F486892

General Info

Members Datasets Scaffolds Average Seq Length
962 439 962 292

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0285494|Ga0373935_0285494_108_1109
Length 333
Sequence LPQFRHCARKVNAFARPRRRAAADITIAHAHARSGPRQSKFWIMTTAGELRSGKGHKDENFPVASRIIAPRHRALILAFYEFVRVADDIADHASLAPDDKLKRLDLLEANLLGRGDEEPEAVRLRTALAERAMSPTHPVDVLKAFRLDVTKLRYANWDELIYYCSYSAMPVGRFVLDVHGESRTTWPASDALCAALQVNNHLQDCAKDFRELNRVYITQDVFAARGAKVEELAATRSSPRLLAAIRDLVPGTARLLADGEALVSQVRDIRLAMEIRVIQIYAARILGLLKTRDPLCDLVHLKPWEMMAYGLMGMASGLYRHTTQPARPSLPAV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
22 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
253 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
254 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
257 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
258 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
263 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
264 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
300 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
301 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
306 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
307 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
311 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
401 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
402 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
415 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
418 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
419 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
420 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
421 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
422 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
423 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
424 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
427 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
428 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
432 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
435 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
436 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
437 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
438 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 7.17
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214600503 2209111006 Bacteria 5353
2 ARSoilYngRDRAFT_c00164 3300000042 Bacteria 11336
3 ARcpr5yngRDRAFT_c000009 3300000043 Bacteria 37168
4 ARSoilOldRDRAFT_c000036 3300000044 Bacteria 30390
5 ARCol0oldRDRAFT_c01030 3300000045 Bacteria 2114
6 ARCol0yngRDRAFT_1000061 3300000652 Bacteria 19655
7 JGI24032J14994_100521 3300001430 Unclassified 2015
8 JGI24746J21847_1001326 3300001977 Bacteria 3944
9 JGI24739J22299_10000090 3300001989 Bacteria 26415
10 JGI24737J22298_10000277 3300001990 Bacteria 16911
11 JGI24737J22298_10009651 3300001990 Bacteria 3201
12 JGI24750J21931_1000109 3300002070 Bacteria 13018
13 JGI24745J21846_1000842 3300002073 Bacteria 2828
14 JGI24748J21848_1001050 3300002074 Unclassified 3004
15 JGI24738J21930_10000613 3300002075 Bacteria 10244
16 JGI24749J21850_1003135 3300002076 Unclassified 2310
17 JGI24033J26618_1000507 3300002155 Unclassified 3813
18 JGI24034J26672_10000125 3300002239 Bacteria 11879
19 JGI24742J22300_10000021 3300002244 Bacteria 26079
20 JGI25165J46597_1000297 3300003214 Bacteria 62745
21 JGI25405J52794_10015093 3300003911 Bacteria 1514
22 Ga0065717_1003026 3300005276 Bacteria 1466
23 Ga0065716_1003269 3300005277 Bacteria 1284
24 Ga0065704_10107884 3300005289 Bacteria 2044
25 Ga0065712_10083478 3300005290 Bacteria 2833
26 Ga0065712_10088717 3300005290 Bacteria 2495
27 Ga0065715_10000367 3300005293 Bacteria 20248
28 Ga0065715_10092263 3300005293 Bacteria 5223
29 Ga0070658_10048077 3300005327 Bacteria 3453
30 Ga0070658_10118250 3300005327 Bacteria 2201
31 Ga0070658_10232664 3300005327 Bacteria 1560
32 Ga0070676_10000016 3300005328 Bacteria 52098
33 Ga0070676_10242206 3300005328 Bacteria 1200
34 Ga0070683_100000075 3300005329 Bacteria 67998
35 Ga0070683_100704767 3300005329 Bacteria 967
36 Ga0070690_100000613 3300005330 Bacteria 18064
37 Ga0070690_100188544 3300005330 Bacteria 1428
38 Ga0070670_100003634 3300005331 Bacteria 12845
39 Ga0070670_100189490 3300005331 Bacteria 1786
40 Ga0070670_100338449 3300005331 Bacteria 1320
41 Ga0070677_10000005 3300005333 Bacteria 79035
42 Ga0068869_100000395 3300005334 Bacteria 23763
43 Ga0070666_10040026 3300005335 Bacteria 3126
44 Ga0070680_100002358 3300005336 Bacteria 13946
45 Ga0070680_100004173 3300005336 Bacteria 10829
46 Ga0070680_100017800 3300005336 Bacteria 5605
47 Ga0070682_100000144 3300005337 Bacteria 56618
48 Ga0070682_100024070 3300005337 Bacteria 3621
49 Ga0070682_100118646 3300005337 Bacteria 1773
50 Ga0068868_100001156 3300005338 Bacteria 18087
51 Ga0068868_100020524 3300005338 Bacteria 4967
52 Ga0068868_100171175 3300005338 Bacteria 1798
53 Ga0070660_100000153 3300005339 Bacteria 44533
54 Ga0070660_100031463 3300005339 Bacteria 3985
55 Ga0070660_100089769 3300005339 Bacteria 2422
56 Ga0070689_100000388 3300005340 Bacteria 25778
57 Ga0070689_100047722 3300005340 Bacteria 3302
58 Ga0070691_10000030 3300005341 Bacteria 39784
59 Ga0070687_100000016 3300005343 Bacteria 55051
60 Ga0070687_100161494 3300005343 Bacteria 1325
61 Ga0070661_100000249 3300005344 Bacteria 44246
62 Ga0070661_100150426 3300005344 Unclassified 1759
63 Ga0070661_100289629 3300005344 Bacteria 1272
64 Ga0070692_10000030 3300005345 Bacteria 26864
65 Ga0070668_100000313 3300005347 Bacteria 32032
66 Ga0070668_100081602 3300005347 Unclassified 2535
67 Ga0070668_100267608 3300005347 Bacteria 1423
68 Ga0070669_100000145 3300005353 Bacteria 63377
69 Ga0070675_100000081 3300005354 Bacteria 56087
70 Ga0070675_100019957 3300005354 Bacteria 5346
71 Ga0070675_100061943 3300005354 Bacteria 3091
72 Ga0070671_100000144 3300005355 Bacteria 46097
73 Ga0070671_100056886 3300005355 Bacteria 3254
74 Ga0070674_100000102 3300005356 Bacteria 39445
75 Ga0070674_100007598 3300005356 Bacteria 6401
76 Ga0070674_100043433 3300005356 Bacteria 3058
77 Ga0070673_100000068 3300005364 Bacteria 43540
78 Ga0070673_100125205 3300005364 Bacteria 2149
79 Ga0070688_100000075 3300005365 Bacteria 49279
80 Ga0070688_100008232 3300005365 Bacteria 5651
81 Ga0070659_100000144 3300005366 Bacteria 55051
82 Ga0070667_100006227 3300005367 Bacteria 9929
83 Ga0070667_100059769 3300005367 Bacteria 3225
84 Ga0070709_10001607 3300005434 Bacteria 12200
85 Ga0070709_10121245 3300005434 Unclassified 1773
86 Ga0070709_10167205 3300005434 Bacteria 1534
87 Ga0070714_100051618 3300005435 Bacteria 3507
88 Ga0070714_100176252 3300005435 Bacteria 1943
89 Ga0070713_100001009 3300005436 Bacteria 18005
90 Ga0070713_100058892 3300005436 Bacteria 3205
91 Ga0070710_10014910 3300005437 Bacteria 3920
92 Ga0070710_10017505 3300005437 Bacteria 3669
93 Ga0070701_10000459 3300005438 Bacteria 13894
94 Ga0070711_100021988 3300005439 Bacteria 4129
95 Ga0070711_100031346 3300005439 Bacteria 3529
96 Ga0070711_100106306 3300005439 Bacteria 2051
97 Ga0070705_100000222 3300005440 Bacteria 33817
98 Ga0070700_100000100 3300005441 Bacteria 54110
99 Ga0070694_100000041 3300005444 Bacteria 59039
100 Ga0070708_100008092 3300005445 Bacteria 8431
101 Ga0070663_100000071 3300005455 Bacteria 44246
102 Ga0070663_100104727 3300005455 Bacteria 2116
103 Ga0070678_100000093 3300005456 Bacteria 34270
104 Ga0070678_100075303 3300005456 Bacteria 2539
105 Ga0070678_100142510 3300005456 Bacteria 1920
106 Ga0070662_100030898 3300005457 Bacteria 3753
107 Ga0070662_100083590 3300005457 Unclassified 2383
108 Ga0070681_10000485 3300005458 Bacteria 32421
109 Ga0070681_10003716 3300005458 Bacteria 14317
110 Ga0070681_10049358 3300005458 Bacteria 4203
111 Ga0070681_10092754 3300005458 Bacteria 2968
112 Ga0070681_10097074 3300005458 Bacteria 2894
113 Ga0070681_10142310 3300005458 Bacteria 2328
114 Ga0070681_10425218 3300005458 Bacteria 1240
115 Ga0068867_100000718 3300005459 Bacteria 22121
116 Ga0070685_10002733 3300005466 Bacteria 9035
117 Ga0070685_10061101 3300005466 Bacteria 2205
118 Ga0070699_100386677 3300005518 Bacteria 1264
119 Ga0070679_100002029 3300005530 Bacteria 18172
120 Ga0070679_100006681 3300005530 Bacteria 10757
121 Ga0070679_100204299 3300005530 Bacteria 1940
122 Ga0070679_100516470 3300005530 Bacteria 1138
123 Ga0070684_100000099 3300005535 Bacteria 56087
124 Ga0070684_100176290 3300005535 Bacteria 1943
125 Ga0070684_100308344 3300005535 Bacteria 1453
126 Ga0070697_100071854 3300005536 Bacteria 2839
127 Ga0070697_100275093 3300005536 Bacteria 1444
128 Ga0068853_100000996 3300005539 Bacteria 19946
129 Ga0068853_100227621 3300005539 Bacteria 1705
130 Ga0068853_100289533 3300005539 Bacteria 1512
131 Ga0068853_100562709 3300005539 Bacteria 1081
132 Ga0070672_100000035 3300005543 Bacteria 60570
133 Ga0070672_100095968 3300005543 Bacteria 2398
134 Ga0070686_100000086 3300005544 Bacteria 65438
135 Ga0070686_100012306 3300005544 Bacteria 4868
136 Ga0070686_100016581 3300005544 Bacteria 4287
137 Ga0070695_100000036 3300005545 Bacteria 51060
138 Ga0070695_100036231 3300005545 Bacteria 3103
139 Ga0070696_100000638 3300005546 Bacteria 22371
140 Ga0070693_100000224 3300005547 Bacteria 26392
141 Ga0070693_100052119 3300005547 Bacteria 2345
142 Ga0070693_100063201 3300005547 Bacteria 2157
143 Ga0070693_100092093 3300005547 Bacteria 1830
144 Ga0070693_100100436 3300005547 Unclassified 1762
145 Ga0070665_100081580 3300005548 Unclassified 3240
146 Ga0070665_100271256 3300005548 Bacteria 1698
147 Ga0070704_100000047 3300005549 Bacteria 39895
148 Ga0070704_100012704 3300005549 Bacteria 5210
149 Ga0068855_100003282 3300005563 Bacteria 19813
150 Ga0068855_100057856 3300005563 Bacteria 4543
151 Ga0068855_100506351 3300005563 Bacteria 1311
152 Ga0070664_100000480 3300005564 Bacteria 30207
153 Ga0070664_100065123 3300005564 Bacteria 3109
154 Ga0070664_100083394 3300005564 Bacteria 2757
155 Ga0070664_100367628 3300005564 Bacteria 1311
156 Ga0068857_100000122 3300005577 Bacteria 46603
157 Ga0068854_100000410 3300005578 Bacteria 26884
158 Ga0068854_100343705 3300005578 Bacteria 1219
159 Ga0068856_100001156 3300005614 Bacteria 27741
160 Ga0068856_100121593 3300005614 Bacteria 2612
161 Ga0068856_100124415 3300005614 Bacteria 2581
162 Ga0068856_100271456 3300005614 Bacteria 1712
163 Ga0068856_100658835 3300005614 Bacteria 1067
164 Ga0070702_100000118 3300005615 Bacteria 24062
165 Ga0070702_100024518 3300005615 Unclassified 3219
166 Ga0068852_100000344 3300005616 Bacteria 31408
167 Ga0068852_100015735 3300005616 Bacteria 5880
168 Ga0068852_100366524 3300005616 Bacteria 1410
169 Ga0068859_100008948 3300005617 Bacteria 10111
170 Ga0068859_100089254 3300005617 Bacteria 3132
171 Ga0068859_100165726 3300005617 Unclassified 2290
172 Ga0068859_100329199 3300005617 Bacteria 1622
173 Ga0068859_100390164 3300005617 Bacteria 1488
174 Ga0068864_100000271 3300005618 Bacteria 46062
175 Ga0068864_100043058 3300005618 Bacteria 3865
176 Ga0068864_100068138 3300005618 Bacteria 3091
177 Ga0068864_100152835 3300005618 Bacteria 2092
178 Ga0068864_100297168 3300005618 Unclassified 1511
179 Ga0068866_10000213 3300005718 Bacteria 27527
180 Ga0068866_10072773 3300005718 Bacteria 1822
181 Ga0068866_10161455 3300005718 Bacteria 1307
182 Ga0068861_100003560 3300005719 Bacteria 10359
183 Ga0068861_100079487 3300005719 Unclassified 2564
184 Ga0068851_10013188 3300005834 Bacteria 3910
185 Ga0068870_10000079 3300005840 Bacteria 31219
186 Ga0068863_100000372 3300005841 Bacteria 45645
187 Ga0068858_100000254 3300005842 Bacteria 57050
188 Ga0068858_100000809 3300005842 Bacteria 32733
189 Ga0068858_100007821 3300005842 Bacteria 10317
190 Ga0068858_100124847 3300005842 Unclassified 2409
191 Ga0068858_100482246 3300005842 Bacteria 1197
192 Ga0068860_100000709 3300005843 Bacteria 38176
193 Ga0068860_100323615 3300005843 Bacteria 1514
194 Ga0068860_100402903 3300005843 Unclassified 1354
195 Ga0068862_100000512 3300005844 Bacteria 41177
196 Ga0068862_100042240 3300005844 Bacteria 3883
197 Ga0068862_100223979 3300005844 Bacteria 1704
198 Ga0081455_10000007 3300005937 Bacteria 269394
199 Ga0081455_10001964 3300005937 Bacteria 24626
200 Ga0081455_10008617 3300005937 Bacteria 10579
201 Ga0081455_10009260 3300005937 Bacteria 10142
202 Ga0081539_10031557 3300005985 Bacteria 3262
203 Ga0081539_10112394 3300005985 Bacteria 1368
204 Ga0070717_10079548 3300006028 Bacteria 2749
205 Ga0070717_10230756 3300006028 Bacteria 1630
206 Ga0075363_100173622 3300006048 Bacteria 1224
207 Ga0075432_10008092 3300006058 Unclassified 3587
208 Ga0070715_10018926 3300006163 Bacteria 2632
209 Ga0070715_10055104 3300006163 Unclassified 1724
210 Ga0070716_100016921 3300006173 Bacteria 3771
211 Ga0070712_100225368 3300006175 Bacteria 1486
212 Ga0075367_10251178 3300006178 Bacteria 1109
213 Ga0075427_10000166 3300006194 Bacteria 6374
214 Ga0075366_10061449 3300006195 Bacteria 2233
215 Ga0097621_100000047 3300006237 Bacteria 63910
216 Ga0097621_100022075 3300006237 Bacteria 4936
217 Ga0097621_100037577 3300006237 Bacteria 3882
218 Ga0097621_100416701 3300006237 Bacteria 1205
219 Ga0068871_100000518 3300006358 Bacteria 26422
220 Ga0068871_100001258 3300006358 Bacteria 16940
221 Ga0068871_100036701 3300006358 Bacteria 3903
222 Ga0068871_100053550 3300006358 Bacteria 3271
223 Ga0075428_100026999 3300006844 Bacteria 6358
224 Ga0075430_100001945 3300006846 Bacteria 16975
225 Ga0075431_100001208 3300006847 Bacteria 23343
226 Ga0075433_10000495 3300006852 Bacteria 25642
227 Ga0075433_10029599 3300006852 Bacteria 4667
228 Ga0075434_100000362 3300006871 Bacteria 32982
229 Ga0075434_100001759 3300006871 Bacteria 18630
230 Ga0075434_100015341 3300006871 Bacteria 7342
231 Ga0075434_100106670 3300006871 Bacteria 2811
232 Ga0075434_100337416 3300006871 Bacteria 1528
233 Ga0075429_100002672 3300006880 Bacteria 15008
234 Ga0068865_100000233 3300006881 Bacteria 30830
235 Ga0068865_100055160 3300006881 Bacteria 2764
236 Ga0068865_100233633 3300006881 Bacteria 1444
237 Ga0097620_100008949 3300006931 Bacteria 10111
238 Ga0097620_100089262 3300006931 Bacteria 3132
239 Ga0097620_100165723 3300006931 Unclassified 2290
240 Ga0097620_100329194 3300006931 Bacteria 1622
241 Ga0097620_100390197 3300006931 Bacteria 1488
242 Ga0075435_100056666 3300007076 Bacteria 3169
243 Ga0075435_100211407 3300007076 Bacteria 1646
244 Ga0099795_10002298 3300007788 Bacteria 4458
245 Ga0105244_10021503 3300009036 Bacteria 3567
246 Ga0105250_10075969 3300009092 Unclassified 1359
247 Ga0105240_10017644 3300009093 Bacteria 9611
248 Ga0111539_10000185 3300009094 Bacteria 72688
249 Ga0111539_10002902 3300009094 Bacteria 22764
250 Ga0111539_10021504 3300009094 Bacteria 7937
251 Ga0111539_10029992 3300009094 Bacteria 6616
252 Ga0105245_10000213 3300009098 Bacteria 55096
253 Ga0105245_10001618 3300009098 Bacteria 20495
254 Ga0105245_10032664 3300009098 Bacteria 4608
255 Ga0105245_10443500 3300009098 Bacteria 1305
256 Ga0105247_10000547 3300009101 Bacteria 30561
257 Ga0114129_10022773 3300009147 Bacteria 8883
258 Ga0114129_10107772 3300009147 Unclassified 3847
259 Ga0105243_10000175 3300009148 Bacteria 73728
260 Ga0105243_10023802 3300009148 Bacteria 4667
261 Ga0105243_10042084 3300009148 Bacteria 3575
262 Ga0105243_10078290 3300009148 Bacteria 2691
263 Ga0105243_10210581 3300009148 Bacteria 1711
264 Ga0105243_10552673 3300009148 Bacteria 1100
265 Ga0105241_10000261 3300009174 Bacteria 39222
266 Ga0105241_10013692 3300009174 Bacteria 5943
267 Ga0105241_10046034 3300009174 Bacteria 3312
268 Ga0105242_10000170 3300009176 Bacteria 49285
269 Ga0105242_10021530 3300009176 Bacteria 5065
270 Ga0105242_10043161 3300009176 Bacteria 3647
271 Ga0105248_10003502 3300009177 Bacteria 17416
272 Ga0105248_10006618 3300009177 Bacteria 12698
273 Ga0105248_10069683 3300009177 Unclassified 3949
274 Ga0105248_10145952 3300009177 Bacteria 2670
275 Ga0105237_10001448 3300009545 Bacteria 31355
276 Ga0105237_10043307 3300009545 Bacteria 4535
277 Ga0105238_10095679 3300009551 Bacteria 2956
278 Ga0105238_10185352 3300009551 Bacteria 2057
279 Ga0105238_10188642 3300009551 Bacteria 2038
280 Ga0105238_10300031 3300009551 Bacteria 1590
281 Ga0105238_10414099 3300009551 Bacteria 1342
282 Ga0105238_10499298 3300009551 Bacteria 1217
283 Ga0105238_10794927 3300009551 Unclassified 961
284 Ga0105249_10000200 3300009553 Bacteria 68748
285 Ga0105239_10000834 3300010375 Bacteria 43762
286 Ga0105239_10053877 3300010375 Bacteria 4411
287 Ga0105239_10247291 3300010375 Bacteria 2003
288 Ga0105239_10316268 3300010375 Bacteria 1760
289 Ga0105239_10472853 3300010375 Bacteria 1423
290 Ga0105246_10000050 3300011119 Bacteria 46833
291 Ga0105246_10038806 3300011119 Bacteria 3204
292 Ga0105246_10069182 3300011119 Unclassified 2478
293 Ga0105246_10104971 3300011119 Unclassified 2064
294 Ga0105246_10264170 3300011119 Bacteria 1372
295 Ga0157335_1003426 3300012492 Bacteria 1017
296 Ga0157342_1001628 3300012507 Bacteria 1704
297 Ga0157371_10004767 3300013102 Bacteria 11690
298 Ga0157370_10079802 3300013104 Bacteria 3081
299 Ga0157370_10150930 3300013104 Bacteria 2162
300 Ga0157370_10490099 3300013104 Bacteria 1129
301 Ga0157369_10088233 3300013105 Bacteria 3310
302 Ga0157374_10016814 3300013296 Bacteria 6436
303 Ga0157374_10279687 3300013296 Bacteria 1647
304 Ga0157374_10539789 3300013296 Bacteria 1173
305 Ga0157378_10000717 3300013297 Bacteria 30971
306 Ga0157378_10106892 3300013297 Bacteria 2560
307 Ga0163162_10000222 3300013306 Bacteria 52141
308 Ga0163162_10008882 3300013306 Bacteria 9773
309 Ga0163162_10066922 3300013306 Bacteria 3642
310 Ga0163162_10117267 3300013306 Bacteria 2764
311 Ga0163162_10229594 3300013306 Bacteria 1986
312 Ga0157372_10001555 3300013307 Bacteria 24983
313 Ga0157372_10109054 3300013307 Bacteria 3169
314 Ga0157372_10473793 3300013307 Bacteria 1459
315 Ga0157375_10000355 3300013308 Bacteria 41608
316 Ga0157375_10503904 3300013308 Bacteria 1375
317 Ga0157375_10553561 3300013308 Unclassified 1312
318 Ga0157375_10632270 3300013308 Bacteria 1228
319 Ga0157375_10901113 3300013308 Bacteria 1028
320 Ga0163163_10001323 3300014325 Bacteria 20914
321 Ga0163163_10004121 3300014325 Bacteria 12383
322 Ga0163163_10065975 3300014325 Bacteria 3594
323 Ga0163163_10355403 3300014325 Bacteria 1521
324 Ga0163163_10443942 3300014325 Bacteria 1357
325 Ga0163163_10482464 3300014325 Bacteria 1301
326 Ga0157380_10000166 3300014326 Bacteria 38031
327 Ga0157380_10082205 3300014326 Bacteria 2636
328 Ga0157377_10000207 3300014745 Bacteria 32216
329 Ga0157377_10084022 3300014745 Bacteria 1866
330 Ga0157379_10000036 3300014968 Bacteria 81888
331 Ga0157376_10000062 3300014969 Bacteria 89308
332 Ga0157376_10137447 3300014969 Bacteria 2188
333 Ga0163161_10000363 3300017792 Bacteria 37872
334 Ga0163161_10053225 3300017792 Bacteria 2935
335 Ga0206353_11648404 3300020082 Bacteria 2889
336 Ga0213874_10000655 3300021377 Bacteria 6986
337 Ga0213874_10041534 3300021377 Bacteria 1378
338 Ga0213876_10028937 3300021384 Bacteria 2922
339 Ga0213876_10050900 3300021384 Bacteria 2189
340 Ga0213876_10082998 3300021384 Bacteria 1695
341 Ga0213875_10001890 3300021388 Bacteria 12952
342 Ga0209233_1000107 3300025261 Bacteria 267399
343 Ga0207666_1000029 3300025271 Bacteria 31521
344 Ga0207673_1000443 3300025290 Bacteria 4293
345 Ga0209758_1000157 3300025297 Bacteria 156173
346 Ga0207697_10000208 3300025315 Bacteria 31492
347 Ga0207697_10017795 3300025315 Bacteria 2919
348 Ga0207656_10011445 3300025321 Bacteria 3352
349 Ga0207682_10000004 3300025893 Bacteria 104760
350 Ga0207682_10000236 3300025893 Bacteria 24920
351 Ga0207692_10003912 3300025898 Bacteria 5851
352 Ga0207692_10049816 3300025898 Bacteria 2115
353 Ga0207642_10000556 3300025899 Bacteria 11456
354 Ga0207642_10109559 3300025899 Bacteria 1403
355 Ga0207710_10003459 3300025900 Bacteria 7038
356 Ga0207710_10021476 3300025900 Bacteria 2767
357 Ga0207688_10000042 3300025901 Bacteria 44479
358 Ga0207688_10314951 3300025901 Bacteria 959
359 Ga0207680_10002676 3300025903 Bacteria 8332
360 Ga0207680_10009820 3300025903 Bacteria 4764
361 Ga0207647_10033344 3300025904 Bacteria 3298
362 Ga0207699_10012876 3300025906 Bacteria 4262
363 Ga0207699_10028140 3300025906 Bacteria 3120
364 Ga0207645_10000061 3300025907 Bacteria 77457
365 Ga0207643_10000012 3300025908 Bacteria 133318
366 Ga0207705_10016041 3300025909 Bacteria 5378
367 Ga0207705_10360207 3300025909 Bacteria 1122
368 Ga0207654_10006985 3300025911 Bacteria 5686
369 Ga0207654_10015120 3300025911 Bacteria 3997
370 Ga0207707_10000405 3300025912 Bacteria 45114
371 Ga0207707_10013006 3300025912 Bacteria 7245
372 Ga0207695_10062614 3300025913 Bacteria 3839
373 Ga0207671_10010683 3300025914 Bacteria 7552
374 Ga0207671_10255924 3300025914 Bacteria 1377
375 Ga0207693_10002228 3300025915 Bacteria 16885
376 Ga0207693_10021878 3300025915 Bacteria 5085
377 Ga0207693_10344058 3300025915 Bacteria 1167
378 Ga0207663_10078279 3300025916 Bacteria 2155
379 Ga0207663_10084949 3300025916 Bacteria 2083
380 Ga0207663_10338010 3300025916 Bacteria 1136
381 Ga0207660_10000008 3300025917 Bacteria 98521
382 Ga0207660_10083879 3300025917 Bacteria 2348
383 Ga0207660_10207006 3300025917 Bacteria 1535
384 Ga0207660_10292993 3300025917 Unclassified 1294
385 Ga0207662_10017516 3300025918 Bacteria 4054
386 Ga0207662_10027345 3300025918 Bacteria 3292
387 Ga0207662_10039414 3300025918 Unclassified 2772
388 Ga0207657_10032057 3300025919 Bacteria 4752
389 Ga0207657_10034735 3300025919 Bacteria 4529
390 Ga0207657_10036441 3300025919 Bacteria 4402
391 Ga0207657_10058101 3300025919 Bacteria 3330
392 Ga0207657_10058127 3300025919 Bacteria 3329
393 Ga0207657_10075517 3300025919 Bacteria 2844
394 Ga0207657_10130850 3300025919 Bacteria 2057
395 Ga0207649_10000099 3300025920 Bacteria 71350
396 Ga0207652_10005026 3300025921 Bacteria 10717
397 Ga0207652_10020374 3300025921 Bacteria 5460
398 Ga0207652_10064345 3300025921 Bacteria 3173
399 Ga0207652_10068951 3300025921 Bacteria 3069
400 Ga0207652_10116932 3300025921 Bacteria 2369
401 Ga0207652_10164492 3300025921 Bacteria 1989
402 Ga0207652_10396284 3300025921 Bacteria 1246
403 Ga0207681_10000141 3300025923 Bacteria 59951
404 Ga0207681_10021299 3300025923 Bacteria 4119
405 Ga0207694_10011088 3300025924 Bacteria 6807
406 Ga0207694_10105504 3300025924 Bacteria 2237
407 Ga0207694_10133397 3300025924 Bacteria 1992
408 Ga0207694_10273488 3300025924 Bacteria 1386
409 Ga0207650_10003620 3300025925 Bacteria 10591
410 Ga0207659_10000023 3300025926 Bacteria 142947
411 Ga0207659_10047227 3300025926 Bacteria 3045
412 Ga0207659_10064413 3300025926 Bacteria 2653
413 Ga0207659_10459445 3300025926 Bacteria 1073
414 Ga0207687_10001943 3300025927 Bacteria 14215
415 Ga0207687_10023625 3300025927 Bacteria 4100
416 Ga0207687_10116638 3300025927 Bacteria 1990
417 Ga0207687_10119087 3300025927 Bacteria 1972
418 Ga0207687_10378098 3300025927 Bacteria 1160
419 Ga0207700_10000896 3300025928 Bacteria 17150
420 Ga0207700_10042180 3300025928 Bacteria 3343
421 Ga0207700_10057161 3300025928 Unclassified 2940
422 Ga0207700_10515379 3300025928 Bacteria 1059
423 Ga0207664_10177899 3300025929 Bacteria 1825
424 Ga0207664_10240190 3300025929 Bacteria 1577
425 Ga0207644_10000286 3300025931 Bacteria 33249
426 Ga0207644_10005169 3300025931 Bacteria 8520
427 Ga0207644_10014489 3300025931 Bacteria 5273
428 Ga0207644_10030974 3300025931 Bacteria 3725
429 Ga0207690_10000105 3300025932 Bacteria 68515
430 Ga0207706_10000438 3300025933 Bacteria 44481
431 Ga0207706_10037959 3300025933 Bacteria 4275
432 Ga0207706_10061574 3300025933 Unclassified 3305
433 Ga0207706_10119157 3300025933 Unclassified 2321
434 Ga0207706_10322847 3300025933 Bacteria 1344
435 Ga0207686_10000140 3300025934 Bacteria 56605
436 Ga0207686_10014222 3300025934 Bacteria 4426
437 Ga0207686_10025521 3300025934 Bacteria 3438
438 Ga0207709_10000264 3300025935 Bacteria 62258
439 Ga0207709_10059227 3300025935 Bacteria 2383
440 Ga0207709_10251358 3300025935 Bacteria 1291
441 Ga0207670_10000108 3300025936 Bacteria 56906
442 Ga0207670_10082591 3300025936 Bacteria 2252
443 Ga0207670_10125300 3300025936 Bacteria 1873
444 Ga0207669_10000110 3300025937 Bacteria 40953
445 Ga0207704_10000171 3300025938 Bacteria 34340
446 Ga0207704_10054112 3300025938 Bacteria 2445
447 Ga0207704_10090326 3300025938 Bacteria 2010
448 Ga0207704_10122644 3300025938 Bacteria 1782
449 Ga0207665_10000121 3300025939 Bacteria 51718
450 Ga0207665_10052800 3300025939 Bacteria 2739
451 Ga0207665_10152428 3300025939 Unclassified 1657
452 Ga0207691_10001221 3300025940 Bacteria 25640
453 Ga0207691_10014531 3300025940 Bacteria 7509
454 Ga0207691_10120309 3300025940 Bacteria 2328
455 Ga0207691_10216463 3300025940 Bacteria 1662
456 Ga0207711_10003268 3300025941 Bacteria 14107
457 Ga0207711_10004585 3300025941 Bacteria 11750
458 Ga0207711_10005315 3300025941 Bacteria 10921
459 Ga0207711_10022702 3300025941 Bacteria 5249
460 Ga0207689_10000008 3300025942 Bacteria 127942
461 Ga0207689_10032070 3300025942 Bacteria 4371
462 Ga0207689_10154116 3300025942 Bacteria 1894
463 Ga0207661_10000053 3300025944 Bacteria 90600
464 Ga0207661_10044119 3300025944 Bacteria 3522
465 Ga0207679_10000053 3300025945 Bacteria 109038
466 Ga0207667_10090252 3300025949 Bacteria 3167
467 Ga0207667_10095126 3300025949 Unclassified 3075
468 Ga0207667_10117924 3300025949 Bacteria 2735
469 Ga0207667_10119092 3300025949 Bacteria 2721
470 Ga0207667_10484020 3300025949 Bacteria 1256
471 Ga0207651_10000052 3300025960 Bacteria 53826
472 Ga0207651_10005685 3300025960 Bacteria 6433
473 Ga0207651_10145948 3300025960 Bacteria 1835
474 Ga0207712_10000317 3300025961 Bacteria 44165
475 Ga0207668_10000160 3300025972 Bacteria 47008
476 Ga0207668_10223031 3300025972 Bacteria 1515
477 Ga0207640_10000232 3300025981 Bacteria 38513
478 Ga0207658_10000890 3300025986 Bacteria 24847
479 Ga0207658_10188973 3300025986 Bacteria 1710
480 Ga0207658_10488222 3300025986 Bacteria 1095
481 Ga0207677_10001309 3300026023 Bacteria 13363
482 Ga0207677_10277525 3300026023 Bacteria 1374
483 Ga0207703_10000255 3300026035 Bacteria 60030
484 Ga0207703_10006598 3300026035 Bacteria 9262
485 Ga0207703_10017058 3300026035 Bacteria 5663
486 Ga0207703_10085674 3300026035 Bacteria 2637
487 Ga0207703_10148622 3300026035 Bacteria 2041
488 Ga0207639_10003340 3300026041 Bacteria 10793
489 Ga0207639_10235070 3300026041 Bacteria 1591
490 Ga0207678_10000185 3300026067 Bacteria 53359
491 Ga0207678_10008025 3300026067 Bacteria 9304
492 Ga0207678_10125249 3300026067 Bacteria 2192
493 Ga0207678_10415491 3300026067 Bacteria 1166
494 Ga0207708_10045698 3300026075 Bacteria 3337
495 Ga0207708_10050476 3300026075 Bacteria 3166
496 Ga0207708_10402042 3300026075 Bacteria 1133
497 Ga0207702_10000297 3300026078 Bacteria 57296
498 Ga0207641_10000775 3300026088 Bacteria 34184
499 Ga0207648_10059526 3300026089 Bacteria 3331
500 Ga0207648_10169675 3300026089 Bacteria 1928
501 Ga0207676_10000182 3300026095 Bacteria 55544
502 Ga0207676_10014792 3300026095 Bacteria 5620
503 Ga0207676_10036098 3300026095 Bacteria 3758
504 Ga0207676_10082155 3300026095 Bacteria 2619
505 Ga0207676_10296817 3300026095 Bacteria 1474
506 Ga0207676_10349025 3300026095 Bacteria 1368
507 Ga0207674_10001329 3300026116 Bacteria 32070
508 Ga0207675_100000342 3300026118 Bacteria 44471
509 Ga0207675_100071547 3300026118 Bacteria 3243
510 Ga0207675_100095793 3300026118 Bacteria 2793
511 Ga0207675_100415771 3300026118 Unclassified 1327
512 Ga0207683_10000006 3300026121 Bacteria 181260
513 Ga0207683_10000315 3300026121 Bacteria 44025
514 Ga0207683_10028726 3300026121 Bacteria 4811
515 Ga0207683_10076290 3300026121 Bacteria 2967
516 Ga0207683_10244165 3300026121 Bacteria 1638
517 Ga0207698_10000236 3300026142 Bacteria 34581
518 Ga0207698_10028183 3300026142 Bacteria 4001
519 Ga0207698_10236859 3300026142 Bacteria 1661
520 Ga0209973_1003406 3300027252 Bacteria 1564
521 Ga0209179_1010668 3300027512 Unclassified 1608
522 Ga0209179_1023419 3300027512 Bacteria 1219
523 Ga0210002_1000806 3300027617 Bacteria 4282
524 Ga0209966_1001141 3300027695 Bacteria 4746
525 Ga0209998_10010506 3300027717 Unclassified 1917
526 Ga0209974_10009950 3300027876 Bacteria 3215
527 Ga0207428_10000112 3300027907 Bacteria 110733
528 Ga0207428_10000480 3300027907 Bacteria 48240
529 Ga0207428_10001796 3300027907 Bacteria 21973
530 Ga0268266_10010891 3300028379 Bacteria 7921
531 Ga0268266_10047404 3300028379 Bacteria 3681
532 Ga0268266_10067329 3300028379 Bacteria 3100
533 Ga0268266_10080514 3300028379 Bacteria 2838
534 Ga0268266_10357714 3300028379 Bacteria 1373
535 Ga0268265_10000257 3300028380 Bacteria 60485
536 Ga0268265_10217951 3300028380 Bacteria 1668
537 Ga0268265_10375224 3300028380 Bacteria 1306
538 Ga0268264_10000579 3300028381 Bacteria 44364
539 Ga0268264_10014927 3300028381 Bacteria 6379
540 Ga0268264_10221945 3300028381 Bacteria 1740
541 Ga0265338_10010107 3300028800 Bacteria 11147
542 Ga0265338_10286167 3300028800 Bacteria 1202
543 Ga0265330_10020096 3300031235 Bacteria 3053
544 Ga0265330_10035465 3300031235 Bacteria 2225
545 Ga0265325_10001085 3300031241 Bacteria 19603
546 Ga0265325_10004680 3300031241 Bacteria 8583
547 Ga0265325_10038642 3300031241 Bacteria 2518
548 Ga0265325_10066728 3300031241 Bacteria 1814
549 Ga0265329_10007026 3300031242 Bacteria 4395
550 Ga0265340_10005814 3300031247 Bacteria 6828
551 Ga0265340_10022778 3300031247 Bacteria 3199
552 Ga0265339_10001375 3300031249 Bacteria 18163
553 Ga0265339_10050886 3300031249 Bacteria 2263
554 Ga0265331_10011409 3300031250 Bacteria 4868
555 Ga0265316_10156844 3300031344 Bacteria 1703
556 Ga0307509_10086698 3300031507 Bacteria 3219
557 Ga0307408_100057990 3300031548 Bacteria 2813
558 Ga0265313_10006380 3300031595 Bacteria 8371
559 Ga0307508_10004809 3300031616 Bacteria 13025
560 Ga0265314_10005091 3300031711 Bacteria 11975
561 Ga0265314_10071170 3300031711 Bacteria 2328
562 Ga0265314_10109836 3300031711 Bacteria 1754
563 Ga0265342_10000569 3300031712 Bacteria 38956
564 Ga0265342_10000966 3300031712 Bacteria 28543
565 Ga0316576_10014553 3300031727 Bacteria 5257
566 Ga0316578_10014098 3300031728 Bacteria 4258
567 Ga0373930_0008521 3300034816 Bacteria 1795
568 Ga0373930_0011109 3300034816 Bacteria 1622
569 Ga0373948_0000208 3300034817 Bacteria 6797
570 Ga0373950_0000236 3300034818 Bacteria 7111
571 Ga0373958_0000783 3300034819 Bacteria 4075
572 Ga0373958_0003617 3300034819 Bacteria 2242
573 Ga0373958_0005918 3300034819 Bacteria 1883
574 Ga0373938_0000241 3300034957 Bacteria 8524
575 Ga0373938_0000618 3300034957 Bacteria 5732
576 Ga0373926_0031909 3300035083 Unclassified 1858
577 Ga0373928_0001002 3300035084 Bacteria 5541
578 Ga0373928_0008727 3300035084 Bacteria 1972
579 Ga0373929_0000730 3300035085 Bacteria 6366
580 Ga0373934_0083248 3300035086 Unclassified 1286
581 Ga0373934_0097640 3300035086 Unclassified 1187
582 Ga0373940_0001277 3300035088 Bacteria 4476
583 Ga0373940_0007382 3300035088 Unclassified 2479
584 Ga0373944_0009061 3300035089 Unclassified 2692
585 Ga0373949_0003478 3300035090 Unclassified 3736
586 Ga0373949_0023566 3300035090 Bacteria 1426
587 Ga0373951_0004638 3300035091 Bacteria 3251
588 Ga0373952_0000999 3300035092 Bacteria 5172
589 Ga0373952_0001835 3300035092 Bacteria 3856
590 Ga0373952_0011449 3300035092 Bacteria 1731
591 Ga0373923_0007585 3300035111 Unclassified 3824
592 Ga0373923_0018854 3300035111 Bacteria 2663
593 Ga0373932_0000083 3300035112 Bacteria 24559
594 Ga0373932_0001722 3300035112 Bacteria 5942
595 Ga0373932_0004174 3300035112 Unclassified 3434
596 Ga0373939_0000284 3300035114 Bacteria 13420
597 Ga0373939_0001402 3300035114 Bacteria 5843
598 Ga0373939_0003206 3300035114 Bacteria 3834
599 Ga0373941_0000052 3300035115 Bacteria 17623
600 Ga0373941_0067480 3300035115 Unclassified 1180
601 Ga0373945_0000454 3300035116 Bacteria 11512
602 Ga0373953_0012136 3300035117 Bacteria 3044
603 Ga0373953_0035371 3300035117 Unclassified 1963
604 Ga0373954_0060889 3300035118 Bacteria 1781
605 Ga0373956_0039540 3300035119 Unclassified 2091
606 Ga0373960_0001413 3300035121 Bacteria 5320
607 Ga0373960_0001868 3300035121 Bacteria 4714
608 Ga0373943_0001219 3300035170 Bacteria 11498
609 Ga0373946_0016986 3300035171 Bacteria 2779
610 Ga0373946_0037475 3300035171 Bacteria 1971
611 Ga0373955_0004758 3300035172 Bacteria 6037
612 Ga0373942_0000221 3300035207 Bacteria 14969
613 Ga0373961_0004414 3300035241 Bacteria 3404
614 Ga0373961_0018473 3300035241 Unclassified 1821
615 Ga0373961_0028047 3300035241 Bacteria 1550
616 Ga0373962_0000218 3300035242 Bacteria 12137
617 Ga0373962_0005140 3300035242 Bacteria 3162
618 Ga0373962_0007318 3300035242 Bacteria 2701
619 Ga0316574_0000639 3300035398 Bacteria 14688
620 Ga0373924_0025619 3300035410 Unclassified 2332
621 Ga0373924_0030202 3300035410 Bacteria 2171
622 Ga0373931_0005439 3300035691 Bacteria 5889
623 Ga0373931_0032063 3300035691 Bacteria 2716
624 Ga0373935_0011345 3300035692 Bacteria 5351
625 Ga0373935_0021914 3300035692 Unclassified 3912
626 Ga0373935_0128687 3300035692 Unclassified 1699
627 Ga0373935_0149610 3300035692 Bacteria 1583
628 Ga0373935_0179206 3300035692 Bacteria 1454
629 Ga0373935_0199779 3300035692 Bacteria 1381
630 Ga0373935_0285494 3300035692 Bacteria 1163
631 Ga0373927_0022779 3300035695 Unclassified 4102
632 Ga0373927_0171087 3300035695 Bacteria 1424
633 Ga0373927_0247466 3300035695 Bacteria 1172
634 Ga0373933_0076622 3300035724 Bacteria 2043
635 Ga0373933_0161140 3300035724 Bacteria 1424
636 Ga0373933_0313323 3300035724 Bacteria 1017
637 Ga0373947_0008305 3300035725 Bacteria 5982
638 Ga0373947_0068393 3300035725 Bacteria 2172
639 Ga0373947_0207969 3300035725 Unclassified 1282
640 Ga0373937_0009394 3300036401 Bacteria 8498
641 Ga0373937_0099348 3300036401 Bacteria 2699
642 Ga0373937_0376431 3300036401 Bacteria 1346
643 Ga0316582_0250834 3300036647 Bacteria 1213
644 Ga0316584_0020630 3300036712 Bacteria 4781
645 Ga0373925_0005624 3300037068 Bacteria 9323
646 Ga0373925_0309247 3300037068 Bacteria 1277
647 Ga0395899_0005913 3300037312 Bacteria 9499
648 Ga0395900_0013922 3300037418 Bacteria 8209
649 Ga0395900_0284533 3300037418 Bacteria 1644
650 Ga0395898_0003374 3300037466 Bacteria 17892
651 Ga0395898_0076248 3300037466 Bacteria 3238
652 Ga0395898_0274640 3300037466 Bacteria 1607
653 Ga0436364_0822555 3300037853 Bacteria 215682
654 Ga0436364_0846620 3300037853 Bacteria 1527
655 Ga0395901_0005140 3300038443 Bacteria 13211
656 Ga0395901_0008846 3300038443 Bacteria 10193
657 Ga0395901_0049543 3300038443 Bacteria 4365
658 Ga0395901_0800693 3300038443 Bacteria 931
659 Ga0242420_001067 3300038996 Bacteria 3502
660 Ga0436365_0635250 3300039437 Bacteria 10464
661 Ga0436365_0698484 3300039437 Bacteria 9473
662 Ga0436365_0766362 3300039437 Bacteria 9394
663 Ga0436365_1185723 3300039437 Bacteria 76482
664 Ga0436361_0238061 3300039447 Bacteria 6479
665 Ga0436361_0967476 3300039447 Bacteria 925
666 Ga0436363_0439761 3300039450 Bacteria 2616
667 Ga0436363_0654613 3300039450 Bacteria 18667
668 Ga0436363_0915837 3300039450 Bacteria 3364
669 Ga0439453_0001679 3300041408 Bacteria 2899
670 Ga0439453_0011520 3300041408 Bacteria 1476
671 Ga0439465_0029742 3300041413 Bacteria 1736
672 Ga0439443_000960 3300042003 Bacteria 2950
673 Ga0439448_0006732 3300042005 Bacteria 3311
674 Ga0439450_007432 3300042008 Bacteria 2007
675 Ga0439455_0002817 3300042012 Bacteria 3229
676 Ga0439435_0043381 3300042436 Bacteria 1265
677 Ga0439464_0012069 3300042439 Bacteria 2296
678 Ga0439464_0030202 3300042439 Bacteria 1517
679 Ga0439460_0015178 3300042461 Bacteria 2035
680 Ga0451577_0173219 3300042876 Bacteria 1945
681 Ga0466966_0269690 3300044684 Bacteria 1024
682 Ga0466964_0077698 3300044706 Bacteria 1418
683 Ga0466957_0015422 3300044842 Bacteria 4464
684 Ga0466957_0135878 3300044842 Bacteria 1580
685 Ga0466967_0051605 3300045976 Bacteria 3605
686 Ga0466967_0056910 3300045976 Bacteria 3450
687 Ga0466967_0517402 3300045976 Bacteria 1172
688 Ga0495617_008093 3300046452 Unclassified 3633
689 Ga0495592_0005820 3300046454 Bacteria 9141
690 Ga0495592_0026634 3300046454 Bacteria 4382
691 Ga0495603_0023812 3300046455 Bacteria 3704
692 Ga0495629_0048654 3300046459 Unclassified 2972
693 Ga0495629_0354468 3300046459 Unclassified 1000
694 Ga0495638_0000332 3300046460 Bacteria 59517
695 Ga0495651_0003705 3300046462 Bacteria 11706
696 Ga0495651_0007751 3300046462 Bacteria 8215
697 Ga0495651_0179035 3300046462 Bacteria 1502
698 Ga0495653_0002409 3300046463 Bacteria 14890
699 Ga0495653_0027712 3300046463 Bacteria 4534
700 Ga0495653_0031307 3300046463 Bacteria 4229
701 Ga0495580_0141039 3300046472 Unclassified 1670
702 Ga0495639_0004750 3300046475 Bacteria 5842
703 Ga0495639_0017548 3300046475 Unclassified 3110
704 Ga0495662_0011745 3300046476 Bacteria 4281
705 Ga0495664_0009343 3300046477 Bacteria 5484
706 Ga0495664_0032247 3300046477 Unclassified 3073
707 Ga0495664_0038584 3300046477 Bacteria 2820
708 Ga0495664_0041978 3300046477 Bacteria 2708
709 Ga0495584_0112568 3300046491 Unclassified 1377
710 Ga0495585_0000631 3300046492 Bacteria 32569
711 Ga0495594_0089221 3300046499 Bacteria 1726
712 Ga0495594_0112523 3300046499 Unclassified 1535
713 Ga0495594_0232996 3300046499 Unclassified 1049
714 Ga0495607_0019819 3300046501 Unclassified 4266
715 Ga0495608_0001510 3300046511 Bacteria 16563
716 Ga0495608_0028110 3300046511 Bacteria 3823
717 Ga0495618_0001563 3300046514 Bacteria 15357
718 Ga0495628_0024355 3300046516 Bacteria 4955
719 Ga0495628_0031547 3300046516 Bacteria 4285
720 Ga0495628_0031998 3300046516 Bacteria 4250
721 Ga0495630_0170762 3300046517 Bacteria 1657
722 Ga0495630_0182896 3300046517 Unclassified 1598
723 Ga0495637_0025228 3300046520 Unclassified 2680
724 Ga0495644_0000752 3300046523 Bacteria 13379
725 Ga0495663_0005915 3300046525 Unclassified 3387
726 Ga0495666_0063214 3300046526 Bacteria 1767
727 Ga0495652_0004105 3300046529 Bacteria 14047
728 Ga0495652_0013609 3300046529 Bacteria 7322
729 Ga0495652_0176099 3300046529 Unclassified 1646
730 Ga0495665_0008272 3300046531 Bacteria 5638
731 Ga0495640_0011139 3300046533 Bacteria 6923
732 Ga0495640_0057280 3300046533 Bacteria 2660
733 Ga0495640_0137308 3300046533 Bacteria 1578
734 Ga0495586_0071708 3300046535 Unclassified 1893
735 Ga0495598_0002749 3300046537 Unclassified 3654
736 Ga0495609_0052605 3300046538 Unclassified 1812
737 Ga0495645_0001517 3300046543 Bacteria 15661
738 Ga0495667_0003144 3300046559 Bacteria 11078
739 Ga0495667_0005312 3300046559 Bacteria 8707
740 Ga0495667_0034860 3300046559 Unclassified 3365
741 Ga0495667_0042526 3300046559 Bacteria 3013
742 Ga0495667_0125579 3300046559 Bacteria 1656
743 Ga0495656_0004899 3300046615 Unclassified 4609
744 Ga0495634_0030035 3300046642 Bacteria 3757
745 Ga0495611_0002973 3300046648 Bacteria 7561
746 Ga0495625_0003059 3300046660 Bacteria 17138
747 Ga0495635_0001408 3300046663 Bacteria 16045
748 Ga0495635_0027974 3300046663 Bacteria 3920
749 Ga0495635_0039010 3300046663 Bacteria 3288
750 Ga0495635_0049978 3300046663 Unclassified 2882
751 Ga0495659_0000882 3300046664 Bacteria 10663
752 Ga0495661_0048852 3300046665 Unclassified 2569
753 Ga0495588_0024242 3300046674 Unclassified 3012
754 Ga0495657_0001888 3300046675 Bacteria 17819
755 Ga0495657_0044338 3300046675 Unclassified 3026
756 Ga0495599_0020358 3300046678 Bacteria 4131
757 Ga0495599_0021313 3300046678 Bacteria 4042
758 Ga0495599_0223400 3300046678 Unclassified 1151
759 Ga0495623_0012554 3300046679 Bacteria 5482
760 Ga0495623_0016072 3300046679 Bacteria 4835
761 Ga0495646_0010421 3300046680 Bacteria 5908
762 Ga0495646_0011661 3300046680 Bacteria 5585
763 Ga0495646_0185981 3300046680 Bacteria 1138
764 Ga0495658_0000560 3300046683 Bacteria 20250
765 Ga0495658_0009422 3300046683 Unclassified 4868
766 Ga0495669_0063344 3300046684 Unclassified 1677
767 Ga0495613_0003541 3300046689 Bacteria 11708
768 Ga0495670_0000125 3300046691 Bacteria 33077
769 Ga0495600_0007601 3300046809 Bacteria 6639
770 Ga0495600_0148049 3300046809 Bacteria 1521
771 Ga0495604_0008243 3300047317 Bacteria 8243
772 Ga0495604_0019908 3300047317 Bacteria 5366
773 Ga0495674_0012627 3300047319 Bacteria 7958
774 Ga0495674_0029944 3300047319 Bacteria 4952
775 Ga0495674_0244716 3300047319 Bacteria 1477
776 Ga0495674_0476688 3300047319 Bacteria 1000
777 Ga0495676_0021858 3300047321 Bacteria 5578
778 Ga0495676_0073772 3300047321 Bacteria 2615
779 Ga0495680_0004412 3300047322 Bacteria 13448
780 Ga0495680_0014033 3300047322 Bacteria 6961
781 Ga0495680_0021068 3300047322 Bacteria 5463
782 Ga0495680_0023630 3300047322 Bacteria 5108
783 Ga0495680_0205967 3300047322 Bacteria 1410
784 Ga0495675_0045223 3300047444 Bacteria 2803
785 Ga0495677_0079755 3300047445 Bacteria 1226
786 Ga0495684_0031787 3300047471 Bacteria 4054
787 Ga0495684_0100888 3300047471 Unclassified 2182
788 Ga0495593_0124853 3300047673 Unclassified 1308
789 Ga0495602_0003131 3300048088 Bacteria 17024
790 Ga0495602_0005133 3300048088 Bacteria 13715
791 Ga0495602_0122028 3300048088 Bacteria 2095
792 Ga0495614_0132409 3300048089 Bacteria 1104
793 Ga0496100_0000249 3300048903 Bacteria 27845
794 Ga0496100_0010298 3300048903 Bacteria 5290
795 Ga0496100_0028260 3300048903 Bacteria 3458
796 Ga0496100_0314649 3300048903 Bacteria 1174
797 Ga0496101_0000526 3300048904 Bacteria 23789
798 Ga0496101_0016287 3300048904 Bacteria 5017
799 Ga0496101_0018614 3300048904 Bacteria 4725
800 Ga0496102_0000433 3300048905 Bacteria 48390
801 Ga0496102_0039389 3300048905 Bacteria 4270
802 Ga0496102_0058306 3300048905 Bacteria 3527
803 Ga0496102_0120570 3300048905 Unclassified 2449
804 Ga0496102_0124734 3300048905 Bacteria 2406
805 Ga0496103_0000537 3300048906 Bacteria 30478
806 Ga0496103_0031236 3300048906 Bacteria 3244
807 Ga0496103_0032797 3300048906 Bacteria 3171
808 Ga0496103_0054408 3300048906 Bacteria 2480
809 Ga0496104_0017252 3300048907 Bacteria 6570
810 Ga0496104_0027601 3300048907 Bacteria 5255
811 Ga0496104_0036930 3300048907 Bacteria 4568
812 Ga0496104_0042787 3300048907 Bacteria 4253
813 Ga0496104_0237212 3300048907 Bacteria 1735
814 Ga0496105_0011066 3300048908 Bacteria 7111
815 Ga0496105_0065812 3300048908 Bacteria 2991
816 Ga0496105_0095526 3300048908 Bacteria 2455
817 Ga0496106_0001596 3300048909 Bacteria 17036
818 Ga0496106_0011937 3300048909 Bacteria 6415
819 Ga0496106_0052013 3300048909 Bacteria 3089
820 Ga0496106_0311060 3300048909 Bacteria 1264
821 Ga0496107_0000078 3300048910 Bacteria 46997
822 Ga0496107_0019236 3300048910 Bacteria 4818
823 Ga0496108_0007233 3300048911 Bacteria 8997
824 Ga0496108_0007917 3300048911 Bacteria 8615
825 Ga0496108_0036082 3300048911 Bacteria 4111
826 Ga0496108_0056943 3300048911 Bacteria 3285
827 Ga0496108_0103489 3300048911 Bacteria 2429
828 Ga0496108_0261851 3300048911 Bacteria 1505
829 Ga0496109_0000406 3300048912 Bacteria 38388
830 Ga0496109_0033630 3300048912 Bacteria 4613
831 Ga0496109_0050329 3300048912 Bacteria 3794
832 Ga0496109_0052682 3300048912 Bacteria 3710
833 Ga0496109_0073983 3300048912 Bacteria 3131
834 Ga0496109_0161909 3300048912 Bacteria 2096
835 Ga0496110_0013775 3300048913 Bacteria 6699
836 Ga0496110_0025351 3300048913 Bacteria 5066
837 Ga0496110_0161757 3300048913 Bacteria 2029
838 Ga0496110_0310705 3300048913 Bacteria 1436
839 Ga0496111_0024889 3300048914 Bacteria 4222
840 Ga0496111_0055008 3300048914 Bacteria 2878
841 Ga0496111_0095503 3300048914 Bacteria 2181
842 Ga0496112_0031930 3300048915 Bacteria 5110
843 Ga0496112_0038727 3300048915 Bacteria 4657
844 Ga0496112_0062212 3300048915 Bacteria 3681
845 Ga0496112_0085855 3300048915 Bacteria 3113
846 Ga0496112_0115532 3300048915 Bacteria 2654
847 Ga0496113_0016310 3300048916 Bacteria 5129
848 Ga0496113_0042358 3300048916 Bacteria 3364
849 Ga0496113_0053458 3300048916 Bacteria 3020
850 Ga0496113_0184077 3300048916 Bacteria 1656
851 Ga0496113_0311313 3300048916 Bacteria 1261
852 Ga0496113_0453433 3300048916 Bacteria 1030
853 Ga0496114_0000418 3300048917 Bacteria 31450
854 Ga0496114_0029193 3300048917 Bacteria 4530
855 Ga0496114_0054803 3300048917 Bacteria 3324
856 Ga0496115_0000437 3300048918 Bacteria 33699
857 Ga0496115_0004165 3300048918 Bacteria 10441
858 Ga0496115_0007793 3300048918 Bacteria 7894
859 Ga0496115_0047193 3300048918 Bacteria 3443
860 Ga0496115_0095942 3300048918 Bacteria 2427
861 Ga0496115_0153141 3300048918 Bacteria 1904
862 Ga0496119_0008818 3300048922 Bacteria 8777
863 Ga0496121_0051404 3300048924 Bacteria 3471
864 Ga0496122_0002969 3300048925 Bacteria 23111
865 Ga0496123_0001480 3300048926 Bacteria 32605
866 Ga0496125_0006882 3300048928 Bacteria 12181
867 Ga0496126_0014468 3300048929 Bacteria 7974
868 Ga0496126_0187598 3300048929 Bacteria 1753
869 Ga0496126_0195495 3300048929 Bacteria 1711
870 Ga0501034_0062316 3300049571 Bacteria 3745
871 Ga0501034_0099805 3300049571 Bacteria 2898
872 Ga0501036_0352722 3300049572 Bacteria 1228
873 Ga0501037_0289552 3300049573 Bacteria 1139
874 Ga0501038_0011459 3300049574 Bacteria 8088
875 Ga0501043_0015446 3300049579 Bacteria 5980
876 Ga0501047_0089345 3300049581 Bacteria 2958
877 Ga0501048_0337348 3300049582 Bacteria 1074
878 Ga0501067_0207977 3300049583 Bacteria 1090
879 Ga0501068_0158916 3300049584 Bacteria 1424
880 Ga0501069_0005668 3300049585 Bacteria 6504
881 Ga0501071_0013418 3300049587 Bacteria 5583
882 Ga0501071_0110680 3300049587 Bacteria 2030
883 Ga0501072_0001393 3300049588 Bacteria 18197
884 Ga0501073_0088402 3300049589 Bacteria 2154
885 Ga0501074_0081851 3300049590 Bacteria 2315
886 Ga0501074_0146445 3300049590 Bacteria 1689
887 Ga0501076_0160487 3300049592 Bacteria 1831
888 Ga0501076_0210122 3300049592 Bacteria 1590
889 Ga0501076_0284354 3300049592 Bacteria 1355
890 Ga0501077_0048973 3300049593 Bacteria 2685
891 Ga0501079_0179903 3300049741 Bacteria 1650
892 Ga0501080_0012087 3300049742 Bacteria 7908
893 Ga0501080_0501111 3300049742 Bacteria 1085
894 Ga0501081_0062078 3300049743 Bacteria 2591
895 Ga0501083_0023728 3300049744 Bacteria 4254
896 Ga0501035_0160968 3300049822 Bacteria 1942
897 Ga0501035_0403457 3300049822 Bacteria 1137
898 Ga0501044_0021906 3300049823 Bacteria 6815
899 Ga0501044_0116933 3300049823 Bacteria 2671
900 nmdc:mga03683_136563_c1 3300050489 Bacteria 1100
901 nmdc:mga03683_42135_c1 3300050489 Bacteria 1877
902 nmdc:mga00v17_274852_c1 3300050491 Bacteria 1093
903 nmdc:mga0k408_158495_c1 3300050493 Bacteria 1348
904 nmdc:mga0k408_18336_c1 3300050493 Bacteria 3905
905 nmdc:mga0k408_34297_c1 3300050493 Bacteria 2259
906 nmdc:mga06z11_87691_c1 3300050494 Bacteria 1683
907 nmdc:mga06z11_91428_c1 3300050494 Bacteria 1653
908 nmdc:mga07m45_214620_c1 3300050496 Unclassified 1119
909 nmdc:mga05p37_501_c1 3300050507 Bacteria 43088
910 nmdc:mga05p37_55172_c1 3300050507 Bacteria 4889
911 nmdc:mga09592_1023_c1 3300050508 Bacteria 22209
912 nmdc:mga0qj67_62_c1 3300050509 Bacteria 79928
913 nmdc:mga0qj67_713_c1 3300050509 Bacteria 22596
914 nmdc:mga06r32_14313_c1 3300050510 Bacteria 7197
915 nmdc:mga06r32_495138_c1 3300050510 Bacteria 1199
916 nmdc:mga06r32_516718_c1 3300050510 Bacteria 1170
917 nmdc:mga08y16_111019_c1 3300050511 Bacteria 2855
918 nmdc:mga08y16_11459_c1 3300050511 Bacteria 9317
919 nmdc:mga08y16_291392_c1 3300050511 Bacteria 1683
920 nmdc:mga08y16_81646_c1 3300050511 Bacteria 3370
921 nmdc:mga0n895_12135_c1 3300050512 Bacteria 7712
922 nmdc:mga0n895_184325_c1 3300050512 Unclassified 2119
923 nmdc:mga0n895_18888_c1 3300050512 Bacteria 6393
924 nmdc:mga0n895_406118_c1 3300050512 Bacteria 1377
925 nmdc:mga0n895_7677_c1 3300050512 Bacteria 9276
926 nmdc:mga0rr50_18874_c1 3300050513 Bacteria 4642
927 nmdc:mga0rr50_298628_c1 3300050513 Unclassified 1347
928 nmdc:mga0rr50_428034_c1 3300050513 Unclassified 1120
929 nmdc:mga0rr50_762_c1 3300050513 Bacteria 17306
930 nmdc:mga08x19_22152_c1 3300050514 Bacteria 3932
931 nmdc:mga08x19_94011_c1 3300050514 Bacteria 1982
932 nmdc:mga0a205_2136_c1 3300050515 Bacteria 17355
933 nmdc:mga0a205_3474_c1 3300050515 Bacteria 14078
934 nmdc:mga0a205_71054_c1 3300050515 Unclassified 3362
935 Ga0495601_0019095 3300053077 Bacteria 4177
936 Ga0495601_0042710 3300053077 Bacteria 2845
937 Ga0495601_0082214 3300053077 Bacteria 2067
938 Ga0495601_0136256 3300053077 Unclassified 1600
939 Ga0495601_0138647 3300053077 Bacteria 1586
940 Ga0495612_0000494 3300053078 Bacteria 15696
941 Ga0495612_0001786 3300053078 Bacteria 8812
942 Ga0495612_0004081 3300053078 Bacteria 6051
943 Ga0495612_0011494 3300053078 Bacteria 3570
944 Ga0500610_0033630 3300053079 Bacteria 2618
945 Ga0495595_0002176 3300053084 Bacteria 7616
946 Ga0495595_0002965 3300053084 Bacteria 6704
947 Ga0495595_0010018 3300053084 Bacteria 3931
948 Ga0495595_0201806 3300053084 Bacteria 990
949 Ga0495619_0000150 3300053085 Bacteria 51375
950 Ga0495619_0000189 3300053085 Bacteria 45580
951 Ga0495619_0009544 3300053085 Bacteria 6124
952 Ga0495619_0037058 3300053085 Unclassified 3176
953 Ga0495619_0053177 3300053085 Bacteria 2678
954 Ga0495619_0299688 3300053085 Bacteria 1113
955 Ga0500556_0000143 3300053104 Bacteria 59621
956 Ga0500595_019552 3300053119 Bacteria 2455
957 Ga0500658_0000788 3300053134 Bacteria 13121
958 Ga0500624_000020 3300053157 Bacteria 118392
959 Ga0500637_0000022 3300053178 Bacteria 61494
960 Ga0501082_0000016 3300060353 Bacteria 115081
961 Ga0501082_0041644 3300060353 Bacteria 3960
962 Ga0501082_0116320 3300060353 Unclassified 2316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10344058 Ga0207693_103440582 251
2 3300048929 Ga0496126_0195495 Ga0496126_0195495_740_1516 256
3 3300025919 Ga0207657_10036441 Ga0207657_100364413 264
4 3300025924 Ga0207694_10011088 Ga0207694_100110886 264
5 3300048924 Ga0496121_0051404 Ga0496121_0051404_708_1547 264
6 3300049571 Ga0501034_0062316 Ga0501034_0062316_2294_3160 264
7 3300039447 Ga0436361_0967476 Ga0436361_0967476_98_901 265
8 3300037466 Ga0395898_0274640 Ga0395898_0274640_299_1174 267
9 3300049592 Ga0501076_0284354 Ga0501076_0284354_399_1280 267
10 3300005937 Ga0081455_10009260 Ga0081455_100092602 268
11 3300037312 Ga0395899_0005913 Ga0395899_0005913_5458_6333 268
12 3300037418 Ga0395900_0013922 Ga0395900_0013922_5963_6838 268
13 3300037466 Ga0395898_0003374 Ga0395898_0003374_9816_10691 268
14 3300038443 Ga0395901_0008846 Ga0395901_0008846_1486_2361 268
15 3300035725 Ga0373947_0207969 Ga0373947_0207969_32_841 269
16 3300046499 Ga0495594_0232996 Ga0495594_0232996_23_832 269
17 3300046516 Ga0495628_0031547 Ga0495628_0031547_3455_4264 269
18 3300047471 Ga0495684_0100888 Ga0495684_0100888_1352_2161 269
19 3300047673 Ga0495593_0124853 Ga0495593_0124853_479_1288 269
20 3300048089 Ga0495614_0132409 Ga0495614_0132409_69_878 269
21 3300053084 Ga0495595_0201806 Ga0495595_0201806_169_978 269
22 3300025916 Ga0207663_10084949 Ga0207663_100849492 270
23 3300049582 Ga0501048_0337348 Ga0501048_0337348_139_1050 270
24 3300009147 Ga0114129_10022773 Ga0114129_100227733 271
25 3300049583 Ga0501067_0207977 Ga0501067_0207977_140_1021 271
26 3300050507 nmdc:mga05p37_55172_c1 nmdc:mga05p37_55172_c1_3727_4623 271
27 3300005327 Ga0070658_10232664 Ga0070658_102326642 272
28 3300005336 Ga0070680_100004173 Ga0070680_1000041733 272
29 3300005458 Ga0070681_10003716 Ga0070681_100037164 272
30 3300005530 Ga0070679_100006681 Ga0070679_1000066812 272
31 3300025912 Ga0207707_10013006 Ga0207707_100130063 272
32 3300025921 Ga0207652_10020374 Ga0207652_100203744 272
33 3300049590 Ga0501074_0081851 Ga0501074_0081851_190_1056 272
34 3300025939 Ga0207665_10052800 Ga0207665_100528002 273
35 3300048918 Ga0496115_0004165 Ga0496115_0004165_2507_3388 273
36 3300049572 Ga0501036_0352722 Ga0501036_0352722_112_1023 273
37 3300049573 Ga0501037_0289552 Ga0501037_0289552_140_1051 273
38 3300049574 Ga0501038_0011459 Ga0501038_0011459_7015_7926 273
39 3300049579 Ga0501043_0015446 Ga0501043_0015446_3902_4813 273
40 3300049585 Ga0501069_0005668 Ga0501069_0005668_3432_4343 273
41 3300049587 Ga0501071_0013418 Ga0501071_0013418_4126_5037 273
42 3300049742 Ga0501080_0012087 Ga0501080_0012087_1043_1954 273
43 3300049822 Ga0501035_0160968 Ga0501035_0160968_140_1051 273
44 3300049823 Ga0501044_0116933 Ga0501044_0116933_1480_2391 273
45 3300048915 Ga0496112_0062212 Ga0496112_0062212_1882_2793 275
46 3300049571 Ga0501034_0099805 Ga0501034_0099805_1787_2698 275
47 3300005617 Ga0068859_100390164 Ga0068859_1003901642 276
48 3300005842 Ga0068858_100482246 Ga0068858_1004822462 276
49 3300005844 Ga0068862_100223979 Ga0068862_1002239792 276
50 3300006931 Ga0097620_100390197 Ga0097620_1003901972 276
51 3300009551 Ga0105238_10414099 Ga0105238_104140992 276
52 3300028380 Ga0268265_10375224 Ga0268265_103752241 276
53 3300048928 Ga0496125_0006882 Ga0496125_0006882_10652_11530 276
54 3300048929 Ga0496126_0014468 Ga0496126_0014468_1840_2718 276
55 3300005330 Ga0070690_100188544 Ga0070690_1001885441 277
56 3300005338 Ga0068868_100171175 Ga0068868_1001711752 277
57 3300005456 Ga0070678_100075303 Ga0070678_1000753033 277
58 3300005618 Ga0068864_100043058 Ga0068864_1000430582 277
59 3300007788 Ga0099795_10002298 Ga0099795_100022983 277
60 3300009098 Ga0105245_10443500 Ga0105245_104435001 277
61 3300013306 Ga0163162_10117267 Ga0163162_101172673 277
62 3300014325 Ga0163163_10065975 Ga0163163_100659752 277
63 3300025918 Ga0207662_10017516 Ga0207662_100175162 277
64 3300025923 Ga0207681_10021299 Ga0207681_100212993 277
65 3300025938 Ga0207704_10054112 Ga0207704_100541123 277
66 3300026095 Ga0207676_10036098 Ga0207676_100360982 277
67 3300027512 Ga0209179_1023419 Ga0209179_10234192 277
68 3300034816 Ga0373930_0008521 Ga0373930_0008521_234_1178 277
69 3300035241 Ga0373961_0028047 Ga0373961_0028047_580_1524 277
70 3300048911 Ga0496108_0056943 Ga0496108_0056943_1422_2366 277
71 3300048916 Ga0496113_0184077 Ga0496113_0184077_420_1364 277
72 3300053157 Ga0500624_000020 Ga0500624_000020_53659_54513 277
73 3300053178 Ga0500637_0000022 Ga0500637_0000022_53634_54488 277
74 3300021388 Ga0213875_10001890 Ga0213875_100018904 278
75 3300037853 Ga0436364_0822555 Ga0436364_0822555_58062_58904 278
76 3300046460 Ga0495638_0000332 Ga0495638_0000332_12347_13186 278
77 3300053134 Ga0500658_0000788 Ga0500658_0000788_7880_8719 278
78 3300003214 JGI25165J46597_1000297 JGI25165J46597_100029741 279
79 3300005356 Ga0070674_100007598 Ga0070674_1000075982 279
80 3300005456 Ga0070678_100142510 Ga0070678_1001425102 279
81 3300005539 Ga0068853_100227621 Ga0068853_1002276211 279
82 3300005548 Ga0070665_100271256 Ga0070665_1002712562 279
83 3300005842 Ga0068858_100000254 Ga0068858_10000025412 279
84 3300009098 Ga0105245_10001618 Ga0105245_100016189 279
85 3300009148 Ga0105243_10210581 Ga0105243_102105812 279
86 3300013296 Ga0157374_10279687 Ga0157374_102796872 279
87 3300013296 Ga0157374_10539789 Ga0157374_105397892 279
88 3300013308 Ga0157375_10503904 Ga0157375_105039041 279
89 3300025261 Ga0209233_1000107 Ga0209233_1000107250 279
90 3300025927 Ga0207687_10023625 Ga0207687_100236254 279
91 3300025940 Ga0207691_10120309 Ga0207691_101203093 279
92 3300025949 Ga0207667_10484020 Ga0207667_104840202 279
93 3300026035 Ga0207703_10000255 Ga0207703_1000025539 279
94 3300026121 Ga0207683_10028726 Ga0207683_100287262 279
95 3300028379 Ga0268266_10080514 Ga0268266_100805143 279
96 3300028379 Ga0268266_10357714 Ga0268266_103577141 279
97 3300031507 Ga0307509_10086698 Ga0307509_100866982 279
98 3300031616 Ga0307508_10004809 Ga0307508_100048095 279
99 3300046526 Ga0495666_0063214 Ga0495666_0063214_93_935 279
100 3300046660 Ga0495625_0003059 Ga0495625_0003059_12226_13068 279
101 3300048909 Ga0496106_0311060 Ga0496106_0311060_29_928 279
102 3300046559 Ga0495667_0034860 Ga0495667_0034860_19_861 280
103 3300005458 Ga0070681_10142310 Ga0070681_101423102 281
104 3300005578 Ga0068854_100343705 Ga0068854_1003437051 281
105 3300005985 Ga0081539_10112394 Ga0081539_101123941 281
106 3300037418 Ga0395900_0284533 Ga0395900_0284533_474_1352 281
107 3300038443 Ga0395901_0005140 Ga0395901_0005140_4085_4963 281
108 3300038443 Ga0395901_0800693 Ga0395901_0800693_17_895 281
109 3300025960 Ga0207651_10145948 Ga0207651_101459482 282
110 3300028379 Ga0268266_10067329 Ga0268266_100673292 282
111 3300031711 Ga0265314_10109836 Ga0265314_101098362 282
112 3300045976 Ga0466967_0056910 Ga0466967_0056910_899_1765 282
113 3300005436 Ga0070713_100058892 Ga0070713_1000588923 283
114 3300006028 Ga0070717_10079548 Ga0070717_100795482 283
115 3300009551 Ga0105238_10188642 Ga0105238_101886423 283
116 3300013308 Ga0157375_10632270 Ga0157375_106322702 283
117 3300014325 Ga0163163_10482464 Ga0163163_104824642 283
118 3300025297 Ga0209758_1000157 Ga0209758_100015727 283
119 3300025928 Ga0207700_10042180 Ga0207700_100421803 283
120 3300025942 Ga0207689_10154116 Ga0207689_101541162 283
121 3300026023 Ga0207677_10277525 Ga0207677_102775252 283
122 3300026095 Ga0207676_10296817 Ga0207676_102968172 283
123 3300026095 Ga0207676_10349025 Ga0207676_103490252 283
124 3300028800 Ga0265338_10010107 Ga0265338_100101072 283
125 3300031249 Ga0265339_10050886 Ga0265339_100508862 283
126 3300037853 Ga0436364_0846620 Ga0436364_0846620_209_1069 283
127 3300039450 Ga0436363_0915837 Ga0436363_0915837_1028_1888 283
128 3300046533 Ga0495640_0137308 Ga0495640_0137308_25_924 283
129 3300048918 Ga0496115_0153141 Ga0496115_0153141_861_1742 283
130 3300050494 nmdc:mga06z11_87691_c1 nmdc:mga06z11_87691_c1_402_1283 283
131 3300035171 Ga0373946_0016986 Ga0373946_0016986_810_1709 284
132 3300035692 Ga0373935_0149610 Ga0373935_0149610_498_1397 284
133 3300041413 Ga0439465_0029742 Ga0439465_0029742_755_1642 284
134 3300046477 Ga0495664_0041978 Ga0495664_0041978_1530_2429 284
135 3300047319 Ga0495674_0244716 Ga0495674_0244716_547_1446 284
136 3300048922 Ga0496119_0008818 Ga0496119_0008818_3414_4301 284
137 3300048925 Ga0496122_0002969 Ga0496122_0002969_14465_15352 284
138 3300048926 Ga0496123_0001480 Ga0496123_0001480_30446_31333 284
139 3300049592 Ga0501076_0160487 Ga0501076_0160487_360_1244 284
140 3300049741 Ga0501079_0179903 Ga0501079_0179903_145_1029 284
141 3300053077 Ga0495601_0082214 Ga0495601_0082214_656_1555 284
142 3300053078 Ga0495612_0011494 Ga0495612_0011494_402_1301 284
143 3300053104 Ga0500556_0000143 Ga0500556_0000143_24221_25108 284
144 3300005563 Ga0068855_100057856 Ga0068855_1000578562 285
145 3300005985 Ga0081539_10031557 Ga0081539_100315574 285
146 3300006358 Ga0068871_100053550 Ga0068871_1000535502 285
147 3300014325 Ga0163163_10443942 Ga0163163_104439421 285
148 3300025921 Ga0207652_10396284 Ga0207652_103962842 285
149 3300025928 Ga0207700_10515379 Ga0207700_105153791 285
150 3300025949 Ga0207667_10117924 Ga0207667_101179242 285
151 3300031548 Ga0307408_100057990 Ga0307408_1000579903 285
152 3300035692 Ga0373935_0285494 Ga0373935_0285494_108_1109 285
153 3300049822 Ga0501035_0403457 Ga0501035_0403457_140_1018 285
154 3300005937 Ga0081455_10001964 Ga0081455_1000196414 286
155 3300006163 Ga0070715_10018926 Ga0070715_100189262 286
156 3300021377 Ga0213874_10041534 Ga0213874_100415342 286
157 3300021384 Ga0213876_10028937 Ga0213876_100289372 286
158 3300025906 Ga0207699_10012876 Ga0207699_100128763 286
159 3300031242 Ga0265329_10007026 Ga0265329_100070263 286
160 3300031247 Ga0265340_10005814 Ga0265340_100058148 286
161 3300031249 Ga0265339_10001375 Ga0265339_1000137518 286
162 3300031250 Ga0265331_10011409 Ga0265331_100114094 286
163 3300031711 Ga0265314_10071170 Ga0265314_100711702 286
164 3300031712 Ga0265342_10000569 Ga0265342_1000056919 286
165 3300037068 Ga0373925_0309247 Ga0373925_0309247_90_971 286
166 3300039437 Ga0436365_0766362 Ga0436365_0766362_1282_2157 286
167 3300039450 Ga0436363_0439761 Ga0436363_0439761_845_1723 286
168 3300048903 Ga0496100_0314649 Ga0496100_0314649_13_873 286
169 3300048916 Ga0496113_0453433 Ga0496113_0453433_13_873 286
170 3300049589 Ga0501073_0088402 Ga0501073_0088402_930_1796 286
171 3300050493 nmdc:mga0k408_18336_c1 nmdc:mga0k408_18336_c1_2053_2946 286
172 3300021377 Ga0213874_10000655 Ga0213874_100006556 287
173 3300026121 Ga0207683_10244165 Ga0207683_102441652 287
174 3300027512 Ga0209179_1010668 Ga0209179_10106682 287
175 3300031727 Ga0316576_10014553 Ga0316576_100145534 287
176 3300031728 Ga0316578_10014098 Ga0316578_100140984 287
177 3300035398 Ga0316574_0000639 Ga0316574_0000639_9637_10518 287
178 3300036647 Ga0316582_0250834 Ga0316582_0250834_175_1056 287
179 3300036712 Ga0316584_0020630 Ga0316584_0020630_2508_3389 287
180 3300039437 Ga0436365_1185723 Ga0436365_1185723_29146_30018 287
181 3300039450 Ga0436363_0654613 Ga0436363_0654613_5349_6221 287
182 3300048908 Ga0496105_0095526 Ga0496105_0095526_774_1658 287
183 3300050489 nmdc:mga03683_136563_c1 nmdc:mga03683_136563_c1_136_1008 287
184 3300050493 nmdc:mga0k408_158495_c1 nmdc:mga0k408_158495_c1_198_1070 287
185 3300050509 nmdc:mga0qj67_62_c1 nmdc:mga0qj67_62_c1_39840_40721 287
186 3300050510 nmdc:mga06r32_516718_c1 nmdc:mga06r32_516718_c1_274_1155 287
187 3300053085 Ga0495619_0053177 Ga0495619_0053177_639_1523 287
188 3300053119 Ga0500595_019552 Ga0500595_019552_408_1283 287
189 3300006048 Ga0075363_100173622 Ga0075363_1001736222 288
190 3300006175 Ga0070712_100225368 Ga0070712_1002253682 288
191 3300006178 Ga0075367_10251178 Ga0075367_102511782 288
192 3300006871 Ga0075434_100015341 Ga0075434_1000153414 288
193 3300006871 Ga0075434_100337416 Ga0075434_1003374162 288
194 3300007076 Ga0075435_100211407 Ga0075435_1002114072 288
195 3300009551 Ga0105238_10499298 Ga0105238_104992981 288
196 3300010375 Ga0105239_10316268 Ga0105239_103162682 288
197 3300013307 Ga0157372_10473793 Ga0157372_104737932 288
198 3300021384 Ga0213876_10082998 Ga0213876_100829982 288
199 3300025909 Ga0207705_10360207 Ga0207705_103602071 288
200 3300025919 Ga0207657_10130850 Ga0207657_101308502 288
201 3300025924 Ga0207694_10273488 Ga0207694_102734882 288
202 3300026075 Ga0207708_10402042 Ga0207708_104020422 288
203 3300031241 Ga0265325_10038642 Ga0265325_100386423 288
204 3300031247 Ga0265340_10022778 Ga0265340_100227782 288
205 3300035118 Ga0373954_0060889 Ga0373954_0060889_891_1769 288
206 3300035692 Ga0373935_0199779 Ga0373935_0199779_331_1209 288
207 3300035724 Ga0373933_0313323 Ga0373933_0313323_82_960 288
208 3300035725 Ga0373947_0068393 Ga0373947_0068393_841_1719 288
209 3300036401 Ga0373937_0376431 Ga0373937_0376431_415_1293 288
210 3300039437 Ga0436365_0698484 Ga0436365_0698484_6606_7481 288
211 3300039447 Ga0436361_0238061 Ga0436361_0238061_5173_6048 288
212 3300045976 Ga0466967_0517402 Ga0466967_0517402_137_1015 288
213 3300046517 Ga0495630_0170762 Ga0495630_0170762_201_1079 288
214 3300046559 Ga0495667_0125579 Ga0495667_0125579_251_1129 288
215 3300047319 Ga0495674_0476688 Ga0495674_0476688_102_980 288
216 3300048913 Ga0496110_0310705 Ga0496110_0310705_201_1076 288
217 3300048929 Ga0496126_0187598 Ga0496126_0187598_688_1563 288
218 3300049588 Ga0501072_0001393 Ga0501072_0001393_13704_14585 288
219 3300049744 Ga0501083_0023728 Ga0501083_0023728_1030_1911 288
220 3300050494 nmdc:mga06z11_91428_c1 nmdc:mga06z11_91428_c1_412_1290 288
221 3300050512 nmdc:mga0n895_406118_c1 nmdc:mga0n895_406118_c1_472_1350 288
222 3300050512 nmdc:mga0n895_7677_c1 nmdc:mga0n895_7677_c1_3723_4601 288
223 3300050514 nmdc:mga08x19_22152_c1 nmdc:mga08x19_22152_c1_1948_2826 288
224 3300060353 Ga0501082_0000016 Ga0501082_0000016_103820_104701 288
225 3300060353 Ga0501082_0041644 Ga0501082_0041644_16_897 288
226 3300006195 Ga0075366_10061449 Ga0075366_100614492 289
227 3300044842 Ga0466957_0135878 Ga0466957_0135878_672_1541 289
228 3300045976 Ga0466967_0051605 Ga0466967_0051605_671_1540 289
229 3300050493 nmdc:mga0k408_34297_c1 nmdc:mga0k408_34297_c1_479_1357 289
230 3300050511 nmdc:mga08y16_291392_c1 nmdc:mga08y16_291392_c1_177_1055 289
231 3300005331 Ga0070670_100189490 Ga0070670_1001894902 290
232 3300005331 Ga0070670_100338449 Ga0070670_1003384491 290
233 3300005347 Ga0070668_100267608 Ga0070668_1002676082 290
234 3300005435 Ga0070714_100176252 Ga0070714_1001762522 290
235 3300005539 Ga0068853_100562709 Ga0068853_1005627091 290
236 3300005543 Ga0070672_100095968 Ga0070672_1000959683 290
237 3300005564 Ga0070664_100083394 Ga0070664_1000833942 290
238 3300005614 Ga0068856_100271456 Ga0068856_1002714562 290
239 3300005617 Ga0068859_100329199 Ga0068859_1003291992 290
240 3300005618 Ga0068864_100152835 Ga0068864_1001528352 290
241 3300006931 Ga0097620_100329194 Ga0097620_1003291942 290
242 3300009148 Ga0105243_10552673 Ga0105243_105526732 290
243 3300011119 Ga0105246_10038806 Ga0105246_100388063 290
244 3300013297 Ga0157378_10106892 Ga0157378_101068922 290
245 3300013306 Ga0163162_10229594 Ga0163162_102295941 290
246 3300014325 Ga0163163_10355403 Ga0163163_103554031 290
247 3300025893 Ga0207682_10000236 Ga0207682_1000023619 290
248 3300025901 Ga0207688_10314951 Ga0207688_103149511 290
249 3300025926 Ga0207659_10459445 Ga0207659_104594452 290
250 3300025927 Ga0207687_10378098 Ga0207687_103780981 290
251 3300025929 Ga0207664_10240190 Ga0207664_102401902 290
252 3300025933 Ga0207706_10037959 Ga0207706_100379592 290
253 3300025933 Ga0207706_10322847 Ga0207706_103228472 290
254 3300025935 Ga0207709_10251358 Ga0207709_102513582 290
255 3300025936 Ga0207670_10125300 Ga0207670_101253002 290
256 3300025938 Ga0207704_10090326 Ga0207704_100903262 290
257 3300025940 Ga0207691_10014531 Ga0207691_100145317 290
258 3300025942 Ga0207689_10032070 Ga0207689_100320702 290
259 3300025972 Ga0207668_10223031 Ga0207668_102230312 290
260 3300026041 Ga0207639_10235070 Ga0207639_102350702 290
261 3300026067 Ga0207678_10415491 Ga0207678_104154912 290
262 3300026095 Ga0207676_10014792 Ga0207676_100147922 290
263 3300028380 Ga0268265_10217951 Ga0268265_102179512 290
264 3300028800 Ga0265338_10286167 Ga0265338_102861672 290
265 3300031235 Ga0265330_10035465 Ga0265330_100354652 290
266 3300031241 Ga0265325_10066728 Ga0265325_100667282 290
267 3300031344 Ga0265316_10156844 Ga0265316_101568442 290
268 3300035410 Ga0373924_0030202 Ga0373924_0030202_751_1635 290
269 3300035724 Ga0373933_0161140 Ga0373933_0161140_418_1302 290
270 3300039437 Ga0436365_0635250 Ga0436365_0635250_3670_4551 290
271 3300041408 Ga0439453_0001679 Ga0439453_0001679_836_1720 290
272 3300042003 Ga0439443_000960 Ga0439443_000960_282_1166 290
273 3300042436 Ga0439435_0043381 Ga0439435_0043381_14_898 290
274 3300042439 Ga0439464_0030202 Ga0439464_0030202_251_1135 290
275 3300044684 Ga0466966_0269690 Ga0466966_0269690_63_935 290
276 3300047322 Ga0495680_0205967 Ga0495680_0205967_442_1326 290
277 3300048088 Ga0495602_0122028 Ga0495602_0122028_1124_2008 290
278 3300048903 Ga0496100_0028260 Ga0496100_0028260_666_1553 290
279 3300050510 nmdc:mga06r32_495138_c1 nmdc:mga06r32_495138_c1_32_916 290
280 3300053077 Ga0495601_0042710 Ga0495601_0042710_1442_2326 290
281 3300053079 Ga0500610_0033630 Ga0500610_0033630_1235_2119 290
282 3300005327 Ga0070658_10048077 Ga0070658_100480771 291
283 3300005327 Ga0070658_10118250 Ga0070658_101182502 291
284 3300005329 Ga0070683_100704767 Ga0070683_1007047671 291
285 3300005339 Ga0070660_100089769 Ga0070660_1000897692 291
286 3300005344 Ga0070661_100289629 Ga0070661_1002896291 291
287 3300005434 Ga0070709_10167205 Ga0070709_101672052 291
288 3300005437 Ga0070710_10014910 Ga0070710_100149103 291
289 3300005439 Ga0070711_100106306 Ga0070711_1001063062 291
290 3300005458 Ga0070681_10092754 Ga0070681_100927542 291
291 3300005458 Ga0070681_10425218 Ga0070681_104252182 291
292 3300005530 Ga0070679_100204299 Ga0070679_1002042992 291
293 3300005530 Ga0070679_100516470 Ga0070679_1005164702 291
294 3300005535 Ga0070684_100176290 Ga0070684_1001762902 291
295 3300005539 Ga0068853_100289533 Ga0068853_1002895332 291
296 3300005547 Ga0070693_100063201 Ga0070693_1000632012 291
297 3300005563 Ga0068855_100506351 Ga0068855_1005063512 291
298 3300005614 Ga0068856_100124415 Ga0068856_1001244152 291
299 3300005614 Ga0068856_100658835 Ga0068856_1006588351 291
300 3300005616 Ga0068852_100015735 Ga0068852_1000157352 291
301 3300005616 Ga0068852_100366524 Ga0068852_1003665242 291
302 3300006237 Ga0097621_100416701 Ga0097621_1004167011 291
303 3300009094 Ga0111539_10029992 Ga0111539_100299921 291
304 3300009176 Ga0105242_10043161 Ga0105242_100431613 291
305 3300009177 Ga0105248_10006618 Ga0105248_100066188 291
306 3300009551 Ga0105238_10095679 Ga0105238_100956792 291
307 3300009551 Ga0105238_10185352 Ga0105238_101853522 291
308 3300010375 Ga0105239_10472853 Ga0105239_104728532 291
309 3300013104 Ga0157370_10150930 Ga0157370_101509302 291
310 3300013104 Ga0157370_10490099 Ga0157370_104900992 291
311 3300013105 Ga0157369_10088233 Ga0157369_100882333 291
312 3300013307 Ga0157372_10109054 Ga0157372_101090543 291
313 3300020082 Ga0206353_11648404 Ga0206353_116484042 291
314 3300021384 Ga0213876_10050900 Ga0213876_100509002 291
315 3300025898 Ga0207692_10049816 Ga0207692_100498162 291
316 3300025909 Ga0207705_10016041 Ga0207705_100160414 291
317 3300025915 Ga0207693_10021878 Ga0207693_100218784 291
318 3300025917 Ga0207660_10083879 Ga0207660_100838792 291
319 3300025919 Ga0207657_10032057 Ga0207657_100320573 291
320 3300025919 Ga0207657_10075517 Ga0207657_100755172 291
321 3300025921 Ga0207652_10164492 Ga0207652_101644922 291
322 3300025924 Ga0207694_10105504 Ga0207694_101055042 291
323 3300025927 Ga0207687_10116638 Ga0207687_101166382 291
324 3300025931 Ga0207644_10030974 Ga0207644_100309741 291
325 3300025934 Ga0207686_10025521 Ga0207686_100255212 291
326 3300025941 Ga0207711_10004585 Ga0207711_100045858 291
327 3300025949 Ga0207667_10090252 Ga0207667_100902522 291
328 3300026035 Ga0207703_10148622 Ga0207703_101486221 291
329 3300026142 Ga0207698_10028183 Ga0207698_100281834 291
330 3300026142 Ga0207698_10236859 Ga0207698_102368592 291
331 3300031241 Ga0265325_10001085 Ga0265325_100010859 291
332 3300031712 Ga0265342_10000966 Ga0265342_1000096612 291
333 3300034819 Ga0373958_0003617 Ga0373958_0003617_469_1368 291
334 3300035084 Ga0373928_0008727 Ga0373928_0008727_101_1000 291
335 3300035092 Ga0373952_0011449 Ga0373952_0011449_801_1700 291
336 3300035691 Ga0373931_0032063 Ga0373931_0032063_858_1757 291
337 3300035695 Ga0373927_0171087 Ga0373927_0171087_455_1354 291
338 3300037466 Ga0395898_0076248 Ga0395898_0076248_1538_2413 291
339 3300038443 Ga0395901_0049543 Ga0395901_0049543_2440_3315 291
340 3300044706 Ga0466964_0077698 Ga0466964_0077698_528_1403 291
341 3300044842 Ga0466957_0015422 Ga0466957_0015422_2046_2921 291
342 3300048903 Ga0496100_0010298 Ga0496100_0010298_1590_2489 291
343 3300048904 Ga0496101_0018614 Ga0496101_0018614_194_1093 291
344 3300048905 Ga0496102_0039389 Ga0496102_0039389_10_909 291
345 3300048906 Ga0496103_0031236 Ga0496103_0031236_1404_2303 291
346 3300048907 Ga0496104_0027601 Ga0496104_0027601_2766_3665 291
347 3300048908 Ga0496105_0011066 Ga0496105_0011066_4116_5015 291
348 3300048909 Ga0496106_0011937 Ga0496106_0011937_2114_3013 291
349 3300048911 Ga0496108_0103489 Ga0496108_0103489_254_1153 291
350 3300048912 Ga0496109_0050329 Ga0496109_0050329_1873_2772 291
351 3300048913 Ga0496110_0013775 Ga0496110_0013775_3747_4646 291
352 3300048914 Ga0496111_0095503 Ga0496111_0095503_902_1801 291
353 3300048915 Ga0496112_0085855 Ga0496112_0085855_1868_2767 291
354 3300048917 Ga0496114_0029193 Ga0496114_0029193_1435_2334 291
355 3300048918 Ga0496115_0007793 Ga0496115_0007793_1591_2490 291
356 3300049581 Ga0501047_0089345 Ga0501047_0089345_1909_2784 291
357 3300049584 Ga0501068_0158916 Ga0501068_0158916_158_1057 291
358 3300049590 Ga0501074_0146445 Ga0501074_0146445_323_1198 291
359 3300049823 Ga0501044_0021906 Ga0501044_0021906_2708_3583 291
360 3300050489 nmdc:mga03683_42135_c1 nmdc:mga03683_42135_c1_792_1691 291
361 3300050491 nmdc:mga00v17_274852_c1 nmdc:mga00v17_274852_c1_24_923 291
362 3300050511 nmdc:mga08y16_81646_c1 nmdc:mga08y16_81646_c1_1999_2874 291
363 3300053077 Ga0495601_0138647 Ga0495601_0138647_347_1222 291
364 3300053084 Ga0495595_0010018 Ga0495595_0010018_2508_3383 291
365 3300053085 Ga0495619_0299688 Ga0495619_0299688_11_1000 291
366 3300003911 JGI25405J52794_10015093 JGI25405J52794_100150932 292
367 3300005290 Ga0065712_10088717 Ga0065712_100887172 292
368 3300005328 Ga0070676_10242206 Ga0070676_102422062 292
369 3300005335 Ga0070666_10040026 Ga0070666_100400263 292
370 3300005337 Ga0070682_100024070 Ga0070682_1000240704 292
371 3300005337 Ga0070682_100118646 Ga0070682_1001186462 292
372 3300005338 Ga0068868_100020524 Ga0068868_1000205244 292
373 3300005343 Ga0070687_100161494 Ga0070687_1001614942 292
374 3300005344 Ga0070661_100150426 Ga0070661_1001504262 292
375 3300005347 Ga0070668_100081602 Ga0070668_1000816022 292
376 3300005354 Ga0070675_100061943 Ga0070675_1000619433 292
377 3300005355 Ga0070671_100056886 Ga0070671_1000568863 292
378 3300005364 Ga0070673_100125205 Ga0070673_1001252053 292
379 3300005367 Ga0070667_100059769 Ga0070667_1000597693 292
380 3300005434 Ga0070709_10001607 Ga0070709_100016077 292
381 3300005435 Ga0070714_100051618 Ga0070714_1000516182 292
382 3300005436 Ga0070713_100001009 Ga0070713_1000010094 292
383 3300005437 Ga0070710_10017505 Ga0070710_100175052 292
384 3300005439 Ga0070711_100021988 Ga0070711_1000219882 292
385 3300005439 Ga0070711_100031346 Ga0070711_1000313462 292
386 3300005455 Ga0070663_100104727 Ga0070663_1001047273 292
387 3300005466 Ga0070685_10061101 Ga0070685_100611012 292
388 3300005544 Ga0070686_100016581 Ga0070686_1000165814 292
389 3300005547 Ga0070693_100052119 Ga0070693_1000521192 292
390 3300005564 Ga0070664_100367628 Ga0070664_1003676282 292
391 3300005615 Ga0070702_100024518 Ga0070702_1000245182 292
392 3300005617 Ga0068859_100165726 Ga0068859_1001657262 292
393 3300005618 Ga0068864_100068138 Ga0068864_1000681384 292
394 3300005718 Ga0068866_10161455 Ga0068866_101614552 292
395 3300005719 Ga0068861_100079487 Ga0068861_1000794873 292
396 3300005842 Ga0068858_100007821 Ga0068858_1000078212 292
397 3300005843 Ga0068860_100323615 Ga0068860_1003236152 292
398 3300005843 Ga0068860_100402903 Ga0068860_1004029032 292
399 3300005937 Ga0081455_10000007 Ga0081455_10000007149 292
400 3300006028 Ga0070717_10230756 Ga0070717_102307562 292
401 3300006058 Ga0075432_10008092 Ga0075432_100080923 292
402 3300006163 Ga0070715_10055104 Ga0070715_100551042 292
403 3300006173 Ga0070716_100016921 Ga0070716_1000169214 292
404 3300006237 Ga0097621_100037577 Ga0097621_1000375774 292
405 3300006358 Ga0068871_100001258 Ga0068871_10000125816 292
406 3300006844 Ga0075428_100026999 Ga0075428_1000269994 292
407 3300006871 Ga0075434_100106670 Ga0075434_1001066702 292
408 3300006881 Ga0068865_100055160 Ga0068865_1000551602 292
409 3300006931 Ga0097620_100165723 Ga0097620_1001657232 292
410 3300007076 Ga0075435_100056666 Ga0075435_1000566663 292
411 3300009094 Ga0111539_10021504 Ga0111539_100215044 292
412 3300009098 Ga0105245_10032664 Ga0105245_100326642 292
413 3300009147 Ga0114129_10107772 Ga0114129_101077723 292
414 3300009148 Ga0105243_10023802 Ga0105243_100238024 292
415 3300009148 Ga0105243_10042084 Ga0105243_100420842 292
416 3300009174 Ga0105241_10013692 Ga0105241_100136925 292
417 3300009176 Ga0105242_10021530 Ga0105242_100215304 292
418 3300009177 Ga0105248_10069683 Ga0105248_100696832 292
419 3300009177 Ga0105248_10145952 Ga0105248_101459523 292
420 3300009551 Ga0105238_10300031 Ga0105238_103000312 292
421 3300009551 Ga0105238_10794927 Ga0105238_107949271 292
422 3300010375 Ga0105239_10053877 Ga0105239_100538774 292
423 3300010375 Ga0105239_10247291 Ga0105239_102472912 292
424 3300011119 Ga0105246_10069182 Ga0105246_100691823 292
425 3300011119 Ga0105246_10104971 Ga0105246_101049712 292
426 3300012492 Ga0157335_1003426 Ga0157335_10034261 292
427 3300013104 Ga0157370_10079802 Ga0157370_100798023 292
428 3300013306 Ga0163162_10066922 Ga0163162_100669223 292
429 3300013308 Ga0157375_10553561 Ga0157375_105535612 292
430 3300013308 Ga0157375_10901113 Ga0157375_109011132 292
431 3300014325 Ga0163163_10001323 Ga0163163_100013238 292
432 3300014745 Ga0157377_10084022 Ga0157377_100840222 292
433 3300014969 Ga0157376_10137447 Ga0157376_101374472 292
434 3300017792 Ga0163161_10053225 Ga0163161_100532253 292
435 3300025898 Ga0207692_10003912 Ga0207692_100039123 292
436 3300025899 Ga0207642_10109559 Ga0207642_101095592 292
437 3300025900 Ga0207710_10021476 Ga0207710_100214762 292
438 3300025903 Ga0207680_10009820 Ga0207680_100098203 292
439 3300025906 Ga0207699_10028140 Ga0207699_100281402 292
440 3300025911 Ga0207654_10006985 Ga0207654_100069853 292
441 3300025914 Ga0207671_10255924 Ga0207671_102559242 292
442 3300025915 Ga0207693_10002228 Ga0207693_1000222814 292
443 3300025916 Ga0207663_10078279 Ga0207663_100782792 292
444 3300025917 Ga0207660_10207006 Ga0207660_102070062 292
445 3300025917 Ga0207660_10292993 Ga0207660_102929932 292
446 3300025918 Ga0207662_10039414 Ga0207662_100394142 292
447 3300025921 Ga0207652_10064345 Ga0207652_100643454 292
448 3300025924 Ga0207694_10133397 Ga0207694_101333972 292
449 3300025926 Ga0207659_10064413 Ga0207659_100644132 292
450 3300025927 Ga0207687_10119087 Ga0207687_101190872 292
451 3300025928 Ga0207700_10000896 Ga0207700_1000089614 292
452 3300025929 Ga0207664_10177899 Ga0207664_101778992 292
453 3300025931 Ga0207644_10005169 Ga0207644_100051695 292
454 3300025933 Ga0207706_10061574 Ga0207706_100615742 292
455 3300025933 Ga0207706_10119157 Ga0207706_101191572 292
456 3300025934 Ga0207686_10014222 Ga0207686_100142222 292
457 3300025936 Ga0207670_10082591 Ga0207670_100825912 292
458 3300025938 Ga0207704_10122644 Ga0207704_101226442 292
459 3300025939 Ga0207665_10000121 Ga0207665_100001212 292
460 3300025940 Ga0207691_10216463 Ga0207691_102164631 292
461 3300025941 Ga0207711_10005315 Ga0207711_100053153 292
462 3300025944 Ga0207661_10044119 Ga0207661_100441193 292
463 3300025986 Ga0207658_10188973 Ga0207658_101889732 292
464 3300025986 Ga0207658_10488222 Ga0207658_104882222 292
465 3300026035 Ga0207703_10017058 Ga0207703_100170582 292
466 3300026035 Ga0207703_10085674 Ga0207703_100856742 292
467 3300026067 Ga0207678_10008025 Ga0207678_100080254 292
468 3300026095 Ga0207676_10082155 Ga0207676_100821552 292
469 3300026118 Ga0207675_100095793 Ga0207675_1000957933 292
470 3300026118 Ga0207675_100415771 Ga0207675_1004157712 292
471 3300026121 Ga0207683_10000315 Ga0207683_100003154 292
472 3300027876 Ga0209974_10009950 Ga0209974_100099501 292
473 3300028379 Ga0268266_10010891 Ga0268266_100108916 292
474 3300028381 Ga0268264_10014927 Ga0268264_100149275 292
475 3300031235 Ga0265330_10020096 Ga0265330_100200962 292
476 3300031241 Ga0265325_10004680 Ga0265325_100046807 292
477 3300031595 Ga0265313_10006380 Ga0265313_100063802 292
478 3300031711 Ga0265314_10005091 Ga0265314_100050917 292
479 3300034816 Ga0373930_0011109 Ga0373930_0011109_165_1043 292
480 3300034819 Ga0373958_0005918 Ga0373958_0005918_865_1743 292
481 3300035083 Ga0373926_0031909 Ga0373926_0031909_605_1483 292
482 3300035086 Ga0373934_0097640 Ga0373934_0097640_289_1167 292
483 3300035089 Ga0373944_0009061 Ga0373944_0009061_90_968 292
484 3300035090 Ga0373949_0023566 Ga0373949_0023566_296_1174 292
485 3300035111 Ga0373923_0007585 Ga0373923_0007585_2418_3296 292
486 3300035111 Ga0373923_0018854 Ga0373923_0018854_1703_2581 292
487 3300035112 Ga0373932_0004174 Ga0373932_0004174_2141_3019 292
488 3300035114 Ga0373939_0001402 Ga0373939_0001402_1065_1943 292
489 3300035115 Ga0373941_0067480 Ga0373941_0067480_45_923 292
490 3300035116 Ga0373945_0000454 Ga0373945_0000454_6548_7426 292
491 3300035117 Ga0373953_0012136 Ga0373953_0012136_1370_2248 292
492 3300035117 Ga0373953_0035371 Ga0373953_0035371_117_995 292
493 3300035119 Ga0373956_0039540 Ga0373956_0039540_175_1053 292
494 3300035170 Ga0373943_0001219 Ga0373943_0001219_9745_10623 292
495 3300035171 Ga0373946_0037475 Ga0373946_0037475_936_1814 292
496 3300035172 Ga0373955_0004758 Ga0373955_0004758_4418_5296 292
497 3300035242 Ga0373962_0007318 Ga0373962_0007318_1199_2077 292
498 3300035410 Ga0373924_0025619 Ga0373924_0025619_854_1732 292
499 3300035692 Ga0373935_0011345 Ga0373935_0011345_398_1276 292
500 3300035692 Ga0373935_0021914 Ga0373935_0021914_563_1441 292
501 3300035692 Ga0373935_0128687 Ga0373935_0128687_810_1688 292
502 3300035692 Ga0373935_0179206 Ga0373935_0179206_535_1413 292
503 3300035695 Ga0373927_0022779 Ga0373927_0022779_848_1726 292
504 3300035695 Ga0373927_0247466 Ga0373927_0247466_175_1053 292
505 3300035724 Ga0373933_0076622 Ga0373933_0076622_72_950 292
506 3300035725 Ga0373947_0008305 Ga0373947_0008305_1002_1880 292
507 3300036401 Ga0373937_0009394 Ga0373937_0009394_5152_6030 292
508 3300036401 Ga0373937_0099348 Ga0373937_0099348_1554_2432 292
509 3300037068 Ga0373925_0005624 Ga0373925_0005624_7330_8208 292
510 3300041408 Ga0439453_0011520 Ga0439453_0011520_406_1308 292
511 3300042005 Ga0439448_0006732 Ga0439448_0006732_2407_3285 292
512 3300042008 Ga0439450_007432 Ga0439450_007432_119_997 292
513 3300042012 Ga0439455_0002817 Ga0439455_0002817_1445_2323 292
514 3300042439 Ga0439464_0012069 Ga0439464_0012069_50_928 292
515 3300042461 Ga0439460_0015178 Ga0439460_0015178_848_1726 292
516 3300042876 Ga0451577_0173219 Ga0451577_0173219_931_1809 292
517 3300046452 Ga0495617_008093 Ga0495617_008093_1490_2368 292
518 3300046454 Ga0495592_0005820 Ga0495592_0005820_5155_6033 292
519 3300046454 Ga0495592_0026634 Ga0495592_0026634_2741_3619 292
520 3300046455 Ga0495603_0023812 Ga0495603_0023812_183_1061 292
521 3300046459 Ga0495629_0048654 Ga0495629_0048654_1611_2489 292
522 3300046459 Ga0495629_0354468 Ga0495629_0354468_91_969 292
523 3300046462 Ga0495651_0003705 Ga0495651_0003705_8301_9179 292
524 3300046462 Ga0495651_0007751 Ga0495651_0007751_1554_2432 292
525 3300046462 Ga0495651_0179035 Ga0495651_0179035_522_1400 292
526 3300046463 Ga0495653_0002409 Ga0495653_0002409_1657_2535 292
527 3300046463 Ga0495653_0027712 Ga0495653_0027712_3567_4445 292
528 3300046463 Ga0495653_0031307 Ga0495653_0031307_2134_3012 292
529 3300046472 Ga0495580_0141039 Ga0495580_0141039_429_1307 292
530 3300046475 Ga0495639_0004750 Ga0495639_0004750_4466_5344 292
531 3300046475 Ga0495639_0017548 Ga0495639_0017548_669_1547 292
532 3300046476 Ga0495662_0011745 Ga0495662_0011745_176_1054 292
533 3300046477 Ga0495664_0009343 Ga0495664_0009343_2797_3675 292
534 3300046477 Ga0495664_0032247 Ga0495664_0032247_1380_2258 292
535 3300046477 Ga0495664_0038584 Ga0495664_0038584_1388_2266 292
536 3300046491 Ga0495584_0112568 Ga0495584_0112568_361_1239 292
537 3300046492 Ga0495585_0000631 Ga0495585_0000631_21899_22777 292
538 3300046499 Ga0495594_0089221 Ga0495594_0089221_468_1346 292
539 3300046499 Ga0495594_0112523 Ga0495594_0112523_256_1134 292
540 3300046501 Ga0495607_0019819 Ga0495607_0019819_2261_3139 292
541 3300046511 Ga0495608_0001510 Ga0495608_0001510_14260_15138 292
542 3300046511 Ga0495608_0028110 Ga0495608_0028110_2515_3393 292
543 3300046514 Ga0495618_0001563 Ga0495618_0001563_12669_13547 292
544 3300046516 Ga0495628_0024355 Ga0495628_0024355_3606_4484 292
545 3300046516 Ga0495628_0031998 Ga0495628_0031998_268_1146 292
546 3300046517 Ga0495630_0182896 Ga0495630_0182896_292_1170 292
547 3300046520 Ga0495637_0025228 Ga0495637_0025228_830_1708 292
548 3300046523 Ga0495644_0000752 Ga0495644_0000752_2496_3374 292
549 3300046525 Ga0495663_0005915 Ga0495663_0005915_24_902 292
550 3300046529 Ga0495652_0004105 Ga0495652_0004105_11321_12199 292
551 3300046529 Ga0495652_0013609 Ga0495652_0013609_583_1461 292
552 3300046529 Ga0495652_0176099 Ga0495652_0176099_218_1096 292
553 3300046531 Ga0495665_0008272 Ga0495665_0008272_1405_2283 292
554 3300046533 Ga0495640_0011139 Ga0495640_0011139_3263_4141 292
555 3300046533 Ga0495640_0057280 Ga0495640_0057280_351_1229 292
556 3300046535 Ga0495586_0071708 Ga0495586_0071708_609_1487 292
557 3300046537 Ga0495598_0002749 Ga0495598_0002749_1713_2591 292
558 3300046543 Ga0495645_0001517 Ga0495645_0001517_10301_11179 292
559 3300046559 Ga0495667_0003144 Ga0495667_0003144_5265_6143 292
560 3300046559 Ga0495667_0005312 Ga0495667_0005312_7206_8084 292
561 3300046559 Ga0495667_0042526 Ga0495667_0042526_770_1648 292
562 3300046615 Ga0495656_0004899 Ga0495656_0004899_2124_3002 292
563 3300046642 Ga0495634_0030035 Ga0495634_0030035_1065_1943 292
564 3300046648 Ga0495611_0002973 Ga0495611_0002973_2547_3425 292
565 3300046663 Ga0495635_0001408 Ga0495635_0001408_1829_2707 292
566 3300046663 Ga0495635_0027974 Ga0495635_0027974_2776_3654 292
567 3300046663 Ga0495635_0039010 Ga0495635_0039010_1800_2678 292
568 3300046663 Ga0495635_0049978 Ga0495635_0049978_1437_2315 292
569 3300046664 Ga0495659_0000882 Ga0495659_0000882_1294_2172 292
570 3300046665 Ga0495661_0048852 Ga0495661_0048852_907_1785 292
571 3300046674 Ga0495588_0024242 Ga0495588_0024242_1252_2130 292
572 3300046675 Ga0495657_0001888 Ga0495657_0001888_4735_5613 292
573 3300046675 Ga0495657_0044338 Ga0495657_0044338_815_1693 292
574 3300046678 Ga0495599_0020358 Ga0495599_0020358_960_1838 292
575 3300046678 Ga0495599_0021313 Ga0495599_0021313_2486_3364 292
576 3300046678 Ga0495599_0223400 Ga0495599_0223400_83_961 292
577 3300046679 Ga0495623_0012554 Ga0495623_0012554_1779_2657 292
578 3300046679 Ga0495623_0016072 Ga0495623_0016072_1217_2095 292
579 3300046680 Ga0495646_0010421 Ga0495646_0010421_3480_4358 292
580 3300046680 Ga0495646_0011661 Ga0495646_0011661_4072_4950 292
581 3300046680 Ga0495646_0185981 Ga0495646_0185981_153_1031 292
582 3300046683 Ga0495658_0000560 Ga0495658_0000560_1663_2541 292
583 3300046683 Ga0495658_0009422 Ga0495658_0009422_1572_2450 292
584 3300046689 Ga0495613_0003541 Ga0495613_0003541_962_1840 292
585 3300046691 Ga0495670_0000125 Ga0495670_0000125_11357_12235 292
586 3300046809 Ga0495600_0007601 Ga0495600_0007601_402_1280 292
587 3300046809 Ga0495600_0148049 Ga0495600_0148049_484_1362 292
588 3300047317 Ga0495604_0008243 Ga0495604_0008243_3526_4404 292
589 3300047317 Ga0495604_0019908 Ga0495604_0019908_2988_3866 292
590 3300047319 Ga0495674_0012627 Ga0495674_0012627_6498_7376 292
591 3300047319 Ga0495674_0029944 Ga0495674_0029944_3460_4338 292
592 3300047321 Ga0495676_0021858 Ga0495676_0021858_2602_3480 292
593 3300047321 Ga0495676_0073772 Ga0495676_0073772_1193_2071 292
594 3300047322 Ga0495680_0004412 Ga0495680_0004412_2277_3155 292
595 3300047322 Ga0495680_0014033 Ga0495680_0014033_484_1362 292
596 3300047322 Ga0495680_0021068 Ga0495680_0021068_1119_1997 292
597 3300047322 Ga0495680_0023630 Ga0495680_0023630_1002_1880 292
598 3300047444 Ga0495675_0045223 Ga0495675_0045223_268_1146 292
599 3300047471 Ga0495684_0031787 Ga0495684_0031787_3015_3893 292
600 3300048088 Ga0495602_0003131 Ga0495602_0003131_5267_6145 292
601 3300048088 Ga0495602_0005133 Ga0495602_0005133_8121_8999 292
602 3300048904 Ga0496101_0016287 Ga0496101_0016287_3854_4732 292
603 3300048905 Ga0496102_0120570 Ga0496102_0120570_1191_2069 292
604 3300048905 Ga0496102_0124734 Ga0496102_0124734_988_1866 292
605 3300048906 Ga0496103_0032797 Ga0496103_0032797_1471_2349 292
606 3300048906 Ga0496103_0054408 Ga0496103_0054408_615_1493 292
607 3300048907 Ga0496104_0017252 Ga0496104_0017252_3140_4018 292
608 3300048907 Ga0496104_0036930 Ga0496104_0036930_2799_3677 292
609 3300048907 Ga0496104_0237212 Ga0496104_0237212_326_1204 292
610 3300048908 Ga0496105_0065812 Ga0496105_0065812_1912_2790 292
611 3300048911 Ga0496108_0007233 Ga0496108_0007233_7706_8584 292
612 3300048911 Ga0496108_0036082 Ga0496108_0036082_541_1419 292
613 3300048912 Ga0496109_0033630 Ga0496109_0033630_958_1836 292
614 3300048912 Ga0496109_0073983 Ga0496109_0073983_947_1825 292
615 3300048912 Ga0496109_0161909 Ga0496109_0161909_678_1556 292
616 3300048913 Ga0496110_0161757 Ga0496110_0161757_1019_1897 292
617 3300048914 Ga0496111_0024889 Ga0496111_0024889_494_1372 292
618 3300048915 Ga0496112_0031930 Ga0496112_0031930_946_1824 292
619 3300048915 Ga0496112_0115532 Ga0496112_0115532_1316_2194 292
620 3300048916 Ga0496113_0016310 Ga0496113_0016310_1579_2457 292
621 3300048916 Ga0496113_0311313 Ga0496113_0311313_241_1119 292
622 3300048917 Ga0496114_0054803 Ga0496114_0054803_2410_3288 292
623 3300048918 Ga0496115_0047193 Ga0496115_0047193_1763_2641 292
624 3300048918 Ga0496115_0095942 Ga0496115_0095942_1011_1889 292
625 3300049587 Ga0501071_0110680 Ga0501071_0110680_325_1203 292
626 3300049592 Ga0501076_0210122 Ga0501076_0210122_678_1556 292
627 3300049593 Ga0501077_0048973 Ga0501077_0048973_1120_1998 292
628 3300049742 Ga0501080_0501111 Ga0501080_0501111_65_943 292
629 3300049743 Ga0501081_0062078 Ga0501081_0062078_1385_2263 292
630 3300050496 nmdc:mga07m45_214620_c1 nmdc:mga07m45_214620_c1_207_1085 292
631 3300050507 nmdc:mga05p37_501_c1 nmdc:mga05p37_501_c1_17934_18812 292
632 3300050508 nmdc:mga09592_1023_c1 nmdc:mga09592_1023_c1_12459_13337 292
633 3300050509 nmdc:mga0qj67_713_c1 nmdc:mga0qj67_713_c1_3784_4662 292
634 3300050510 nmdc:mga06r32_14313_c1 nmdc:mga06r32_14313_c1_2619_3497 292
635 3300050512 nmdc:mga0n895_184325_c1 nmdc:mga0n895_184325_c1_476_1354 292
636 3300050512 nmdc:mga0n895_18888_c1 nmdc:mga0n895_18888_c1_3036_3914 292
637 3300050513 nmdc:mga0rr50_428034_c1 nmdc:mga0rr50_428034_c1_178_1056 292
638 3300050513 nmdc:mga0rr50_762_c1 nmdc:mga0rr50_762_c1_12729_13607 292
639 3300050514 nmdc:mga08x19_94011_c1 nmdc:mga08x19_94011_c1_120_998 292
640 3300050515 nmdc:mga0a205_2136_c1 nmdc:mga0a205_2136_c1_6897_7775 292
641 3300050515 nmdc:mga0a205_71054_c1 nmdc:mga0a205_71054_c1_1888_2766 292
642 3300053077 Ga0495601_0019095 Ga0495601_0019095_1588_2466 292
643 3300053077 Ga0495601_0136256 Ga0495601_0136256_583_1461 292
644 3300053078 Ga0495612_0000494 Ga0495612_0000494_14236_15114 292
645 3300053078 Ga0495612_0001786 Ga0495612_0001786_3445_4323 292
646 3300053078 Ga0495612_0004081 Ga0495612_0004081_242_1120 292
647 3300053084 Ga0495595_0002176 Ga0495595_0002176_5219_6097 292
648 3300053084 Ga0495595_0002965 Ga0495595_0002965_2958_3836 292
649 3300053085 Ga0495619_0000150 Ga0495619_0000150_6559_7437 292
650 3300053085 Ga0495619_0000189 Ga0495619_0000189_26880_27758 292
651 3300053085 Ga0495619_0009544 Ga0495619_0009544_4754_5632 292
652 3300053085 Ga0495619_0037058 Ga0495619_0037058_617_1495 292
653 3300060353 Ga0501082_0116320 Ga0501082_0116320_1307_2185 292
654 2209111006 2214600503 2213637959 293
655 3300000042 ARSoilYngRDRAFT_c00164 ARSoilYngRDRAFT_001643 293
656 3300000043 ARcpr5yngRDRAFT_c000009 ARcpr5yngRDRAFT_0000095 293
657 3300000044 ARSoilOldRDRAFT_c000036 ARSoilOldRDRAFT_00003610 293
658 3300000045 ARCol0oldRDRAFT_c01030 ARCol0oldRDRAFT_010302 293
659 3300000652 ARCol0yngRDRAFT_1000061 ARCol0yngRDRAFT_100006119 293
660 3300001430 JGI24032J14994_100521 JGI24032J14994_1005212 293
661 3300001977 JGI24746J21847_1001326 JGI24746J21847_10013263 293
662 3300001989 JGI24739J22299_10000090 JGI24739J22299_100000903 293
663 3300001990 JGI24737J22298_10000277 JGI24737J22298_1000027712 293
664 3300001990 JGI24737J22298_10009651 JGI24737J22298_100096512 293
665 3300002070 JGI24750J21931_1000109 JGI24750J21931_10001094 293
666 3300002073 JGI24745J21846_1000842 JGI24745J21846_10008422 293
667 3300002074 JGI24748J21848_1001050 JGI24748J21848_10010503 293
668 3300002075 JGI24738J21930_10000613 JGI24738J21930_100006134 293
669 3300002076 JGI24749J21850_1003135 JGI24749J21850_10031352 293
670 3300002155 JGI24033J26618_1000507 JGI24033J26618_10005073 293
671 3300002239 JGI24034J26672_10000125 JGI24034J26672_100001253 293
672 3300002244 JGI24742J22300_10000021 JGI24742J22300_1000002121 293
673 3300005276 Ga0065717_1003026 Ga0065717_10030261 293
674 3300005277 Ga0065716_1003269 Ga0065716_10032692 293
675 3300005289 Ga0065704_10107884 Ga0065704_101078842 293
676 3300005290 Ga0065712_10083478 Ga0065712_100834782 293
677 3300005293 Ga0065715_10000367 Ga0065715_100003671 293
678 3300005293 Ga0065715_10092263 Ga0065715_100922632 293
679 3300005328 Ga0070676_10000016 Ga0070676_100000168 293
680 3300005329 Ga0070683_100000075 Ga0070683_10000007517 293
681 3300005330 Ga0070690_100000613 Ga0070690_10000061317 293
682 3300005331 Ga0070670_100003634 Ga0070670_1000036344 293
683 3300005333 Ga0070677_10000005 Ga0070677_1000000514 293
684 3300005334 Ga0068869_100000395 Ga0068869_10000039515 293
685 3300005336 Ga0070680_100002358 Ga0070680_1000023588 293
686 3300005336 Ga0070680_100017800 Ga0070680_1000178003 293
687 3300005337 Ga0070682_100000144 Ga0070682_10000014426 293
688 3300005338 Ga0068868_100001156 Ga0068868_10000115613 293
689 3300005339 Ga0070660_100000153 Ga0070660_1000001537 293
690 3300005339 Ga0070660_100031463 Ga0070660_1000314633 293
691 3300005340 Ga0070689_100000388 Ga0070689_10000038817 293
692 3300005340 Ga0070689_100047722 Ga0070689_1000477223 293
693 3300005341 Ga0070691_10000030 Ga0070691_100000304 293
694 3300005343 Ga0070687_100000016 Ga0070687_10000001624 293
695 3300005344 Ga0070661_100000249 Ga0070661_10000024924 293
696 3300005345 Ga0070692_10000030 Ga0070692_1000003012 293
697 3300005347 Ga0070668_100000313 Ga0070668_10000031311 293
698 3300005353 Ga0070669_100000145 Ga0070669_10000014516 293
699 3300005354 Ga0070675_100000081 Ga0070675_10000008124 293
700 3300005354 Ga0070675_100019957 Ga0070675_1000199574 293
701 3300005355 Ga0070671_100000144 Ga0070671_10000014431 293
702 3300005356 Ga0070674_100000102 Ga0070674_10000010222 293
703 3300005356 Ga0070674_100043433 Ga0070674_1000434333 293
704 3300005364 Ga0070673_100000068 Ga0070673_10000006813 293
705 3300005365 Ga0070688_100000075 Ga0070688_10000007539 293
706 3300005365 Ga0070688_100008232 Ga0070688_1000082323 293
707 3300005366 Ga0070659_100000144 Ga0070659_10000014424 293
708 3300005367 Ga0070667_100006227 Ga0070667_1000062275 293
709 3300005434 Ga0070709_10121245 Ga0070709_101212452 293
710 3300005438 Ga0070701_10000459 Ga0070701_100004599 293
711 3300005440 Ga0070705_100000222 Ga0070705_10000022220 293
712 3300005441 Ga0070700_100000100 Ga0070700_10000010024 293
713 3300005444 Ga0070694_100000041 Ga0070694_10000004136 293
714 3300005445 Ga0070708_100008092 Ga0070708_1000080925 293
715 3300005455 Ga0070663_100000071 Ga0070663_10000007124 293
716 3300005456 Ga0070678_100000093 Ga0070678_1000000939 293
717 3300005457 Ga0070662_100030898 Ga0070662_1000308983 293
718 3300005457 Ga0070662_100083590 Ga0070662_1000835902 293
719 3300005458 Ga0070681_10000485 Ga0070681_100004853 293
720 3300005458 Ga0070681_10049358 Ga0070681_100493582 293
721 3300005458 Ga0070681_10097074 Ga0070681_100970741 293
722 3300005459 Ga0068867_100000718 Ga0068867_1000007185 293
723 3300005466 Ga0070685_10002733 Ga0070685_100027333 293
724 3300005518 Ga0070699_100386677 Ga0070699_1003866772 293
725 3300005530 Ga0070679_100002029 Ga0070679_1000020298 293
726 3300005535 Ga0070684_100000099 Ga0070684_10000009922 293
727 3300005535 Ga0070684_100308344 Ga0070684_1003083441 293
728 3300005536 Ga0070697_100071854 Ga0070697_1000718543 293
729 3300005536 Ga0070697_100275093 Ga0070697_1002750931 293
730 3300005539 Ga0068853_100000996 Ga0068853_1000009968 293
731 3300005543 Ga0070672_100000035 Ga0070672_10000003531 293
732 3300005544 Ga0070686_100000086 Ga0070686_10000008625 293
733 3300005544 Ga0070686_100012306 Ga0070686_1000123062 293
734 3300005545 Ga0070695_100000036 Ga0070695_10000003624 293
735 3300005545 Ga0070695_100036231 Ga0070695_1000362312 293
736 3300005546 Ga0070696_100000638 Ga0070696_10000063813 293
737 3300005547 Ga0070693_100000224 Ga0070693_1000002247 293
738 3300005547 Ga0070693_100092093 Ga0070693_1000920932 293
739 3300005547 Ga0070693_100100436 Ga0070693_1001004362 293
740 3300005548 Ga0070665_100081580 Ga0070665_1000815802 293
741 3300005549 Ga0070704_100000047 Ga0070704_10000004713 293
742 3300005549 Ga0070704_100012704 Ga0070704_1000127042 293
743 3300005563 Ga0068855_100003282 Ga0068855_1000032828 293
744 3300005564 Ga0070664_100000480 Ga0070664_10000048020 293
745 3300005564 Ga0070664_100065123 Ga0070664_1000651233 293
746 3300005577 Ga0068857_100000122 Ga0068857_10000012237 293
747 3300005578 Ga0068854_100000410 Ga0068854_10000041026 293
748 3300005614 Ga0068856_100001156 Ga0068856_10000115620 293
749 3300005614 Ga0068856_100121593 Ga0068856_1001215934 293
750 3300005615 Ga0070702_100000118 Ga0070702_10000011816 293
751 3300005616 Ga0068852_100000344 Ga0068852_10000034416 293
752 3300005617 Ga0068859_100008948 Ga0068859_1000089483 293
753 3300005617 Ga0068859_100089254 Ga0068859_1000892543 293
754 3300005618 Ga0068864_100000271 Ga0068864_10000027137 293
755 3300005618 Ga0068864_100297168 Ga0068864_1002971682 293
756 3300005718 Ga0068866_10000213 Ga0068866_100002133 293
757 3300005718 Ga0068866_10072773 Ga0068866_100727731 293
758 3300005719 Ga0068861_100003560 Ga0068861_1000035603 293
759 3300005834 Ga0068851_10013188 Ga0068851_100131883 293
760 3300005840 Ga0068870_10000079 Ga0068870_1000007929 293
761 3300005841 Ga0068863_100000372 Ga0068863_1000003725 293
762 3300005842 Ga0068858_100000809 Ga0068858_10000080929 293
763 3300005842 Ga0068858_100124847 Ga0068858_1001248472 293
764 3300005843 Ga0068860_100000709 Ga0068860_1000007096 293
765 3300005844 Ga0068862_100000512 Ga0068862_1000005125 293
766 3300005844 Ga0068862_100042240 Ga0068862_1000422403 293
767 3300005937 Ga0081455_10008617 Ga0081455_100086178 293
768 3300006194 Ga0075427_10000166 Ga0075427_100001664 293
769 3300006237 Ga0097621_100000047 Ga0097621_10000004717 293
770 3300006237 Ga0097621_100022075 Ga0097621_1000220754 293
771 3300006358 Ga0068871_100000518 Ga0068871_1000005185 293
772 3300006358 Ga0068871_100036701 Ga0068871_1000367014 293
773 3300006846 Ga0075430_100001945 Ga0075430_1000019454 293
774 3300006847 Ga0075431_100001208 Ga0075431_1000012085 293
775 3300006852 Ga0075433_10000495 Ga0075433_100004954 293
776 3300006852 Ga0075433_10029599 Ga0075433_100295994 293
777 3300006871 Ga0075434_100000362 Ga0075434_10000036216 293
778 3300006871 Ga0075434_100001759 Ga0075434_10000175912 293
779 3300006880 Ga0075429_100002672 Ga0075429_1000026725 293
780 3300006881 Ga0068865_100000233 Ga0068865_10000023314 293
781 3300006881 Ga0068865_100233633 Ga0068865_1002336332 293
782 3300006931 Ga0097620_100008949 Ga0097620_1000089493 293
783 3300006931 Ga0097620_100089262 Ga0097620_1000892623 293
784 3300009036 Ga0105244_10021503 Ga0105244_100215033 293
785 3300009092 Ga0105250_10075969 Ga0105250_100759692 293
786 3300009093 Ga0105240_10017644 Ga0105240_100176447 293
787 3300009094 Ga0111539_10000185 Ga0111539_1000018519 293
788 3300009094 Ga0111539_10002902 Ga0111539_100029024 293
789 3300009098 Ga0105245_10000213 Ga0105245_1000021337 293
790 3300009101 Ga0105247_10000547 Ga0105247_100005478 293
791 3300009148 Ga0105243_10000175 Ga0105243_1000017521 293
792 3300009148 Ga0105243_10078290 Ga0105243_100782903 293
793 3300009174 Ga0105241_10000261 Ga0105241_1000026123 293
794 3300009174 Ga0105241_10046034 Ga0105241_100460344 293
795 3300009176 Ga0105242_10000170 Ga0105242_100001706 293
796 3300009177 Ga0105248_10003502 Ga0105248_100035026 293
797 3300009545 Ga0105237_10001448 Ga0105237_100014487 293
798 3300009545 Ga0105237_10043307 Ga0105237_100433073 293
799 3300009553 Ga0105249_10000200 Ga0105249_1000020016 293
800 3300010375 Ga0105239_10000834 Ga0105239_100008345 293
801 3300011119 Ga0105246_10000050 Ga0105246_100000504 293
802 3300011119 Ga0105246_10264170 Ga0105246_102641701 293
803 3300012507 Ga0157342_1001628 Ga0157342_10016282 293
804 3300013102 Ga0157371_10004767 Ga0157371_100047671 293
805 3300013296 Ga0157374_10016814 Ga0157374_100168144 293
806 3300013297 Ga0157378_10000717 Ga0157378_100007171 293
807 3300013306 Ga0163162_10000222 Ga0163162_100002228 293
808 3300013306 Ga0163162_10008882 Ga0163162_100088823 293
809 3300013307 Ga0157372_10001555 Ga0157372_100015553 293
810 3300013308 Ga0157375_10000355 Ga0157375_1000035520 293
811 3300014325 Ga0163163_10004121 Ga0163163_1000412112 293
812 3300014326 Ga0157380_10000166 Ga0157380_1000016617 293
813 3300014326 Ga0157380_10082205 Ga0157380_100822053 293
814 3300014745 Ga0157377_10000207 Ga0157377_100002073 293
815 3300014968 Ga0157379_10000036 Ga0157379_1000003641 293
816 3300014969 Ga0157376_10000062 Ga0157376_1000006220 293
817 3300017792 Ga0163161_10000363 Ga0163161_100003634 293
818 3300025271 Ga0207666_1000029 Ga0207666_100002919 293
819 3300025290 Ga0207673_1000443 Ga0207673_10004432 293
820 3300025315 Ga0207697_10000208 Ga0207697_100002083 293
821 3300025315 Ga0207697_10017795 Ga0207697_100177953 293
822 3300025321 Ga0207656_10011445 Ga0207656_100114453 293
823 3300025893 Ga0207682_10000004 Ga0207682_1000000476 293
824 3300025899 Ga0207642_10000556 Ga0207642_100005562 293
825 3300025900 Ga0207710_10003459 Ga0207710_100034594 293
826 3300025901 Ga0207688_10000042 Ga0207688_1000004241 293
827 3300025903 Ga0207680_10002676 Ga0207680_100026763 293
828 3300025904 Ga0207647_10033344 Ga0207647_100333443 293
829 3300025907 Ga0207645_10000061 Ga0207645_1000006145 293
830 3300025908 Ga0207643_10000012 Ga0207643_10000012104 293
831 3300025911 Ga0207654_10015120 Ga0207654_100151204 293
832 3300025912 Ga0207707_10000405 Ga0207707_1000040519 293
833 3300025913 Ga0207695_10062614 Ga0207695_100626143 293
834 3300025914 Ga0207671_10010683 Ga0207671_100106833 293
835 3300025916 Ga0207663_10338010 Ga0207663_103380101 293
836 3300025917 Ga0207660_10000008 Ga0207660_1000000816 293
837 3300025918 Ga0207662_10027345 Ga0207662_100273452 293
838 3300025919 Ga0207657_10034735 Ga0207657_100347352 293
839 3300025919 Ga0207657_10058101 Ga0207657_100581013 293
840 3300025919 Ga0207657_10058127 Ga0207657_100581273 293
841 3300025920 Ga0207649_10000099 Ga0207649_100000993 293
842 3300025921 Ga0207652_10005026 Ga0207652_100050266 293
843 3300025921 Ga0207652_10068951 Ga0207652_100689512 293
844 3300025921 Ga0207652_10116932 Ga0207652_101169322 293
845 3300025923 Ga0207681_10000141 Ga0207681_1000014144 293
846 3300025925 Ga0207650_10003620 Ga0207650_100036205 293
847 3300025926 Ga0207659_10000023 Ga0207659_1000002316 293
848 3300025926 Ga0207659_10047227 Ga0207659_100472272 293
849 3300025927 Ga0207687_10001943 Ga0207687_100019435 293
850 3300025928 Ga0207700_10057161 Ga0207700_100571613 293
851 3300025931 Ga0207644_10000286 Ga0207644_100002865 293
852 3300025931 Ga0207644_10014489 Ga0207644_100144894 293
853 3300025932 Ga0207690_10000105 Ga0207690_1000010522 293
854 3300025933 Ga0207706_10000438 Ga0207706_1000043841 293
855 3300025934 Ga0207686_10000140 Ga0207686_100001408 293
856 3300025935 Ga0207709_10000264 Ga0207709_1000026427 293
857 3300025935 Ga0207709_10059227 Ga0207709_100592272 293
858 3300025936 Ga0207670_10000108 Ga0207670_1000010837 293
859 3300025937 Ga0207669_10000110 Ga0207669_100001103 293
860 3300025938 Ga0207704_10000171 Ga0207704_1000017126 293
861 3300025939 Ga0207665_10152428 Ga0207665_101524282 293
862 3300025940 Ga0207691_10001221 Ga0207691_100012212 293
863 3300025941 Ga0207711_10003268 Ga0207711_100032685 293
864 3300025941 Ga0207711_10022702 Ga0207711_100227022 293
865 3300025942 Ga0207689_10000008 Ga0207689_1000000890 293
866 3300025944 Ga0207661_10000053 Ga0207661_1000005316 293
867 3300025945 Ga0207679_10000053 Ga0207679_1000005379 293
868 3300025949 Ga0207667_10095126 Ga0207667_100951263 293
869 3300025949 Ga0207667_10119092 Ga0207667_101190922 293
870 3300025960 Ga0207651_10000052 Ga0207651_1000005226 293
871 3300025960 Ga0207651_10005685 Ga0207651_100056854 293
872 3300025961 Ga0207712_10000317 Ga0207712_1000031720 293
873 3300025972 Ga0207668_10000160 Ga0207668_1000016037 293
874 3300025981 Ga0207640_10000232 Ga0207640_1000023216 293
875 3300025986 Ga0207658_10000890 Ga0207658_1000089023 293
876 3300026023 Ga0207677_10001309 Ga0207677_100013092 293
877 3300026035 Ga0207703_10006598 Ga0207703_100065982 293
878 3300026041 Ga0207639_10003340 Ga0207639_100033404 293
879 3300026067 Ga0207678_10000185 Ga0207678_100001852 293
880 3300026067 Ga0207678_10125249 Ga0207678_101252492 293
881 3300026075 Ga0207708_10045698 Ga0207708_100456983 293
882 3300026075 Ga0207708_10050476 Ga0207708_100504762 293
883 3300026078 Ga0207702_10000297 Ga0207702_1000029728 293
884 3300026088 Ga0207641_10000775 Ga0207641_1000077526 293
885 3300026089 Ga0207648_10059526 Ga0207648_100595263 293
886 3300026089 Ga0207648_10169675 Ga0207648_101696752 293
887 3300026095 Ga0207676_10000182 Ga0207676_1000018244 293
888 3300026116 Ga0207674_10001329 Ga0207674_100013293 293
889 3300026118 Ga0207675_100000342 Ga0207675_10000034241 293
890 3300026118 Ga0207675_100071547 Ga0207675_1000715472 293
891 3300026121 Ga0207683_10000006 Ga0207683_1000000619 293
892 3300026121 Ga0207683_10076290 Ga0207683_100762902 293
893 3300026142 Ga0207698_10000236 Ga0207698_100002365 293
894 3300027252 Ga0209973_1003406 Ga0209973_10034061 293
895 3300027617 Ga0210002_1000806 Ga0210002_10008062 293
896 3300027695 Ga0209966_1001141 Ga0209966_10011414 293
897 3300027717 Ga0209998_10010506 Ga0209998_100105062 293
898 3300027907 Ga0207428_10000112 Ga0207428_1000011280 293
899 3300027907 Ga0207428_10000480 Ga0207428_100004809 293
900 3300027907 Ga0207428_10001796 Ga0207428_100017964 293
901 3300028379 Ga0268266_10047404 Ga0268266_100474044 293
902 3300028380 Ga0268265_10000257 Ga0268265_1000025716 293
903 3300028381 Ga0268264_10000579 Ga0268264_1000057914 293
904 3300028381 Ga0268264_10221945 Ga0268264_102219452 293
905 3300034817 Ga0373948_0000208 Ga0373948_0000208_5452_6333 293
906 3300034818 Ga0373950_0000236 Ga0373950_0000236_1793_2674 293
907 3300034819 Ga0373958_0000783 Ga0373958_0000783_46_927 293
908 3300034957 Ga0373938_0000241 Ga0373938_0000241_2989_3870 293
909 3300034957 Ga0373938_0000618 Ga0373938_0000618_2458_3339 293
910 3300035084 Ga0373928_0001002 Ga0373928_0001002_3733_4614 293
911 3300035085 Ga0373929_0000730 Ga0373929_0000730_4914_5795 293
912 3300035086 Ga0373934_0083248 Ga0373934_0083248_97_1014 293
913 3300035088 Ga0373940_0001277 Ga0373940_0001277_2723_3604 293
914 3300035088 Ga0373940_0007382 Ga0373940_0007382_580_1461 293
915 3300035090 Ga0373949_0003478 Ga0373949_0003478_761_1642 293
916 3300035091 Ga0373951_0004638 Ga0373951_0004638_1688_2569 293
917 3300035092 Ga0373952_0000999 Ga0373952_0000999_1261_2142 293
918 3300035092 Ga0373952_0001835 Ga0373952_0001835_1874_2755 293
919 3300035112 Ga0373932_0000083 Ga0373932_0000083_8377_9258 293
920 3300035112 Ga0373932_0001722 Ga0373932_0001722_1850_2731 293
921 3300035114 Ga0373939_0000284 Ga0373939_0000284_4312_5193 293
922 3300035114 Ga0373939_0003206 Ga0373939_0003206_993_1874 293
923 3300035115 Ga0373941_0000052 Ga0373941_0000052_15185_16066 293
924 3300035121 Ga0373960_0001413 Ga0373960_0001413_11_892 293
925 3300035121 Ga0373960_0001868 Ga0373960_0001868_3559_4440 293
926 3300035207 Ga0373942_0000221 Ga0373942_0000221_8089_8970 293
927 3300035241 Ga0373961_0004414 Ga0373961_0004414_709_1590 293
928 3300035241 Ga0373961_0018473 Ga0373961_0018473_690_1571 293
929 3300035242 Ga0373962_0000218 Ga0373962_0000218_2066_2947 293
930 3300035242 Ga0373962_0005140 Ga0373962_0005140_1913_2794 293
931 3300035691 Ga0373931_0005439 Ga0373931_0005439_3019_3900 293
932 3300038996 Ga0242420_001067 Ga0242420_001067_2185_3066 293
933 3300046538 Ga0495609_0052605 Ga0495609_0052605_232_1113 293
934 3300046684 Ga0495669_0063344 Ga0495669_0063344_553_1434 293
935 3300047445 Ga0495677_0079755 Ga0495677_0079755_255_1136 293
936 3300048903 Ga0496100_0000249 Ga0496100_0000249_19495_20376 293
937 3300048904 Ga0496101_0000526 Ga0496101_0000526_15018_15899 293
938 3300048905 Ga0496102_0000433 Ga0496102_0000433_26432_27313 293
939 3300048905 Ga0496102_0058306 Ga0496102_0058306_1598_2479 293
940 3300048906 Ga0496103_0000537 Ga0496103_0000537_7763_8644 293
941 3300048907 Ga0496104_0042787 Ga0496104_0042787_2691_3572 293
942 3300048909 Ga0496106_0001596 Ga0496106_0001596_1817_2698 293
943 3300048909 Ga0496106_0052013 Ga0496106_0052013_1664_2545 293
944 3300048910 Ga0496107_0000078 Ga0496107_0000078_19557_20438 293
945 3300048910 Ga0496107_0019236 Ga0496107_0019236_398_1279 293
946 3300048911 Ga0496108_0007917 Ga0496108_0007917_6657_7538 293
947 3300048911 Ga0496108_0261851 Ga0496108_0261851_347_1228 293
948 3300048912 Ga0496109_0000406 Ga0496109_0000406_7572_8453 293
949 3300048912 Ga0496109_0052682 Ga0496109_0052682_2487_3368 293
950 3300048913 Ga0496110_0025351 Ga0496110_0025351_2464_3345 293
951 3300048914 Ga0496111_0055008 Ga0496111_0055008_918_1799 293
952 3300048915 Ga0496112_0038727 Ga0496112_0038727_2663_3544 293
953 3300048916 Ga0496113_0042358 Ga0496113_0042358_1813_2694 293
954 3300048916 Ga0496113_0053458 Ga0496113_0053458_182_1063 293
955 3300048917 Ga0496114_0000418 Ga0496114_0000418_24200_25081 293
956 3300048918 Ga0496115_0000437 Ga0496115_0000437_8707_9588 293
957 3300050511 nmdc:mga08y16_111019_c1 nmdc:mga08y16_111019_c1_1509_2390 293
958 3300050511 nmdc:mga08y16_11459_c1 nmdc:mga08y16_11459_c1_7954_8835 293
959 3300050512 nmdc:mga0n895_12135_c1 nmdc:mga0n895_12135_c1_2369_3250 293
960 3300050513 nmdc:mga0rr50_18874_c1 nmdc:mga0rr50_18874_c1_664_1545 293
961 3300050513 nmdc:mga0rr50_298628_c1 nmdc:mga0rr50_298628_c1_18_935 293
962 3300050515 nmdc:mga0a205_3474_c1 nmdc:mga0a205_3474_c1_7935_8816 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

54

305

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.8518 5 249
7vwt-assembly1.cif.gz_B carbazole prenyl transferase cqsb4 0.8277 23 278
3acx-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-673 0.8253 21 274
3adz-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp 0.8245 21 274
3wcc-assembly1.cif.gz_C the complex structure of tcsqs with ligand, e5700 0.8222 21 272
ID Description Score Start End Superfamily
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8784 23 272 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8602 21 248 1.10.600.10
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8557 21 245 1.10.600.10
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8498 5 249 1.10.600.10
af_A4ID42_69_319_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.836 27 255 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A838UGN9-F1-model_v4 Squalene/phytoene synthase family protein 0.98 63 287 GO:0008299
AF-A0A1L7AF82-F1-model_v4 Squalene synthase HpnC 0.9793 3 280 GO:0004311
GO:0008299
GO:0051996
AF-A0A327KRZ7-F1-model_v4 Squalene synthase HpnC 0.9777 2 279 GO:0004311
GO:0008299
GO:0051996
AF-A0A7C7FS03-F1-model_v4 Squalene synthase HpnC 0.9764 68 277 GO:0008299
AF-A0A537UHM7-F1-model_v4 Squalene synthase HpnC (EC 2.5.1.21) 0.9756 26 293 GO:0004311
GO:0008299
GO:0051996

Feature Viewer

pLDDT pTM Quality
87.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map