 40984
797 Ga0500559_0000565 3300053136 Bacteria 25683
798 Ga0500559_0035365 3300053136 Bacteria 2157
799 Ga0500568_0000064 3300053139 Bacteria 106056
800 Ga0500568_0000534 3300053139 Bacteria 28043
801 Ga0500568_0046973 3300053139 Bacteria 1711
802 Ga0500573_0000017 3300053140 Bacteria 181426
803 Ga0500573_0025610 3300053140 Bacteria 3392
804 Ga0500604_0023186 3300053151 Bacteria 1769
805 Ga0500616_0000553 3300053153 Bacteria 46504
806 Ga0500616_0001343 3300053153 Bacteria 24047
807 Ga0500616_0026369 3300053153 Bacteria 3218
808 Ga0501084_0028089 3300054114 Bacteria 4701
809 Ga0501084_0357771 3300054114 Bacteria 1233
810 Ga0590075_043434 3300059424 Bacteria 1150
811 Ga0587093_025631 3300059478 Bacteria 819
812 Ga0587073_0153811 3300059492 Bacteria 653
813 Ga0587090_068946 3300059510 Bacteria 687
814 Ga0587092_030583 3300059512 Bacteria 888
815 Ga0587094_058652 3300059513 Bacteria 669
816 Ga0587098_045127 3300059604 Bacteria 653
817 Ga0587106_040413 3300059605 Bacteria 789
818 Ga0587101_006042 3300059623 Bacteria 1370
819 Ga0587113_021139 3300059625 Bacteria 685
820 Ga0587115_041102 3300059626 Bacteria 722
821 Ga0587068_052078 3300059641 Bacteria 769
822 Ga0587107_038675 3300059652 Bacteria 761
823 Ga0587119_037768 3300059658 Bacteria 683
824 Ga0587124_006163 3300059660 Bacteria 980
825 Ga0587071_018327 3300060344 Bacteria 1257
826 Ga0501082_0066814 3300060353 Bacteria 3096
827 Ga0466962_0016187 3300061719 Bacteria 3597
828 Ga0466962_0344707 3300061719 Bacteria 741
829 Ga0530510_0086382 3300061734 Bacteria 2285
830 Ga0530510_0093049 3300061734 Bacteria 2200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10064798 Ga0207709_100647982 168
2 3300025937 Ga0207669_10728024 Ga0207669_107280242 168
3 3300026121 Ga0207683_10128007 Ga0207683_101280072 168
4 3300030745 Ga0316182_1275098 Ga0316182_12750982 175
5 3300006844 Ga0075428_100216167 Ga0075428_1002161672 177
6 3300006846 Ga0075430_100124552 Ga0075430_1001245523 177
7 3300006847 Ga0075431_100144258 Ga0075431_1001442583 177
8 3300030734 Ga0316179_1041824 Ga0316179_10418243 177
9 3300031995 Ga0307409_100204326 Ga0307409_1002043262 177
10 3300037418 Ga0395900_0263204 Ga0395900_0263204_909_1472 177
11 3300037466 Ga0395898_0073982 Ga0395898_0073982_1731_2294 177
12 3300037471 Ga0395905_0065536 Ga0395905_0065536_1950_2513 177
13 3300038443 Ga0395901_0356711 Ga0395901_0356711_758_1321 177
14 3300041505 Ga0451849_0029660 Ga0451849_0029660_129_692 177
15 3300044683 Ga0466965_0074500 Ga0466965_0074500_456_1022 177
16 3300048912 Ga0496109_1409733 Ga0496109_1409733_46_609 177
17 3300048913 Ga0496110_0485187 Ga0496110_0485187_184_747 177
18 3300048915 Ga0496112_0069265 Ga0496112_0069265_1974_2537 177
19 3300049160 Ga0501304_020910 Ga0501304_020910_69_632 177
20 3300049533 Ga0501317_021348 Ga0501317_021348_73_636 177
21 3300050509 nmdc:mga0qj67_206148_c1 nmdc:mga0qj67_206148_c1_808_1368 177
22 3300050510 nmdc:mga06r32_392601_c1 nmdc:mga06r32_392601_c1_210_770 177
23 3300053083 Ga0495655_0043362 Ga0495655_0043362_179_742 177
24 3300059492 Ga0587073_0153811 Ga0587073_0153811_76_639 177
25 3300059604 Ga0587098_045127 Ga0587098_045127_68_631 177
26 3300059605 Ga0587106_040413 Ga0587106_040413_151_714 177
27 3300059623 Ga0587101_006042 Ga0587101_006042_242_805 177
28 3300059641 Ga0587068_052078 Ga0587068_052078_41_601 177
29 3300059658 Ga0587119_037768 Ga0587119_037768_45_608 177
30 3300060344 Ga0587071_018327 Ga0587071_018327_384_947 177
31 3300005356 Ga0070674_100541932 Ga0070674_1005419322 178
32 3300005456 Ga0070678_100097557 Ga0070678_1000975572 178
33 3300005547 Ga0070693_100251022 Ga0070693_1002510222 178
34 3300005615 Ga0070702_100039169 Ga0070702_1000391694 178
35 3300005718 Ga0068866_10100878 Ga0068866_101008782 178
36 3300009098 Ga0105245_10499134 Ga0105245_104991342 178
37 3300009148 Ga0105243_10016689 Ga0105243_100166896 178
38 3300009176 Ga0105242_10257820 Ga0105242_102578202 178
39 3300009551 Ga0105238_10037839 Ga0105238_100378393 178
40 3300013297 Ga0157378_10031377 Ga0157378_100313775 178
41 3300013306 Ga0163162_10157520 Ga0163162_101575204 178
42 3300013308 Ga0157375_10053337 Ga0157375_100533372 178
43 3300014326 Ga0157380_10050189 Ga0157380_100501895 178
44 3300025899 Ga0207642_10244373 Ga0207642_102443732 178
45 3300025924 Ga0207694_10298513 Ga0207694_102985132 178
46 3300025927 Ga0207687_10410149 Ga0207687_104101492 178
47 3300025949 Ga0207667_10123116 Ga0207667_101231163 178
48 3300025972 Ga0207668_10041772 Ga0207668_100417722 178
49 3300026089 Ga0207648_10074086 Ga0207648_100740864 178
50 3300031727 Ga0316576_10003688 Ga0316576_100036885 179
51 3300035398 Ga0316574_0003174 Ga0316574_0003174_883_1446 179
52 3300046511 Ga0495608_0399833 Ga0495608_0399833_88_648 179
53 3300005356 Ga0070674_100114580 Ga0070674_1001145802 180
54 3300005456 Ga0070678_100331914 Ga0070678_1003319142 180
55 3300005548 Ga0070665_100285998 Ga0070665_1002859983 180
56 3300005564 Ga0070664_101206516 Ga0070664_1012065161 180
57 3300005615 Ga0070702_100457913 Ga0070702_1004579132 180
58 3300009094 Ga0111539_11473747 Ga0111539_114737472 180
59 3300009148 Ga0105243_10057279 Ga0105243_100572794 180
60 3300009176 Ga0105242_10060957 Ga0105242_100609573 180
61 3300009177 Ga0105248_10342412 Ga0105248_103424122 180
62 3300009551 Ga0105238_10076535 Ga0105238_100765354 180
63 3300013102 Ga0157371_10538948 Ga0157371_105389482 180
64 3300013306 Ga0163162_10586181 Ga0163162_105861812 180
65 3300014326 Ga0157380_10052971 Ga0157380_100529713 180
66 3300020070 Ga0206356_11624222 Ga0206356_116242222 180
67 3300025901 Ga0207688_10103113 Ga0207688_101031132 180
68 3300025925 Ga0207650_10203250 Ga0207650_102032502 180
69 3300025926 Ga0207659_10429085 Ga0207659_104290852 180
70 3300025927 Ga0207687_10567454 Ga0207687_105674541 180
71 3300025934 Ga0207686_10184360 Ga0207686_101843602 180
72 3300025935 Ga0207709_10270201 Ga0207709_102702012 180
73 3300025937 Ga0207669_10129934 Ga0207669_101299342 180
74 3300025940 Ga0207691_10146806 Ga0207691_101468063 180
75 3300026089 Ga0207648_10311790 Ga0207648_103117902 180
76 3300026118 Ga0207675_100368196 Ga0207675_1003681962 180
77 3300026121 Ga0207683_10069279 Ga0207683_100692792 180
78 3300026142 Ga0207698_10247904 Ga0207698_102479043 180
79 3300041411 Ga0439466_0103961 Ga0439466_0103961_142_702 180
80 3300042007 Ga0439449_0078161 Ga0439449_0078161_81_641 180
81 3300046663 Ga0495635_0087097 Ga0495635_0087097_1289_1849 180
82 3300046681 Ga0495647_0051851 Ga0495647_0051851_391_951 180
83 3300048904 Ga0496101_0647089 Ga0496101_0647089_28_588 180
84 3300048909 Ga0496106_0054358 Ga0496106_0054358_379_939 180
85 3300048909 Ga0496106_0388376 Ga0496106_0388376_89_649 180
86 3300048911 Ga0496108_0448302 Ga0496108_0448302_385_945 180
87 3300048912 Ga0496109_0277843 Ga0496109_0277843_391_951 180
88 3300048917 Ga0496114_0040282 Ga0496114_0040282_2955_3515 180
89 3300048918 Ga0496115_0414204 Ga0496115_0414204_354_914 180
90 iso_pu_bacteria 2734482000 2734972130 180
91 3300025938 Ga0207704_10516697 Ga0207704_105166972 181
92 iso_pu_bacteria 2501939600 2501942775 181
93 iso_pu_bacteria 2515154088 2515494867 181
94 iso_pu_bacteria 2515154137 2515755530 181
95 iso_pu_bacteria 2515154155 2515851122 181
96 iso_pu_bacteria 2515154203 2516090169 181
97 iso_pu_bacteria 2772190715 2772643606 181
98 iso_pu_bacteria 2831935698 2831936657 181
99 iso_pu_bacteria 2832004796 2832008490 181
100 iso_pu_bacteria 2855670206 2855675226 181
101 iso_pu_bacteria 2855676851 2855682004 181
102 iso_pu_bacteria 2856858025 2856861999 181
103 iso_pu_bacteria 2857288857 2857292898 181
104 iso_pu_bacteria 2858848962 2858850057 181
105 iso_pu_bacteria 2858882152 2858883430 181
106 iso_pu_bacteria 2858888857 2858893813 181
107 iso_pu_bacteria 2858895516 2858899389 181
108 iso_pu_bacteria 2866065130 2866067608 181
109 iso_pu_bacteria 2867312974 2867319143 181
110 iso_pu_bacteria 2867319477 2867320148 181
111 iso_pu_bacteria 2867507094 2867508594 181
112 iso_pu_bacteria 2869048445 2869054810 181
113 iso_pu_bacteria 2869061728 2869066648 181
114 iso_pu_bacteria 2869068681 2869074103 181
115 iso_pu_bacteria 2880489317 2880492087 181
116 iso_pu_bacteria 2880495981 2880500211 181
117 iso_pu_bacteria 2929226422 2929228762 181
118 iso_pu_bacteria 2996221748 2996227928 181
119 iso_pu_bacteria 649633069 649812599 181
120 iso_pu_bacteria 8003830390 8003837089 181
121 iso_pu_bacteria 8003856774 8003857234 181
122 iso_pu_bacteria 8003870546 8003875670 181
123 iso_pu_bacteria 8053945823 8053947336 181
124 iso_pu_bacteria 8054704163 8054707110 181
125 iso_pu_bacteria 8054727385 8054731803 181
126 iso_pu_bacteria 8054734606 8054738359 181
127 iso_pu_bacteria 8057568493 8057568582 181
128 iso_pu_bacteria 2523533628 2524001447 182
129 iso_pu_bacteria 2537561592 2537898834 182
130 iso_pu_bacteria 2554235227 2555229927 182
131 iso_pu_bacteria 2585428094 2587862888 182
132 iso_pu_bacteria 2643221542 2643733678 182
133 iso_pu_bacteria 2643221546 2643752041 182
134 iso_pu_bacteria 2643221549 2643767825 182
135 iso_pu_bacteria 2643221553 2643785763 182
136 iso_pu_bacteria 2643221567 2643849657 182
137 iso_pu_bacteria 2643221572 2643875094 182
138 iso_pu_bacteria 2643221575 2643885549 182
139 iso_pu_bacteria 2643221576 2643891657 182
140 iso_pu_bacteria 2643221590 2643960705 182
141 iso_pu_bacteria 2643221597 2643995818 182
142 iso_pu_bacteria 2643221616 2644096191 182
143 iso_pu_bacteria 2643221619 2644111205 182
144 iso_pu_bacteria 2643221624 2644135658 182
145 iso_pu_bacteria 2643221630 2644170252 182
146 iso_pu_bacteria 2643221635 2644199247 182
147 iso_pu_bacteria 2643221649 2644280613 182
148 iso_pu_bacteria 2643221669 2644382150 182
149 iso_pu_bacteria 2643221679 2644445244 182
150 iso_pu_bacteria 2643221724 2644680175 182
151 iso_pu_bacteria 2654587600 2655032631 182
152 iso_pu_bacteria 2721755702 2723641978 182
153 iso_pu_bacteria 2728369276 2729904914 182
154 iso_pu_bacteria 2728369380 2730229625 182
155 iso_pu_bacteria 2731639228 2731906963 182
156 iso_pu_bacteria 2738541272 2738695685 182
157 iso_pu_bacteria 2738543027 2739326171 182
158 iso_pu_bacteria 2739367654 2739604989 182
159 iso_pu_bacteria 2747842429 2747951961 182
160 iso_pu_bacteria 2751185734 2753073925 182
161 iso_pu_bacteria 2758568522 2760308068 182
162 iso_pu_bacteria 2758568621 2760623310 182
163 iso_pu_bacteria 2773857759 2774384428 182
164 iso_pu_bacteria 2773857763 2774399623 182
165 iso_pu_bacteria 2784132109 2784472385 182
166 iso_pu_bacteria 2799112218 2799183976 182
167 iso_pu_bacteria 2808606365 2808874500 182
168 iso_pu_bacteria 2808606368 2808885561 182
169 iso_pu_bacteria 2808606372 2808901952 182
170 iso_pu_bacteria 2808606394 2809028196 182
171 iso_pu_bacteria 2808606447 2809227357 182
172 iso_pu_bacteria 2811994872 2812323022 182
173 iso_pu_bacteria 2811994882 2812375166 182
174 iso_pu_bacteria 2818991318 2819427907 182
175 iso_pu_bacteria 2818991462 2819691914 182
176 iso_pu_bacteria 2818991469 2819729302 182
177 iso_pu_bacteria 2821268502 2821269926 182
178 iso_pu_bacteria 2833709550 2833710860 182
179 iso_pu_bacteria 2835188231 2835188493 182
180 iso_pu_bacteria 2844841374 2844842599 182
181 iso_pu_bacteria 2844852863 2844855533 182
182 iso_pu_bacteria 2852632344 2852633265 182
183 iso_pu_bacteria 2852643534 2852645501 182
184 iso_pu_bacteria 2855386786 2855386932 182
185 iso_pu_bacteria 2857479173 2857480049 182
186 iso_pu_bacteria 2857481737 2857484643 182
187 iso_pu_bacteria 2857632687 2857633796 182
188 iso_pu_bacteria 2857723135 2857723772 182
189 iso_pu_bacteria 2857729791 2857732639 182
190 iso_pu_bacteria 2857733635 2857735707 182
191 iso_pu_bacteria 2862993130 2862996341 182
192 iso_pu_bacteria 2870628048 2870630267 182
193 iso_pu_bacteria 2870721527 2870725809 182
194 iso_pu_bacteria 2870801768 2870802381 182
195 iso_pu_bacteria 2870804320 2870804462 182
196 iso_pu_bacteria 2884763398 2884765567 182
197 iso_pu_bacteria 2887443736 2887446498 182
198 iso_pu_bacteria 2895660088 2895661221 182
199 iso_pu_bacteria 2904497146 2904498082 182
200 iso_pu_bacteria 2915358134 2915359677 182
201 iso_pu_bacteria 2919051321 2919055203 182
202 iso_pu_bacteria 2919055335 2919058283 182
203 iso_pu_bacteria 2919443155 2919446270 182
204 iso_pu_bacteria 2919446982 2919450634 182
205 iso_pu_bacteria 2919523602 2919524656 182
206 iso_pu_bacteria 2920879853 2920883793 182
207 iso_pu_bacteria 2928090899 2928092170 182
208 iso_pu_bacteria 2928121344 2928122980 182
209 iso_pu_bacteria 2928153084 2928156420 182
210 iso_pu_bacteria 2935409751 2935411329 182
211 iso_pu_bacteria 2946033335 2946033820 182
212 iso_pu_bacteria 2946041624 2946044193 182
213 iso_pu_bacteria 2964326757 2964329772 182
214 iso_pu_bacteria 2966921586 2966922834 182
215 iso_pu_bacteria 2984580707 2984581057 182
216 iso_pu_bacteria 2995726249 2995727915 182
217 iso_pu_bacteria 3001889506 3001891619 182
218 iso_pu_bacteria 8002811521 8002811879 182
219 iso_pu_bacteria 8004182704 8004185177 182
220 iso_pu_bacteria 8004212874 8004214212 182
221 iso_pu_bacteria 8046352972 8046352988 182
222 iso_pu_bacteria 8046352972 8046356495 182
223 iso_pu_bacteria 8054472261 8054474677 182
224 iso_pu_bacteria 8055034563 8055036101 182
225 iso_pu_bacteria 8055037949 8055038390 182
226 iso_pu_bacteria 8056579771 8056582228 182
227 3300005329 Ga0070683_100008380 Ga0070683_1000083806 185
228 3300005329 Ga0070683_100026298 Ga0070683_1000262986 185
229 3300005334 Ga0068869_100353197 Ga0068869_1003531972 185
230 3300005336 Ga0070680_100385350 Ga0070680_1003853501 185
231 3300005344 Ga0070661_100006348 Ga0070661_1000063488 185
232 3300005345 Ga0070692_10053790 Ga0070692_100537904 185
233 3300005436 Ga0070713_100426104 Ga0070713_1004261042 185
234 3300005456 Ga0070678_100469852 Ga0070678_1004698522 185
235 3300005530 Ga0070679_100168603 Ga0070679_1001686032 185
236 3300005535 Ga0070684_100064651 Ga0070684_1000646515 185
237 3300005564 Ga0070664_100227321 Ga0070664_1002273212 185
238 3300005577 Ga0068857_100211286 Ga0068857_1002112863 185
239 3300005983 Ga0081540_1123311 Ga0081540_11233111 185
240 3300006844 Ga0075428_100115020 Ga0075428_1001150203 185
241 3300006846 Ga0075430_100055920 Ga0075430_1000559202 185
242 3300006846 Ga0075430_100114486 Ga0075430_1001144863 185
243 3300006847 Ga0075431_100109652 Ga0075431_1001096525 185
244 3300006871 Ga0075434_100675482 Ga0075434_1006754822 185
245 3300006880 Ga0075429_100088769 Ga0075429_1000887694 185
246 3300009147 Ga0114129_10004855 Ga0114129_1000485517 185
247 3300010375 Ga0105239_11886250 Ga0105239_118862501 185
248 3300013104 Ga0157370_10590283 Ga0157370_105902832 185
249 3300013105 Ga0157369_10020802 Ga0157369_100208028 185
250 3300013307 Ga0157372_10163231 Ga0157372_101632312 185
251 3300014325 Ga0163163_10344685 Ga0163163_103446852 185
252 3300020069 Ga0197907_10258756 Ga0197907_102587563 185
253 3300020070 Ga0206356_10717007 Ga0206356_107170071 185
254 3300020075 Ga0206349_1159386 Ga0206349_11593861 185
255 3300020076 Ga0206355_1423249 Ga0206355_14232491 185
256 3300020078 Ga0206352_11224977 Ga0206352_112249771 185
257 3300020081 Ga0206354_11686283 Ga0206354_116862833 185
258 3300020082 Ga0206353_10443024 Ga0206353_104430245 185
259 3300022467 Ga0224712_10053013 Ga0224712_100530133 185
260 3300025909 Ga0207705_10029292 Ga0207705_100292922 185
261 3300025921 Ga0207652_10141513 Ga0207652_101415131 185
262 3300025929 Ga0207664_10159236 Ga0207664_101592362 185
263 3300025939 Ga0207665_10056058 Ga0207665_100560583 185
264 3300025944 Ga0207661_10019379 Ga0207661_100193792 185
265 3300025944 Ga0207661_10045354 Ga0207661_100453542 185
266 3300025944 Ga0207661_10475707 Ga0207661_104757072 185
267 3300025945 Ga0207679_10380897 Ga0207679_103808972 185
268 3300026078 Ga0207702_10128137 Ga0207702_101281372 185
269 3300026116 Ga0207674_10010641 Ga0207674_100106417 185
270 3300026116 Ga0207674_10040969 Ga0207674_100409695 185
271 3300026118 Ga0207675_101676294 Ga0207675_1016762941 185
272 3300026121 Ga0207683_10407011 Ga0207683_104070112 185
273 3300028794 Ga0307515_10073868 Ga0307515_100738681 185
274 3300031728 Ga0316578_10065307 Ga0316578_100653073 185
275 3300031824 Ga0307413_10377778 Ga0307413_103777782 185
276 3300031901 Ga0307406_10188774 Ga0307406_101887742 185
277 3300031901 Ga0307406_10304407 Ga0307406_103044072 185
278 3300031901 Ga0307406_10369382 Ga0307406_103693822 185
279 3300032126 Ga0307415_100124925 Ga0307415_1001249252 185
280 3300032139 Ga0316580_10034447 Ga0316580_100344472 185
281 3300032168 Ga0316593_10273750 Ga0316593_102737501 185
282 3300033524 Ga0316592_1096410 Ga0316592_10964101 185
283 3300033541 Ga0316596_1033908 Ga0316596_10339082 185
284 3300035398 Ga0316574_0018303 Ga0316574_0018303_1681_2244 185
285 3300036647 Ga0316582_0101695 Ga0316582_0101695_277_840 185
286 3300036712 Ga0316584_0069754 Ga0316584_0069754_1312_1875 185
287 3300037312 Ga0395899_0025982 Ga0395899_0025982_3513_4070 185
288 3300037418 Ga0395900_0048256 Ga0395900_0048256_823_1380 185
289 3300037466 Ga0395898_0034838 Ga0395898_0034838_803_1360 185
290 3300037471 Ga0395905_0001103 Ga0395905_0001103_32648_33205 185
291 3300038443 Ga0395901_0009293 Ga0395901_0009293_5819_6376 185
292 3300042156 Ga0439446_0133797 Ga0439446_0133797_209_766 185
293 3300044684 Ga0466966_0010911 Ga0466966_0010911_5175_5732 185
294 3300044693 Ga0466961_0009823 Ga0466961_0009823_105_662 185
295 3300044719 Ga0466971_0032302 Ga0466971_0032302_923_1480 185
296 3300044765 Ga0466970_0134122 Ga0466970_0134122_553_1110 185
297 3300045049 Ga0466959_0027280 Ga0466959_0027280_549_1106 185
298 3300047315 Ga0495581_0444972 Ga0495581_0444972_97_654 185
299 3300047319 Ga0495674_0797331 Ga0495674_0797331_147_704 185
300 3300047320 Ga0495672_0017547 Ga0495672_0017547_486_1043 185
301 3300047472 Ga0495686_0380361 Ga0495686_0380361_88_645 185
302 3300048915 Ga0496112_0270044 Ga0496112_0270044_848_1405 185
303 3300048929 Ga0496126_0075480 Ga0496126_0075480_108_665 185
304 3300049527 Ga0501311_059086 Ga0501311_059086_49_606 185
305 3300049569 Ga0501032_0016609 Ga0501032_0016609_659_1216 185
306 3300049569 Ga0501032_0083083 Ga0501032_0083083_1457_2014 185
307 3300049571 Ga0501034_0050471 Ga0501034_0050471_849_1406 185
308 3300049571 Ga0501034_0064120 Ga0501034_0064120_833_1390 185
309 3300049574 Ga0501038_0061060 Ga0501038_0061060_1647_2204 185
310 3300049574 Ga0501038_0704007 Ga0501038_0704007_97_654 185
311 3300049575 Ga0501039_0575495 Ga0501039_0575495_284_841 185
312 3300049580 Ga0501046_0915421 Ga0501046_0915421_44_601 185
313 3300049583 Ga0501067_0165315 Ga0501067_0165315_243_800 185
314 3300049586 Ga0501070_0351961 Ga0501070_0351961_185_742 185
315 3300049589 Ga0501073_0000029 Ga0501073_0000029_17842_18399 185
316 3300049742 Ga0501080_0099182 Ga0501080_0099182_778_1335 185
317 3300050507 nmdc:mga05p37_3914_c1 nmdc:mga05p37_3914_c1_703_1260 185
318 3300050508 nmdc:mga09592_1805_c1 nmdc:mga09592_1805_c1_845_1402 185
319 3300050509 nmdc:mga0qj67_1059_c2 nmdc:mga0qj67_1059_c2_976_1533 185
320 3300050509 nmdc:mga0qj67_549494_c1 nmdc:mga0qj67_549494_c1_149_727 185
321 3300050510 nmdc:mga06r32_1833_c2 nmdc:mga06r32_1833_c2_845_1402 185
322 3300053085 Ga0495619_0302488 Ga0495619_0302488_440_1000 185
323 3300053108 Ga0500562_001128 Ga0500562_001128_1193_1750 185
324 3300053139 Ga0500568_0000064 Ga0500568_0000064_21409_21966 185
325 3300053139 Ga0500568_0000534 Ga0500568_0000534_23960_24517 185
326 3300059510 Ga0587090_068946 Ga0587090_068946_113_670 185
327 3300059625 Ga0587113_021139 Ga0587113_021139_87_644 185
328 3300001989 JGI24739J22299_10033890 JGI24739J22299_100338902 186
329 3300001989 JGI24739J22299_10090630 JGI24739J22299_100906302 186
330 3300001989 JGI24739J22299_10095805 JGI24739J22299_100958052 186
331 3300001990 JGI24737J22298_10040121 JGI24737J22298_100401212 186
332 3300002067 JGI24735J21928_10002346 JGI24735J21928_100023462 186
333 3300002077 JGI24744J21845_10035085 JGI24744J21845_100350852 186
334 3300002772 JGI25164J39214_1000271 JGI25164J39214_100027110 186
335 3300003203 JGI25406J46586_10016618 JGI25406J46586_100166184 186
336 3300003203 JGI25406J46586_10068009 JGI25406J46586_100680091 186
337 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004569 186
338 3300003578 Ga0006562J51391_1083570 Ga0006562J51391_10835705 186
339 3300003752 Ga0055539_1000008 Ga0055539_1000008137 186
340 3300003756 Ga0055533_1000001 Ga0055533_1000001934 186
341 3300003759 Ga0055525_1000840 Ga0055525_10008409 186
342 3300003759 Ga0055525_1002311 Ga0055525_10023113 186
343 3300003760 Ga0055527_1000001 Ga0055527_1000001402 186
344 3300003763 Ga0055529_1000018 Ga0055529_100001894 186
345 3300003841 Ga0055541_1002301 Ga0055541_10023012 186
346 3300004798 Ga0058859_11831639 Ga0058859_118316391 186
347 3300004799 Ga0058863_11873486 Ga0058863_118734861 186
348 3300004800 Ga0058861_10008255 Ga0058861_100082551 186
349 3300004801 Ga0058860_10023170 Ga0058860_100231701 186
350 3300005288 Ga0065714_10079860 Ga0065714_100798602 186
351 3300005329 Ga0070683_100730310 Ga0070683_1007303101 186
352 3300005333 Ga0070677_10317834 Ga0070677_103178342 186
353 3300005337 Ga0070682_100821590 Ga0070682_1008215901 186
354 3300005366 Ga0070659_100381787 Ga0070659_1003817872 186
355 3300005435 Ga0070714_100000039 Ga0070714_10000003999 186
356 3300005436 Ga0070713_100063477 Ga0070713_1000634772 186
357 3300005437 Ga0070710_10607510 Ga0070710_106075101 186
358 3300005437 Ga0070710_10650797 Ga0070710_106507971 186
359 3300005456 Ga0070678_100460285 Ga0070678_1004602852 186
360 3300005530 Ga0070679_100105114 Ga0070679_1001051142 186
361 3300005530 Ga0070679_100662200 Ga0070679_1006622002 186
362 3300005535 Ga0070684_100992801 Ga0070684_1009928011 186
363 3300005546 Ga0070696_100222559 Ga0070696_1002225592 186
364 3300005547 Ga0070693_100200871 Ga0070693_1002008712 186
365 3300005577 Ga0068857_100070797 Ga0068857_1000707973 186
366 3300005577 Ga0068857_100381996 Ga0068857_1003819962 186
367 3300005577 Ga0068857_100627881 Ga0068857_1006278812 186
368 3300005614 Ga0068856_100731411 Ga0068856_1007314112 186
369 3300005616 Ga0068852_100660166 Ga0068852_1006601662 186
370 3300005719 Ga0068861_100062449 Ga0068861_1000624493 186
371 3300005719 Ga0068861_100530824 Ga0068861_1005308241 186
372 3300005834 Ga0068851_10322449 Ga0068851_103224492 186
373 3300005840 Ga0068870_10181743 Ga0068870_101817432 186
374 3300005841 Ga0068863_100180238 Ga0068863_1001802383 186
375 3300005844 Ga0068862_100545124 Ga0068862_1005451242 186
376 3300005983 Ga0081540_1008923 Ga0081540_10089236 186
377 3300005985 Ga0081539_10000352 Ga0081539_1000035274 186
378 3300005985 Ga0081539_10007039 Ga0081539_100070392 186
379 3300005985 Ga0081539_10032371 Ga0081539_100323715 186
380 3300005985 Ga0081539_10286784 Ga0081539_102867841 186
381 3300006028 Ga0070717_10088157 Ga0070717_100881574 186
382 3300006038 Ga0075365_10112988 Ga0075365_101129882 186
383 3300006051 Ga0075364_10025537 Ga0075364_100255373 186
384 3300006051 Ga0075364_10026800 Ga0075364_100268002 186
385 3300006051 Ga0075364_10057541 Ga0075364_100575413 186
386 3300006051 Ga0075364_10080926 Ga0075364_100809262 186
387 3300006051 Ga0075364_10139526 Ga0075364_101395263 186
388 3300006051 Ga0075364_10215791 Ga0075364_102157912 186
389 3300006175 Ga0070712_100533463 Ga0070712_1005334632 186
390 3300006186 Ga0075369_10101076 Ga0075369_101010762 186
391 3300009036 Ga0105244_10041918 Ga0105244_100419182 186
392 3300009036 Ga0105244_10047386 Ga0105244_100473863 186
393 3300009093 Ga0105240_10369905 Ga0105240_103699052 186
394 3300009098 Ga0105245_10389792 Ga0105245_103897922 186
395 3300009148 Ga0105243_10060196 Ga0105243_100601962 186
396 3300009148 Ga0105243_10185209 Ga0105243_101852092 186
397 3300009177 Ga0105248_10787119 Ga0105248_107871192 186
398 3300009551 Ga0105238_10271205 Ga0105238_102712052 186
399 3300009553 Ga0105249_10177166 Ga0105249_101771663 186
400 3300009553 Ga0105249_11307442 Ga0105249_113074421 186
401 3300010375 Ga0105239_11107970 Ga0105239_111079701 186
402 3300011119 Ga0105246_10128132 Ga0105246_101281323 186
403 3300011119 Ga0105246_10991788 Ga0105246_109917881 186
404 3300012497 Ga0157319_1005725 Ga0157319_10057251 186
405 3300013102 Ga0157371_10002721 Ga0157371_100027215 186
406 3300013102 Ga0157371_10256141 Ga0157371_102561412 186
407 3300013104 Ga0157370_10056690 Ga0157370_100566902 186
408 3300013104 Ga0157370_10132584 Ga0157370_101325842 186
409 3300013104 Ga0157370_10453141 Ga0157370_104531412 186
410 3300013105 Ga0157369_10018556 Ga0157369_100185564 186
411 3300013105 Ga0157369_10080708 Ga0157369_100807082 186
412 3300013105 Ga0157369_10265963 Ga0157369_102659632 186
413 3300013105 Ga0157369_10404765 Ga0157369_104047653 186
414 3300013306 Ga0163162_10175534 Ga0163162_101755345 186
415 3300013306 Ga0163162_10634250 Ga0163162_106342502 186
416 3300013306 Ga0163162_10828628 Ga0163162_108286282 186
417 3300013307 Ga0157372_10039598 Ga0157372_100395983 186
418 3300013307 Ga0157372_10080461 Ga0157372_100804615 186
419 3300013307 Ga0157372_10281506 Ga0157372_102815062 186
420 3300013308 Ga0157375_10095249 Ga0157375_100952491 186
421 3300013308 Ga0157375_10720030 Ga0157375_107200302 186
422 3300013308 Ga0157375_10891900 Ga0157375_108919002 186
423 3300014326 Ga0157380_10935208 Ga0157380_109352082 186
424 3300014969 Ga0157376_10408152 Ga0157376_104081521 186
425 3300017792 Ga0163161_10080822 Ga0163161_100808222 186
426 3300020069 Ga0197907_10125867 Ga0197907_101258671 186
427 3300020069 Ga0197907_10190572 Ga0197907_101905721 186
428 3300020069 Ga0197907_10761571 Ga0197907_107615711 186
429 3300020069 Ga0197907_10932477 Ga0197907_109324772 186
430 3300020069 Ga0197907_11256546 Ga0197907_112565461 186
431 3300020069 Ga0197907_11383208 Ga0197907_113832081 186
432 3300020070 Ga0206356_10019973 Ga0206356_100199731 186
433 3300020070 Ga0206356_10203588 Ga0206356_102035882 186
434 3300020070 Ga0206356_10500775 Ga0206356_105007751 186
435 3300020070 Ga0206356_11739052 Ga0206356_117390522 186
436 3300020075 Ga0206349_1368267 Ga0206349_13682672 186
437 3300020075 Ga0206349_1972671 Ga0206349_19726711 186
438 3300020076 Ga0206355_1412026 Ga0206355_14120261 186
439 3300020076 Ga0206355_1611973 Ga0206355_16119731 186
440 3300020077 Ga0206351_10720129 Ga0206351_107201292 186
441 3300020077 Ga0206351_10888382 Ga0206351_108883821 186
442 3300020078 Ga0206352_10057062 Ga0206352_100570621 186
443 3300020078 Ga0206352_10058262 Ga0206352_100582622 186
444 3300020080 Ga0206350_11332409 Ga0206350_113324092 186
445 3300020081 Ga0206354_10434866 Ga0206354_104348662 186
446 3300020081 Ga0206354_10484737 Ga0206354_104847371 186
447 3300020081 Ga0206354_10698463 Ga0206354_106984632 186
448 3300020081 Ga0206354_10956684 Ga0206354_109566842 186
449 3300020081 Ga0206354_11270526 Ga0206354_112705263 186
450 3300020081 Ga0206354_11591078 Ga0206354_115910783 186
451 3300020082 Ga0206353_10147464 Ga0206353_101474641 186
452 3300020082 Ga0206353_10432556 Ga0206353_104325562 186
453 3300020082 Ga0206353_10470645 Ga0206353_104706453 186
454 3300020082 Ga0206353_10933407 Ga0206353_109334072 186
455 3300020082 Ga0206353_11447911 Ga0206353_114479112 186
456 3300020610 Ga0154015_1016208 Ga0154015_10162083 186
457 3300020610 Ga0154015_1212596 Ga0154015_12125961 186
458 3300020610 Ga0154015_1565778 Ga0154015_15657781 186
459 3300022467 Ga0224712_10059957 Ga0224712_100599572 186
460 3300022467 Ga0224712_10088721 Ga0224712_100887212 186
461 3300022467 Ga0224712_10121937 Ga0224712_101219371 186
462 3300025225 Ga0209566_100050 Ga0209566_10005054 186
463 3300025226 Ga0209674_100001 Ga0209674_100001934 186
464 3300025228 Ga0209672_100006 Ga0209672_100006574 186
465 3300025229 Ga0209147_100486 Ga0209147_10048621 186
466 3300025230 Ga0209563_100001 Ga0209563_100001934 186
467 3300025230 Ga0209563_100219 Ga0209563_10021916 186
468 3300025231 Ga0207427_100010 Ga0207427_10001013 186
469 3300025233 Ga0209437_100989 Ga0209437_1009896 186
470 3300025242 Ga0209258_101984 Ga0209258_1019848 186
471 3300025246 Ga0209646_1000099 Ga0209646_100009939 186
472 3300025253 Ga0209677_100001 Ga0209677_100001934 186
473 3300025253 Ga0209677_100187 Ga0209677_10018750 186
474 3300025254 Ga0209148_1000015 Ga0209148_1000015418 186
475 3300025261 Ga0209233_1000001 Ga0209233_10000011937 186
476 3300025261 Ga0209233_1022852 Ga0209233_10228522 186
477 3300025272 Ga0209455_1000013 Ga0209455_1000013418 186
478 3300025728 Ga0207655_1113449 Ga0207655_11134492 186
479 3300025898 Ga0207692_10470526 Ga0207692_104705261 186
480 3300025901 Ga0207688_10207532 Ga0207688_102075322 186
481 3300025901 Ga0207688_10226292 Ga0207688_102262922 186
482 3300025904 Ga0207647_10026839 Ga0207647_100268395 186
483 3300025904 Ga0207647_10042282 Ga0207647_100422824 186
484 3300025904 Ga0207647_10282682 Ga0207647_102826821 186
485 3300025908 Ga0207643_10175739 Ga0207643_101757392 186
486 3300025912 Ga0207707_10430438 Ga0207707_104304382 186
487 3300025913 Ga0207695_10258711 Ga0207695_102587112 186
488 3300025914 Ga0207671_10506111 Ga0207671_105061111 186
489 3300025917 Ga0207660_11086500 Ga0207660_110865001 186
490 3300025919 Ga0207657_10196090 Ga0207657_101960902 186
491 3300025921 Ga0207652_10298432 Ga0207652_102984321 186
492 3300025924 Ga0207694_10909643 Ga0207694_109096431 186
493 3300025926 Ga0207659_10104232 Ga0207659_101042323 186
494 3300025928 Ga0207700_10299165 Ga0207700_102991652 186
495 3300025929 Ga0207664_10001112 Ga0207664_1000111218 186
496 3300025929 Ga0207664_10030114 Ga0207664_100301143 186
497 3300025935 Ga0207709_10046435 Ga0207709_100464352 186
498 3300025935 Ga0207709_10113781 Ga0207709_101137813 186
499 3300025935 Ga0207709_10115069 Ga0207709_101150692 186
500 3300025939 Ga0207665_10664016 Ga0207665_106640162 186
501 3300025942 Ga0207689_10019688 Ga0207689_100196888 186
502 3300025942 Ga0207689_10056449 Ga0207689_100564494 186
503 3300025961 Ga0207712_10446151 Ga0207712_104461512 186
504 3300025972 Ga0207668_10248899 Ga0207668_102488992 186
505 3300026041 Ga0207639_10903985 Ga0207639_109039852 186
506 3300026041 Ga0207639_11109793 Ga0207639_111097931 186
507 3300026067 Ga0207678_10224375 Ga0207678_102243751 186
508 3300026078 Ga0207702_10280248 Ga0207702_102802482 186
509 3300026078 Ga0207702_10466897 Ga0207702_104668972 186
510 3300026089 Ga0207648_10463244 Ga0207648_104632442 186
511 3300026116 Ga0207674_10019369 Ga0207674_100193698 186
512 3300026116 Ga0207674_10671918 Ga0207674_106719182 186
513 3300026118 Ga0207675_100102916 Ga0207675_1001029162 186
514 3300026121 Ga0207683_10467654 Ga0207683_104676542 186
515 3300026121 Ga0207683_10941221 Ga0207683_109412211 186
516 3300028573 Ga0265334_10006588 Ga0265334_100065885 186
517 3300028794 Ga0307515_10068581 Ga0307515_100685817 186
518 3300028794 Ga0307515_10227573 Ga0307515_102275731 186
519 3300028794 Ga0307515_10285124 Ga0307515_102851243 186
520 3300028794 Ga0307515_10531742 Ga0307515_105317421 186
521 3300030745 Ga0316182_1203598 Ga0316182_12035982 186
522 3300031247 Ga0265340_10192404 Ga0265340_101924041 186
523 3300031456 Ga0307513_10000970 Ga0307513_1000097034 186
524 3300031548 Ga0307408_100707839 Ga0307408_1007078392 186
525 3300031665 Ga0316575_10005797 Ga0316575_100057978 186
526 3300031691 Ga0316579_10001539 Ga0316579_100015396 186
527 3300031691 Ga0316579_10005432 Ga0316579_100054329 186
528 3300031727 Ga0316576_10010721 Ga0316576_100107219 186
529 3300031727 Ga0316576_10061212 Ga0316576_100612127 186
530 3300031728 Ga0316578_10052248 Ga0316578_100522481 186
531 3300031728 Ga0316578_10067718 Ga0316578_100677181 186
532 3300031731 Ga0307405_10895140 Ga0307405_108951402 186
533 3300031733 Ga0316577_10072570 Ga0316577_100725701 186
534 3300031824 Ga0307413_10826002 Ga0307413_108260022 186
535 3300031852 Ga0307410_10025624 Ga0307410_100256245 186
536 3300031852 Ga0307410_10199382 Ga0307410_101993822 186
537 3300031901 Ga0307406_10000108 Ga0307406_1000010818 186
538 3300031901 Ga0307406_10061840 Ga0307406_100618403 186
539 3300031901 Ga0307406_10098155 Ga0307406_100981553 186
540 3300031903 Ga0307407_10045016 Ga0307407_100450162 186
541 3300031903 Ga0307407_10716056 Ga0307407_107160561 186
542 3300031911 Ga0307412_10050146 Ga0307412_100501463 186
543 3300031911 Ga0307412_10053288 Ga0307412_100532882 186
544 3300031911 Ga0307412_10173446 Ga0307412_101734462 186
545 3300031995 Ga0307409_100064464 Ga0307409_1000644643 186
546 3300031995 Ga0307409_100092517 Ga0307409_1000925174 186
547 3300032002 Ga0307416_100094182 Ga0307416_1000941824 186
548 3300032002 Ga0307416_100137994 Ga0307416_1001379943 186
549 3300032002 Ga0307416_100385623 Ga0307416_1003856233 186
550 3300032004 Ga0307414_10135400 Ga0307414_101354002 186
551 3300032004 Ga0307414_11034602 Ga0307414_110346021 186
552 3300032005 Ga0307411_10446978 Ga0307411_104469782 186
553 3300032126 Ga0307415_100025820 Ga0307415_1000258203 186
554 3300032126 Ga0307415_100452608 Ga0307415_1004526082 186
555 3300032126 Ga0307415_100663420 Ga0307415_1006634202 186
556 3300032137 Ga0316585_10013947 Ga0316585_100139472 186
557 3300032139 Ga0316580_10017414 Ga0316580_100174144 186
558 3300032168 Ga0316593_10043125 Ga0316593_100431254 186
559 3300033524 Ga0316592_1057024 Ga0316592_10570242 186
560 3300033528 Ga0316588_1070652 Ga0316588_10706522 186
561 3300033541 Ga0316596_1019662 Ga0316596_10196625 186
562 3300035121 Ga0373960_0142831 Ga0373960_0142831_94_654 186
563 3300035398 Ga0316574_0006251 Ga0316574_0006251_1262_1822 186
564 3300035398 Ga0316574_0077584 Ga0316574_0077584_432_992 186
565 3300035691 Ga0373931_0462877 Ga0373931_0462877_172_732 186
566 3300036401 Ga0373937_1225718 Ga0373937_1225718_105_668 186
567 3300036647 Ga0316582_0001733 Ga0316582_0001733_6399_6959 186
568 3300036647 Ga0316582_0049547 Ga0316582_0049547_561_1121 186
569 3300036647 Ga0316582_0672790 Ga0316582_0672790_36_677 186
570 3300036712 Ga0316584_0110376 Ga0316584_0110376_195_755 186
571 3300036712 Ga0316584_0169758 Ga0316584_0169758_356_916 186
572 3300036712 Ga0316584_0606809 Ga0316584_0606809_122_682 186
573 3300037312 Ga0395899_0001589 Ga0395899_0001589_4569_5132 186
574 3300037312 Ga0395899_0008073 Ga0395899_0008073_3842_4498 186
575 3300037312 Ga0395899_0016290 Ga0395899_0016290_2550_3173 186
576 3300037312 Ga0395899_0101263 Ga0395899_0101263_1392_1955 186
577 3300037418 Ga0395900_0024033 Ga0395900_0024033_3904_4470 186
578 3300037418 Ga0395900_0053242 Ga0395900_0053242_408_1031 186
579 3300037418 Ga0395900_0055561 Ga0395900_0055561_1454_2017 186
580 3300037418 Ga0395900_0127183 Ga0395900_0127183_298_858 186
581 3300037418 Ga0395900_0140387 Ga0395900_0140387_1193_1756 186
582 3300037418 Ga0395900_0142025 Ga0395900_0142025_1700_2356 186
583 3300037418 Ga0395900_0181777 Ga0395900_0181777_511_1071 186
584 3300037418 Ga0395900_0618887 Ga0395900_0618887_169_729 186
585 3300037418 Ga0395900_0630041 Ga0395900_0630041_118_678 186
586 3300037466 Ga0395898_0000131 Ga0395898_0000131_187465_188088 186
587 3300037466 Ga0395898_0007362 Ga0395898_0007362_7627_8190 186
588 3300037466 Ga0395898_0014196 Ga0395898_0014196_4813_5373 186
589 3300037466 Ga0395898_0032980 Ga0395898_0032980_4176_4739 186
590 3300037466 Ga0395898_0126923 Ga0395898_0126923_1703_2359 186
591 3300037471 Ga0395905_0112062 Ga0395905_0112062_1552_2115 186
592 3300037588 Ga0316581_0035049 Ga0316581_0035049_712_1272 186
593 3300038443 Ga0395901_0013369 Ga0395901_0013369_2771_3331 186
594 3300038443 Ga0395901_0018977 Ga0395901_0018977_2650_3210 186
595 3300038443 Ga0395901_0048147 Ga0395901_0048147_3200_3763 186
596 3300038443 Ga0395901_0104376 Ga0395901_0104376_675_1241 186
597 3300038443 Ga0395901_0118903 Ga0395901_0118903_1705_2268 186
598 3300038443 Ga0395901_0174201 Ga0395901_0174201_56_616 186
599 3300038443 Ga0395901_0189786 Ga0395901_0189786_377_937 186
600 3300038443 Ga0395901_0282214 Ga0395901_0282214_672_1232 186
601 3300038735 Ga0400485_01906 Ga0400485_01906_30334_30897 186
602 3300038741 Ga0400488_21867 Ga0400488_21867_3467_4030 186
603 3300038742 Ga0400486_20001 Ga0400486_20001_91006_91569 186
604 3300039450 Ga0436363_0475003 Ga0436363_0475003_1275_1838 186
605 3300039453 Ga0436362_0058353 Ga0436362_0058353_95_655 186
606 3300041451 Ga0451791_0360065 Ga0451791_0360065_321_884 186
607 3300041451 Ga0451791_1525161 Ga0451791_1525161_203_763 186
608 3300041452 Ga0451793_1114004 Ga0451793_1114004_57_617 186
609 3300041456 Ga0451795_0152704 Ga0451795_0152704_333_893 186
610 3300041458 Ga0451798_0543836 Ga0451798_0543836_390_950 186
611 3300041459 Ga0451800_0549017 Ga0451800_0549017_18_578 186
612 3300041460 Ga0451802_0181093 Ga0451802_0181093_179_739 186
613 3300041463 Ga0451804_0464391 Ga0451804_0464391_255_818 186
614 3300041486 Ga0451807_0200845 Ga0451807_0200845_259_819 186
615 3300041486 Ga0451807_1080106 Ga0451807_1080106_277_840 186
616 3300041492 Ga0451835_0268814 Ga0451835_0268814_98_658 186
617 3300041494 Ga0451837_1272064 Ga0451837_1272064_1423_1983 186
618 3300041494 Ga0451837_1312361 Ga0451837_1312361_32_595 186
619 3300041507 Ga0451851_0154827 Ga0451851_0154827_1287_1847 186
620 3300041511 Ga0451855_1012064 Ga0451855_1012064_144_704 186
621 3300041512 Ga0451853_0604592 Ga0451853_0604592_433_993 186
622 3300041512 Ga0451853_0817060 Ga0451853_0817060_45_605 186
623 3300041997 Ga0439431_0044622 Ga0439431_0044622_195_758 186
624 3300042007 Ga0439449_0124342 Ga0439449_0124342_50_610 186
625 3300042531 Ga0450918_039104 Ga0450918_039104_132_692 186
626 3300044656 Ga0466969_0247626 Ga0466969_0247626_185_748 186
627 3300044658 Ga0466972_0024228 Ga0466972_0024228_1271_1897 186
628 3300044658 Ga0466972_0068242 Ga0466972_0068242_400_963 186
629 3300044658 Ga0466972_0275783 Ga0466972_0275783_26_589 186
630 3300044683 Ga0466965_0005741 Ga0466965_0005741_1673_2233 186
631 3300044683 Ga0466965_0048316 Ga0466965_0048316_999_1562 186
632 3300044683 Ga0466965_0053104 Ga0466965_0053104_957_1520 186
633 3300044683 Ga0466965_0177056 Ga0466965_0177056_142_705 186
634 3300044683 Ga0466965_0519297 Ga0466965_0519297_39_599 186
635 3300044693 Ga0466961_0038827 Ga0466961_0038827_2179_2835 186
636 3300044694 Ga0466963_0016854 Ga0466963_0016854_1851_2414 186
637 3300044694 Ga0466963_0137935 Ga0466963_0137935_1106_1669 186
638 3300044694 Ga0466963_0140704 Ga0466963_0140704_121_723 186
639 3300044706 Ga0466964_0229806 Ga0466964_0229806_118_720 186
640 3300044719 Ga0466971_0064402 Ga0466971_0064402_645_1301 186
641 3300044719 Ga0466971_0121344 Ga0466971_0121344_501_1061 186
642 3300044735 Ga0466968_0070487 Ga0466968_0070487_239_802 186
643 3300044735 Ga0466968_0217778 Ga0466968_0217778_215_775 186
644 3300044765 Ga0466970_0012124 Ga0466970_0012124_1300_1863 186
645 3300044765 Ga0466970_0117860 Ga0466970_0117860_668_1336 186
646 3300044765 Ga0466970_0141194 Ga0466970_0141194_367_927 186
647 3300044765 Ga0466970_0315851 Ga0466970_0315851_15_578 186
648 3300044842 Ga0466957_0089707 Ga0466957_0089707_692_1255 186
649 3300044842 Ga0466957_0106008 Ga0466957_0106008_246_809 186
650 3300044842 Ga0466957_0132765 Ga0466957_0132765_253_813 186
651 3300044842 Ga0466957_0168313 Ga0466957_0168313_799_1362 186
652 3300044901 Ga0466960_0003363 Ga0466960_0003363_3881_4441 186
653 3300044901 Ga0466960_0011156 Ga0466960_0011156_1283_1846 186
654 3300044901 Ga0466960_0073372 Ga0466960_0073372_543_1103 186
655 3300044901 Ga0466960_0086332 Ga0466960_0086332_74_634 186
656 3300044901 Ga0466960_0180965 Ga0466960_0180965_184_747 186
657 3300044901 Ga0466960_0405015 Ga0466960_0405015_163_723 186
658 3300045049 Ga0466959_0076146 Ga0466959_0076146_1588_2151 186
659 3300045049 Ga0466959_0119059 Ga0466959_0119059_1017_1577 186
660 3300045836 Ga0466958_0065933 Ga0466958_0065933_803_1366 186
661 3300045836 Ga0466958_0346350 Ga0466958_0346350_312_872 186
662 3300045836 Ga0466958_0423770 Ga0466958_0423770_254_817 186
663 3300045976 Ga0466967_0005856 Ga0466967_0005856_1677_2240 186
664 3300045976 Ga0466967_0101057 Ga0466967_0101057_1231_1794 186
665 3300045976 Ga0466967_0249316 Ga0466967_0249316_504_1067 186
666 3300045976 Ga0466967_0270336 Ga0466967_0270336_241_801 186
667 3300045976 Ga0466967_0678802 Ga0466967_0678802_288_848 186
668 3300046453 Ga0495627_001650 Ga0495627_001650_5156_5716 186
669 3300046460 Ga0495638_0019724 Ga0495638_0019724_1033_1596 186
670 3300046477 Ga0495664_0153888 Ga0495664_0153888_148_708 186
671 3300046523 Ga0495644_0296643 Ga0495644_0296643_17_577 186
672 3300046533 Ga0495640_0061108 Ga0495640_0061108_1518_2078 186
673 3300046536 Ga0495587_0149292 Ga0495587_0149292_446_1006 186
674 3300046558 Ga0495633_0106184 Ga0495633_0106184_180_743 186
675 3300046559 Ga0495667_0049897 Ga0495667_0049897_1566_2126 186
676 3300046559 Ga0495667_0181636 Ga0495667_0181636_23_586 186
677 3300046615 Ga0495656_0027647 Ga0495656_0027647_1155_1715 186
678 3300046615 Ga0495656_0141099 Ga0495656_0141099_285_848 186
679 3300046642 Ga0495634_0121813 Ga0495634_0121813_794_1354 186
680 3300046660 Ga0495625_0100760 Ga0495625_0100760_680_1240 186
681 3300046663 Ga0495635_0232413 Ga0495635_0232413_439_999 186
682 3300046689 Ga0495613_0258756 Ga0495613_0258756_173_733 186
683 3300046690 Ga0495624_0416627 Ga0495624_0416627_89_649 186
684 3300046694 Ga0495649_0348421 Ga0495649_0348421_64_624 186
685 3300046809 Ga0495600_0281241 Ga0495600_0281241_239_799 186
686 3300047315 Ga0495581_0057647 Ga0495581_0057647_437_997 186
687 3300047319 Ga0495674_0319214 Ga0495674_0319214_666_1226 186
688 3300047322 Ga0495680_0280339 Ga0495680_0280339_477_1037 186
689 3300047322 Ga0495680_0588006 Ga0495680_0588006_152_712 186
690 3300047444 Ga0495675_0081054 Ga0495675_0081054_910_1470 186
691 3300047444 Ga0495675_0486394 Ga0495675_0486394_27_590 186
692 3300047471 Ga0495684_0533353 Ga0495684_0533353_216_776 186
693 3300047472 Ga0495686_0113671 Ga0495686_0113671_862_1422 186
694 3300047472 Ga0495686_0269684 Ga0495686_0269684_234_794 186
695 3300047472 Ga0495686_0454040 Ga0495686_0454040_40_600 186
696 3300048088 Ga0495602_0082893 Ga0495602_0082893_1420_1980 186
697 3300048903 Ga0496100_0055811 Ga0496100_0055811_316_876 186
698 3300048903 Ga0496100_0086725 Ga0496100_0086725_64_624 186
699 3300048903 Ga0496100_0208075 Ga0496100_0208075_368_928 186
700 3300048903 Ga0496100_0231255 Ga0496100_0231255_771_1334 186
701 3300048904 Ga0496101_0025696 Ga0496101_0025696_2564_3124 186
702 3300048904 Ga0496101_0043514 Ga0496101_0043514_2131_2754 186
703 3300048904 Ga0496101_0108385 Ga0496101_0108385_1201_1764 186
704 3300048904 Ga0496101_0237973 Ga0496101_0237973_437_997 186
705 3300048904 Ga0496101_0292037 Ga0496101_0292037_573_1136 186
706 3300048904 Ga0496101_0553153 Ga0496101_0553153_51_611 186
707 3300048904 Ga0496101_0688533 Ga0496101_0688533_133_693 186
708 3300048905 Ga0496102_0007945 Ga0496102_0007945_6222_6782 186
709 3300048905 Ga0496102_0040977 Ga0496102_0040977_2343_2903 186
710 3300048905 Ga0496102_0044215 Ga0496102_0044215_2423_3046 186
711 3300048906 Ga0496103_0002549 Ga0496103_0002549_7856_8416 186
712 3300048906 Ga0496103_0020679 Ga0496103_0020679_364_924 186
713 3300048906 Ga0496103_0058136 Ga0496103_0058136_994_1617 186
714 3300048907 Ga0496104_0102883 Ga0496104_0102883_79_639 186
715 3300048907 Ga0496104_0116043 Ga0496104_0116043_351_911 186
716 3300048907 Ga0496104_0481771 Ga0496104_0481771_314_874 186
717 3300048907 Ga0496104_0890207 Ga0496104_0890207_167_727 186
718 3300048908 Ga0496105_0007370 Ga0496105_0007370_6343_6903 186
719 3300048908 Ga0496105_0035840 Ga0496105_0035840_1770_2393 186
720 3300048908 Ga0496105_0252017 Ga0496105_0252017_596_1156 186
721 3300048908 Ga0496105_0261843 Ga0496105_0261843_515_1075 186
722 3300048910 Ga0496107_0055402 Ga0496107_0055402_2002_2562 186
723 3300048910 Ga0496107_0142770 Ga0496107_0142770_388_1011 186
724 3300048910 Ga0496107_0170876 Ga0496107_0170876_165_725 186
725 3300048911 Ga0496108_0074045 Ga0496108_0074045_1793_2353 186
726 3300048912 Ga0496109_0123867 Ga0496109_0123867_1079_1639 186
727 3300048912 Ga0496109_0145515 Ga0496109_0145515_1273_1833 186
728 3300048912 Ga0496109_0304969 Ga0496109_0304969_488_1048 186
729 3300048912 Ga0496109_1278650 Ga0496109_1278650_91_651 186
730 3300048913 Ga0496110_0003842 Ga0496110_0003842_1131_1694 186
731 3300048913 Ga0496110_0075302 Ga0496110_0075302_1898_2458 186
732 3300048913 Ga0496110_0075641 Ga0496110_0075641_2413_2973 186
733 3300048913 Ga0496110_0227332 Ga0496110_0227332_712_1275 186
734 3300048914 Ga0496111_0037450 Ga0496111_0037450_793_1353 186
735 3300048914 Ga0496111_0817421 Ga0496111_0817421_29_589 186
736 3300048915 Ga0496112_0093514 Ga0496112_0093514_272_832 186
737 3300048916 Ga0496113_0124755 Ga0496113_0124755_643_1206 186
738 3300048916 Ga0496113_0191257 Ga0496113_0191257_1035_1598 186
739 3300048916 Ga0496113_0257422 Ga0496113_0257422_712_1275 186
740 3300048916 Ga0496113_0497806 Ga0496113_0497806_130_690 186
741 3300048917 Ga0496114_0021664 Ga0496114_0021664_2300_2860 186
742 3300048917 Ga0496114_0023550 Ga0496114_0023550_2715_3338 186
743 3300048917 Ga0496114_0081857 Ga0496114_0081857_1315_1875 186
744 3300048917 Ga0496114_0173315 Ga0496114_0173315_156_719 186
745 3300048917 Ga0496114_0195696 Ga0496114_0195696_447_1007 186
746 3300048917 Ga0496114_0253845 Ga0496114_0253845_599_1159 186
747 3300048917 Ga0496114_0429517 Ga0496114_0429517_14_577 186
748 3300048918 Ga0496115_0074021 Ga0496115_0074021_1412_1972 186
749 3300048918 Ga0496115_0312547 Ga0496115_0312547_236_796 186
750 3300048918 Ga0496115_0526180 Ga0496115_0526180_149_709 186
751 3300048919 Ga0496116_0019712 Ga0496116_0019712_900_1460 186
752 3300048919 Ga0496116_0134225 Ga0496116_0134225_566_1129 186
753 3300048920 Ga0496117_0000468 Ga0496117_0000468_64337_64897 186
754 3300048920 Ga0496117_0001642 Ga0496117_0001642_5361_5921 186
755 3300048920 Ga0496117_0016338 Ga0496117_0016338_19_579 186
756 3300048920 Ga0496117_0018386 Ga0496117_0018386_3036_3599 186
757 3300048920 Ga0496117_0052644 Ga0496117_0052644_142_765 186
758 3300048920 Ga0496117_0069032 Ga0496117_0069032_397_960 186
759 3300048920 Ga0496117_0103701 Ga0496117_0103701_1188_1748 186
760 3300048920 Ga0496117_0122293 Ga0496117_0122293_692_1252 186
761 3300048920 Ga0496117_0179138 Ga0496117_0179138_222_782 186
762 3300048920 Ga0496117_0443444 Ga0496117_0443444_31_594 186
763 3300048921 Ga0496118_0004353 Ga0496118_0004353_12662_13222 186
764 3300048921 Ga0496118_0011768 Ga0496118_0011768_1266_1826 186
765 3300048921 Ga0496118_0017452 Ga0496118_0017452_5435_5998 186
766 3300048921 Ga0496118_0058757 Ga0496118_0058757_1253_1813 186
767 3300048921 Ga0496118_0082443 Ga0496118_0082443_584_1207 186
768 3300048921 Ga0496118_0210821 Ga0496118_0210821_477_1040 186
769 3300048921 Ga0496118_0356933 Ga0496118_0356933_100_663 186
770 3300048921 Ga0496118_0438540 Ga0496118_0438540_26_586 186
771 3300048922 Ga0496119_0001447 Ga0496119_0001447_27872_28432 186
772 3300048922 Ga0496119_0002168 Ga0496119_0002168_16087_16647 186
773 3300048922 Ga0496119_0002636 Ga0496119_0002636_13589_14149 186
774 3300048922 Ga0496119_0003788 Ga0496119_0003788_439_999 186
775 3300048922 Ga0496119_0008817 Ga0496119_0008817_6068_6631 186
776 3300048922 Ga0496119_0015749 Ga0496119_0015749_2269_2832 186
777 3300048922 Ga0496119_0105437 Ga0496119_0105437_202_762 186
778 3300048922 Ga0496119_0202951 Ga0496119_0202951_201_836 186
779 3300048923 Ga0496120_0000565 Ga0496120_0000565_9536_10096 186
780 3300048923 Ga0496120_0032972 Ga0496120_0032972_1318_1878 186
781 3300048923 Ga0496120_0086267 Ga0496120_0086267_628_1251 186
782 3300048924 Ga0496121_0000040 Ga0496121_0000040_234671_235234 186
783 3300048924 Ga0496121_0083728 Ga0496121_0083728_540_1103 186
784 3300048924 Ga0496121_0202409 Ga0496121_0202409_284_907 186
785 3300048925 Ga0496122_0000054 Ga0496122_0000054_145416_145976 186
786 3300048925 Ga0496122_0000240 Ga0496122_0000240_63931_64491 186
787 3300048925 Ga0496122_0004129 Ga0496122_0004129_3483_4046 186
788 3300048925 Ga0496122_0004482 Ga0496122_0004482_15694_16254 186
789 3300048925 Ga0496122_0044311 Ga0496122_0044311_513_1073 186
790 3300048925 Ga0496122_0054530 Ga0496122_0054530_1642_2202 186
791 3300048925 Ga0496122_0153675 Ga0496122_0153675_427_987 186
792 3300048926 Ga0496123_0000039 Ga0496123_0000039_145416_145976 186
793 3300048926 Ga0496123_0000076 Ga0496123_0000076_1381_1941 186
794 3300048926 Ga0496123_0006901 Ga0496123_0006901_10089_10652 186
795 3300048926 Ga0496123_0007074 Ga0496123_0007074_3703_4263 186
796 3300048926 Ga0496123_0120762 Ga0496123_0120762_769_1329 186
797 3300048926 Ga0496123_0148414 Ga0496123_0148414_194_754 186
798 3300048927 Ga0496124_0002700 Ga0496124_0002700_17398_17958 186
799 3300048927 Ga0496124_0002802 Ga0496124_0002802_1644_2204 186
800 3300048927 Ga0496124_0003349 Ga0496124_0003349_10748_11308 186
801 3300048927 Ga0496124_0103941 Ga0496124_0103941_456_1016 186
802 3300048927 Ga0496124_0110410 Ga0496124_0110410_817_1377 186
803 3300048927 Ga0496124_0365839 Ga0496124_0365839_220_780 186
804 3300048927 Ga0496124_0415576 Ga0496124_0415576_271_831 186
805 3300048928 Ga0496125_0000061 Ga0496125_0000061_86402_86962 186
806 3300048928 Ga0496125_0005037 Ga0496125_0005037_11789_12349 186
807 3300048928 Ga0496125_0013256 Ga0496125_0013256_6716_7276 186
808 3300048928 Ga0496125_0024358 Ga0496125_0024358_1257_1817 186
809 3300048928 Ga0496125_0035020 Ga0496125_0035020_2959_3519 186
810 3300048928 Ga0496125_0062145 Ga0496125_0062145_2178_2738 186
811 3300048928 Ga0496125_0294691 Ga0496125_0294691_375_938 186
812 3300048929 Ga0496126_0003246 Ga0496126_0003246_13031_13591 186
813 3300048929 Ga0496126_0006703 Ga0496126_0006703_1877_2437 186
814 3300048929 Ga0496126_0008752 Ga0496126_0008752_5603_6163 186
815 3300048929 Ga0496126_0017018 Ga0496126_0017018_5719_6279 186
816 3300048929 Ga0496126_0082638 Ga0496126_0082638_1599_2222 186
817 3300048929 Ga0496126_0088488 Ga0496126_0088488_2062_2622 186
818 3300048929 Ga0496126_0428540 Ga0496126_0428540_274_834 186
819 3300048929 Ga0496126_0621418 Ga0496126_0621418_85_645 186
820 3300049127 Ga0501306_032927 Ga0501306_032927_155_715 186
821 3300049127 Ga0501306_033692 Ga0501306_033692_147_710 186
822 3300049127 Ga0501306_050051 Ga0501306_050051_23_586 186
823 3300049129 Ga0501309_014427 Ga0501309_014427_174_734 186
824 3300049129 Ga0501309_050139 Ga0501309_050139_37_600 186
825 3300049160 Ga0501304_007091 Ga0501304_007091_23_586 186
826 3300049161 Ga0501305_062041 Ga0501305_062041_18_581 186
827 3300049527 Ga0501311_021168 Ga0501311_021168_286_846 186
828 3300049528 Ga0501312_052982 Ga0501312_052982_67_630 186
829 3300049530 Ga0501314_021815 Ga0501314_021815_92_652 186
830 3300049530 Ga0501314_028252 Ga0501314_028252_32_595 186
831 3300049531 Ga0501315_018264 Ga0501315_018264_124_687 186
832 3300049533 Ga0501317_008631 Ga0501317_008631_312_875 186
833 3300049533 Ga0501317_033401 Ga0501317_033401_69_632 186
834 3300049533 Ga0501317_033629 Ga0501317_033629_179_739 186
835 3300049534 Ga0501318_004758 Ga0501318_004758_69_632 186
836 3300049534 Ga0501318_006907 Ga0501318_006907_306_869 186
837 3300049534 Ga0501318_012840 Ga0501318_012840_30_590 186
838 3300049535 Ga0501319_010515 Ga0501319_010515_129_692 186
839 3300049535 Ga0501319_019111 Ga0501319_019111_21_584 186
840 3300049537 Ga0501321_009484 Ga0501321_009484_267_830 186
841 3300049537 Ga0501321_011536 Ga0501321_011536_415_975 186
842 3300049539 Ga0501323_014682 Ga0501323_014682_378_938 186
843 3300049541 Ga0501325_005801 Ga0501325_005801_83_646 186
844 3300049541 Ga0501325_023591 Ga0501325_023591_83_643 186
845 3300049568 Ga0501031_0012930 Ga0501031_0012930_881_1444 186
846 3300049568 Ga0501031_0014748 Ga0501031_0014748_2390_2953 186
847 3300049568 Ga0501031_0108135 Ga0501031_0108135_476_1039 186
848 3300049568 Ga0501031_0172007 Ga0501031_0172007_385_945 186
849 3300049568 Ga0501031_0191237 Ga0501031_0191237_233_796 186
850 3300049569 Ga0501032_0002467 Ga0501032_0002467_2103_2666 186
851 3300049569 Ga0501032_0137185 Ga0501032_0137185_946_1509 186
852 3300049569 Ga0501032_0145814 Ga0501032_0145814_494_1057 186
853 3300049570 Ga0501033_0038626 Ga0501033_0038626_643_1206 186
854 3300049570 Ga0501033_0232255 Ga0501033_0232255_65_625 186
855 3300049570 Ga0501033_0324411 Ga0501033_0324411_14_577 186
856 3300049571 Ga0501034_0002512 Ga0501034_0002512_14996_15559 186
857 3300049571 Ga0501034_0003477 Ga0501034_0003477_14474_15034 186
858 3300049571 Ga0501034_0019043 Ga0501034_0019043_3087_3650 186
859 3300049572 Ga0501036_0036856 Ga0501036_0036856_1058_1618 186
860 3300049573 Ga0501037_0001179 Ga0501037_0001179_6310_6873 186
861 3300049573 Ga0501037_0271350 Ga0501037_0271350_86_649 186
862 3300049574 Ga0501038_0015936 Ga0501038_0015936_5386_5949 186
863 3300049574 Ga0501038_0021169 Ga0501038_0021169_5163_5726 186
864 3300049574 Ga0501038_0080407 Ga0501038_0080407_444_1004 186
865 3300049574 Ga0501038_0089014 Ga0501038_0089014_1251_1814 186
866 3300049574 Ga0501038_0174653 Ga0501038_0174653_548_1111 186
867 3300049574 Ga0501038_0483763 Ga0501038_0483763_205_765 186
868 3300049575 Ga0501039_0000678 Ga0501039_0000678_12907_13470 186
869 3300049575 Ga0501039_0155506 Ga0501039_0155506_70_630 186
870 3300049575 Ga0501039_0155636 Ga0501039_0155636_478_1041 186
871 3300049576 Ga0501040_0002965 Ga0501040_0002965_6577_7137 186
872 3300049576 Ga0501040_0264941 Ga0501040_0264941_555_1118 186
873 3300049576 Ga0501040_0355930 Ga0501040_0355930_460_1020 186
874 3300049576 Ga0501040_0370668 Ga0501040_0370668_148_708 186
875 3300049577 Ga0501041_0113126 Ga0501041_0113126_527_1087 186
876 3300049577 Ga0501041_0325976 Ga0501041_0325976_236_799 186
877 3300049578 Ga0501042_0119498 Ga0501042_0119498_889_1449 186
878 3300049578 Ga0501042_0121018 Ga0501042_0121018_876_1439 186
879 3300049578 Ga0501042_0184111 Ga0501042_0184111_230_793 186
880 3300049578 Ga0501042_0754395 Ga0501042_0754395_33_593 186
881 3300049578 Ga0501042_0854212 Ga0501042_0854212_32_592 186
882 3300049579 Ga0501043_0014495 Ga0501043_0014495_5556_6119 186
883 3300049579 Ga0501043_0032686 Ga0501043_0032686_1256_1816 186
884 3300049579 Ga0501043_0037822 Ga0501043_0037822_641_1204 186
885 3300049579 Ga0501043_0161542 Ga0501043_0161542_990_1553 186
886 3300049579 Ga0501043_0197623 Ga0501043_0197623_959_1522 186
887 3300049579 Ga0501043_0268327 Ga0501043_0268327_670_1233 186
888 3300049580 Ga0501046_0005735 Ga0501046_0005735_5712_6275 186
889 3300049580 Ga0501046_0005990 Ga0501046_0005990_10238_10798 186
890 3300049581 Ga0501047_0060896 Ga0501047_0060896_1447_2010 186
891 3300049581 Ga0501047_0082971 Ga0501047_0082971_2022_2585 186
892 3300049581 Ga0501047_0196700 Ga0501047_0196700_1298_1861 186
893 3300049581 Ga0501047_0234502 Ga0501047_0234502_1039_1602 186
894 3300049582 Ga0501048_0007529 Ga0501048_0007529_3502_4062 186
895 3300049582 Ga0501048_0053519 Ga0501048_0053519_1332_1895 186
896 3300049584 Ga0501068_0037663 Ga0501068_0037663_625_1188 186
897 3300049584 Ga0501068_0199775 Ga0501068_0199775_390_953 186
898 3300049586 Ga0501070_0000198 Ga0501070_0000198_51127_51750 186
899 3300049586 Ga0501070_0008288 Ga0501070_0008288_3475_4038 186
900 3300049586 Ga0501070_0361877 Ga0501070_0361877_235_798 186
901 3300049587 Ga0501071_0037112 Ga0501071_0037112_476_1036 186
902 3300049587 Ga0501071_0111922 Ga0501071_0111922_550_1113 186
903 3300049588 Ga0501072_0015828 Ga0501072_0015828_925_1488 186
904 3300049588 Ga0501072_0156811 Ga0501072_0156811_773_1333 186
905 3300049589 Ga0501073_0268591 Ga0501073_0268591_503_1066 186
906 3300049590 Ga0501074_0028586 Ga0501074_0028586_511_1074 186
907 3300049590 Ga0501074_0214328 Ga0501074_0214328_466_1026 186
908 3300049591 Ga0501075_0152142 Ga0501075_0152142_444_1004 186
909 3300049592 Ga0501076_0000795 Ga0501076_0000795_13272_13832 186
910 3300049592 Ga0501076_0426341 Ga0501076_0426341_486_1049 186
911 3300049741 Ga0501079_0314149 Ga0501079_0314149_420_980 186
912 3300049742 Ga0501080_0111243 Ga0501080_0111243_604_1167 186
913 3300049742 Ga0501080_0205219 Ga0501080_0205219_717_1277 186
914 3300049743 Ga0501081_0068380 Ga0501081_0068380_1393_1956 186
915 3300049744 Ga0501083_0000003 Ga0501083_0000003_178427_178990 186
916 3300049744 Ga0501083_0044350 Ga0501083_0044350_483_1046 186
917 3300049822 Ga0501035_0005688 Ga0501035_0005688_2020_2643 186
918 3300049822 Ga0501035_0038886 Ga0501035_0038886_2261_2824 186
919 3300049822 Ga0501035_0636661 Ga0501035_0636661_15_578 186
920 3300049823 Ga0501044_0001379 Ga0501044_0001379_11269_11832 186
921 3300049823 Ga0501044_0025724 Ga0501044_0025724_5211_5774 186
922 3300049823 Ga0501044_0036713 Ga0501044_0036713_1716_2279 186
923 3300049823 Ga0501044_0395774 Ga0501044_0395774_168_731 186
924 3300049824 Ga0501045_0071306 Ga0501045_0071306_1752_2315 186
925 3300049824 Ga0501045_0106551 Ga0501045_0106551_495_1058 186
926 3300049824 Ga0501045_0130034 Ga0501045_0130034_599_1159 186
927 3300050491 nmdc:mga00v17_103909_c1 nmdc:mga00v17_103909_c1_543_1103 186
928 3300050491 nmdc:mga00v17_2023_c2 nmdc:mga00v17_2023_c2_5399_5962 186
929 3300050491 nmdc:mga00v17_44017_c1 nmdc:mga00v17_44017_c1_1016_1576 186
930 3300050491 nmdc:mga00v17_50861_c1 nmdc:mga00v17_50861_c1_1546_2109 186
931 3300050491 nmdc:mga00v17_56106_c1 nmdc:mga00v17_56106_c1_287_850 186
932 3300050491 nmdc:mga00v17_622889_c1 nmdc:mga00v17_622889_c1_88_651 186
933 3300050491 nmdc:mga00v17_623289_c1 nmdc:mga00v17_623289_c1_22_582 186
934 3300050496 nmdc:mga07m45_42585_c1 nmdc:mga07m45_42585_c1_641_1201 186
935 3300050516 nmdc:mga0sz30_101031_c1 nmdc:mga0sz30_101031_c1_273_833 186
936 3300050516 nmdc:mga0sz30_184735_c1 nmdc:mga0sz30_184735_c1_308_868 186
937 3300050516 nmdc:mga0sz30_3162_c1 nmdc:mga0sz30_3162_c1_3184_3747 186
938 3300053080 Ga0500635_0000012 Ga0500635_0000012_100823_101386 186
939 3300053085 Ga0495619_0292551 Ga0495619_0292551_373_975 186
940 3300053085 Ga0495619_0585344 Ga0495619_0585344_72_632 186
941 3300053088 Ga0500644_0005516 Ga0500644_0005516_1348_1911 186
942 3300053136 Ga0500559_0000194 Ga0500559_0000194_14280_14846 186
943 3300053136 Ga0500559_0000264 Ga0500559_0000264_16174_16737 186
944 3300053136 Ga0500559_0000565 Ga0500559_0000565_21542_22102 186
945 3300053136 Ga0500559_0035365 Ga0500559_0035365_539_1099 186
946 3300053139 Ga0500568_0046973 Ga0500568_0046973_588_1223 186
947 3300053140 Ga0500573_0000017 Ga0500573_0000017_10439_11002 186
948 3300053140 Ga0500573_0025610 Ga0500573_0025610_184_747 186
949 3300053151 Ga0500604_0023186 Ga0500604_0023186_382_942 186
950 3300053153 Ga0500616_0000553 Ga0500616_0000553_15550_16110 186
951 3300053153 Ga0500616_0001343 Ga0500616_0001343_20901_21461 186
952 3300053153 Ga0500616_0026369 Ga0500616_0026369_1764_2327 186
953 3300054114 Ga0501084_0028089 Ga0501084_0028089_486_1046 186
954 3300054114 Ga0501084_0357771 Ga0501084_0357771_479_1042 186
955 3300059424 Ga0590075_043434 Ga0590075_043434_58_621 186
956 3300059478 Ga0587093_025631 Ga0587093_025631_216_776 186
957 3300059512 Ga0587092_030583 Ga0587092_030583_209_769 186
958 3300059513 Ga0587094_058652 Ga0587094_058652_38_601 186
959 3300059626 Ga0587115_041102 Ga0587115_041102_149_712 186
960 3300059652 Ga0587107_038675 Ga0587107_038675_69_629 186
961 3300059660 Ga0587124_006163 Ga0587124_006163_332_895 186
962 3300060353 Ga0501082_0066814 Ga0501082_0066814_315_875 186
963 3300061719 Ga0466962_0016187 Ga0466962_0016187_49_705 186
964 3300061719 Ga0466962_0344707 Ga0466962_0344707_24_584 186
965 3300061734 Ga0530510_0086382 Ga0530510_0086382_1198_1761 186
966 3300061734 Ga0530510_0093049 Ga0530510_0093049_457_1017 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

165

220

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

104

157

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

39

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ueb-assembly2.cif.gz_B crystal structure of translation elongation factor p from thermus thermophilus hb8 0.953 1 185
1ueb-assembly2.cif.gz_B crystal structure of translation elongation factor p from thermus thermophilus hb8 0.9479 1 185
1ueb-assembly1.cif.gz_A crystal structure of translation elongation factor p from thermus thermophilus hb8 0.9313 1 185
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.931 1 59
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9277 1 185
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9977 64 126 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9822 64 126 2.40.50.140
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9796 2 63 2.30.30.30
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9787 64 126 2.40.50.140
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9742 2 61 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A543JMV3-F1-model_v4 Elongation factor P (EF-P) 0.9933 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A0Q7B5L2-F1-model_v4 Elongation factor P (EF-P) 0.9933 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A3N3ZSX0-F1-model_v4 Elongation factor P (EF-P) 0.9932 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A4TBX4-F1-model_v4 Elongation factor P (EF-P) 0.9931 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A1Q8JK81-F1-model_v4 Elongation factor P (EF-P) 0.9928 2 186 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
91.95 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map