F486892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 962 | 439 | 962 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300035692|Ga0373935_0285494|Ga0373935_0285494_108_1109 |
| Length | 333 |
| Sequence | LPQFRHCARKVNAFARPRRRAAADITIAHAHARSGPRQSKFWIMTTAGELRSGKGHKDENFPVASRIIAPRHRALILAFYEFVRVADDIADHASLAPDDKLKRLDLLEANLLGRGDEEPEAVRLRTALAERAMSPTHPVDVLKAFRLDVTKLRYANWDELIYYCSYSAMPVGRFVLDVHGESRTTWPASDALCAALQVNNHLQDCAKDFRELNRVYITQDVFAARGAKVEELAATRSSPRLLAAIRDLVPGTARLLADGEALVSQVRDIRLAMEIRVIQIYAARILGLLKTRDPLCDLVHLKPWEMMAYGLMGMASGLYRHTTQPARPSLPAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 22 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 300 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 301 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 302 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 303 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 304 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 305 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 306 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 307 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 382 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 383 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 384 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 418 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 420 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 436 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 438 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.18 |
| Nodule | 0 |
| Rhizoplane | 7.17 |
| Rhizosphere | 88.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214600503 | 2209111006 | Bacteria | 5353 |
| 2 | ARSoilYngRDRAFT_c00164 | 3300000042 | Bacteria | 11336 |
| 3 | ARcpr5yngRDRAFT_c000009 | 3300000043 | Bacteria | 37168 |
| 4 | ARSoilOldRDRAFT_c000036 | 3300000044 | Bacteria | 30390 |
| 5 | ARCol0oldRDRAFT_c01030 | 3300000045 | Bacteria | 2114 |
| 6 | ARCol0yngRDRAFT_1000061 | 3300000652 | Bacteria | 19655 |
| 7 | JGI24032J14994_100521 | 3300001430 | Unclassified | 2015 |
| 8 | JGI24746J21847_1001326 | 3300001977 | Bacteria | 3944 |
| 9 | JGI24739J22299_10000090 | 3300001989 | Bacteria | 26415 |
| 10 | JGI24737J22298_10000277 | 3300001990 | Bacteria | 16911 |
| 11 | JGI24737J22298_10009651 | 3300001990 | Bacteria | 3201 |
| 12 | JGI24750J21931_1000109 | 3300002070 | Bacteria | 13018 |
| 13 | JGI24745J21846_1000842 | 3300002073 | Bacteria | 2828 |
| 14 | JGI24748J21848_1001050 | 3300002074 | Unclassified | 3004 |
| 15 | JGI24738J21930_10000613 | 3300002075 | Bacteria | 10244 |
| 16 | JGI24749J21850_1003135 | 3300002076 | Unclassified | 2310 |
| 17 | JGI24033J26618_1000507 | 3300002155 | Unclassified | 3813 |
| 18 | JGI24034J26672_10000125 | 3300002239 | Bacteria | 11879 |
| 19 | JGI24742J22300_10000021 | 3300002244 | Bacteria | 26079 |
| 20 | JGI25165J46597_1000297 | 3300003214 | Bacteria | 62745 |
| 21 | JGI25405J52794_10015093 | 3300003911 | Bacteria | 1514 |
| 22 | Ga0065717_1003026 | 3300005276 | Bacteria | 1466 |
| 23 | Ga0065716_1003269 | 3300005277 | Bacteria | 1284 |
| 24 | Ga0065704_10107884 | 3300005289 | Bacteria | 2044 |
| 25 | Ga0065712_10083478 | 3300005290 | Bacteria | 2833 |
| 26 | Ga0065712_10088717 | 3300005290 | Bacteria | 2495 |
| 27 | Ga0065715_10000367 | 3300005293 | Bacteria | 20248 |
| 28 | Ga0065715_10092263 | 3300005293 | Bacteria | 5223 |
| 29 | Ga0070658_10048077 | 3300005327 | Bacteria | 3453 |
| 30 | Ga0070658_10118250 | 3300005327 | Bacteria | 2201 |
| 31 | Ga0070658_10232664 | 3300005327 | Bacteria | 1560 |
| 32 | Ga0070676_10000016 | 3300005328 | Bacteria | 52098 |
| 33 | Ga0070676_10242206 | 3300005328 | Bacteria | 1200 |
| 34 | Ga0070683_100000075 | 3300005329 | Bacteria | 67998 |
| 35 | Ga0070683_100704767 | 3300005329 | Bacteria | 967 |
| 36 | Ga0070690_100000613 | 3300005330 | Bacteria | 18064 |
| 37 | Ga0070690_100188544 | 3300005330 | Bacteria | 1428 |
| 38 | Ga0070670_100003634 | 3300005331 | Bacteria | 12845 |
| 39 | Ga0070670_100189490 | 3300005331 | Bacteria | 1786 |
| 40 | Ga0070670_100338449 | 3300005331 | Bacteria | 1320 |
| 41 | Ga0070677_10000005 | 3300005333 | Bacteria | 79035 |
| 42 | Ga0068869_100000395 | 3300005334 | Bacteria | 23763 |
| 43 | Ga0070666_10040026 | 3300005335 | Bacteria | 3126 |
| 44 | Ga0070680_100002358 | 3300005336 | Bacteria | 13946 |
| 45 | Ga0070680_100004173 | 3300005336 | Bacteria | 10829 |
| 46 | Ga0070680_100017800 | 3300005336 | Bacteria | 5605 |
| 47 | Ga0070682_100000144 | 3300005337 | Bacteria | 56618 |
| 48 | Ga0070682_100024070 | 3300005337 | Bacteria | 3621 |
| 49 | Ga0070682_100118646 | 3300005337 | Bacteria | 1773 |
| 50 | Ga0068868_100001156 | 3300005338 | Bacteria | 18087 |
| 51 | Ga0068868_100020524 | 3300005338 | Bacteria | 4967 |
| 52 | Ga0068868_100171175 | 3300005338 | Bacteria | 1798 |
| 53 | Ga0070660_100000153 | 3300005339 | Bacteria | 44533 |
| 54 | Ga0070660_100031463 | 3300005339 | Bacteria | 3985 |
| 55 | Ga0070660_100089769 | 3300005339 | Bacteria | 2422 |
| 56 | Ga0070689_100000388 | 3300005340 | Bacteria | 25778 |
| 57 | Ga0070689_100047722 | 3300005340 | Bacteria | 3302 |
| 58 | Ga0070691_10000030 | 3300005341 | Bacteria | 39784 |
| 59 | Ga0070687_100000016 | 3300005343 | Bacteria | 55051 |
| 60 | Ga0070687_100161494 | 3300005343 | Bacteria | 1325 |
| 61 | Ga0070661_100000249 | 3300005344 | Bacteria | 44246 |
| 62 | Ga0070661_100150426 | 3300005344 | Unclassified | 1759 |
| 63 | Ga0070661_100289629 | 3300005344 | Bacteria | 1272 |
| 64 | Ga0070692_10000030 | 3300005345 | Bacteria | 26864 |
| 65 | Ga0070668_100000313 | 3300005347 | Bacteria | 32032 |
| 66 | Ga0070668_100081602 | 3300005347 | Unclassified | 2535 |
| 67 | Ga0070668_100267608 | 3300005347 | Bacteria | 1423 |
| 68 | Ga0070669_100000145 | 3300005353 | Bacteria | 63377 |
| 69 | Ga0070675_100000081 | 3300005354 | Bacteria | 56087 |
| 70 | Ga0070675_100019957 | 3300005354 | Bacteria | 5346 |
| 71 | Ga0070675_100061943 | 3300005354 | Bacteria | 3091 |
| 72 | Ga0070671_100000144 | 3300005355 | Bacteria | 46097 |
| 73 | Ga0070671_100056886 | 3300005355 | Bacteria | 3254 |
| 74 | Ga0070674_100000102 | 3300005356 | Bacteria | 39445 |
| 75 | Ga0070674_100007598 | 3300005356 | Bacteria | 6401 |
| 76 | Ga0070674_100043433 | 3300005356 | Bacteria | 3058 |
| 77 | Ga0070673_100000068 | 3300005364 | Bacteria | 43540 |
| 78 | Ga0070673_100125205 | 3300005364 | Bacteria | 2149 |
| 79 | Ga0070688_100000075 | 3300005365 | Bacteria | 49279 |
| 80 | Ga0070688_100008232 | 3300005365 | Bacteria | 5651 |
| 81 | Ga0070659_100000144 | 3300005366 | Bacteria | 55051 |
| 82 | Ga0070667_100006227 | 3300005367 | Bacteria | 9929 |
| 83 | Ga0070667_100059769 | 3300005367 | Bacteria | 3225 |
| 84 | Ga0070709_10001607 | 3300005434 | Bacteria | 12200 |
| 85 | Ga0070709_10121245 | 3300005434 | Unclassified | 1773 |
| 86 | Ga0070709_10167205 | 3300005434 | Bacteria | 1534 |
| 87 | Ga0070714_100051618 | 3300005435 | Bacteria | 3507 |
| 88 | Ga0070714_100176252 | 3300005435 | Bacteria | 1943 |
| 89 | Ga0070713_100001009 | 3300005436 | Bacteria | 18005 |
| 90 | Ga0070713_100058892 | 3300005436 | Bacteria | 3205 |
| 91 | Ga0070710_10014910 | 3300005437 | Bacteria | 3920 |
| 92 | Ga0070710_10017505 | 3300005437 | Bacteria | 3669 |
| 93 | Ga0070701_10000459 | 3300005438 | Bacteria | 13894 |
| 94 | Ga0070711_100021988 | 3300005439 | Bacteria | 4129 |
| 95 | Ga0070711_100031346 | 3300005439 | Bacteria | 3529 |
| 96 | Ga0070711_100106306 | 3300005439 | Bacteria | 2051 |
| 97 | Ga0070705_100000222 | 3300005440 | Bacteria | 33817 |
| 98 | Ga0070700_100000100 | 3300005441 | Bacteria | 54110 |
| 99 | Ga0070694_100000041 | 3300005444 | Bacteria | 59039 |
| 100 | Ga0070708_100008092 | 3300005445 | Bacteria | 8431 |
| 101 | Ga0070663_100000071 | 3300005455 | Bacteria | 44246 |
| 102 | Ga0070663_100104727 | 3300005455 | Bacteria | 2116 |
| 103 | Ga0070678_100000093 | 3300005456 | Bacteria | 34270 |
| 104 | Ga0070678_100075303 | 3300005456 | Bacteria | 2539 |
| 105 | Ga0070678_100142510 | 3300005456 | Bacteria | 1920 |
| 106 | Ga0070662_100030898 | 3300005457 | Bacteria | 3753 |
| 107 | Ga0070662_100083590 | 3300005457 | Unclassified | 2383 |
| 108 | Ga0070681_10000485 | 3300005458 | Bacteria | 32421 |
| 109 | Ga0070681_10003716 | 3300005458 | Bacteria | 14317 |
| 110 | Ga0070681_10049358 | 3300005458 | Bacteria | 4203 |
| 111 | Ga0070681_10092754 | 3300005458 | Bacteria | 2968 |
| 112 | Ga0070681_10097074 | 3300005458 | Bacteria | 2894 |
| 113 | Ga0070681_10142310 | 3300005458 | Bacteria | 2328 |
| 114 | Ga0070681_10425218 | 3300005458 | Bacteria | 1240 |
| 115 | Ga0068867_100000718 | 3300005459 | Bacteria | 22121 |
| 116 | Ga0070685_10002733 | 3300005466 | Bacteria | 9035 |
| 117 | Ga0070685_10061101 | 3300005466 | Bacteria | 2205 |
| 118 | Ga0070699_100386677 | 3300005518 | Bacteria | 1264 |
| 119 | Ga0070679_100002029 | 3300005530 | Bacteria | 18172 |
| 120 | Ga0070679_100006681 | 3300005530 | Bacteria | 10757 |
| 121 | Ga0070679_100204299 | 3300005530 | Bacteria | 1940 |
| 122 | Ga0070679_100516470 | 3300005530 | Bacteria | 1138 |
| 123 | Ga0070684_100000099 | 3300005535 | Bacteria | 56087 |
| 124 | Ga0070684_100176290 | 3300005535 | Bacteria | 1943 |
| 125 | Ga0070684_100308344 | 3300005535 | Bacteria | 1453 |
| 126 | Ga0070697_100071854 | 3300005536 | Bacteria | 2839 |
| 127 | Ga0070697_100275093 | 3300005536 | Bacteria | 1444 |
| 128 | Ga0068853_100000996 | 3300005539 | Bacteria | 19946 |
| 129 | Ga0068853_100227621 | 3300005539 | Bacteria | 1705 |
| 130 | Ga0068853_100289533 | 3300005539 | Bacteria | 1512 |
| 131 | Ga0068853_100562709 | 3300005539 | Bacteria | 1081 |
| 132 | Ga0070672_100000035 | 3300005543 | Bacteria | 60570 |
| 133 | Ga0070672_100095968 | 3300005543 | Bacteria | 2398 |
| 134 | Ga0070686_100000086 | 3300005544 | Bacteria | 65438 |
| 135 | Ga0070686_100012306 | 3300005544 | Bacteria | 4868 |
| 136 | Ga0070686_100016581 | 3300005544 | Bacteria | 4287 |
| 137 | Ga0070695_100000036 | 3300005545 | Bacteria | 51060 |
| 138 | Ga0070695_100036231 | 3300005545 | Bacteria | 3103 |
| 139 | Ga0070696_100000638 | 3300005546 | Bacteria | 22371 |
| 140 | Ga0070693_100000224 | 3300005547 | Bacteria | 26392 |
| 141 | Ga0070693_100052119 | 3300005547 | Bacteria | 2345 |
| 142 | Ga0070693_100063201 | 3300005547 | Bacteria | 2157 |
| 143 | Ga0070693_100092093 | 3300005547 | Bacteria | 1830 |
| 144 | Ga0070693_100100436 | 3300005547 | Unclassified | 1762 |
| 145 | Ga0070665_100081580 | 3300005548 | Unclassified | 3240 |
| 146 | Ga0070665_100271256 | 3300005548 | Bacteria | 1698 |
| 147 | Ga0070704_100000047 | 3300005549 | Bacteria | 39895 |
| 148 | Ga0070704_100012704 | 3300005549 | Bacteria | 5210 |
| 149 | Ga0068855_100003282 | 3300005563 | Bacteria | 19813 |
| 150 | Ga0068855_100057856 | 3300005563 | Bacteria | 4543 |
| 151 | Ga0068855_100506351 | 3300005563 | Bacteria | 1311 |
| 152 | Ga0070664_100000480 | 3300005564 | Bacteria | 30207 |
| 153 | Ga0070664_100065123 | 3300005564 | Bacteria | 3109 |
| 154 | Ga0070664_100083394 | 3300005564 | Bacteria | 2757 |
| 155 | Ga0070664_100367628 | 3300005564 | Bacteria | 1311 |
| 156 | Ga0068857_100000122 | 3300005577 | Bacteria | 46603 |
| 157 | Ga0068854_100000410 | 3300005578 | Bacteria | 26884 |
| 158 | Ga0068854_100343705 | 3300005578 | Bacteria | 1219 |
| 159 | Ga0068856_100001156 | 3300005614 | Bacteria | 27741 |
| 160 | Ga0068856_100121593 | 3300005614 | Bacteria | 2612 |
| 161 | Ga0068856_100124415 | 3300005614 | Bacteria | 2581 |
| 162 | Ga0068856_100271456 | 3300005614 | Bacteria | 1712 |
| 163 | Ga0068856_100658835 | 3300005614 | Bacteria | 1067 |
| 164 | Ga0070702_100000118 | 3300005615 | Bacteria | 24062 |
| 165 | Ga0070702_100024518 | 3300005615 | Unclassified | 3219 |
| 166 | Ga0068852_100000344 | 3300005616 | Bacteria | 31408 |
| 167 | Ga0068852_100015735 | 3300005616 | Bacteria | 5880 |
| 168 | Ga0068852_100366524 | 3300005616 | Bacteria | 1410 |
| 169 | Ga0068859_100008948 | 3300005617 | Bacteria | 10111 |
| 170 | Ga0068859_100089254 | 3300005617 | Bacteria | 3132 |
| 171 | Ga0068859_100165726 | 3300005617 | Unclassified | 2290 |
| 172 | Ga0068859_100329199 | 3300005617 | Bacteria | 1622 |
| 173 | Ga0068859_100390164 | 3300005617 | Bacteria | 1488 |
| 174 | Ga0068864_100000271 | 3300005618 | Bacteria | 46062 |
| 175 | Ga0068864_100043058 | 3300005618 | Bacteria | 3865 |
| 176 | Ga0068864_100068138 | 3300005618 | Bacteria | 3091 |
| 177 | Ga0068864_100152835 | 3300005618 | Bacteria | 2092 |
| 178 | Ga0068864_100297168 | 3300005618 | Unclassified | 1511 |
| 179 | Ga0068866_10000213 | 3300005718 | Bacteria | 27527 |
| 180 | Ga0068866_10072773 | 3300005718 | Bacteria | 1822 |
| 181 | Ga0068866_10161455 | 3300005718 | Bacteria | 1307 |
| 182 | Ga0068861_100003560 | 3300005719 | Bacteria | 10359 |
| 183 | Ga0068861_100079487 | 3300005719 | Unclassified | 2564 |
| 184 | Ga0068851_10013188 | 3300005834 | Bacteria | 3910 |
| 185 | Ga0068870_10000079 | 3300005840 | Bacteria | 31219 |
| 186 | Ga0068863_100000372 | 3300005841 | Bacteria | 45645 |
| 187 | Ga0068858_100000254 | 3300005842 | Bacteria | 57050 |
| 188 | Ga0068858_100000809 | 3300005842 | Bacteria | 32733 |
| 189 | Ga0068858_100007821 | 3300005842 | Bacteria | 10317 |
| 190 | Ga0068858_100124847 | 3300005842 | Unclassified | 2409 |
| 191 | Ga0068858_100482246 | 3300005842 | Bacteria | 1197 |
| 192 | Ga0068860_100000709 | 3300005843 | Bacteria | 38176 |
| 193 | Ga0068860_100323615 | 3300005843 | Bacteria | 1514 |
| 194 | Ga0068860_100402903 | 3300005843 | Unclassified | 1354 |
| 195 | Ga0068862_100000512 | 3300005844 | Bacteria | 41177 |
| 196 | Ga0068862_100042240 | 3300005844 | Bacteria | 3883 |
| 197 | Ga0068862_100223979 | 3300005844 | Bacteria | 1704 |
| 198 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 199 | Ga0081455_10001964 | 3300005937 | Bacteria | 24626 |
| 200 | Ga0081455_10008617 | 3300005937 | Bacteria | 10579 |
| 201 | Ga0081455_10009260 | 3300005937 | Bacteria | 10142 |
| 202 | Ga0081539_10031557 | 3300005985 | Bacteria | 3262 |
| 203 | Ga0081539_10112394 | 3300005985 | Bacteria | 1368 |
| 204 | Ga0070717_10079548 | 3300006028 | Bacteria | 2749 |
| 205 | Ga0070717_10230756 | 3300006028 | Bacteria | 1630 |
| 206 | Ga0075363_100173622 | 3300006048 | Bacteria | 1224 |
| 207 | Ga0075432_10008092 | 3300006058 | Unclassified | 3587 |
| 208 | Ga0070715_10018926 | 3300006163 | Bacteria | 2632 |
| 209 | Ga0070715_10055104 | 3300006163 | Unclassified | 1724 |
| 210 | Ga0070716_100016921 | 3300006173 | Bacteria | 3771 |
| 211 | Ga0070712_100225368 | 3300006175 | Bacteria | 1486 |
| 212 | Ga0075367_10251178 | 3300006178 | Bacteria | 1109 |
| 213 | Ga0075427_10000166 | 3300006194 | Bacteria | 6374 |
| 214 | Ga0075366_10061449 | 3300006195 | Bacteria | 2233 |
| 215 | Ga0097621_100000047 | 3300006237 | Bacteria | 63910 |
| 216 | Ga0097621_100022075 | 3300006237 | Bacteria | 4936 |
| 217 | Ga0097621_100037577 | 3300006237 | Bacteria | 3882 |
| 218 | Ga0097621_100416701 | 3300006237 | Bacteria | 1205 |
| 219 | Ga0068871_100000518 | 3300006358 | Bacteria | 26422 |
| 220 | Ga0068871_100001258 | 3300006358 | Bacteria | 16940 |
| 221 | Ga0068871_100036701 | 3300006358 | Bacteria | 3903 |
| 222 | Ga0068871_100053550 | 3300006358 | Bacteria | 3271 |
| 223 | Ga0075428_100026999 | 3300006844 | Bacteria | 6358 |
| 224 | Ga0075430_100001945 | 3300006846 | Bacteria | 16975 |
| 225 | Ga0075431_100001208 | 3300006847 | Bacteria | 23343 |
| 226 | Ga0075433_10000495 | 3300006852 | Bacteria | 25642 |
| 227 | Ga0075433_10029599 | 3300006852 | Bacteria | 4667 |
| 228 | Ga0075434_100000362 | 3300006871 | Bacteria | 32982 |
| 229 | Ga0075434_100001759 | 3300006871 | Bacteria | 18630 |
| 230 | Ga0075434_100015341 | 3300006871 | Bacteria | 7342 |
| 231 | Ga0075434_100106670 | 3300006871 | Bacteria | 2811 |
| 232 | Ga0075434_100337416 | 3300006871 | Bacteria | 1528 |
| 233 | Ga0075429_100002672 | 3300006880 | Bacteria | 15008 |
| 234 | Ga0068865_100000233 | 3300006881 | Bacteria | 30830 |
| 235 | Ga0068865_100055160 | 3300006881 | Bacteria | 2764 |
| 236 | Ga0068865_100233633 | 3300006881 | Bacteria | 1444 |
| 237 | Ga0097620_100008949 | 3300006931 | Bacteria | 10111 |
| 238 | Ga0097620_100089262 | 3300006931 | Bacteria | 3132 |
| 239 | Ga0097620_100165723 | 3300006931 | Unclassified | 2290 |
| 240 | Ga0097620_100329194 | 3300006931 | Bacteria | 1622 |
| 241 | Ga0097620_100390197 | 3300006931 | Bacteria | 1488 |
| 242 | Ga0075435_100056666 | 3300007076 | Bacteria | 3169 |
| 243 | Ga0075435_100211407 | 3300007076 | Bacteria | 1646 |
| 244 | Ga0099795_10002298 | 3300007788 | Bacteria | 4458 |
| 245 | Ga0105244_10021503 | 3300009036 | Bacteria | 3567 |
| 246 | Ga0105250_10075969 | 3300009092 | Unclassified | 1359 |
| 247 | Ga0105240_10017644 | 3300009093 | Bacteria | 9611 |
| 248 | Ga0111539_10000185 | 3300009094 | Bacteria | 72688 |
| 249 | Ga0111539_10002902 | 3300009094 | Bacteria | 22764 |
| 250 | Ga0111539_10021504 | 3300009094 | Bacteria | 7937 |
| 251 | Ga0111539_10029992 | 3300009094 | Bacteria | 6616 |
| 252 | Ga0105245_10000213 | 3300009098 | Bacteria | 55096 |
| 253 | Ga0105245_10001618 | 3300009098 | Bacteria | 20495 |
| 254 | Ga0105245_10032664 | 3300009098 | Bacteria | 4608 |
| 255 | Ga0105245_10443500 | 3300009098 | Bacteria | 1305 |
| 256 | Ga0105247_10000547 | 3300009101 | Bacteria | 30561 |
| 257 | Ga0114129_10022773 | 3300009147 | Bacteria | 8883 |
| 258 | Ga0114129_10107772 | 3300009147 | Unclassified | 3847 |
| 259 | Ga0105243_10000175 | 3300009148 | Bacteria | 73728 |
| 260 | Ga0105243_10023802 | 3300009148 | Bacteria | 4667 |
| 261 | Ga0105243_10042084 | 3300009148 | Bacteria | 3575 |
| 262 | Ga0105243_10078290 | 3300009148 | Bacteria | 2691 |
| 263 | Ga0105243_10210581 | 3300009148 | Bacteria | 1711 |
| 264 | Ga0105243_10552673 | 3300009148 | Bacteria | 1100 |
| 265 | Ga0105241_10000261 | 3300009174 | Bacteria | 39222 |
| 266 | Ga0105241_10013692 | 3300009174 | Bacteria | 5943 |
| 267 | Ga0105241_10046034 | 3300009174 | Bacteria | 3312 |
| 268 | Ga0105242_10000170 | 3300009176 | Bacteria | 49285 |
| 269 | Ga0105242_10021530 | 3300009176 | Bacteria | 5065 |
| 270 | Ga0105242_10043161 | 3300009176 | Bacteria | 3647 |
| 271 | Ga0105248_10003502 | 3300009177 | Bacteria | 17416 |
| 272 | Ga0105248_10006618 | 3300009177 | Bacteria | 12698 |
| 273 | Ga0105248_10069683 | 3300009177 | Unclassified | 3949 |
| 274 | Ga0105248_10145952 | 3300009177 | Bacteria | 2670 |
| 275 | Ga0105237_10001448 | 3300009545 | Bacteria | 31355 |
| 276 | Ga0105237_10043307 | 3300009545 | Bacteria | 4535 |
| 277 | Ga0105238_10095679 | 3300009551 | Bacteria | 2956 |
| 278 | Ga0105238_10185352 | 3300009551 | Bacteria | 2057 |
| 279 | Ga0105238_10188642 | 3300009551 | Bacteria | 2038 |
| 280 | Ga0105238_10300031 | 3300009551 | Bacteria | 1590 |
| 281 | Ga0105238_10414099 | 3300009551 | Bacteria | 1342 |
| 282 | Ga0105238_10499298 | 3300009551 | Bacteria | 1217 |
| 283 | Ga0105238_10794927 | 3300009551 | Unclassified | 961 |
| 284 | Ga0105249_10000200 | 3300009553 | Bacteria | 68748 |
| 285 | Ga0105239_10000834 | 3300010375 | Bacteria | 43762 |
| 286 | Ga0105239_10053877 | 3300010375 | Bacteria | 4411 |
| 287 | Ga0105239_10247291 | 3300010375 | Bacteria | 2003 |
| 288 | Ga0105239_10316268 | 3300010375 | Bacteria | 1760 |
| 289 | Ga0105239_10472853 | 3300010375 | Bacteria | 1423 |
| 290 | Ga0105246_10000050 | 3300011119 | Bacteria | 46833 |
| 291 | Ga0105246_10038806 | 3300011119 | Bacteria | 3204 |
| 292 | Ga0105246_10069182 | 3300011119 | Unclassified | 2478 |
| 293 | Ga0105246_10104971 | 3300011119 | Unclassified | 2064 |
| 294 | Ga0105246_10264170 | 3300011119 | Bacteria | 1372 |
| 295 | Ga0157335_1003426 | 3300012492 | Bacteria | 1017 |
| 296 | Ga0157342_1001628 | 3300012507 | Bacteria | 1704 |
| 297 | Ga0157371_10004767 | 3300013102 | Bacteria | 11690 |
| 298 | Ga0157370_10079802 | 3300013104 | Bacteria | 3081 |
| 299 | Ga0157370_10150930 | 3300013104 | Bacteria | 2162 |
| 300 | Ga0157370_10490099 | 3300013104 | Bacteria | 1129 |
| 301 | Ga0157369_10088233 | 3300013105 | Bacteria | 3310 |
| 302 | Ga0157374_10016814 | 3300013296 | Bacteria | 6436 |
| 303 | Ga0157374_10279687 | 3300013296 | Bacteria | 1647 |
| 304 | Ga0157374_10539789 | 3300013296 | Bacteria | 1173 |
| 305 | Ga0157378_10000717 | 3300013297 | Bacteria | 30971 |
| 306 | Ga0157378_10106892 | 3300013297 | Bacteria | 2560 |
| 307 | Ga0163162_10000222 | 3300013306 | Bacteria | 52141 |
| 308 | Ga0163162_10008882 | 3300013306 | Bacteria | 9773 |
| 309 | Ga0163162_10066922 | 3300013306 | Bacteria | 3642 |
| 310 | Ga0163162_10117267 | 3300013306 | Bacteria | 2764 |
| 311 | Ga0163162_10229594 | 3300013306 | Bacteria | 1986 |
| 312 | Ga0157372_10001555 | 3300013307 | Bacteria | 24983 |
| 313 | Ga0157372_10109054 | 3300013307 | Bacteria | 3169 |
| 314 | Ga0157372_10473793 | 3300013307 | Bacteria | 1459 |
| 315 | Ga0157375_10000355 | 3300013308 | Bacteria | 41608 |
| 316 | Ga0157375_10503904 | 3300013308 | Bacteria | 1375 |
| 317 | Ga0157375_10553561 | 3300013308 | Unclassified | 1312 |
| 318 | Ga0157375_10632270 | 3300013308 | Bacteria | 1228 |
| 319 | Ga0157375_10901113 | 3300013308 | Bacteria | 1028 |
| 320 | Ga0163163_10001323 | 3300014325 | Bacteria | 20914 |
| 321 | Ga0163163_10004121 | 3300014325 | Bacteria | 12383 |
| 322 | Ga0163163_10065975 | 3300014325 | Bacteria | 3594 |
| 323 | Ga0163163_10355403 | 3300014325 | Bacteria | 1521 |
| 324 | Ga0163163_10443942 | 3300014325 | Bacteria | 1357 |
| 325 | Ga0163163_10482464 | 3300014325 | Bacteria | 1301 |
| 326 | Ga0157380_10000166 | 3300014326 | Bacteria | 38031 |
| 327 | Ga0157380_10082205 | 3300014326 | Bacteria | 2636 |
| 328 | Ga0157377_10000207 | 3300014745 | Bacteria | 32216 |
| 329 | Ga0157377_10084022 | 3300014745 | Bacteria | 1866 |
| 330 | Ga0157379_10000036 | 3300014968 | Bacteria | 81888 |
| 331 | Ga0157376_10000062 | 3300014969 | Bacteria | 89308 |
| 332 | Ga0157376_10137447 | 3300014969 | Bacteria | 2188 |
| 333 | Ga0163161_10000363 | 3300017792 | Bacteria | 37872 |
| 334 | Ga0163161_10053225 | 3300017792 | Bacteria | 2935 |
| 335 | Ga0206353_11648404 | 3300020082 | Bacteria | 2889 |
| 336 | Ga0213874_10000655 | 3300021377 | Bacteria | 6986 |
| 337 | Ga0213874_10041534 | 3300021377 | Bacteria | 1378 |
| 338 | Ga0213876_10028937 | 3300021384 | Bacteria | 2922 |
| 339 | Ga0213876_10050900 | 3300021384 | Bacteria | 2189 |
| 340 | Ga0213876_10082998 | 3300021384 | Bacteria | 1695 |
| 341 | Ga0213875_10001890 | 3300021388 | Bacteria | 12952 |
| 342 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 343 | Ga0207666_1000029 | 3300025271 | Bacteria | 31521 |
| 344 | Ga0207673_1000443 | 3300025290 | Bacteria | 4293 |
| 345 | Ga0209758_1000157 | 3300025297 | Bacteria | 156173 |
| 346 | Ga0207697_10000208 | 3300025315 | Bacteria | 31492 |
| 347 | Ga0207697_10017795 | 3300025315 | Bacteria | 2919 |
| 348 | Ga0207656_10011445 | 3300025321 | Bacteria | 3352 |
| 349 | Ga0207682_10000004 | 3300025893 | Bacteria | 104760 |
| 350 | Ga0207682_10000236 | 3300025893 | Bacteria | 24920 |
| 351 | Ga0207692_10003912 | 3300025898 | Bacteria | 5851 |
| 352 | Ga0207692_10049816 | 3300025898 | Bacteria | 2115 |
| 353 | Ga0207642_10000556 | 3300025899 | Bacteria | 11456 |
| 354 | Ga0207642_10109559 | 3300025899 | Bacteria | 1403 |
| 355 | Ga0207710_10003459 | 3300025900 | Bacteria | 7038 |
| 356 | Ga0207710_10021476 | 3300025900 | Bacteria | 2767 |
| 357 | Ga0207688_10000042 | 3300025901 | Bacteria | 44479 |
| 358 | Ga0207688_10314951 | 3300025901 | Bacteria | 959 |
| 359 | Ga0207680_10002676 | 3300025903 | Bacteria | 8332 |
| 360 | Ga0207680_10009820 | 3300025903 | Bacteria | 4764 |
| 361 | Ga0207647_10033344 | 3300025904 | Bacteria | 3298 |
| 362 | Ga0207699_10012876 | 3300025906 | Bacteria | 4262 |
| 363 | Ga0207699_10028140 | 3300025906 | Bacteria | 3120 |
| 364 | Ga0207645_10000061 | 3300025907 | Bacteria | 77457 |
| 365 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 366 | Ga0207705_10016041 | 3300025909 | Bacteria | 5378 |
| 367 | Ga0207705_10360207 | 3300025909 | Bacteria | 1122 |
| 368 | Ga0207654_10006985 | 3300025911 | Bacteria | 5686 |
| 369 | Ga0207654_10015120 | 3300025911 | Bacteria | 3997 |
| 370 | Ga0207707_10000405 | 3300025912 | Bacteria | 45114 |
| 371 | Ga0207707_10013006 | 3300025912 | Bacteria | 7245 |
| 372 | Ga0207695_10062614 | 3300025913 | Bacteria | 3839 |
| 373 | Ga0207671_10010683 | 3300025914 | Bacteria | 7552 |
| 374 | Ga0207671_10255924 | 3300025914 | Bacteria | 1377 |
| 375 | Ga0207693_10002228 | 3300025915 | Bacteria | 16885 |
| 376 | Ga0207693_10021878 | 3300025915 | Bacteria | 5085 |
| 377 | Ga0207693_10344058 | 3300025915 | Bacteria | 1167 |
| 378 | Ga0207663_10078279 | 3300025916 | Bacteria | 2155 |
| 379 | Ga0207663_10084949 | 3300025916 | Bacteria | 2083 |
| 380 | Ga0207663_10338010 | 3300025916 | Bacteria | 1136 |
| 381 | Ga0207660_10000008 | 3300025917 | Bacteria | 98521 |
| 382 | Ga0207660_10083879 | 3300025917 | Bacteria | 2348 |
| 383 | Ga0207660_10207006 | 3300025917 | Bacteria | 1535 |
| 384 | Ga0207660_10292993 | 3300025917 | Unclassified | 1294 |
| 385 | Ga0207662_10017516 | 3300025918 | Bacteria | 4054 |
| 386 | Ga0207662_10027345 | 3300025918 | Bacteria | 3292 |
| 387 | Ga0207662_10039414 | 3300025918 | Unclassified | 2772 |
| 388 | Ga0207657_10032057 | 3300025919 | Bacteria | 4752 |
| 389 | Ga0207657_10034735 | 3300025919 | Bacteria | 4529 |
| 390 | Ga0207657_10036441 | 3300025919 | Bacteria | 4402 |
| 391 | Ga0207657_10058101 | 3300025919 | Bacteria | 3330 |
| 392 | Ga0207657_10058127 | 3300025919 | Bacteria | 3329 |
| 393 | Ga0207657_10075517 | 3300025919 | Bacteria | 2844 |
| 394 | Ga0207657_10130850 | 3300025919 | Bacteria | 2057 |
| 395 | Ga0207649_10000099 | 3300025920 | Bacteria | 71350 |
| 396 | Ga0207652_10005026 | 3300025921 | Bacteria | 10717 |
| 397 | Ga0207652_10020374 | 3300025921 | Bacteria | 5460 |
| 398 | Ga0207652_10064345 | 3300025921 | Bacteria | 3173 |
| 399 | Ga0207652_10068951 | 3300025921 | Bacteria | 3069 |
| 400 | Ga0207652_10116932 | 3300025921 | Bacteria | 2369 |
| 401 | Ga0207652_10164492 | 3300025921 | Bacteria | 1989 |
| 402 | Ga0207652_10396284 | 3300025921 | Bacteria | 1246 |
| 403 | Ga0207681_10000141 | 3300025923 | Bacteria | 59951 |
| 404 | Ga0207681_10021299 | 3300025923 | Bacteria | 4119 |
| 405 | Ga0207694_10011088 | 3300025924 | Bacteria | 6807 |
| 406 | Ga0207694_10105504 | 3300025924 | Bacteria | 2237 |
| 407 | Ga0207694_10133397 | 3300025924 | Bacteria | 1992 |
| 408 | Ga0207694_10273488 | 3300025924 | Bacteria | 1386 |
| 409 | Ga0207650_10003620 | 3300025925 | Bacteria | 10591 |
| 410 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 411 | Ga0207659_10047227 | 3300025926 | Bacteria | 3045 |
| 412 | Ga0207659_10064413 | 3300025926 | Bacteria | 2653 |
| 413 | Ga0207659_10459445 | 3300025926 | Bacteria | 1073 |
| 414 | Ga0207687_10001943 | 3300025927 | Bacteria | 14215 |
| 415 | Ga0207687_10023625 | 3300025927 | Bacteria | 4100 |
| 416 | Ga0207687_10116638 | 3300025927 | Bacteria | 1990 |
| 417 | Ga0207687_10119087 | 3300025927 | Bacteria | 1972 |
| 418 | Ga0207687_10378098 | 3300025927 | Bacteria | 1160 |
| 419 | Ga0207700_10000896 | 3300025928 | Bacteria | 17150 |
| 420 | Ga0207700_10042180 | 3300025928 | Bacteria | 3343 |
| 421 | Ga0207700_10057161 | 3300025928 | Unclassified | 2940 |
| 422 | Ga0207700_10515379 | 3300025928 | Bacteria | 1059 |
| 423 | Ga0207664_10177899 | 3300025929 | Bacteria | 1825 |
| 424 | Ga0207664_10240190 | 3300025929 | Bacteria | 1577 |
| 425 | Ga0207644_10000286 | 3300025931 | Bacteria | 33249 |
| 426 | Ga0207644_10005169 | 3300025931 | Bacteria | 8520 |
| 427 | Ga0207644_10014489 | 3300025931 | Bacteria | 5273 |
| 428 | Ga0207644_10030974 | 3300025931 | Bacteria | 3725 |
| 429 | Ga0207690_10000105 | 3300025932 | Bacteria | 68515 |
| 430 | Ga0207706_10000438 | 3300025933 | Bacteria | 44481 |
| 431 | Ga0207706_10037959 | 3300025933 | Bacteria | 4275 |
| 432 | Ga0207706_10061574 | 3300025933 | Unclassified | 3305 |
| 433 | Ga0207706_10119157 | 3300025933 | Unclassified | 2321 |
| 434 | Ga0207706_10322847 | 3300025933 | Bacteria | 1344 |
| 435 | Ga0207686_10000140 | 3300025934 | Bacteria | 56605 |
| 436 | Ga0207686_10014222 | 3300025934 | Bacteria | 4426 |
| 437 | Ga0207686_10025521 | 3300025934 | Bacteria | 3438 |
| 438 | Ga0207709_10000264 | 3300025935 | Bacteria | 62258 |
| 439 | Ga0207709_10059227 | 3300025935 | Bacteria | 2383 |
| 440 | Ga0207709_10251358 | 3300025935 | Bacteria | 1291 |
| 441 | Ga0207670_10000108 | 3300025936 | Bacteria | 56906 |
| 442 | Ga0207670_10082591 | 3300025936 | Bacteria | 2252 |
| 443 | Ga0207670_10125300 | 3300025936 | Bacteria | 1873 |
| 444 | Ga0207669_10000110 | 3300025937 | Bacteria | 40953 |
| 445 | Ga0207704_10000171 | 3300025938 | Bacteria | 34340 |
| 446 | Ga0207704_10054112 | 3300025938 | Bacteria | 2445 |
| 447 | Ga0207704_10090326 | 3300025938 | Bacteria | 2010 |
| 448 | Ga0207704_10122644 | 3300025938 | Bacteria | 1782 |
| 449 | Ga0207665_10000121 | 3300025939 | Bacteria | 51718 |
| 450 | Ga0207665_10052800 | 3300025939 | Bacteria | 2739 |
| 451 | Ga0207665_10152428 | 3300025939 | Unclassified | 1657 |
| 452 | Ga0207691_10001221 | 3300025940 | Bacteria | 25640 |
| 453 | Ga0207691_10014531 | 3300025940 | Bacteria | 7509 |
| 454 | Ga0207691_10120309 | 3300025940 | Bacteria | 2328 |
| 455 | Ga0207691_10216463 | 3300025940 | Bacteria | 1662 |
| 456 | Ga0207711_10003268 | 3300025941 | Bacteria | 14107 |
| 457 | Ga0207711_10004585 | 3300025941 | Bacteria | 11750 |
| 458 | Ga0207711_10005315 | 3300025941 | Bacteria | 10921 |
| 459 | Ga0207711_10022702 | 3300025941 | Bacteria | 5249 |
| 460 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 461 | Ga0207689_10032070 | 3300025942 | Bacteria | 4371 |
| 462 | Ga0207689_10154116 | 3300025942 | Bacteria | 1894 |
| 463 | Ga0207661_10000053 | 3300025944 | Bacteria | 90600 |
| 464 | Ga0207661_10044119 | 3300025944 | Bacteria | 3522 |
| 465 | Ga0207679_10000053 | 3300025945 | Bacteria | 109038 |
| 466 | Ga0207667_10090252 | 3300025949 | Bacteria | 3167 |
| 467 | Ga0207667_10095126 | 3300025949 | Unclassified | 3075 |
| 468 | Ga0207667_10117924 | 3300025949 | Bacteria | 2735 |
| 469 | Ga0207667_10119092 | 3300025949 | Bacteria | 2721 |
| 470 | Ga0207667_10484020 | 3300025949 | Bacteria | 1256 |
| 471 | Ga0207651_10000052 | 3300025960 | Bacteria | 53826 |
| 472 | Ga0207651_10005685 | 3300025960 | Bacteria | 6433 |
| 473 | Ga0207651_10145948 | 3300025960 | Bacteria | 1835 |
| 474 | Ga0207712_10000317 | 3300025961 | Bacteria | 44165 |
| 475 | Ga0207668_10000160 | 3300025972 | Bacteria | 47008 |
| 476 | Ga0207668_10223031 | 3300025972 | Bacteria | 1515 |
| 477 | Ga0207640_10000232 | 3300025981 | Bacteria | 38513 |
| 478 | Ga0207658_10000890 | 3300025986 | Bacteria | 24847 |
| 479 | Ga0207658_10188973 | 3300025986 | Bacteria | 1710 |
| 480 | Ga0207658_10488222 | 3300025986 | Bacteria | 1095 |
| 481 | Ga0207677_10001309 | 3300026023 | Bacteria | 13363 |
| 482 | Ga0207677_10277525 | 3300026023 | Bacteria | 1374 |
| 483 | Ga0207703_10000255 | 3300026035 | Bacteria | 60030 |
| 484 | Ga0207703_10006598 | 3300026035 | Bacteria | 9262 |
| 485 | Ga0207703_10017058 | 3300026035 | Bacteria | 5663 |
| 486 | Ga0207703_10085674 | 3300026035 | Bacteria | 2637 |
| 487 | Ga0207703_10148622 | 3300026035 | Bacteria | 2041 |
| 488 | Ga0207639_10003340 | 3300026041 | Bacteria | 10793 |
| 489 | Ga0207639_10235070 | 3300026041 | Bacteria | 1591 |
| 490 | Ga0207678_10000185 | 3300026067 | Bacteria | 53359 |
| 491 | Ga0207678_10008025 | 3300026067 | Bacteria | 9304 |
| 492 | Ga0207678_10125249 | 3300026067 | Bacteria | 2192 |
| 493 | Ga0207678_10415491 | 3300026067 | Bacteria | 1166 |
| 494 | Ga0207708_10045698 | 3300026075 | Bacteria | 3337 |
| 495 | Ga0207708_10050476 | 3300026075 | Bacteria | 3166 |
| 496 | Ga0207708_10402042 | 3300026075 | Bacteria | 1133 |
| 497 | Ga0207702_10000297 | 3300026078 | Bacteria | 57296 |
| 498 | Ga0207641_10000775 | 3300026088 | Bacteria | 34184 |
| 499 | Ga0207648_10059526 | 3300026089 | Bacteria | 3331 |
| 500 | Ga0207648_10169675 | 3300026089 | Bacteria | 1928 |
| 501 | Ga0207676_10000182 | 3300026095 | Bacteria | 55544 |
| 502 | Ga0207676_10014792 | 3300026095 | Bacteria | 5620 |
| 503 | Ga0207676_10036098 | 3300026095 | Bacteria | 3758 |
| 504 | Ga0207676_10082155 | 3300026095 | Bacteria | 2619 |
| 505 | Ga0207676_10296817 | 3300026095 | Bacteria | 1474 |
| 506 | Ga0207676_10349025 | 3300026095 | Bacteria | 1368 |
| 507 | Ga0207674_10001329 | 3300026116 | Bacteria | 32070 |
| 508 | Ga0207675_100000342 | 3300026118 | Bacteria | 44471 |
| 509 | Ga0207675_100071547 | 3300026118 | Bacteria | 3243 |
| 510 | Ga0207675_100095793 | 3300026118 | Bacteria | 2793 |
| 511 | Ga0207675_100415771 | 3300026118 | Unclassified | 1327 |
| 512 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 513 | Ga0207683_10000315 | 3300026121 | Bacteria | 44025 |
| 514 | Ga0207683_10028726 | 3300026121 | Bacteria | 4811 |
| 515 | Ga0207683_10076290 | 3300026121 | Bacteria | 2967 |
| 516 | Ga0207683_10244165 | 3300026121 | Bacteria | 1638 |
| 517 | Ga0207698_10000236 | 3300026142 | Bacteria | 34581 |
| 518 | Ga0207698_10028183 | 3300026142 | Bacteria | 4001 |
| 519 | Ga0207698_10236859 | 3300026142 | Bacteria | 1661 |
| 520 | Ga0209973_1003406 | 3300027252 | Bacteria | 1564 |
| 521 | Ga0209179_1010668 | 3300027512 | Unclassified | 1608 |
| 522 | Ga0209179_1023419 | 3300027512 | Bacteria | 1219 |
| 523 | Ga0210002_1000806 | 3300027617 | Bacteria | 4282 |
| 524 | Ga0209966_1001141 | 3300027695 | Bacteria | 4746 |
| 525 | Ga0209998_10010506 | 3300027717 | Unclassified | 1917 |
| 526 | Ga0209974_10009950 | 3300027876 | Bacteria | 3215 |
| 527 | Ga0207428_10000112 | 3300027907 | Bacteria | 110733 |
| 528 | Ga0207428_10000480 | 3300027907 | Bacteria | 48240 |
| 529 | Ga0207428_10001796 | 3300027907 | Bacteria | 21973 |
| 530 | Ga0268266_10010891 | 3300028379 | Bacteria | 7921 |
| 531 | Ga0268266_10047404 | 3300028379 | Bacteria | 3681 |
| 532 | Ga0268266_10067329 | 3300028379 | Bacteria | 3100 |
| 533 | Ga0268266_10080514 | 3300028379 | Bacteria | 2838 |
| 534 | Ga0268266_10357714 | 3300028379 | Bacteria | 1373 |
| 535 | Ga0268265_10000257 | 3300028380 | Bacteria | 60485 |
| 536 | Ga0268265_10217951 | 3300028380 | Bacteria | 1668 |
| 537 | Ga0268265_10375224 | 3300028380 | Bacteria | 1306 |
| 538 | Ga0268264_10000579 | 3300028381 | Bacteria | 44364 |
| 539 | Ga0268264_10014927 | 3300028381 | Bacteria | 6379 |
| 540 | Ga0268264_10221945 | 3300028381 | Bacteria | 1740 |
| 541 | Ga0265338_10010107 | 3300028800 | Bacteria | 11147 |
| 542 | Ga0265338_10286167 | 3300028800 | Bacteria | 1202 |
| 543 | Ga0265330_10020096 | 3300031235 | Bacteria | 3053 |
| 544 | Ga0265330_10035465 | 3300031235 | Bacteria | 2225 |
| 545 | Ga0265325_10001085 | 3300031241 | Bacteria | 19603 |
| 546 | Ga0265325_10004680 | 3300031241 | Bacteria | 8583 |
| 547 | Ga0265325_10038642 | 3300031241 | Bacteria | 2518 |
| 548 | Ga0265325_10066728 | 3300031241 | Bacteria | 1814 |
| 549 | Ga0265329_10007026 | 3300031242 | Bacteria | 4395 |
| 550 | Ga0265340_10005814 | 3300031247 | Bacteria | 6828 |
| 551 | Ga0265340_10022778 | 3300031247 | Bacteria | 3199 |
| 552 | Ga0265339_10001375 | 3300031249 | Bacteria | 18163 |
| 553 | Ga0265339_10050886 | 3300031249 | Bacteria | 2263 |
| 554 | Ga0265331_10011409 | 3300031250 | Bacteria | 4868 |
| 555 | Ga0265316_10156844 | 3300031344 | Bacteria | 1703 |
| 556 | Ga0307509_10086698 | 3300031507 | Bacteria | 3219 |
| 557 | Ga0307408_100057990 | 3300031548 | Bacteria | 2813 |
| 558 | Ga0265313_10006380 | 3300031595 | Bacteria | 8371 |
| 559 | Ga0307508_10004809 | 3300031616 | Bacteria | 13025 |
| 560 | Ga0265314_10005091 | 3300031711 | Bacteria | 11975 |
| 561 | Ga0265314_10071170 | 3300031711 | Bacteria | 2328 |
| 562 | Ga0265314_10109836 | 3300031711 | Bacteria | 1754 |
| 563 | Ga0265342_10000569 | 3300031712 | Bacteria | 38956 |
| 564 | Ga0265342_10000966 | 3300031712 | Bacteria | 28543 |
| 565 | Ga0316576_10014553 | 3300031727 | Bacteria | 5257 |
| 566 | Ga0316578_10014098 | 3300031728 | Bacteria | 4258 |
| 567 | Ga0373930_0008521 | 3300034816 | Bacteria | 1795 |
| 568 | Ga0373930_0011109 | 3300034816 | Bacteria | 1622 |
| 569 | Ga0373948_0000208 | 3300034817 | Bacteria | 6797 |
| 570 | Ga0373950_0000236 | 3300034818 | Bacteria | 7111 |
| 571 | Ga0373958_0000783 | 3300034819 | Bacteria | 4075 |
| 572 | Ga0373958_0003617 | 3300034819 | Bacteria | 2242 |
| 573 | Ga0373958_0005918 | 3300034819 | Bacteria | 1883 |
| 574 | Ga0373938_0000241 | 3300034957 | Bacteria | 8524 |
| 575 | Ga0373938_0000618 | 3300034957 | Bacteria | 5732 |
| 576 | Ga0373926_0031909 | 3300035083 | Unclassified | 1858 |
| 577 | Ga0373928_0001002 | 3300035084 | Bacteria | 5541 |
| 578 | Ga0373928_0008727 | 3300035084 | Bacteria | 1972 |
| 579 | Ga0373929_0000730 | 3300035085 | Bacteria | 6366 |
| 580 | Ga0373934_0083248 | 3300035086 | Unclassified | 1286 |
| 581 | Ga0373934_0097640 | 3300035086 | Unclassified | 1187 |
| 582 | Ga0373940_0001277 | 3300035088 | Bacteria | 4476 |
| 583 | Ga0373940_0007382 | 3300035088 | Unclassified | 2479 |
| 584 | Ga0373944_0009061 | 3300035089 | Unclassified | 2692 |
| 585 | Ga0373949_0003478 | 3300035090 | Unclassified | 3736 |
| 586 | Ga0373949_0023566 | 3300035090 | Bacteria | 1426 |
| 587 | Ga0373951_0004638 | 3300035091 | Bacteria | 3251 |
| 588 | Ga0373952_0000999 | 3300035092 | Bacteria | 5172 |
| 589 | Ga0373952_0001835 | 3300035092 | Bacteria | 3856 |
| 590 | Ga0373952_0011449 | 3300035092 | Bacteria | 1731 |
| 591 | Ga0373923_0007585 | 3300035111 | Unclassified | 3824 |
| 592 | Ga0373923_0018854 | 3300035111 | Bacteria | 2663 |
| 593 | Ga0373932_0000083 | 3300035112 | Bacteria | 24559 |
| 594 | Ga0373932_0001722 | 3300035112 | Bacteria | 5942 |
| 595 | Ga0373932_0004174 | 3300035112 | Unclassified | 3434 |
| 596 | Ga0373939_0000284 | 3300035114 | Bacteria | 13420 |
| 597 | Ga0373939_0001402 | 3300035114 | Bacteria | 5843 |
| 598 | Ga0373939_0003206 | 3300035114 | Bacteria | 3834 |
| 599 | Ga0373941_0000052 | 3300035115 | Bacteria | 17623 |
| 600 | Ga0373941_0067480 | 3300035115 | Unclassified | 1180 |
| 601 | Ga0373945_0000454 | 3300035116 | Bacteria | 11512 |
| 602 | Ga0373953_0012136 | 3300035117 | Bacteria | 3044 |
| 603 | Ga0373953_0035371 | 3300035117 | Unclassified | 1963 |
| 604 | Ga0373954_0060889 | 3300035118 | Bacteria | 1781 |
| 605 | Ga0373956_0039540 | 3300035119 | Unclassified | 2091 |
| 606 | Ga0373960_0001413 | 3300035121 | Bacteria | 5320 |
| 607 | Ga0373960_0001868 | 3300035121 | Bacteria | 4714 |
| 608 | Ga0373943_0001219 | 3300035170 | Bacteria | 11498 |
| 609 | Ga0373946_0016986 | 3300035171 | Bacteria | 2779 |
| 610 | Ga0373946_0037475 | 3300035171 | Bacteria | 1971 |
| 611 | Ga0373955_0004758 | 3300035172 | Bacteria | 6037 |
| 612 | Ga0373942_0000221 | 3300035207 | Bacteria | 14969 |
| 613 | Ga0373961_0004414 | 3300035241 | Bacteria | 3404 |
| 614 | Ga0373961_0018473 | 3300035241 | Unclassified | 1821 |
| 615 | Ga0373961_0028047 | 3300035241 | Bacteria | 1550 |
| 616 | Ga0373962_0000218 | 3300035242 | Bacteria | 12137 |
| 617 | Ga0373962_0005140 | 3300035242 | Bacteria | 3162 |
| 618 | Ga0373962_0007318 | 3300035242 | Bacteria | 2701 |
| 619 | Ga0316574_0000639 | 3300035398 | Bacteria | 14688 |
| 620 | Ga0373924_0025619 | 3300035410 | Unclassified | 2332 |
| 621 | Ga0373924_0030202 | 3300035410 | Bacteria | 2171 |
| 622 | Ga0373931_0005439 | 3300035691 | Bacteria | 5889 |
| 623 | Ga0373931_0032063 | 3300035691 | Bacteria | 2716 |
| 624 | Ga0373935_0011345 | 3300035692 | Bacteria | 5351 |
| 625 | Ga0373935_0021914 | 3300035692 | Unclassified | 3912 |
| 626 | Ga0373935_0128687 | 3300035692 | Unclassified | 1699 |
| 627 | Ga0373935_0149610 | 3300035692 | Bacteria | 1583 |
| 628 | Ga0373935_0179206 | 3300035692 | Bacteria | 1454 |
| 629 | Ga0373935_0199779 | 3300035692 | Bacteria | 1381 |
| 630 | Ga0373935_0285494 | 3300035692 | Bacteria | 1163 |
| 631 | Ga0373927_0022779 | 3300035695 | Unclassified | 4102 |
| 632 | Ga0373927_0171087 | 3300035695 | Bacteria | 1424 |
| 633 | Ga0373927_0247466 | 3300035695 | Bacteria | 1172 |
| 634 | Ga0373933_0076622 | 3300035724 | Bacteria | 2043 |
| 635 | Ga0373933_0161140 | 3300035724 | Bacteria | 1424 |
| 636 | Ga0373933_0313323 | 3300035724 | Bacteria | 1017 |
| 637 | Ga0373947_0008305 | 3300035725 | Bacteria | 5982 |
| 638 | Ga0373947_0068393 | 3300035725 | Bacteria | 2172 |
| 639 | Ga0373947_0207969 | 3300035725 | Unclassified | 1282 |
| 640 | Ga0373937_0009394 | 3300036401 | Bacteria | 8498 |
| 641 | Ga0373937_0099348 | 3300036401 | Bacteria | 2699 |
| 642 | Ga0373937_0376431 | 3300036401 | Bacteria | 1346 |
| 643 | Ga0316582_0250834 | 3300036647 | Bacteria | 1213 |
| 644 | Ga0316584_0020630 | 3300036712 | Bacteria | 4781 |
| 645 | Ga0373925_0005624 | 3300037068 | Bacteria | 9323 |
| 646 | Ga0373925_0309247 | 3300037068 | Bacteria | 1277 |
| 647 | Ga0395899_0005913 | 3300037312 | Bacteria | 9499 |
| 648 | Ga0395900_0013922 | 3300037418 | Bacteria | 8209 |
| 649 | Ga0395900_0284533 | 3300037418 | Bacteria | 1644 |
| 650 | Ga0395898_0003374 | 3300037466 | Bacteria | 17892 |
| 651 | Ga0395898_0076248 | 3300037466 | Bacteria | 3238 |
| 652 | Ga0395898_0274640 | 3300037466 | Bacteria | 1607 |
| 653 | Ga0436364_0822555 | 3300037853 | Bacteria | 215682 |
| 654 | Ga0436364_0846620 | 3300037853 | Bacteria | 1527 |
| 655 | Ga0395901_0005140 | 3300038443 | Bacteria | 13211 |
| 656 | Ga0395901_0008846 | 3300038443 | Bacteria | 10193 |
| 657 | Ga0395901_0049543 | 3300038443 | Bacteria | 4365 |
| 658 | Ga0395901_0800693 | 3300038443 | Bacteria | 931 |
| 659 | Ga0242420_001067 | 3300038996 | Bacteria | 3502 |
| 660 | Ga0436365_0635250 | 3300039437 | Bacteria | 10464 |
| 661 | Ga0436365_0698484 | 3300039437 | Bacteria | 9473 |
| 662 | Ga0436365_0766362 | 3300039437 | Bacteria | 9394 |
| 663 | Ga0436365_1185723 | 3300039437 | Bacteria | 76482 |
| 664 | Ga0436361_0238061 | 3300039447 | Bacteria | 6479 |
| 665 | Ga0436361_0967476 | 3300039447 | Bacteria | 925 |
| 666 | Ga0436363_0439761 | 3300039450 | Bacteria | 2616 |
| 667 | Ga0436363_0654613 | 3300039450 | Bacteria | 18667 |
| 668 | Ga0436363_0915837 | 3300039450 | Bacteria | 3364 |
| 669 | Ga0439453_0001679 | 3300041408 | Bacteria | 2899 |
| 670 | Ga0439453_0011520 | 3300041408 | Bacteria | 1476 |
| 671 | Ga0439465_0029742 | 3300041413 | Bacteria | 1736 |
| 672 | Ga0439443_000960 | 3300042003 | Bacteria | 2950 |
| 673 | Ga0439448_0006732 | 3300042005 | Bacteria | 3311 |
| 674 | Ga0439450_007432 | 3300042008 | Bacteria | 2007 |
| 675 | Ga0439455_0002817 | 3300042012 | Bacteria | 3229 |
| 676 | Ga0439435_0043381 | 3300042436 | Bacteria | 1265 |
| 677 | Ga0439464_0012069 | 3300042439 | Bacteria | 2296 |
| 678 | Ga0439464_0030202 | 3300042439 | Bacteria | 1517 |
| 679 | Ga0439460_0015178 | 3300042461 | Bacteria | 2035 |
| 680 | Ga0451577_0173219 | 3300042876 | Bacteria | 1945 |
| 681 | Ga0466966_0269690 | 3300044684 | Bacteria | 1024 |
| 682 | Ga0466964_0077698 | 3300044706 | Bacteria | 1418 |
| 683 | Ga0466957_0015422 | 3300044842 | Bacteria | 4464 |
| 684 | Ga0466957_0135878 | 3300044842 | Bacteria | 1580 |
| 685 | Ga0466967_0051605 | 3300045976 | Bacteria | 3605 |
| 686 | Ga0466967_0056910 | 3300045976 | Bacteria | 3450 |
| 687 | Ga0466967_0517402 | 3300045976 | Bacteria | 1172 |
| 688 | Ga0495617_008093 | 3300046452 | Unclassified | 3633 |
| 689 | Ga0495592_0005820 | 3300046454 | Bacteria | 9141 |
| 690 | Ga0495592_0026634 | 3300046454 | Bacteria | 4382 |
| 691 | Ga0495603_0023812 | 3300046455 | Bacteria | 3704 |
| 692 | Ga0495629_0048654 | 3300046459 | Unclassified | 2972 |
| 693 | Ga0495629_0354468 | 3300046459 | Unclassified | 1000 |
| 694 | Ga0495638_0000332 | 3300046460 | Bacteria | 59517 |
| 695 | Ga0495651_0003705 | 3300046462 | Bacteria | 11706 |
| 696 | Ga0495651_0007751 | 3300046462 | Bacteria | 8215 |
| 697 | Ga0495651_0179035 | 3300046462 | Bacteria | 1502 |
| 698 | Ga0495653_0002409 | 3300046463 | Bacteria | 14890 |
| 699 | Ga0495653_0027712 | 3300046463 | Bacteria | 4534 |
| 700 | Ga0495653_0031307 | 3300046463 | Bacteria | 4229 |
| 701 | Ga0495580_0141039 | 3300046472 | Unclassified | 1670 |
| 702 | Ga0495639_0004750 | 3300046475 | Bacteria | 5842 |
| 703 | Ga0495639_0017548 | 3300046475 | Unclassified | 3110 |
| 704 | Ga0495662_0011745 | 3300046476 | Bacteria | 4281 |
| 705 | Ga0495664_0009343 | 3300046477 | Bacteria | 5484 |
| 706 | Ga0495664_0032247 | 3300046477 | Unclassified | 3073 |
| 707 | Ga0495664_0038584 | 3300046477 | Bacteria | 2820 |
| 708 | Ga0495664_0041978 | 3300046477 | Bacteria | 2708 |
| 709 | Ga0495584_0112568 | 3300046491 | Unclassified | 1377 |
| 710 | Ga0495585_0000631 | 3300046492 | Bacteria | 32569 |
| 711 | Ga0495594_0089221 | 3300046499 | Bacteria | 1726 |
| 712 | Ga0495594_0112523 | 3300046499 | Unclassified | 1535 |
| 713 | Ga0495594_0232996 | 3300046499 | Unclassified | 1049 |
| 714 | Ga0495607_0019819 | 3300046501 | Unclassified | 4266 |
| 715 | Ga0495608_0001510 | 3300046511 | Bacteria | 16563 |
| 716 | Ga0495608_0028110 | 3300046511 | Bacteria | 3823 |
| 717 | Ga0495618_0001563 | 3300046514 | Bacteria | 15357 |
| 718 | Ga0495628_0024355 | 3300046516 | Bacteria | 4955 |
| 719 | Ga0495628_0031547 | 3300046516 | Bacteria | 4285 |
| 720 | Ga0495628_0031998 | 3300046516 | Bacteria | 4250 |
| 721 | Ga0495630_0170762 | 3300046517 | Bacteria | 1657 |
| 722 | Ga0495630_0182896 | 3300046517 | Unclassified | 1598 |
| 723 | Ga0495637_0025228 | 3300046520 | Unclassified | 2680 |
| 724 | Ga0495644_0000752 | 3300046523 | Bacteria | 13379 |
| 725 | Ga0495663_0005915 | 3300046525 | Unclassified | 3387 |
| 726 | Ga0495666_0063214 | 3300046526 | Bacteria | 1767 |
| 727 | Ga0495652_0004105 | 3300046529 | Bacteria | 14047 |
| 728 | Ga0495652_0013609 | 3300046529 | Bacteria | 7322 |
| 729 | Ga0495652_0176099 | 3300046529 | Unclassified | 1646 |
| 730 | Ga0495665_0008272 | 3300046531 | Bacteria | 5638 |
| 731 | Ga0495640_0011139 | 3300046533 | Bacteria | 6923 |
| 732 | Ga0495640_0057280 | 3300046533 | Bacteria | 2660 |
| 733 | Ga0495640_0137308 | 3300046533 | Bacteria | 1578 |
| 734 | Ga0495586_0071708 | 3300046535 | Unclassified | 1893 |
| 735 | Ga0495598_0002749 | 3300046537 | Unclassified | 3654 |
| 736 | Ga0495609_0052605 | 3300046538 | Unclassified | 1812 |
| 737 | Ga0495645_0001517 | 3300046543 | Bacteria | 15661 |
| 738 | Ga0495667_0003144 | 3300046559 | Bacteria | 11078 |
| 739 | Ga0495667_0005312 | 3300046559 | Bacteria | 8707 |
| 740 | Ga0495667_0034860 | 3300046559 | Unclassified | 3365 |
| 741 | Ga0495667_0042526 | 3300046559 | Bacteria | 3013 |
| 742 | Ga0495667_0125579 | 3300046559 | Bacteria | 1656 |
| 743 | Ga0495656_0004899 | 3300046615 | Unclassified | 4609 |
| 744 | Ga0495634_0030035 | 3300046642 | Bacteria | 3757 |
| 745 | Ga0495611_0002973 | 3300046648 | Bacteria | 7561 |
| 746 | Ga0495625_0003059 | 3300046660 | Bacteria | 17138 |
| 747 | Ga0495635_0001408 | 3300046663 | Bacteria | 16045 |
| 748 | Ga0495635_0027974 | 3300046663 | Bacteria | 3920 |
| 749 | Ga0495635_0039010 | 3300046663 | Bacteria | 3288 |
| 750 | Ga0495635_0049978 | 3300046663 | Unclassified | 2882 |
| 751 | Ga0495659_0000882 | 3300046664 | Bacteria | 10663 |
| 752 | Ga0495661_0048852 | 3300046665 | Unclassified | 2569 |
| 753 | Ga0495588_0024242 | 3300046674 | Unclassified | 3012 |
| 754 | Ga0495657_0001888 | 3300046675 | Bacteria | 17819 |
| 755 | Ga0495657_0044338 | 3300046675 | Unclassified | 3026 |
| 756 | Ga0495599_0020358 | 3300046678 | Bacteria | 4131 |
| 757 | Ga0495599_0021313 | 3300046678 | Bacteria | 4042 |
| 758 | Ga0495599_0223400 | 3300046678 | Unclassified | 1151 |
| 759 | Ga0495623_0012554 | 3300046679 | Bacteria | 5482 |
| 760 | Ga0495623_0016072 | 3300046679 | Bacteria | 4835 |
| 761 | Ga0495646_0010421 | 3300046680 | Bacteria | 5908 |
| 762 | Ga0495646_0011661 | 3300046680 | Bacteria | 5585 |
| 763 | Ga0495646_0185981 | 3300046680 | Bacteria | 1138 |
| 764 | Ga0495658_0000560 | 3300046683 | Bacteria | 20250 |
| 765 | Ga0495658_0009422 | 3300046683 | Unclassified | 4868 |
| 766 | Ga0495669_0063344 | 3300046684 | Unclassified | 1677 |
| 767 | Ga0495613_0003541 | 3300046689 | Bacteria | 11708 |
| 768 | Ga0495670_0000125 | 3300046691 | Bacteria | 33077 |
| 769 | Ga0495600_0007601 | 3300046809 | Bacteria | 6639 |
| 770 | Ga0495600_0148049 | 3300046809 | Bacteria | 1521 |
| 771 | Ga0495604_0008243 | 3300047317 | Bacteria | 8243 |
| 772 | Ga0495604_0019908 | 3300047317 | Bacteria | 5366 |
| 773 | Ga0495674_0012627 | 3300047319 | Bacteria | 7958 |
| 774 | Ga0495674_0029944 | 3300047319 | Bacteria | 4952 |
| 775 | Ga0495674_0244716 | 3300047319 | Bacteria | 1477 |
| 776 | Ga0495674_0476688 | 3300047319 | Bacteria | 1000 |
| 777 | Ga0495676_0021858 | 3300047321 | Bacteria | 5578 |
| 778 | Ga0495676_0073772 | 3300047321 | Bacteria | 2615 |
| 779 | Ga0495680_0004412 | 3300047322 | Bacteria | 13448 |
| 780 | Ga0495680_0014033 | 3300047322 | Bacteria | 6961 |
| 781 | Ga0495680_0021068 | 3300047322 | Bacteria | 5463 |
| 782 | Ga0495680_0023630 | 3300047322 | Bacteria | 5108 |
| 783 | Ga0495680_0205967 | 3300047322 | Bacteria | 1410 |
| 784 | Ga0495675_0045223 | 3300047444 | Bacteria | 2803 |
| 785 | Ga0495677_0079755 | 3300047445 | Bacteria | 1226 |
| 786 | Ga0495684_0031787 | 3300047471 | Bacteria | 4054 |
| 787 | Ga0495684_0100888 | 3300047471 | Unclassified | 2182 |
| 788 | Ga0495593_0124853 | 3300047673 | Unclassified | 1308 |
| 789 | Ga0495602_0003131 | 3300048088 | Bacteria | 17024 |
| 790 | Ga0495602_0005133 | 3300048088 | Bacteria | 13715 |
| 791 | Ga0495602_0122028 | 3300048088 | Bacteria | 2095 |
| 792 | Ga0495614_0132409 | 3300048089 | Bacteria | 1104 |
| 793 | Ga0496100_0000249 | 3300048903 | Bacteria | 27845 |
| 794 | Ga0496100_0010298 | 3300048903 | Bacteria | 5290 |
| 795 | Ga0496100_0028260 | 3300048903 | Bacteria | 3458 |
| 796 | Ga0496100_0314649 | 3300048903 | Bacteria | 1174 |
| 797 | Ga0496101_0000526 | 3300048904 | Bacteria | 23789 |
| 798 | Ga0496101_0016287 | 3300048904 | Bacteria | 5017 |
| 799 | Ga0496101_0018614 | 3300048904 | Bacteria | 4725 |
| 800 | Ga0496102_0000433 | 3300048905 | Bacteria | 48390 |
| 801 | Ga0496102_0039389 | 3300048905 | Bacteria | 4270 |
| 802 | Ga0496102_0058306 | 3300048905 | Bacteria | 3527 |
| 803 | Ga0496102_0120570 | 3300048905 | Unclassified | 2449 |
| 804 | Ga0496102_0124734 | 3300048905 | Bacteria | 2406 |
| 805 | Ga0496103_0000537 | 3300048906 | Bacteria | 30478 |
| 806 | Ga0496103_0031236 | 3300048906 | Bacteria | 3244 |
| 807 | Ga0496103_0032797 | 3300048906 | Bacteria | 3171 |
| 808 | Ga0496103_0054408 | 3300048906 | Bacteria | 2480 |
| 809 | Ga0496104_0017252 | 3300048907 | Bacteria | 6570 |
| 810 | Ga0496104_0027601 | 3300048907 | Bacteria | 5255 |
| 811 | Ga0496104_0036930 | 3300048907 | Bacteria | 4568 |
| 812 | Ga0496104_0042787 | 3300048907 | Bacteria | 4253 |
| 813 | Ga0496104_0237212 | 3300048907 | Bacteria | 1735 |
| 814 | Ga0496105_0011066 | 3300048908 | Bacteria | 7111 |
| 815 | Ga0496105_0065812 | 3300048908 | Bacteria | 2991 |
| 816 | Ga0496105_0095526 | 3300048908 | Bacteria | 2455 |
| 817 | Ga0496106_0001596 | 3300048909 | Bacteria | 17036 |
| 818 | Ga0496106_0011937 | 3300048909 | Bacteria | 6415 |
| 819 | Ga0496106_0052013 | 3300048909 | Bacteria | 3089 |
| 820 | Ga0496106_0311060 | 3300048909 | Bacteria | 1264 |
| 821 | Ga0496107_0000078 | 3300048910 | Bacteria | 46997 |
| 822 | Ga0496107_0019236 | 3300048910 | Bacteria | 4818 |
| 823 | Ga0496108_0007233 | 3300048911 | Bacteria | 8997 |
| 824 | Ga0496108_0007917 | 3300048911 | Bacteria | 8615 |
| 825 | Ga0496108_0036082 | 3300048911 | Bacteria | 4111 |
| 826 | Ga0496108_0056943 | 3300048911 | Bacteria | 3285 |
| 827 | Ga0496108_0103489 | 3300048911 | Bacteria | 2429 |
| 828 | Ga0496108_0261851 | 3300048911 | Bacteria | 1505 |
| 829 | Ga0496109_0000406 | 3300048912 | Bacteria | 38388 |
| 830 | Ga0496109_0033630 | 3300048912 | Bacteria | 4613 |
| 831 | Ga0496109_0050329 | 3300048912 | Bacteria | 3794 |
| 832 | Ga0496109_0052682 | 3300048912 | Bacteria | 3710 |
| 833 | Ga0496109_0073983 | 3300048912 | Bacteria | 3131 |
| 834 | Ga0496109_0161909 | 3300048912 | Bacteria | 2096 |
| 835 | Ga0496110_0013775 | 3300048913 | Bacteria | 6699 |
| 836 | Ga0496110_0025351 | 3300048913 | Bacteria | 5066 |
| 837 | Ga0496110_0161757 | 3300048913 | Bacteria | 2029 |
| 838 | Ga0496110_0310705 | 3300048913 | Bacteria | 1436 |
| 839 | Ga0496111_0024889 | 3300048914 | Bacteria | 4222 |
| 840 | Ga0496111_0055008 | 3300048914 | Bacteria | 2878 |
| 841 | Ga0496111_0095503 | 3300048914 | Bacteria | 2181 |
| 842 | Ga0496112_0031930 | 3300048915 | Bacteria | 5110 |
| 843 | Ga0496112_0038727 | 3300048915 | Bacteria | 4657 |
| 844 | Ga0496112_0062212 | 3300048915 | Bacteria | 3681 |
| 845 | Ga0496112_0085855 | 3300048915 | Bacteria | 3113 |
| 846 | Ga0496112_0115532 | 3300048915 | Bacteria | 2654 |
| 847 | Ga0496113_0016310 | 3300048916 | Bacteria | 5129 |
| 848 | Ga0496113_0042358 | 3300048916 | Bacteria | 3364 |
| 849 | Ga0496113_0053458 | 3300048916 | Bacteria | 3020 |
| 850 | Ga0496113_0184077 | 3300048916 | Bacteria | 1656 |
| 851 | Ga0496113_0311313 | 3300048916 | Bacteria | 1261 |
| 852 | Ga0496113_0453433 | 3300048916 | Bacteria | 1030 |
| 853 | Ga0496114_0000418 | 3300048917 | Bacteria | 31450 |
| 854 | Ga0496114_0029193 | 3300048917 | Bacteria | 4530 |
| 855 | Ga0496114_0054803 | 3300048917 | Bacteria | 3324 |
| 856 | Ga0496115_0000437 | 3300048918 | Bacteria | 33699 |
| 857 | Ga0496115_0004165 | 3300048918 | Bacteria | 10441 |
| 858 | Ga0496115_0007793 | 3300048918 | Bacteria | 7894 |
| 859 | Ga0496115_0047193 | 3300048918 | Bacteria | 3443 |
| 860 | Ga0496115_0095942 | 3300048918 | Bacteria | 2427 |
| 861 | Ga0496115_0153141 | 3300048918 | Bacteria | 1904 |
| 862 | Ga0496119_0008818 | 3300048922 | Bacteria | 8777 |
| 863 | Ga0496121_0051404 | 3300048924 | Bacteria | 3471 |
| 864 | Ga0496122_0002969 | 3300048925 | Bacteria | 23111 |
| 865 | Ga0496123_0001480 | 3300048926 | Bacteria | 32605 |
| 866 | Ga0496125_0006882 | 3300048928 | Bacteria | 12181 |
| 867 | Ga0496126_0014468 | 3300048929 | Bacteria | 7974 |
| 868 | Ga0496126_0187598 | 3300048929 | Bacteria | 1753 |
| 869 | Ga0496126_0195495 | 3300048929 | Bacteria | 1711 |
| 870 | Ga0501034_0062316 | 3300049571 | Bacteria | 3745 |
| 871 | Ga0501034_0099805 | 3300049571 | Bacteria | 2898 |
| 872 | Ga0501036_0352722 | 3300049572 | Bacteria | 1228 |
| 873 | Ga0501037_0289552 | 3300049573 | Bacteria | 1139 |
| 874 | Ga0501038_0011459 | 3300049574 | Bacteria | 8088 |
| 875 | Ga0501043_0015446 | 3300049579 | Bacteria | 5980 |
| 876 | Ga0501047_0089345 | 3300049581 | Bacteria | 2958 |
| 877 | Ga0501048_0337348 | 3300049582 | Bacteria | 1074 |
| 878 | Ga0501067_0207977 | 3300049583 | Bacteria | 1090 |
| 879 | Ga0501068_0158916 | 3300049584 | Bacteria | 1424 |
| 880 | Ga0501069_0005668 | 3300049585 | Bacteria | 6504 |
| 881 | Ga0501071_0013418 | 3300049587 | Bacteria | 5583 |
| 882 | Ga0501071_0110680 | 3300049587 | Bacteria | 2030 |
| 883 | Ga0501072_0001393 | 3300049588 | Bacteria | 18197 |
| 884 | Ga0501073_0088402 | 3300049589 | Bacteria | 2154 |
| 885 | Ga0501074_0081851 | 3300049590 | Bacteria | 2315 |
| 886 | Ga0501074_0146445 | 3300049590 | Bacteria | 1689 |
| 887 | Ga0501076_0160487 | 3300049592 | Bacteria | 1831 |
| 888 | Ga0501076_0210122 | 3300049592 | Bacteria | 1590 |
| 889 | Ga0501076_0284354 | 3300049592 | Bacteria | 1355 |
| 890 | Ga0501077_0048973 | 3300049593 | Bacteria | 2685 |
| 891 | Ga0501079_0179903 | 3300049741 | Bacteria | 1650 |
| 892 | Ga0501080_0012087 | 3300049742 | Bacteria | 7908 |
| 893 | Ga0501080_0501111 | 3300049742 | Bacteria | 1085 |
| 894 | Ga0501081_0062078 | 3300049743 | Bacteria | 2591 |
| 895 | Ga0501083_0023728 | 3300049744 | Bacteria | 4254 |
| 896 | Ga0501035_0160968 | 3300049822 | Bacteria | 1942 |
| 897 | Ga0501035_0403457 | 3300049822 | Bacteria | 1137 |
| 898 | Ga0501044_0021906 | 3300049823 | Bacteria | 6815 |
| 899 | Ga0501044_0116933 | 3300049823 | Bacteria | 2671 |
| 900 | nmdc:mga03683_136563_c1 | 3300050489 | Bacteria | 1100 |
| 901 | nmdc:mga03683_42135_c1 | 3300050489 | Bacteria | 1877 |
| 902 | nmdc:mga00v17_274852_c1 | 3300050491 | Bacteria | 1093 |
| 903 | nmdc:mga0k408_158495_c1 | 3300050493 | Bacteria | 1348 |
| 904 | nmdc:mga0k408_18336_c1 | 3300050493 | Bacteria | 3905 |
| 905 | nmdc:mga0k408_34297_c1 | 3300050493 | Bacteria | 2259 |
| 906 | nmdc:mga06z11_87691_c1 | 3300050494 | Bacteria | 1683 |
| 907 | nmdc:mga06z11_91428_c1 | 3300050494 | Bacteria | 1653 |
| 908 | nmdc:mga07m45_214620_c1 | 3300050496 | Unclassified | 1119 |
| 909 | nmdc:mga05p37_501_c1 | 3300050507 | Bacteria | 43088 |
| 910 | nmdc:mga05p37_55172_c1 | 3300050507 | Bacteria | 4889 |
| 911 | nmdc:mga09592_1023_c1 | 3300050508 | Bacteria | 22209 |
| 912 | nmdc:mga0qj67_62_c1 | 3300050509 | Bacteria | 79928 |
| 913 | nmdc:mga0qj67_713_c1 | 3300050509 | Bacteria | 22596 |
| 914 | nmdc:mga06r32_14313_c1 | 3300050510 | Bacteria | 7197 |
| 915 | nmdc:mga06r32_495138_c1 | 3300050510 | Bacteria | 1199 |
| 916 | nmdc:mga06r32_516718_c1 | 3300050510 | Bacteria | 1170 |
| 917 | nmdc:mga08y16_111019_c1 | 3300050511 | Bacteria | 2855 |
| 918 | nmdc:mga08y16_11459_c1 | 3300050511 | Bacteria | 9317 |
| 919 | nmdc:mga08y16_291392_c1 | 3300050511 | Bacteria | 1683 |
| 920 | nmdc:mga08y16_81646_c1 | 3300050511 | Bacteria | 3370 |
| 921 | nmdc:mga0n895_12135_c1 | 3300050512 | Bacteria | 7712 |
| 922 | nmdc:mga0n895_184325_c1 | 3300050512 | Unclassified | 2119 |
| 923 | nmdc:mga0n895_18888_c1 | 3300050512 | Bacteria | 6393 |
| 924 | nmdc:mga0n895_406118_c1 | 3300050512 | Bacteria | 1377 |
| 925 | nmdc:mga0n895_7677_c1 | 3300050512 | Bacteria | 9276 |
| 926 | nmdc:mga0rr50_18874_c1 | 3300050513 | Bacteria | 4642 |
| 927 | nmdc:mga0rr50_298628_c1 | 3300050513 | Unclassified | 1347 |
| 928 | nmdc:mga0rr50_428034_c1 | 3300050513 | Unclassified | 1120 |
| 929 | nmdc:mga0rr50_762_c1 | 3300050513 | Bacteria | 17306 |
| 930 | nmdc:mga08x19_22152_c1 | 3300050514 | Bacteria | 3932 |
| 931 | nmdc:mga08x19_94011_c1 | 3300050514 | Bacteria | 1982 |
| 932 | nmdc:mga0a205_2136_c1 | 3300050515 | Bacteria | 17355 |
| 933 | nmdc:mga0a205_3474_c1 | 3300050515 | Bacteria | 14078 |
| 934 | nmdc:mga0a205_71054_c1 | 3300050515 | Unclassified | 3362 |
| 935 | Ga0495601_0019095 | 3300053077 | Bacteria | 4177 |
| 936 | Ga0495601_0042710 | 3300053077 | Bacteria | 2845 |
| 937 | Ga0495601_0082214 | 3300053077 | Bacteria | 2067 |
| 938 | Ga0495601_0136256 | 3300053077 | Unclassified | 1600 |
| 939 | Ga0495601_0138647 | 3300053077 | Bacteria | 1586 |
| 940 | Ga0495612_0000494 | 3300053078 | Bacteria | 15696 |
| 941 | Ga0495612_0001786 | 3300053078 | Bacteria | 8812 |
| 942 | Ga0495612_0004081 | 3300053078 | Bacteria | 6051 |
| 943 | Ga0495612_0011494 | 3300053078 | Bacteria | 3570 |
| 944 | Ga0500610_0033630 | 3300053079 | Bacteria | 2618 |
| 945 | Ga0495595_0002176 | 3300053084 | Bacteria | 7616 |
| 946 | Ga0495595_0002965 | 3300053084 | Bacteria | 6704 |
| 947 | Ga0495595_0010018 | 3300053084 | Bacteria | 3931 |
| 948 | Ga0495595_0201806 | 3300053084 | Bacteria | 990 |
| 949 | Ga0495619_0000150 | 3300053085 | Bacteria | 51375 |
| 950 | Ga0495619_0000189 | 3300053085 | Bacteria | 45580 |
| 951 | Ga0495619_0009544 | 3300053085 | Bacteria | 6124 |
| 952 | Ga0495619_0037058 | 3300053085 | Unclassified | 3176 |
| 953 | Ga0495619_0053177 | 3300053085 | Bacteria | 2678 |
| 954 | Ga0495619_0299688 | 3300053085 | Bacteria | 1113 |
| 955 | Ga0500556_0000143 | 3300053104 | Bacteria | 59621 |
| 956 | Ga0500595_019552 | 3300053119 | Bacteria | 2455 |
| 957 | Ga0500658_0000788 | 3300053134 | Bacteria | 13121 |
| 958 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 959 | Ga0500637_0000022 | 3300053178 | Bacteria | 61494 |
| 960 | Ga0501082_0000016 | 3300060353 | Bacteria | 115081 |
| 961 | Ga0501082_0041644 | 3300060353 | Bacteria | 3960 |
| 962 | Ga0501082_0116320 | 3300060353 | Unclassified | 2316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10344058 | Ga0207693_103440582 | 251 |
| 2 | 3300048929 | Ga0496126_0195495 | Ga0496126_0195495_740_1516 | 256 |
| 3 | 3300025919 | Ga0207657_10036441 | Ga0207657_100364413 | 264 |
| 4 | 3300025924 | Ga0207694_10011088 | Ga0207694_100110886 | 264 |
| 5 | 3300048924 | Ga0496121_0051404 | Ga0496121_0051404_708_1547 | 264 |
| 6 | 3300049571 | Ga0501034_0062316 | Ga0501034_0062316_2294_3160 | 264 |
| 7 | 3300039447 | Ga0436361_0967476 | Ga0436361_0967476_98_901 | 265 |
| 8 | 3300037466 | Ga0395898_0274640 | Ga0395898_0274640_299_1174 | 267 |
| 9 | 3300049592 | Ga0501076_0284354 | Ga0501076_0284354_399_1280 | 267 |
| 10 | 3300005937 | Ga0081455_10009260 | Ga0081455_100092602 | 268 |
| 11 | 3300037312 | Ga0395899_0005913 | Ga0395899_0005913_5458_6333 | 268 |
| 12 | 3300037418 | Ga0395900_0013922 | Ga0395900_0013922_5963_6838 | 268 |
| 13 | 3300037466 | Ga0395898_0003374 | Ga0395898_0003374_9816_10691 | 268 |
| 14 | 3300038443 | Ga0395901_0008846 | Ga0395901_0008846_1486_2361 | 268 |
| 15 | 3300035725 | Ga0373947_0207969 | Ga0373947_0207969_32_841 | 269 |
| 16 | 3300046499 | Ga0495594_0232996 | Ga0495594_0232996_23_832 | 269 |
| 17 | 3300046516 | Ga0495628_0031547 | Ga0495628_0031547_3455_4264 | 269 |
| 18 | 3300047471 | Ga0495684_0100888 | Ga0495684_0100888_1352_2161 | 269 |
| 19 | 3300047673 | Ga0495593_0124853 | Ga0495593_0124853_479_1288 | 269 |
| 20 | 3300048089 | Ga0495614_0132409 | Ga0495614_0132409_69_878 | 269 |
| 21 | 3300053084 | Ga0495595_0201806 | Ga0495595_0201806_169_978 | 269 |
| 22 | 3300025916 | Ga0207663_10084949 | Ga0207663_100849492 | 270 |
| 23 | 3300049582 | Ga0501048_0337348 | Ga0501048_0337348_139_1050 | 270 |
| 24 | 3300009147 | Ga0114129_10022773 | Ga0114129_100227733 | 271 |
| 25 | 3300049583 | Ga0501067_0207977 | Ga0501067_0207977_140_1021 | 271 |
| 26 | 3300050507 | nmdc:mga05p37_55172_c1 | nmdc:mga05p37_55172_c1_3727_4623 | 271 |
| 27 | 3300005327 | Ga0070658_10232664 | Ga0070658_102326642 | 272 |
| 28 | 3300005336 | Ga0070680_100004173 | Ga0070680_1000041733 | 272 |
| 29 | 3300005458 | Ga0070681_10003716 | Ga0070681_100037164 | 272 |
| 30 | 3300005530 | Ga0070679_100006681 | Ga0070679_1000066812 | 272 |
| 31 | 3300025912 | Ga0207707_10013006 | Ga0207707_100130063 | 272 |
| 32 | 3300025921 | Ga0207652_10020374 | Ga0207652_100203744 | 272 |
| 33 | 3300049590 | Ga0501074_0081851 | Ga0501074_0081851_190_1056 | 272 |
| 34 | 3300025939 | Ga0207665_10052800 | Ga0207665_100528002 | 273 |
| 35 | 3300048918 | Ga0496115_0004165 | Ga0496115_0004165_2507_3388 | 273 |
| 36 | 3300049572 | Ga0501036_0352722 | Ga0501036_0352722_112_1023 | 273 |
| 37 | 3300049573 | Ga0501037_0289552 | Ga0501037_0289552_140_1051 | 273 |
| 38 | 3300049574 | Ga0501038_0011459 | Ga0501038_0011459_7015_7926 | 273 |
| 39 | 3300049579 | Ga0501043_0015446 | Ga0501043_0015446_3902_4813 | 273 |
| 40 | 3300049585 | Ga0501069_0005668 | Ga0501069_0005668_3432_4343 | 273 |
| 41 | 3300049587 | Ga0501071_0013418 | Ga0501071_0013418_4126_5037 | 273 |
| 42 | 3300049742 | Ga0501080_0012087 | Ga0501080_0012087_1043_1954 | 273 |
| 43 | 3300049822 | Ga0501035_0160968 | Ga0501035_0160968_140_1051 | 273 |
| 44 | 3300049823 | Ga0501044_0116933 | Ga0501044_0116933_1480_2391 | 273 |
| 45 | 3300048915 | Ga0496112_0062212 | Ga0496112_0062212_1882_2793 | 275 |
| 46 | 3300049571 | Ga0501034_0099805 | Ga0501034_0099805_1787_2698 | 275 |
| 47 | 3300005617 | Ga0068859_100390164 | Ga0068859_1003901642 | 276 |
| 48 | 3300005842 | Ga0068858_100482246 | Ga0068858_1004822462 | 276 |
| 49 | 3300005844 | Ga0068862_100223979 | Ga0068862_1002239792 | 276 |
| 50 | 3300006931 | Ga0097620_100390197 | Ga0097620_1003901972 | 276 |
| 51 | 3300009551 | Ga0105238_10414099 | Ga0105238_104140992 | 276 |
| 52 | 3300028380 | Ga0268265_10375224 | Ga0268265_103752241 | 276 |
| 53 | 3300048928 | Ga0496125_0006882 | Ga0496125_0006882_10652_11530 | 276 |
| 54 | 3300048929 | Ga0496126_0014468 | Ga0496126_0014468_1840_2718 | 276 |
| 55 | 3300005330 | Ga0070690_100188544 | Ga0070690_1001885441 | 277 |
| 56 | 3300005338 | Ga0068868_100171175 | Ga0068868_1001711752 | 277 |
| 57 | 3300005456 | Ga0070678_100075303 | Ga0070678_1000753033 | 277 |
| 58 | 3300005618 | Ga0068864_100043058 | Ga0068864_1000430582 | 277 |
| 59 | 3300007788 | Ga0099795_10002298 | Ga0099795_100022983 | 277 |
| 60 | 3300009098 | Ga0105245_10443500 | Ga0105245_104435001 | 277 |
| 61 | 3300013306 | Ga0163162_10117267 | Ga0163162_101172673 | 277 |
| 62 | 3300014325 | Ga0163163_10065975 | Ga0163163_100659752 | 277 |
| 63 | 3300025918 | Ga0207662_10017516 | Ga0207662_100175162 | 277 |
| 64 | 3300025923 | Ga0207681_10021299 | Ga0207681_100212993 | 277 |
| 65 | 3300025938 | Ga0207704_10054112 | Ga0207704_100541123 | 277 |
| 66 | 3300026095 | Ga0207676_10036098 | Ga0207676_100360982 | 277 |
| 67 | 3300027512 | Ga0209179_1023419 | Ga0209179_10234192 | 277 |
| 68 | 3300034816 | Ga0373930_0008521 | Ga0373930_0008521_234_1178 | 277 |
| 69 | 3300035241 | Ga0373961_0028047 | Ga0373961_0028047_580_1524 | 277 |
| 70 | 3300048911 | Ga0496108_0056943 | Ga0496108_0056943_1422_2366 | 277 |
| 71 | 3300048916 | Ga0496113_0184077 | Ga0496113_0184077_420_1364 | 277 |
| 72 | 3300053157 | Ga0500624_000020 | Ga0500624_000020_53659_54513 | 277 |
| 73 | 3300053178 | Ga0500637_0000022 | Ga0500637_0000022_53634_54488 | 277 |
| 74 | 3300021388 | Ga0213875_10001890 | Ga0213875_100018904 | 278 |
| 75 | 3300037853 | Ga0436364_0822555 | Ga0436364_0822555_58062_58904 | 278 |
| 76 | 3300046460 | Ga0495638_0000332 | Ga0495638_0000332_12347_13186 | 278 |
| 77 | 3300053134 | Ga0500658_0000788 | Ga0500658_0000788_7880_8719 | 278 |
| 78 | 3300003214 | JGI25165J46597_1000297 | JGI25165J46597_100029741 | 279 |
| 79 | 3300005356 | Ga0070674_100007598 | Ga0070674_1000075982 | 279 |
| 80 | 3300005456 | Ga0070678_100142510 | Ga0070678_1001425102 | 279 |
| 81 | 3300005539 | Ga0068853_100227621 | Ga0068853_1002276211 | 279 |
| 82 | 3300005548 | Ga0070665_100271256 | Ga0070665_1002712562 | 279 |
| 83 | 3300005842 | Ga0068858_100000254 | Ga0068858_10000025412 | 279 |
| 84 | 3300009098 | Ga0105245_10001618 | Ga0105245_100016189 | 279 |
| 85 | 3300009148 | Ga0105243_10210581 | Ga0105243_102105812 | 279 |
| 86 | 3300013296 | Ga0157374_10279687 | Ga0157374_102796872 | 279 |
| 87 | 3300013296 | Ga0157374_10539789 | Ga0157374_105397892 | 279 |
| 88 | 3300013308 | Ga0157375_10503904 | Ga0157375_105039041 | 279 |
| 89 | 3300025261 | Ga0209233_1000107 | Ga0209233_1000107250 | 279 |
| 90 | 3300025927 | Ga0207687_10023625 | Ga0207687_100236254 | 279 |
| 91 | 3300025940 | Ga0207691_10120309 | Ga0207691_101203093 | 279 |
| 92 | 3300025949 | Ga0207667_10484020 | Ga0207667_104840202 | 279 |
| 93 | 3300026035 | Ga0207703_10000255 | Ga0207703_1000025539 | 279 |
| 94 | 3300026121 | Ga0207683_10028726 | Ga0207683_100287262 | 279 |
| 95 | 3300028379 | Ga0268266_10080514 | Ga0268266_100805143 | 279 |
| 96 | 3300028379 | Ga0268266_10357714 | Ga0268266_103577141 | 279 |
| 97 | 3300031507 | Ga0307509_10086698 | Ga0307509_100866982 | 279 |
| 98 | 3300031616 | Ga0307508_10004809 | Ga0307508_100048095 | 279 |
| 99 | 3300046526 | Ga0495666_0063214 | Ga0495666_0063214_93_935 | 279 |
| 100 | 3300046660 | Ga0495625_0003059 | Ga0495625_0003059_12226_13068 | 279 |
| 101 | 3300048909 | Ga0496106_0311060 | Ga0496106_0311060_29_928 | 279 |
| 102 | 3300046559 | Ga0495667_0034860 | Ga0495667_0034860_19_861 | 280 |
| 103 | 3300005458 | Ga0070681_10142310 | Ga0070681_101423102 | 281 |
| 104 | 3300005578 | Ga0068854_100343705 | Ga0068854_1003437051 | 281 |
| 105 | 3300005985 | Ga0081539_10112394 | Ga0081539_101123941 | 281 |
| 106 | 3300037418 | Ga0395900_0284533 | Ga0395900_0284533_474_1352 | 281 |
| 107 | 3300038443 | Ga0395901_0005140 | Ga0395901_0005140_4085_4963 | 281 |
| 108 | 3300038443 | Ga0395901_0800693 | Ga0395901_0800693_17_895 | 281 |
| 109 | 3300025960 | Ga0207651_10145948 | Ga0207651_101459482 | 282 |
| 110 | 3300028379 | Ga0268266_10067329 | Ga0268266_100673292 | 282 |
| 111 | 3300031711 | Ga0265314_10109836 | Ga0265314_101098362 | 282 |
| 112 | 3300045976 | Ga0466967_0056910 | Ga0466967_0056910_899_1765 | 282 |
| 113 | 3300005436 | Ga0070713_100058892 | Ga0070713_1000588923 | 283 |
| 114 | 3300006028 | Ga0070717_10079548 | Ga0070717_100795482 | 283 |
| 115 | 3300009551 | Ga0105238_10188642 | Ga0105238_101886423 | 283 |
| 116 | 3300013308 | Ga0157375_10632270 | Ga0157375_106322702 | 283 |
| 117 | 3300014325 | Ga0163163_10482464 | Ga0163163_104824642 | 283 |
| 118 | 3300025297 | Ga0209758_1000157 | Ga0209758_100015727 | 283 |
| 119 | 3300025928 | Ga0207700_10042180 | Ga0207700_100421803 | 283 |
| 120 | 3300025942 | Ga0207689_10154116 | Ga0207689_101541162 | 283 |
| 121 | 3300026023 | Ga0207677_10277525 | Ga0207677_102775252 | 283 |
| 122 | 3300026095 | Ga0207676_10296817 | Ga0207676_102968172 | 283 |
| 123 | 3300026095 | Ga0207676_10349025 | Ga0207676_103490252 | 283 |
| 124 | 3300028800 | Ga0265338_10010107 | Ga0265338_100101072 | 283 |
| 125 | 3300031249 | Ga0265339_10050886 | Ga0265339_100508862 | 283 |
| 126 | 3300037853 | Ga0436364_0846620 | Ga0436364_0846620_209_1069 | 283 |
| 127 | 3300039450 | Ga0436363_0915837 | Ga0436363_0915837_1028_1888 | 283 |
| 128 | 3300046533 | Ga0495640_0137308 | Ga0495640_0137308_25_924 | 283 |
| 129 | 3300048918 | Ga0496115_0153141 | Ga0496115_0153141_861_1742 | 283 |
| 130 | 3300050494 | nmdc:mga06z11_87691_c1 | nmdc:mga06z11_87691_c1_402_1283 | 283 |
| 131 | 3300035171 | Ga0373946_0016986 | Ga0373946_0016986_810_1709 | 284 |
| 132 | 3300035692 | Ga0373935_0149610 | Ga0373935_0149610_498_1397 | 284 |
| 133 | 3300041413 | Ga0439465_0029742 | Ga0439465_0029742_755_1642 | 284 |
| 134 | 3300046477 | Ga0495664_0041978 | Ga0495664_0041978_1530_2429 | 284 |
| 135 | 3300047319 | Ga0495674_0244716 | Ga0495674_0244716_547_1446 | 284 |
| 136 | 3300048922 | Ga0496119_0008818 | Ga0496119_0008818_3414_4301 | 284 |
| 137 | 3300048925 | Ga0496122_0002969 | Ga0496122_0002969_14465_15352 | 284 |
| 138 | 3300048926 | Ga0496123_0001480 | Ga0496123_0001480_30446_31333 | 284 |
| 139 | 3300049592 | Ga0501076_0160487 | Ga0501076_0160487_360_1244 | 284 |
| 140 | 3300049741 | Ga0501079_0179903 | Ga0501079_0179903_145_1029 | 284 |
| 141 | 3300053077 | Ga0495601_0082214 | Ga0495601_0082214_656_1555 | 284 |
| 142 | 3300053078 | Ga0495612_0011494 | Ga0495612_0011494_402_1301 | 284 |
| 143 | 3300053104 | Ga0500556_0000143 | Ga0500556_0000143_24221_25108 | 284 |
| 144 | 3300005563 | Ga0068855_100057856 | Ga0068855_1000578562 | 285 |
| 145 | 3300005985 | Ga0081539_10031557 | Ga0081539_100315574 | 285 |
| 146 | 3300006358 | Ga0068871_100053550 | Ga0068871_1000535502 | 285 |
| 147 | 3300014325 | Ga0163163_10443942 | Ga0163163_104439421 | 285 |
| 148 | 3300025921 | Ga0207652_10396284 | Ga0207652_103962842 | 285 |
| 149 | 3300025928 | Ga0207700_10515379 | Ga0207700_105153791 | 285 |
| 150 | 3300025949 | Ga0207667_10117924 | Ga0207667_101179242 | 285 |
| 151 | 3300031548 | Ga0307408_100057990 | Ga0307408_1000579903 | 285 |
| 152 | 3300035692 | Ga0373935_0285494 | Ga0373935_0285494_108_1109 | 285 |
| 153 | 3300049822 | Ga0501035_0403457 | Ga0501035_0403457_140_1018 | 285 |
| 154 | 3300005937 | Ga0081455_10001964 | Ga0081455_1000196414 | 286 |
| 155 | 3300006163 | Ga0070715_10018926 | Ga0070715_100189262 | 286 |
| 156 | 3300021377 | Ga0213874_10041534 | Ga0213874_100415342 | 286 |
| 157 | 3300021384 | Ga0213876_10028937 | Ga0213876_100289372 | 286 |
| 158 | 3300025906 | Ga0207699_10012876 | Ga0207699_100128763 | 286 |
| 159 | 3300031242 | Ga0265329_10007026 | Ga0265329_100070263 | 286 |
| 160 | 3300031247 | Ga0265340_10005814 | Ga0265340_100058148 | 286 |
| 161 | 3300031249 | Ga0265339_10001375 | Ga0265339_1000137518 | 286 |
| 162 | 3300031250 | Ga0265331_10011409 | Ga0265331_100114094 | 286 |
| 163 | 3300031711 | Ga0265314_10071170 | Ga0265314_100711702 | 286 |
| 164 | 3300031712 | Ga0265342_10000569 | Ga0265342_1000056919 | 286 |
| 165 | 3300037068 | Ga0373925_0309247 | Ga0373925_0309247_90_971 | 286 |
| 166 | 3300039437 | Ga0436365_0766362 | Ga0436365_0766362_1282_2157 | 286 |
| 167 | 3300039450 | Ga0436363_0439761 | Ga0436363_0439761_845_1723 | 286 |
| 168 | 3300048903 | Ga0496100_0314649 | Ga0496100_0314649_13_873 | 286 |
| 169 | 3300048916 | Ga0496113_0453433 | Ga0496113_0453433_13_873 | 286 |
| 170 | 3300049589 | Ga0501073_0088402 | Ga0501073_0088402_930_1796 | 286 |
| 171 | 3300050493 | nmdc:mga0k408_18336_c1 | nmdc:mga0k408_18336_c1_2053_2946 | 286 |
| 172 | 3300021377 | Ga0213874_10000655 | Ga0213874_100006556 | 287 |
| 173 | 3300026121 | Ga0207683_10244165 | Ga0207683_102441652 | 287 |
| 174 | 3300027512 | Ga0209179_1010668 | Ga0209179_10106682 | 287 |
| 175 | 3300031727 | Ga0316576_10014553 | Ga0316576_100145534 | 287 |
| 176 | 3300031728 | Ga0316578_10014098 | Ga0316578_100140984 | 287 |
| 177 | 3300035398 | Ga0316574_0000639 | Ga0316574_0000639_9637_10518 | 287 |
| 178 | 3300036647 | Ga0316582_0250834 | Ga0316582_0250834_175_1056 | 287 |
| 179 | 3300036712 | Ga0316584_0020630 | Ga0316584_0020630_2508_3389 | 287 |
| 180 | 3300039437 | Ga0436365_1185723 | Ga0436365_1185723_29146_30018 | 287 |
| 181 | 3300039450 | Ga0436363_0654613 | Ga0436363_0654613_5349_6221 | 287 |
| 182 | 3300048908 | Ga0496105_0095526 | Ga0496105_0095526_774_1658 | 287 |
| 183 | 3300050489 | nmdc:mga03683_136563_c1 | nmdc:mga03683_136563_c1_136_1008 | 287 |
| 184 | 3300050493 | nmdc:mga0k408_158495_c1 | nmdc:mga0k408_158495_c1_198_1070 | 287 |
| 185 | 3300050509 | nmdc:mga0qj67_62_c1 | nmdc:mga0qj67_62_c1_39840_40721 | 287 |
| 186 | 3300050510 | nmdc:mga06r32_516718_c1 | nmdc:mga06r32_516718_c1_274_1155 | 287 |
| 187 | 3300053085 | Ga0495619_0053177 | Ga0495619_0053177_639_1523 | 287 |
| 188 | 3300053119 | Ga0500595_019552 | Ga0500595_019552_408_1283 | 287 |
| 189 | 3300006048 | Ga0075363_100173622 | Ga0075363_1001736222 | 288 |
| 190 | 3300006175 | Ga0070712_100225368 | Ga0070712_1002253682 | 288 |
| 191 | 3300006178 | Ga0075367_10251178 | Ga0075367_102511782 | 288 |
| 192 | 3300006871 | Ga0075434_100015341 | Ga0075434_1000153414 | 288 |
| 193 | 3300006871 | Ga0075434_100337416 | Ga0075434_1003374162 | 288 |
| 194 | 3300007076 | Ga0075435_100211407 | Ga0075435_1002114072 | 288 |
| 195 | 3300009551 | Ga0105238_10499298 | Ga0105238_104992981 | 288 |
| 196 | 3300010375 | Ga0105239_10316268 | Ga0105239_103162682 | 288 |
| 197 | 3300013307 | Ga0157372_10473793 | Ga0157372_104737932 | 288 |
| 198 | 3300021384 | Ga0213876_10082998 | Ga0213876_100829982 | 288 |
| 199 | 3300025909 | Ga0207705_10360207 | Ga0207705_103602071 | 288 |
| 200 | 3300025919 | Ga0207657_10130850 | Ga0207657_101308502 | 288 |
| 201 | 3300025924 | Ga0207694_10273488 | Ga0207694_102734882 | 288 |
| 202 | 3300026075 | Ga0207708_10402042 | Ga0207708_104020422 | 288 |
| 203 | 3300031241 | Ga0265325_10038642 | Ga0265325_100386423 | 288 |
| 204 | 3300031247 | Ga0265340_10022778 | Ga0265340_100227782 | 288 |
| 205 | 3300035118 | Ga0373954_0060889 | Ga0373954_0060889_891_1769 | 288 |
| 206 | 3300035692 | Ga0373935_0199779 | Ga0373935_0199779_331_1209 | 288 |
| 207 | 3300035724 | Ga0373933_0313323 | Ga0373933_0313323_82_960 | 288 |
| 208 | 3300035725 | Ga0373947_0068393 | Ga0373947_0068393_841_1719 | 288 |
| 209 | 3300036401 | Ga0373937_0376431 | Ga0373937_0376431_415_1293 | 288 |
| 210 | 3300039437 | Ga0436365_0698484 | Ga0436365_0698484_6606_7481 | 288 |
| 211 | 3300039447 | Ga0436361_0238061 | Ga0436361_0238061_5173_6048 | 288 |
| 212 | 3300045976 | Ga0466967_0517402 | Ga0466967_0517402_137_1015 | 288 |
| 213 | 3300046517 | Ga0495630_0170762 | Ga0495630_0170762_201_1079 | 288 |
| 214 | 3300046559 | Ga0495667_0125579 | Ga0495667_0125579_251_1129 | 288 |
| 215 | 3300047319 | Ga0495674_0476688 | Ga0495674_0476688_102_980 | 288 |
| 216 | 3300048913 | Ga0496110_0310705 | Ga0496110_0310705_201_1076 | 288 |
| 217 | 3300048929 | Ga0496126_0187598 | Ga0496126_0187598_688_1563 | 288 |
| 218 | 3300049588 | Ga0501072_0001393 | Ga0501072_0001393_13704_14585 | 288 |
| 219 | 3300049744 | Ga0501083_0023728 | Ga0501083_0023728_1030_1911 | 288 |
| 220 | 3300050494 | nmdc:mga06z11_91428_c1 | nmdc:mga06z11_91428_c1_412_1290 | 288 |
| 221 | 3300050512 | nmdc:mga0n895_406118_c1 | nmdc:mga0n895_406118_c1_472_1350 | 288 |
| 222 | 3300050512 | nmdc:mga0n895_7677_c1 | nmdc:mga0n895_7677_c1_3723_4601 | 288 |
| 223 | 3300050514 | nmdc:mga08x19_22152_c1 | nmdc:mga08x19_22152_c1_1948_2826 | 288 |
| 224 | 3300060353 | Ga0501082_0000016 | Ga0501082_0000016_103820_104701 | 288 |
| 225 | 3300060353 | Ga0501082_0041644 | Ga0501082_0041644_16_897 | 288 |
| 226 | 3300006195 | Ga0075366_10061449 | Ga0075366_100614492 | 289 |
| 227 | 3300044842 | Ga0466957_0135878 | Ga0466957_0135878_672_1541 | 289 |
| 228 | 3300045976 | Ga0466967_0051605 | Ga0466967_0051605_671_1540 | 289 |
| 229 | 3300050493 | nmdc:mga0k408_34297_c1 | nmdc:mga0k408_34297_c1_479_1357 | 289 |
| 230 | 3300050511 | nmdc:mga08y16_291392_c1 | nmdc:mga08y16_291392_c1_177_1055 | 289 |
| 231 | 3300005331 | Ga0070670_100189490 | Ga0070670_1001894902 | 290 |
| 232 | 3300005331 | Ga0070670_100338449 | Ga0070670_1003384491 | 290 |
| 233 | 3300005347 | Ga0070668_100267608 | Ga0070668_1002676082 | 290 |
| 234 | 3300005435 | Ga0070714_100176252 | Ga0070714_1001762522 | 290 |
| 235 | 3300005539 | Ga0068853_100562709 | Ga0068853_1005627091 | 290 |
| 236 | 3300005543 | Ga0070672_100095968 | Ga0070672_1000959683 | 290 |
| 237 | 3300005564 | Ga0070664_100083394 | Ga0070664_1000833942 | 290 |
| 238 | 3300005614 | Ga0068856_100271456 | Ga0068856_1002714562 | 290 |
| 239 | 3300005617 | Ga0068859_100329199 | Ga0068859_1003291992 | 290 |
| 240 | 3300005618 | Ga0068864_100152835 | Ga0068864_1001528352 | 290 |
| 241 | 3300006931 | Ga0097620_100329194 | Ga0097620_1003291942 | 290 |
| 242 | 3300009148 | Ga0105243_10552673 | Ga0105243_105526732 | 290 |
| 243 | 3300011119 | Ga0105246_10038806 | Ga0105246_100388063 | 290 |
| 244 | 3300013297 | Ga0157378_10106892 | Ga0157378_101068922 | 290 |
| 245 | 3300013306 | Ga0163162_10229594 | Ga0163162_102295941 | 290 |
| 246 | 3300014325 | Ga0163163_10355403 | Ga0163163_103554031 | 290 |
| 247 | 3300025893 | Ga0207682_10000236 | Ga0207682_1000023619 | 290 |
| 248 | 3300025901 | Ga0207688_10314951 | Ga0207688_103149511 | 290 |
| 249 | 3300025926 | Ga0207659_10459445 | Ga0207659_104594452 | 290 |
| 250 | 3300025927 | Ga0207687_10378098 | Ga0207687_103780981 | 290 |
| 251 | 3300025929 | Ga0207664_10240190 | Ga0207664_102401902 | 290 |
| 252 | 3300025933 | Ga0207706_10037959 | Ga0207706_100379592 | 290 |
| 253 | 3300025933 | Ga0207706_10322847 | Ga0207706_103228472 | 290 |
| 254 | 3300025935 | Ga0207709_10251358 | Ga0207709_102513582 | 290 |
| 255 | 3300025936 | Ga0207670_10125300 | Ga0207670_101253002 | 290 |
| 256 | 3300025938 | Ga0207704_10090326 | Ga0207704_100903262 | 290 |
| 257 | 3300025940 | Ga0207691_10014531 | Ga0207691_100145317 | 290 |
| 258 | 3300025942 | Ga0207689_10032070 | Ga0207689_100320702 | 290 |
| 259 | 3300025972 | Ga0207668_10223031 | Ga0207668_102230312 | 290 |
| 260 | 3300026041 | Ga0207639_10235070 | Ga0207639_102350702 | 290 |
| 261 | 3300026067 | Ga0207678_10415491 | Ga0207678_104154912 | 290 |
| 262 | 3300026095 | Ga0207676_10014792 | Ga0207676_100147922 | 290 |
| 263 | 3300028380 | Ga0268265_10217951 | Ga0268265_102179512 | 290 |
| 264 | 3300028800 | Ga0265338_10286167 | Ga0265338_102861672 | 290 |
| 265 | 3300031235 | Ga0265330_10035465 | Ga0265330_100354652 | 290 |
| 266 | 3300031241 | Ga0265325_10066728 | Ga0265325_100667282 | 290 |
| 267 | 3300031344 | Ga0265316_10156844 | Ga0265316_101568442 | 290 |
| 268 | 3300035410 | Ga0373924_0030202 | Ga0373924_0030202_751_1635 | 290 |
| 269 | 3300035724 | Ga0373933_0161140 | Ga0373933_0161140_418_1302 | 290 |
| 270 | 3300039437 | Ga0436365_0635250 | Ga0436365_0635250_3670_4551 | 290 |
| 271 | 3300041408 | Ga0439453_0001679 | Ga0439453_0001679_836_1720 | 290 |
| 272 | 3300042003 | Ga0439443_000960 | Ga0439443_000960_282_1166 | 290 |
| 273 | 3300042436 | Ga0439435_0043381 | Ga0439435_0043381_14_898 | 290 |
| 274 | 3300042439 | Ga0439464_0030202 | Ga0439464_0030202_251_1135 | 290 |
| 275 | 3300044684 | Ga0466966_0269690 | Ga0466966_0269690_63_935 | 290 |
| 276 | 3300047322 | Ga0495680_0205967 | Ga0495680_0205967_442_1326 | 290 |
| 277 | 3300048088 | Ga0495602_0122028 | Ga0495602_0122028_1124_2008 | 290 |
| 278 | 3300048903 | Ga0496100_0028260 | Ga0496100_0028260_666_1553 | 290 |
| 279 | 3300050510 | nmdc:mga06r32_495138_c1 | nmdc:mga06r32_495138_c1_32_916 | 290 |
| 280 | 3300053077 | Ga0495601_0042710 | Ga0495601_0042710_1442_2326 | 290 |
| 281 | 3300053079 | Ga0500610_0033630 | Ga0500610_0033630_1235_2119 | 290 |
| 282 | 3300005327 | Ga0070658_10048077 | Ga0070658_100480771 | 291 |
| 283 | 3300005327 | Ga0070658_10118250 | Ga0070658_101182502 | 291 |
| 284 | 3300005329 | Ga0070683_100704767 | Ga0070683_1007047671 | 291 |
| 285 | 3300005339 | Ga0070660_100089769 | Ga0070660_1000897692 | 291 |
| 286 | 3300005344 | Ga0070661_100289629 | Ga0070661_1002896291 | 291 |
| 287 | 3300005434 | Ga0070709_10167205 | Ga0070709_101672052 | 291 |
| 288 | 3300005437 | Ga0070710_10014910 | Ga0070710_100149103 | 291 |
| 289 | 3300005439 | Ga0070711_100106306 | Ga0070711_1001063062 | 291 |
| 290 | 3300005458 | Ga0070681_10092754 | Ga0070681_100927542 | 291 |
| 291 | 3300005458 | Ga0070681_10425218 | Ga0070681_104252182 | 291 |
| 292 | 3300005530 | Ga0070679_100204299 | Ga0070679_1002042992 | 291 |
| 293 | 3300005530 | Ga0070679_100516470 | Ga0070679_1005164702 | 291 |
| 294 | 3300005535 | Ga0070684_100176290 | Ga0070684_1001762902 | 291 |
| 295 | 3300005539 | Ga0068853_100289533 | Ga0068853_1002895332 | 291 |
| 296 | 3300005547 | Ga0070693_100063201 | Ga0070693_1000632012 | 291 |
| 297 | 3300005563 | Ga0068855_100506351 | Ga0068855_1005063512 | 291 |
| 298 | 3300005614 | Ga0068856_100124415 | Ga0068856_1001244152 | 291 |
| 299 | 3300005614 | Ga0068856_100658835 | Ga0068856_1006588351 | 291 |
| 300 | 3300005616 | Ga0068852_100015735 | Ga0068852_1000157352 | 291 |
| 301 | 3300005616 | Ga0068852_100366524 | Ga0068852_1003665242 | 291 |
| 302 | 3300006237 | Ga0097621_100416701 | Ga0097621_1004167011 | 291 |
| 303 | 3300009094 | Ga0111539_10029992 | Ga0111539_100299921 | 291 |
| 304 | 3300009176 | Ga0105242_10043161 | Ga0105242_100431613 | 291 |
| 305 | 3300009177 | Ga0105248_10006618 | Ga0105248_100066188 | 291 |
| 306 | 3300009551 | Ga0105238_10095679 | Ga0105238_100956792 | 291 |
| 307 | 3300009551 | Ga0105238_10185352 | Ga0105238_101853522 | 291 |
| 308 | 3300010375 | Ga0105239_10472853 | Ga0105239_104728532 | 291 |
| 309 | 3300013104 | Ga0157370_10150930 | Ga0157370_101509302 | 291 |
| 310 | 3300013104 | Ga0157370_10490099 | Ga0157370_104900992 | 291 |
| 311 | 3300013105 | Ga0157369_10088233 | Ga0157369_100882333 | 291 |
| 312 | 3300013307 | Ga0157372_10109054 | Ga0157372_101090543 | 291 |
| 313 | 3300020082 | Ga0206353_11648404 | Ga0206353_116484042 | 291 |
| 314 | 3300021384 | Ga0213876_10050900 | Ga0213876_100509002 | 291 |
| 315 | 3300025898 | Ga0207692_10049816 | Ga0207692_100498162 | 291 |
| 316 | 3300025909 | Ga0207705_10016041 | Ga0207705_100160414 | 291 |
| 317 | 3300025915 | Ga0207693_10021878 | Ga0207693_100218784 | 291 |
| 318 | 3300025917 | Ga0207660_10083879 | Ga0207660_100838792 | 291 |
| 319 | 3300025919 | Ga0207657_10032057 | Ga0207657_100320573 | 291 |
| 320 | 3300025919 | Ga0207657_10075517 | Ga0207657_100755172 | 291 |
| 321 | 3300025921 | Ga0207652_10164492 | Ga0207652_101644922 | 291 |
| 322 | 3300025924 | Ga0207694_10105504 | Ga0207694_101055042 | 291 |
| 323 | 3300025927 | Ga0207687_10116638 | Ga0207687_101166382 | 291 |
| 324 | 3300025931 | Ga0207644_10030974 | Ga0207644_100309741 | 291 |
| 325 | 3300025934 | Ga0207686_10025521 | Ga0207686_100255212 | 291 |
| 326 | 3300025941 | Ga0207711_10004585 | Ga0207711_100045858 | 291 |
| 327 | 3300025949 | Ga0207667_10090252 | Ga0207667_100902522 | 291 |
| 328 | 3300026035 | Ga0207703_10148622 | Ga0207703_101486221 | 291 |
| 329 | 3300026142 | Ga0207698_10028183 | Ga0207698_100281834 | 291 |
| 330 | 3300026142 | Ga0207698_10236859 | Ga0207698_102368592 | 291 |
| 331 | 3300031241 | Ga0265325_10001085 | Ga0265325_100010859 | 291 |
| 332 | 3300031712 | Ga0265342_10000966 | Ga0265342_1000096612 | 291 |
| 333 | 3300034819 | Ga0373958_0003617 | Ga0373958_0003617_469_1368 | 291 |
| 334 | 3300035084 | Ga0373928_0008727 | Ga0373928_0008727_101_1000 | 291 |
| 335 | 3300035092 | Ga0373952_0011449 | Ga0373952_0011449_801_1700 | 291 |
| 336 | 3300035691 | Ga0373931_0032063 | Ga0373931_0032063_858_1757 | 291 |
| 337 | 3300035695 | Ga0373927_0171087 | Ga0373927_0171087_455_1354 | 291 |
| 338 | 3300037466 | Ga0395898_0076248 | Ga0395898_0076248_1538_2413 | 291 |
| 339 | 3300038443 | Ga0395901_0049543 | Ga0395901_0049543_2440_3315 | 291 |
| 340 | 3300044706 | Ga0466964_0077698 | Ga0466964_0077698_528_1403 | 291 |
| 341 | 3300044842 | Ga0466957_0015422 | Ga0466957_0015422_2046_2921 | 291 |
| 342 | 3300048903 | Ga0496100_0010298 | Ga0496100_0010298_1590_2489 | 291 |
| 343 | 3300048904 | Ga0496101_0018614 | Ga0496101_0018614_194_1093 | 291 |
| 344 | 3300048905 | Ga0496102_0039389 | Ga0496102_0039389_10_909 | 291 |
| 345 | 3300048906 | Ga0496103_0031236 | Ga0496103_0031236_1404_2303 | 291 |
| 346 | 3300048907 | Ga0496104_0027601 | Ga0496104_0027601_2766_3665 | 291 |
| 347 | 3300048908 | Ga0496105_0011066 | Ga0496105_0011066_4116_5015 | 291 |
| 348 | 3300048909 | Ga0496106_0011937 | Ga0496106_0011937_2114_3013 | 291 |
| 349 | 3300048911 | Ga0496108_0103489 | Ga0496108_0103489_254_1153 | 291 |
| 350 | 3300048912 | Ga0496109_0050329 | Ga0496109_0050329_1873_2772 | 291 |
| 351 | 3300048913 | Ga0496110_0013775 | Ga0496110_0013775_3747_4646 | 291 |
| 352 | 3300048914 | Ga0496111_0095503 | Ga0496111_0095503_902_1801 | 291 |
| 353 | 3300048915 | Ga0496112_0085855 | Ga0496112_0085855_1868_2767 | 291 |
| 354 | 3300048917 | Ga0496114_0029193 | Ga0496114_0029193_1435_2334 | 291 |
| 355 | 3300048918 | Ga0496115_0007793 | Ga0496115_0007793_1591_2490 | 291 |
| 356 | 3300049581 | Ga0501047_0089345 | Ga0501047_0089345_1909_2784 | 291 |
| 357 | 3300049584 | Ga0501068_0158916 | Ga0501068_0158916_158_1057 | 291 |
| 358 | 3300049590 | Ga0501074_0146445 | Ga0501074_0146445_323_1198 | 291 |
| 359 | 3300049823 | Ga0501044_0021906 | Ga0501044_0021906_2708_3583 | 291 |
| 360 | 3300050489 | nmdc:mga03683_42135_c1 | nmdc:mga03683_42135_c1_792_1691 | 291 |
| 361 | 3300050491 | nmdc:mga00v17_274852_c1 | nmdc:mga00v17_274852_c1_24_923 | 291 |
| 362 | 3300050511 | nmdc:mga08y16_81646_c1 | nmdc:mga08y16_81646_c1_1999_2874 | 291 |
| 363 | 3300053077 | Ga0495601_0138647 | Ga0495601_0138647_347_1222 | 291 |
| 364 | 3300053084 | Ga0495595_0010018 | Ga0495595_0010018_2508_3383 | 291 |
| 365 | 3300053085 | Ga0495619_0299688 | Ga0495619_0299688_11_1000 | 291 |
| 366 | 3300003911 | JGI25405J52794_10015093 | JGI25405J52794_100150932 | 292 |
| 367 | 3300005290 | Ga0065712_10088717 | Ga0065712_100887172 | 292 |
| 368 | 3300005328 | Ga0070676_10242206 | Ga0070676_102422062 | 292 |
| 369 | 3300005335 | Ga0070666_10040026 | Ga0070666_100400263 | 292 |
| 370 | 3300005337 | Ga0070682_100024070 | Ga0070682_1000240704 | 292 |
| 371 | 3300005337 | Ga0070682_100118646 | Ga0070682_1001186462 | 292 |
| 372 | 3300005338 | Ga0068868_100020524 | Ga0068868_1000205244 | 292 |
| 373 | 3300005343 | Ga0070687_100161494 | Ga0070687_1001614942 | 292 |
| 374 | 3300005344 | Ga0070661_100150426 | Ga0070661_1001504262 | 292 |
| 375 | 3300005347 | Ga0070668_100081602 | Ga0070668_1000816022 | 292 |
| 376 | 3300005354 | Ga0070675_100061943 | Ga0070675_1000619433 | 292 |
| 377 | 3300005355 | Ga0070671_100056886 | Ga0070671_1000568863 | 292 |
| 378 | 3300005364 | Ga0070673_100125205 | Ga0070673_1001252053 | 292 |
| 379 | 3300005367 | Ga0070667_100059769 | Ga0070667_1000597693 | 292 |
| 380 | 3300005434 | Ga0070709_10001607 | Ga0070709_100016077 | 292 |
| 381 | 3300005435 | Ga0070714_100051618 | Ga0070714_1000516182 | 292 |
| 382 | 3300005436 | Ga0070713_100001009 | Ga0070713_1000010094 | 292 |
| 383 | 3300005437 | Ga0070710_10017505 | Ga0070710_100175052 | 292 |
| 384 | 3300005439 | Ga0070711_100021988 | Ga0070711_1000219882 | 292 |
| 385 | 3300005439 | Ga0070711_100031346 | Ga0070711_1000313462 | 292 |
| 386 | 3300005455 | Ga0070663_100104727 | Ga0070663_1001047273 | 292 |
| 387 | 3300005466 | Ga0070685_10061101 | Ga0070685_100611012 | 292 |
| 388 | 3300005544 | Ga0070686_100016581 | Ga0070686_1000165814 | 292 |
| 389 | 3300005547 | Ga0070693_100052119 | Ga0070693_1000521192 | 292 |
| 390 | 3300005564 | Ga0070664_100367628 | Ga0070664_1003676282 | 292 |
| 391 | 3300005615 | Ga0070702_100024518 | Ga0070702_1000245182 | 292 |
| 392 | 3300005617 | Ga0068859_100165726 | Ga0068859_1001657262 | 292 |
| 393 | 3300005618 | Ga0068864_100068138 | Ga0068864_1000681384 | 292 |
| 394 | 3300005718 | Ga0068866_10161455 | Ga0068866_101614552 | 292 |
| 395 | 3300005719 | Ga0068861_100079487 | Ga0068861_1000794873 | 292 |
| 396 | 3300005842 | Ga0068858_100007821 | Ga0068858_1000078212 | 292 |
| 397 | 3300005843 | Ga0068860_100323615 | Ga0068860_1003236152 | 292 |
| 398 | 3300005843 | Ga0068860_100402903 | Ga0068860_1004029032 | 292 |
| 399 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007149 | 292 |
| 400 | 3300006028 | Ga0070717_10230756 | Ga0070717_102307562 | 292 |
| 401 | 3300006058 | Ga0075432_10008092 | Ga0075432_100080923 | 292 |
| 402 | 3300006163 | Ga0070715_10055104 | Ga0070715_100551042 | 292 |
| 403 | 3300006173 | Ga0070716_100016921 | Ga0070716_1000169214 | 292 |
| 404 | 3300006237 | Ga0097621_100037577 | Ga0097621_1000375774 | 292 |
| 405 | 3300006358 | Ga0068871_100001258 | Ga0068871_10000125816 | 292 |
| 406 | 3300006844 | Ga0075428_100026999 | Ga0075428_1000269994 | 292 |
| 407 | 3300006871 | Ga0075434_100106670 | Ga0075434_1001066702 | 292 |
| 408 | 3300006881 | Ga0068865_100055160 | Ga0068865_1000551602 | 292 |
| 409 | 3300006931 | Ga0097620_100165723 | Ga0097620_1001657232 | 292 |
| 410 | 3300007076 | Ga0075435_100056666 | Ga0075435_1000566663 | 292 |
| 411 | 3300009094 | Ga0111539_10021504 | Ga0111539_100215044 | 292 |
| 412 | 3300009098 | Ga0105245_10032664 | Ga0105245_100326642 | 292 |
| 413 | 3300009147 | Ga0114129_10107772 | Ga0114129_101077723 | 292 |
| 414 | 3300009148 | Ga0105243_10023802 | Ga0105243_100238024 | 292 |
| 415 | 3300009148 | Ga0105243_10042084 | Ga0105243_100420842 | 292 |
| 416 | 3300009174 | Ga0105241_10013692 | Ga0105241_100136925 | 292 |
| 417 | 3300009176 | Ga0105242_10021530 | Ga0105242_100215304 | 292 |
| 418 | 3300009177 | Ga0105248_10069683 | Ga0105248_100696832 | 292 |
| 419 | 3300009177 | Ga0105248_10145952 | Ga0105248_101459523 | 292 |
| 420 | 3300009551 | Ga0105238_10300031 | Ga0105238_103000312 | 292 |
| 421 | 3300009551 | Ga0105238_10794927 | Ga0105238_107949271 | 292 |
| 422 | 3300010375 | Ga0105239_10053877 | Ga0105239_100538774 | 292 |
| 423 | 3300010375 | Ga0105239_10247291 | Ga0105239_102472912 | 292 |
| 424 | 3300011119 | Ga0105246_10069182 | Ga0105246_100691823 | 292 |
| 425 | 3300011119 | Ga0105246_10104971 | Ga0105246_101049712 | 292 |
| 426 | 3300012492 | Ga0157335_1003426 | Ga0157335_10034261 | 292 |
| 427 | 3300013104 | Ga0157370_10079802 | Ga0157370_100798023 | 292 |
| 428 | 3300013306 | Ga0163162_10066922 | Ga0163162_100669223 | 292 |
| 429 | 3300013308 | Ga0157375_10553561 | Ga0157375_105535612 | 292 |
| 430 | 3300013308 | Ga0157375_10901113 | Ga0157375_109011132 | 292 |
| 431 | 3300014325 | Ga0163163_10001323 | Ga0163163_100013238 | 292 |
| 432 | 3300014745 | Ga0157377_10084022 | Ga0157377_100840222 | 292 |
| 433 | 3300014969 | Ga0157376_10137447 | Ga0157376_101374472 | 292 |
| 434 | 3300017792 | Ga0163161_10053225 | Ga0163161_100532253 | 292 |
| 435 | 3300025898 | Ga0207692_10003912 | Ga0207692_100039123 | 292 |
| 436 | 3300025899 | Ga0207642_10109559 | Ga0207642_101095592 | 292 |
| 437 | 3300025900 | Ga0207710_10021476 | Ga0207710_100214762 | 292 |
| 438 | 3300025903 | Ga0207680_10009820 | Ga0207680_100098203 | 292 |
| 439 | 3300025906 | Ga0207699_10028140 | Ga0207699_100281402 | 292 |
| 440 | 3300025911 | Ga0207654_10006985 | Ga0207654_100069853 | 292 |
| 441 | 3300025914 | Ga0207671_10255924 | Ga0207671_102559242 | 292 |
| 442 | 3300025915 | Ga0207693_10002228 | Ga0207693_1000222814 | 292 |
| 443 | 3300025916 | Ga0207663_10078279 | Ga0207663_100782792 | 292 |
| 444 | 3300025917 | Ga0207660_10207006 | Ga0207660_102070062 | 292 |
| 445 | 3300025917 | Ga0207660_10292993 | Ga0207660_102929932 | 292 |
| 446 | 3300025918 | Ga0207662_10039414 | Ga0207662_100394142 | 292 |
| 447 | 3300025921 | Ga0207652_10064345 | Ga0207652_100643454 | 292 |
| 448 | 3300025924 | Ga0207694_10133397 | Ga0207694_101333972 | 292 |
| 449 | 3300025926 | Ga0207659_10064413 | Ga0207659_100644132 | 292 |
| 450 | 3300025927 | Ga0207687_10119087 | Ga0207687_101190872 | 292 |
| 451 | 3300025928 | Ga0207700_10000896 | Ga0207700_1000089614 | 292 |
| 452 | 3300025929 | Ga0207664_10177899 | Ga0207664_101778992 | 292 |
| 453 | 3300025931 | Ga0207644_10005169 | Ga0207644_100051695 | 292 |
| 454 | 3300025933 | Ga0207706_10061574 | Ga0207706_100615742 | 292 |
| 455 | 3300025933 | Ga0207706_10119157 | Ga0207706_101191572 | 292 |
| 456 | 3300025934 | Ga0207686_10014222 | Ga0207686_100142222 | 292 |
| 457 | 3300025936 | Ga0207670_10082591 | Ga0207670_100825912 | 292 |
| 458 | 3300025938 | Ga0207704_10122644 | Ga0207704_101226442 | 292 |
| 459 | 3300025939 | Ga0207665_10000121 | Ga0207665_100001212 | 292 |
| 460 | 3300025940 | Ga0207691_10216463 | Ga0207691_102164631 | 292 |
| 461 | 3300025941 | Ga0207711_10005315 | Ga0207711_100053153 | 292 |
| 462 | 3300025944 | Ga0207661_10044119 | Ga0207661_100441193 | 292 |
| 463 | 3300025986 | Ga0207658_10188973 | Ga0207658_101889732 | 292 |
| 464 | 3300025986 | Ga0207658_10488222 | Ga0207658_104882222 | 292 |
| 465 | 3300026035 | Ga0207703_10017058 | Ga0207703_100170582 | 292 |
| 466 | 3300026035 | Ga0207703_10085674 | Ga0207703_100856742 | 292 |
| 467 | 3300026067 | Ga0207678_10008025 | Ga0207678_100080254 | 292 |
| 468 | 3300026095 | Ga0207676_10082155 | Ga0207676_100821552 | 292 |
| 469 | 3300026118 | Ga0207675_100095793 | Ga0207675_1000957933 | 292 |
| 470 | 3300026118 | Ga0207675_100415771 | Ga0207675_1004157712 | 292 |
| 471 | 3300026121 | Ga0207683_10000315 | Ga0207683_100003154 | 292 |
| 472 | 3300027876 | Ga0209974_10009950 | Ga0209974_100099501 | 292 |
| 473 | 3300028379 | Ga0268266_10010891 | Ga0268266_100108916 | 292 |
| 474 | 3300028381 | Ga0268264_10014927 | Ga0268264_100149275 | 292 |
| 475 | 3300031235 | Ga0265330_10020096 | Ga0265330_100200962 | 292 |
| 476 | 3300031241 | Ga0265325_10004680 | Ga0265325_100046807 | 292 |
| 477 | 3300031595 | Ga0265313_10006380 | Ga0265313_100063802 | 292 |
| 478 | 3300031711 | Ga0265314_10005091 | Ga0265314_100050917 | 292 |
| 479 | 3300034816 | Ga0373930_0011109 | Ga0373930_0011109_165_1043 | 292 |
| 480 | 3300034819 | Ga0373958_0005918 | Ga0373958_0005918_865_1743 | 292 |
| 481 | 3300035083 | Ga0373926_0031909 | Ga0373926_0031909_605_1483 | 292 |
| 482 | 3300035086 | Ga0373934_0097640 | Ga0373934_0097640_289_1167 | 292 |
| 483 | 3300035089 | Ga0373944_0009061 | Ga0373944_0009061_90_968 | 292 |
| 484 | 3300035090 | Ga0373949_0023566 | Ga0373949_0023566_296_1174 | 292 |
| 485 | 3300035111 | Ga0373923_0007585 | Ga0373923_0007585_2418_3296 | 292 |
| 486 | 3300035111 | Ga0373923_0018854 | Ga0373923_0018854_1703_2581 | 292 |
| 487 | 3300035112 | Ga0373932_0004174 | Ga0373932_0004174_2141_3019 | 292 |
| 488 | 3300035114 | Ga0373939_0001402 | Ga0373939_0001402_1065_1943 | 292 |
| 489 | 3300035115 | Ga0373941_0067480 | Ga0373941_0067480_45_923 | 292 |
| 490 | 3300035116 | Ga0373945_0000454 | Ga0373945_0000454_6548_7426 | 292 |
| 491 | 3300035117 | Ga0373953_0012136 | Ga0373953_0012136_1370_2248 | 292 |
| 492 | 3300035117 | Ga0373953_0035371 | Ga0373953_0035371_117_995 | 292 |
| 493 | 3300035119 | Ga0373956_0039540 | Ga0373956_0039540_175_1053 | 292 |
| 494 | 3300035170 | Ga0373943_0001219 | Ga0373943_0001219_9745_10623 | 292 |
| 495 | 3300035171 | Ga0373946_0037475 | Ga0373946_0037475_936_1814 | 292 |
| 496 | 3300035172 | Ga0373955_0004758 | Ga0373955_0004758_4418_5296 | 292 |
| 497 | 3300035242 | Ga0373962_0007318 | Ga0373962_0007318_1199_2077 | 292 |
| 498 | 3300035410 | Ga0373924_0025619 | Ga0373924_0025619_854_1732 | 292 |
| 499 | 3300035692 | Ga0373935_0011345 | Ga0373935_0011345_398_1276 | 292 |
| 500 | 3300035692 | Ga0373935_0021914 | Ga0373935_0021914_563_1441 | 292 |
| 501 | 3300035692 | Ga0373935_0128687 | Ga0373935_0128687_810_1688 | 292 |
| 502 | 3300035692 | Ga0373935_0179206 | Ga0373935_0179206_535_1413 | 292 |
| 503 | 3300035695 | Ga0373927_0022779 | Ga0373927_0022779_848_1726 | 292 |
| 504 | 3300035695 | Ga0373927_0247466 | Ga0373927_0247466_175_1053 | 292 |
| 505 | 3300035724 | Ga0373933_0076622 | Ga0373933_0076622_72_950 | 292 |
| 506 | 3300035725 | Ga0373947_0008305 | Ga0373947_0008305_1002_1880 | 292 |
| 507 | 3300036401 | Ga0373937_0009394 | Ga0373937_0009394_5152_6030 | 292 |
| 508 | 3300036401 | Ga0373937_0099348 | Ga0373937_0099348_1554_2432 | 292 |
| 509 | 3300037068 | Ga0373925_0005624 | Ga0373925_0005624_7330_8208 | 292 |
| 510 | 3300041408 | Ga0439453_0011520 | Ga0439453_0011520_406_1308 | 292 |
| 511 | 3300042005 | Ga0439448_0006732 | Ga0439448_0006732_2407_3285 | 292 |
| 512 | 3300042008 | Ga0439450_007432 | Ga0439450_007432_119_997 | 292 |
| 513 | 3300042012 | Ga0439455_0002817 | Ga0439455_0002817_1445_2323 | 292 |
| 514 | 3300042439 | Ga0439464_0012069 | Ga0439464_0012069_50_928 | 292 |
| 515 | 3300042461 | Ga0439460_0015178 | Ga0439460_0015178_848_1726 | 292 |
| 516 | 3300042876 | Ga0451577_0173219 | Ga0451577_0173219_931_1809 | 292 |
| 517 | 3300046452 | Ga0495617_008093 | Ga0495617_008093_1490_2368 | 292 |
| 518 | 3300046454 | Ga0495592_0005820 | Ga0495592_0005820_5155_6033 | 292 |
| 519 | 3300046454 | Ga0495592_0026634 | Ga0495592_0026634_2741_3619 | 292 |
| 520 | 3300046455 | Ga0495603_0023812 | Ga0495603_0023812_183_1061 | 292 |
| 521 | 3300046459 | Ga0495629_0048654 | Ga0495629_0048654_1611_2489 | 292 |
| 522 | 3300046459 | Ga0495629_0354468 | Ga0495629_0354468_91_969 | 292 |
| 523 | 3300046462 | Ga0495651_0003705 | Ga0495651_0003705_8301_9179 | 292 |
| 524 | 3300046462 | Ga0495651_0007751 | Ga0495651_0007751_1554_2432 | 292 |
| 525 | 3300046462 | Ga0495651_0179035 | Ga0495651_0179035_522_1400 | 292 |
| 526 | 3300046463 | Ga0495653_0002409 | Ga0495653_0002409_1657_2535 | 292 |
| 527 | 3300046463 | Ga0495653_0027712 | Ga0495653_0027712_3567_4445 | 292 |
| 528 | 3300046463 | Ga0495653_0031307 | Ga0495653_0031307_2134_3012 | 292 |
| 529 | 3300046472 | Ga0495580_0141039 | Ga0495580_0141039_429_1307 | 292 |
| 530 | 3300046475 | Ga0495639_0004750 | Ga0495639_0004750_4466_5344 | 292 |
| 531 | 3300046475 | Ga0495639_0017548 | Ga0495639_0017548_669_1547 | 292 |
| 532 | 3300046476 | Ga0495662_0011745 | Ga0495662_0011745_176_1054 | 292 |
| 533 | 3300046477 | Ga0495664_0009343 | Ga0495664_0009343_2797_3675 | 292 |
| 534 | 3300046477 | Ga0495664_0032247 | Ga0495664_0032247_1380_2258 | 292 |
| 535 | 3300046477 | Ga0495664_0038584 | Ga0495664_0038584_1388_2266 | 292 |
| 536 | 3300046491 | Ga0495584_0112568 | Ga0495584_0112568_361_1239 | 292 |
| 537 | 3300046492 | Ga0495585_0000631 | Ga0495585_0000631_21899_22777 | 292 |
| 538 | 3300046499 | Ga0495594_0089221 | Ga0495594_0089221_468_1346 | 292 |
| 539 | 3300046499 | Ga0495594_0112523 | Ga0495594_0112523_256_1134 | 292 |
| 540 | 3300046501 | Ga0495607_0019819 | Ga0495607_0019819_2261_3139 | 292 |
| 541 | 3300046511 | Ga0495608_0001510 | Ga0495608_0001510_14260_15138 | 292 |
| 542 | 3300046511 | Ga0495608_0028110 | Ga0495608_0028110_2515_3393 | 292 |
| 543 | 3300046514 | Ga0495618_0001563 | Ga0495618_0001563_12669_13547 | 292 |
| 544 | 3300046516 | Ga0495628_0024355 | Ga0495628_0024355_3606_4484 | 292 |
| 545 | 3300046516 | Ga0495628_0031998 | Ga0495628_0031998_268_1146 | 292 |
| 546 | 3300046517 | Ga0495630_0182896 | Ga0495630_0182896_292_1170 | 292 |
| 547 | 3300046520 | Ga0495637_0025228 | Ga0495637_0025228_830_1708 | 292 |
| 548 | 3300046523 | Ga0495644_0000752 | Ga0495644_0000752_2496_3374 | 292 |
| 549 | 3300046525 | Ga0495663_0005915 | Ga0495663_0005915_24_902 | 292 |
| 550 | 3300046529 | Ga0495652_0004105 | Ga0495652_0004105_11321_12199 | 292 |
| 551 | 3300046529 | Ga0495652_0013609 | Ga0495652_0013609_583_1461 | 292 |
| 552 | 3300046529 | Ga0495652_0176099 | Ga0495652_0176099_218_1096 | 292 |
| 553 | 3300046531 | Ga0495665_0008272 | Ga0495665_0008272_1405_2283 | 292 |
| 554 | 3300046533 | Ga0495640_0011139 | Ga0495640_0011139_3263_4141 | 292 |
| 555 | 3300046533 | Ga0495640_0057280 | Ga0495640_0057280_351_1229 | 292 |
| 556 | 3300046535 | Ga0495586_0071708 | Ga0495586_0071708_609_1487 | 292 |
| 557 | 3300046537 | Ga0495598_0002749 | Ga0495598_0002749_1713_2591 | 292 |
| 558 | 3300046543 | Ga0495645_0001517 | Ga0495645_0001517_10301_11179 | 292 |
| 559 | 3300046559 | Ga0495667_0003144 | Ga0495667_0003144_5265_6143 | 292 |
| 560 | 3300046559 | Ga0495667_0005312 | Ga0495667_0005312_7206_8084 | 292 |
| 561 | 3300046559 | Ga0495667_0042526 | Ga0495667_0042526_770_1648 | 292 |
| 562 | 3300046615 | Ga0495656_0004899 | Ga0495656_0004899_2124_3002 | 292 |
| 563 | 3300046642 | Ga0495634_0030035 | Ga0495634_0030035_1065_1943 | 292 |
| 564 | 3300046648 | Ga0495611_0002973 | Ga0495611_0002973_2547_3425 | 292 |
| 565 | 3300046663 | Ga0495635_0001408 | Ga0495635_0001408_1829_2707 | 292 |
| 566 | 3300046663 | Ga0495635_0027974 | Ga0495635_0027974_2776_3654 | 292 |
| 567 | 3300046663 | Ga0495635_0039010 | Ga0495635_0039010_1800_2678 | 292 |
| 568 | 3300046663 | Ga0495635_0049978 | Ga0495635_0049978_1437_2315 | 292 |
| 569 | 3300046664 | Ga0495659_0000882 | Ga0495659_0000882_1294_2172 | 292 |
| 570 | 3300046665 | Ga0495661_0048852 | Ga0495661_0048852_907_1785 | 292 |
| 571 | 3300046674 | Ga0495588_0024242 | Ga0495588_0024242_1252_2130 | 292 |
| 572 | 3300046675 | Ga0495657_0001888 | Ga0495657_0001888_4735_5613 | 292 |
| 573 | 3300046675 | Ga0495657_0044338 | Ga0495657_0044338_815_1693 | 292 |
| 574 | 3300046678 | Ga0495599_0020358 | Ga0495599_0020358_960_1838 | 292 |
| 575 | 3300046678 | Ga0495599_0021313 | Ga0495599_0021313_2486_3364 | 292 |
| 576 | 3300046678 | Ga0495599_0223400 | Ga0495599_0223400_83_961 | 292 |
| 577 | 3300046679 | Ga0495623_0012554 | Ga0495623_0012554_1779_2657 | 292 |
| 578 | 3300046679 | Ga0495623_0016072 | Ga0495623_0016072_1217_2095 | 292 |
| 579 | 3300046680 | Ga0495646_0010421 | Ga0495646_0010421_3480_4358 | 292 |
| 580 | 3300046680 | Ga0495646_0011661 | Ga0495646_0011661_4072_4950 | 292 |
| 581 | 3300046680 | Ga0495646_0185981 | Ga0495646_0185981_153_1031 | 292 |
| 582 | 3300046683 | Ga0495658_0000560 | Ga0495658_0000560_1663_2541 | 292 |
| 583 | 3300046683 | Ga0495658_0009422 | Ga0495658_0009422_1572_2450 | 292 |
| 584 | 3300046689 | Ga0495613_0003541 | Ga0495613_0003541_962_1840 | 292 |
| 585 | 3300046691 | Ga0495670_0000125 | Ga0495670_0000125_11357_12235 | 292 |
| 586 | 3300046809 | Ga0495600_0007601 | Ga0495600_0007601_402_1280 | 292 |
| 587 | 3300046809 | Ga0495600_0148049 | Ga0495600_0148049_484_1362 | 292 |
| 588 | 3300047317 | Ga0495604_0008243 | Ga0495604_0008243_3526_4404 | 292 |
| 589 | 3300047317 | Ga0495604_0019908 | Ga0495604_0019908_2988_3866 | 292 |
| 590 | 3300047319 | Ga0495674_0012627 | Ga0495674_0012627_6498_7376 | 292 |
| 591 | 3300047319 | Ga0495674_0029944 | Ga0495674_0029944_3460_4338 | 292 |
| 592 | 3300047321 | Ga0495676_0021858 | Ga0495676_0021858_2602_3480 | 292 |
| 593 | 3300047321 | Ga0495676_0073772 | Ga0495676_0073772_1193_2071 | 292 |
| 594 | 3300047322 | Ga0495680_0004412 | Ga0495680_0004412_2277_3155 | 292 |
| 595 | 3300047322 | Ga0495680_0014033 | Ga0495680_0014033_484_1362 | 292 |
| 596 | 3300047322 | Ga0495680_0021068 | Ga0495680_0021068_1119_1997 | 292 |
| 597 | 3300047322 | Ga0495680_0023630 | Ga0495680_0023630_1002_1880 | 292 |
| 598 | 3300047444 | Ga0495675_0045223 | Ga0495675_0045223_268_1146 | 292 |
| 599 | 3300047471 | Ga0495684_0031787 | Ga0495684_0031787_3015_3893 | 292 |
| 600 | 3300048088 | Ga0495602_0003131 | Ga0495602_0003131_5267_6145 | 292 |
| 601 | 3300048088 | Ga0495602_0005133 | Ga0495602_0005133_8121_8999 | 292 |
| 602 | 3300048904 | Ga0496101_0016287 | Ga0496101_0016287_3854_4732 | 292 |
| 603 | 3300048905 | Ga0496102_0120570 | Ga0496102_0120570_1191_2069 | 292 |
| 604 | 3300048905 | Ga0496102_0124734 | Ga0496102_0124734_988_1866 | 292 |
| 605 | 3300048906 | Ga0496103_0032797 | Ga0496103_0032797_1471_2349 | 292 |
| 606 | 3300048906 | Ga0496103_0054408 | Ga0496103_0054408_615_1493 | 292 |
| 607 | 3300048907 | Ga0496104_0017252 | Ga0496104_0017252_3140_4018 | 292 |
| 608 | 3300048907 | Ga0496104_0036930 | Ga0496104_0036930_2799_3677 | 292 |
| 609 | 3300048907 | Ga0496104_0237212 | Ga0496104_0237212_326_1204 | 292 |
| 610 | 3300048908 | Ga0496105_0065812 | Ga0496105_0065812_1912_2790 | 292 |
| 611 | 3300048911 | Ga0496108_0007233 | Ga0496108_0007233_7706_8584 | 292 |
| 612 | 3300048911 | Ga0496108_0036082 | Ga0496108_0036082_541_1419 | 292 |
| 613 | 3300048912 | Ga0496109_0033630 | Ga0496109_0033630_958_1836 | 292 |
| 614 | 3300048912 | Ga0496109_0073983 | Ga0496109_0073983_947_1825 | 292 |
| 615 | 3300048912 | Ga0496109_0161909 | Ga0496109_0161909_678_1556 | 292 |
| 616 | 3300048913 | Ga0496110_0161757 | Ga0496110_0161757_1019_1897 | 292 |
| 617 | 3300048914 | Ga0496111_0024889 | Ga0496111_0024889_494_1372 | 292 |
| 618 | 3300048915 | Ga0496112_0031930 | Ga0496112_0031930_946_1824 | 292 |
| 619 | 3300048915 | Ga0496112_0115532 | Ga0496112_0115532_1316_2194 | 292 |
| 620 | 3300048916 | Ga0496113_0016310 | Ga0496113_0016310_1579_2457 | 292 |
| 621 | 3300048916 | Ga0496113_0311313 | Ga0496113_0311313_241_1119 | 292 |
| 622 | 3300048917 | Ga0496114_0054803 | Ga0496114_0054803_2410_3288 | 292 |
| 623 | 3300048918 | Ga0496115_0047193 | Ga0496115_0047193_1763_2641 | 292 |
| 624 | 3300048918 | Ga0496115_0095942 | Ga0496115_0095942_1011_1889 | 292 |
| 625 | 3300049587 | Ga0501071_0110680 | Ga0501071_0110680_325_1203 | 292 |
| 626 | 3300049592 | Ga0501076_0210122 | Ga0501076_0210122_678_1556 | 292 |
| 627 | 3300049593 | Ga0501077_0048973 | Ga0501077_0048973_1120_1998 | 292 |
| 628 | 3300049742 | Ga0501080_0501111 | Ga0501080_0501111_65_943 | 292 |
| 629 | 3300049743 | Ga0501081_0062078 | Ga0501081_0062078_1385_2263 | 292 |
| 630 | 3300050496 | nmdc:mga07m45_214620_c1 | nmdc:mga07m45_214620_c1_207_1085 | 292 |
| 631 | 3300050507 | nmdc:mga05p37_501_c1 | nmdc:mga05p37_501_c1_17934_18812 | 292 |
| 632 | 3300050508 | nmdc:mga09592_1023_c1 | nmdc:mga09592_1023_c1_12459_13337 | 292 |
| 633 | 3300050509 | nmdc:mga0qj67_713_c1 | nmdc:mga0qj67_713_c1_3784_4662 | 292 |
| 634 | 3300050510 | nmdc:mga06r32_14313_c1 | nmdc:mga06r32_14313_c1_2619_3497 | 292 |
| 635 | 3300050512 | nmdc:mga0n895_184325_c1 | nmdc:mga0n895_184325_c1_476_1354 | 292 |
| 636 | 3300050512 | nmdc:mga0n895_18888_c1 | nmdc:mga0n895_18888_c1_3036_3914 | 292 |
| 637 | 3300050513 | nmdc:mga0rr50_428034_c1 | nmdc:mga0rr50_428034_c1_178_1056 | 292 |
| 638 | 3300050513 | nmdc:mga0rr50_762_c1 | nmdc:mga0rr50_762_c1_12729_13607 | 292 |
| 639 | 3300050514 | nmdc:mga08x19_94011_c1 | nmdc:mga08x19_94011_c1_120_998 | 292 |
| 640 | 3300050515 | nmdc:mga0a205_2136_c1 | nmdc:mga0a205_2136_c1_6897_7775 | 292 |
| 641 | 3300050515 | nmdc:mga0a205_71054_c1 | nmdc:mga0a205_71054_c1_1888_2766 | 292 |
| 642 | 3300053077 | Ga0495601_0019095 | Ga0495601_0019095_1588_2466 | 292 |
| 643 | 3300053077 | Ga0495601_0136256 | Ga0495601_0136256_583_1461 | 292 |
| 644 | 3300053078 | Ga0495612_0000494 | Ga0495612_0000494_14236_15114 | 292 |
| 645 | 3300053078 | Ga0495612_0001786 | Ga0495612_0001786_3445_4323 | 292 |
| 646 | 3300053078 | Ga0495612_0004081 | Ga0495612_0004081_242_1120 | 292 |
| 647 | 3300053084 | Ga0495595_0002176 | Ga0495595_0002176_5219_6097 | 292 |
| 648 | 3300053084 | Ga0495595_0002965 | Ga0495595_0002965_2958_3836 | 292 |
| 649 | 3300053085 | Ga0495619_0000150 | Ga0495619_0000150_6559_7437 | 292 |
| 650 | 3300053085 | Ga0495619_0000189 | Ga0495619_0000189_26880_27758 | 292 |
| 651 | 3300053085 | Ga0495619_0009544 | Ga0495619_0009544_4754_5632 | 292 |
| 652 | 3300053085 | Ga0495619_0037058 | Ga0495619_0037058_617_1495 | 292 |
| 653 | 3300060353 | Ga0501082_0116320 | Ga0501082_0116320_1307_2185 | 292 |
| 654 | 2209111006 | 2214600503 | 2213637959 | 293 |
| 655 | 3300000042 | ARSoilYngRDRAFT_c00164 | ARSoilYngRDRAFT_001643 | 293 |
| 656 | 3300000043 | ARcpr5yngRDRAFT_c000009 | ARcpr5yngRDRAFT_0000095 | 293 |
| 657 | 3300000044 | ARSoilOldRDRAFT_c000036 | ARSoilOldRDRAFT_00003610 | 293 |
| 658 | 3300000045 | ARCol0oldRDRAFT_c01030 | ARCol0oldRDRAFT_010302 | 293 |
| 659 | 3300000652 | ARCol0yngRDRAFT_1000061 | ARCol0yngRDRAFT_100006119 | 293 |
| 660 | 3300001430 | JGI24032J14994_100521 | JGI24032J14994_1005212 | 293 |
| 661 | 3300001977 | JGI24746J21847_1001326 | JGI24746J21847_10013263 | 293 |
| 662 | 3300001989 | JGI24739J22299_10000090 | JGI24739J22299_100000903 | 293 |
| 663 | 3300001990 | JGI24737J22298_10000277 | JGI24737J22298_1000027712 | 293 |
| 664 | 3300001990 | JGI24737J22298_10009651 | JGI24737J22298_100096512 | 293 |
| 665 | 3300002070 | JGI24750J21931_1000109 | JGI24750J21931_10001094 | 293 |
| 666 | 3300002073 | JGI24745J21846_1000842 | JGI24745J21846_10008422 | 293 |
| 667 | 3300002074 | JGI24748J21848_1001050 | JGI24748J21848_10010503 | 293 |
| 668 | 3300002075 | JGI24738J21930_10000613 | JGI24738J21930_100006134 | 293 |
| 669 | 3300002076 | JGI24749J21850_1003135 | JGI24749J21850_10031352 | 293 |
| 670 | 3300002155 | JGI24033J26618_1000507 | JGI24033J26618_10005073 | 293 |
| 671 | 3300002239 | JGI24034J26672_10000125 | JGI24034J26672_100001253 | 293 |
| 672 | 3300002244 | JGI24742J22300_10000021 | JGI24742J22300_1000002121 | 293 |
| 673 | 3300005276 | Ga0065717_1003026 | Ga0065717_10030261 | 293 |
| 674 | 3300005277 | Ga0065716_1003269 | Ga0065716_10032692 | 293 |
| 675 | 3300005289 | Ga0065704_10107884 | Ga0065704_101078842 | 293 |
| 676 | 3300005290 | Ga0065712_10083478 | Ga0065712_100834782 | 293 |
| 677 | 3300005293 | Ga0065715_10000367 | Ga0065715_100003671 | 293 |
| 678 | 3300005293 | Ga0065715_10092263 | Ga0065715_100922632 | 293 |
| 679 | 3300005328 | Ga0070676_10000016 | Ga0070676_100000168 | 293 |
| 680 | 3300005329 | Ga0070683_100000075 | Ga0070683_10000007517 | 293 |
| 681 | 3300005330 | Ga0070690_100000613 | Ga0070690_10000061317 | 293 |
| 682 | 3300005331 | Ga0070670_100003634 | Ga0070670_1000036344 | 293 |
| 683 | 3300005333 | Ga0070677_10000005 | Ga0070677_1000000514 | 293 |
| 684 | 3300005334 | Ga0068869_100000395 | Ga0068869_10000039515 | 293 |
| 685 | 3300005336 | Ga0070680_100002358 | Ga0070680_1000023588 | 293 |
| 686 | 3300005336 | Ga0070680_100017800 | Ga0070680_1000178003 | 293 |
| 687 | 3300005337 | Ga0070682_100000144 | Ga0070682_10000014426 | 293 |
| 688 | 3300005338 | Ga0068868_100001156 | Ga0068868_10000115613 | 293 |
| 689 | 3300005339 | Ga0070660_100000153 | Ga0070660_1000001537 | 293 |
| 690 | 3300005339 | Ga0070660_100031463 | Ga0070660_1000314633 | 293 |
| 691 | 3300005340 | Ga0070689_100000388 | Ga0070689_10000038817 | 293 |
| 692 | 3300005340 | Ga0070689_100047722 | Ga0070689_1000477223 | 293 |
| 693 | 3300005341 | Ga0070691_10000030 | Ga0070691_100000304 | 293 |
| 694 | 3300005343 | Ga0070687_100000016 | Ga0070687_10000001624 | 293 |
| 695 | 3300005344 | Ga0070661_100000249 | Ga0070661_10000024924 | 293 |
| 696 | 3300005345 | Ga0070692_10000030 | Ga0070692_1000003012 | 293 |
| 697 | 3300005347 | Ga0070668_100000313 | Ga0070668_10000031311 | 293 |
| 698 | 3300005353 | Ga0070669_100000145 | Ga0070669_10000014516 | 293 |
| 699 | 3300005354 | Ga0070675_100000081 | Ga0070675_10000008124 | 293 |
| 700 | 3300005354 | Ga0070675_100019957 | Ga0070675_1000199574 | 293 |
| 701 | 3300005355 | Ga0070671_100000144 | Ga0070671_10000014431 | 293 |
| 702 | 3300005356 | Ga0070674_100000102 | Ga0070674_10000010222 | 293 |
| 703 | 3300005356 | Ga0070674_100043433 | Ga0070674_1000434333 | 293 |
| 704 | 3300005364 | Ga0070673_100000068 | Ga0070673_10000006813 | 293 |
| 705 | 3300005365 | Ga0070688_100000075 | Ga0070688_10000007539 | 293 |
| 706 | 3300005365 | Ga0070688_100008232 | Ga0070688_1000082323 | 293 |
| 707 | 3300005366 | Ga0070659_100000144 | Ga0070659_10000014424 | 293 |
| 708 | 3300005367 | Ga0070667_100006227 | Ga0070667_1000062275 | 293 |
| 709 | 3300005434 | Ga0070709_10121245 | Ga0070709_101212452 | 293 |
| 710 | 3300005438 | Ga0070701_10000459 | Ga0070701_100004599 | 293 |
| 711 | 3300005440 | Ga0070705_100000222 | Ga0070705_10000022220 | 293 |
| 712 | 3300005441 | Ga0070700_100000100 | Ga0070700_10000010024 | 293 |
| 713 | 3300005444 | Ga0070694_100000041 | Ga0070694_10000004136 | 293 |
| 714 | 3300005445 | Ga0070708_100008092 | Ga0070708_1000080925 | 293 |
| 715 | 3300005455 | Ga0070663_100000071 | Ga0070663_10000007124 | 293 |
| 716 | 3300005456 | Ga0070678_100000093 | Ga0070678_1000000939 | 293 |
| 717 | 3300005457 | Ga0070662_100030898 | Ga0070662_1000308983 | 293 |
| 718 | 3300005457 | Ga0070662_100083590 | Ga0070662_1000835902 | 293 |
| 719 | 3300005458 | Ga0070681_10000485 | Ga0070681_100004853 | 293 |
| 720 | 3300005458 | Ga0070681_10049358 | Ga0070681_100493582 | 293 |
| 721 | 3300005458 | Ga0070681_10097074 | Ga0070681_100970741 | 293 |
| 722 | 3300005459 | Ga0068867_100000718 | Ga0068867_1000007185 | 293 |
| 723 | 3300005466 | Ga0070685_10002733 | Ga0070685_100027333 | 293 |
| 724 | 3300005518 | Ga0070699_100386677 | Ga0070699_1003866772 | 293 |
| 725 | 3300005530 | Ga0070679_100002029 | Ga0070679_1000020298 | 293 |
| 726 | 3300005535 | Ga0070684_100000099 | Ga0070684_10000009922 | 293 |
| 727 | 3300005535 | Ga0070684_100308344 | Ga0070684_1003083441 | 293 |
| 728 | 3300005536 | Ga0070697_100071854 | Ga0070697_1000718543 | 293 |
| 729 | 3300005536 | Ga0070697_100275093 | Ga0070697_1002750931 | 293 |
| 730 | 3300005539 | Ga0068853_100000996 | Ga0068853_1000009968 | 293 |
| 731 | 3300005543 | Ga0070672_100000035 | Ga0070672_10000003531 | 293 |
| 732 | 3300005544 | Ga0070686_100000086 | Ga0070686_10000008625 | 293 |
| 733 | 3300005544 | Ga0070686_100012306 | Ga0070686_1000123062 | 293 |
| 734 | 3300005545 | Ga0070695_100000036 | Ga0070695_10000003624 | 293 |
| 735 | 3300005545 | Ga0070695_100036231 | Ga0070695_1000362312 | 293 |
| 736 | 3300005546 | Ga0070696_100000638 | Ga0070696_10000063813 | 293 |
| 737 | 3300005547 | Ga0070693_100000224 | Ga0070693_1000002247 | 293 |
| 738 | 3300005547 | Ga0070693_100092093 | Ga0070693_1000920932 | 293 |
| 739 | 3300005547 | Ga0070693_100100436 | Ga0070693_1001004362 | 293 |
| 740 | 3300005548 | Ga0070665_100081580 | Ga0070665_1000815802 | 293 |
| 741 | 3300005549 | Ga0070704_100000047 | Ga0070704_10000004713 | 293 |
| 742 | 3300005549 | Ga0070704_100012704 | Ga0070704_1000127042 | 293 |
| 743 | 3300005563 | Ga0068855_100003282 | Ga0068855_1000032828 | 293 |
| 744 | 3300005564 | Ga0070664_100000480 | Ga0070664_10000048020 | 293 |
| 745 | 3300005564 | Ga0070664_100065123 | Ga0070664_1000651233 | 293 |
| 746 | 3300005577 | Ga0068857_100000122 | Ga0068857_10000012237 | 293 |
| 747 | 3300005578 | Ga0068854_100000410 | Ga0068854_10000041026 | 293 |
| 748 | 3300005614 | Ga0068856_100001156 | Ga0068856_10000115620 | 293 |
| 749 | 3300005614 | Ga0068856_100121593 | Ga0068856_1001215934 | 293 |
| 750 | 3300005615 | Ga0070702_100000118 | Ga0070702_10000011816 | 293 |
| 751 | 3300005616 | Ga0068852_100000344 | Ga0068852_10000034416 | 293 |
| 752 | 3300005617 | Ga0068859_100008948 | Ga0068859_1000089483 | 293 |
| 753 | 3300005617 | Ga0068859_100089254 | Ga0068859_1000892543 | 293 |
| 754 | 3300005618 | Ga0068864_100000271 | Ga0068864_10000027137 | 293 |
| 755 | 3300005618 | Ga0068864_100297168 | Ga0068864_1002971682 | 293 |
| 756 | 3300005718 | Ga0068866_10000213 | Ga0068866_100002133 | 293 |
| 757 | 3300005718 | Ga0068866_10072773 | Ga0068866_100727731 | 293 |
| 758 | 3300005719 | Ga0068861_100003560 | Ga0068861_1000035603 | 293 |
| 759 | 3300005834 | Ga0068851_10013188 | Ga0068851_100131883 | 293 |
| 760 | 3300005840 | Ga0068870_10000079 | Ga0068870_1000007929 | 293 |
| 761 | 3300005841 | Ga0068863_100000372 | Ga0068863_1000003725 | 293 |
| 762 | 3300005842 | Ga0068858_100000809 | Ga0068858_10000080929 | 293 |
| 763 | 3300005842 | Ga0068858_100124847 | Ga0068858_1001248472 | 293 |
| 764 | 3300005843 | Ga0068860_100000709 | Ga0068860_1000007096 | 293 |
| 765 | 3300005844 | Ga0068862_100000512 | Ga0068862_1000005125 | 293 |
| 766 | 3300005844 | Ga0068862_100042240 | Ga0068862_1000422403 | 293 |
| 767 | 3300005937 | Ga0081455_10008617 | Ga0081455_100086178 | 293 |
| 768 | 3300006194 | Ga0075427_10000166 | Ga0075427_100001664 | 293 |
| 769 | 3300006237 | Ga0097621_100000047 | Ga0097621_10000004717 | 293 |
| 770 | 3300006237 | Ga0097621_100022075 | Ga0097621_1000220754 | 293 |
| 771 | 3300006358 | Ga0068871_100000518 | Ga0068871_1000005185 | 293 |
| 772 | 3300006358 | Ga0068871_100036701 | Ga0068871_1000367014 | 293 |
| 773 | 3300006846 | Ga0075430_100001945 | Ga0075430_1000019454 | 293 |
| 774 | 3300006847 | Ga0075431_100001208 | Ga0075431_1000012085 | 293 |
| 775 | 3300006852 | Ga0075433_10000495 | Ga0075433_100004954 | 293 |
| 776 | 3300006852 | Ga0075433_10029599 | Ga0075433_100295994 | 293 |
| 777 | 3300006871 | Ga0075434_100000362 | Ga0075434_10000036216 | 293 |
| 778 | 3300006871 | Ga0075434_100001759 | Ga0075434_10000175912 | 293 |
| 779 | 3300006880 | Ga0075429_100002672 | Ga0075429_1000026725 | 293 |
| 780 | 3300006881 | Ga0068865_100000233 | Ga0068865_10000023314 | 293 |
| 781 | 3300006881 | Ga0068865_100233633 | Ga0068865_1002336332 | 293 |
| 782 | 3300006931 | Ga0097620_100008949 | Ga0097620_1000089493 | 293 |
| 783 | 3300006931 | Ga0097620_100089262 | Ga0097620_1000892623 | 293 |
| 784 | 3300009036 | Ga0105244_10021503 | Ga0105244_100215033 | 293 |
| 785 | 3300009092 | Ga0105250_10075969 | Ga0105250_100759692 | 293 |
| 786 | 3300009093 | Ga0105240_10017644 | Ga0105240_100176447 | 293 |
| 787 | 3300009094 | Ga0111539_10000185 | Ga0111539_1000018519 | 293 |
| 788 | 3300009094 | Ga0111539_10002902 | Ga0111539_100029024 | 293 |
| 789 | 3300009098 | Ga0105245_10000213 | Ga0105245_1000021337 | 293 |
| 790 | 3300009101 | Ga0105247_10000547 | Ga0105247_100005478 | 293 |
| 791 | 3300009148 | Ga0105243_10000175 | Ga0105243_1000017521 | 293 |
| 792 | 3300009148 | Ga0105243_10078290 | Ga0105243_100782903 | 293 |
| 793 | 3300009174 | Ga0105241_10000261 | Ga0105241_1000026123 | 293 |
| 794 | 3300009174 | Ga0105241_10046034 | Ga0105241_100460344 | 293 |
| 795 | 3300009176 | Ga0105242_10000170 | Ga0105242_100001706 | 293 |
| 796 | 3300009177 | Ga0105248_10003502 | Ga0105248_100035026 | 293 |
| 797 | 3300009545 | Ga0105237_10001448 | Ga0105237_100014487 | 293 |
| 798 | 3300009545 | Ga0105237_10043307 | Ga0105237_100433073 | 293 |
| 799 | 3300009553 | Ga0105249_10000200 | Ga0105249_1000020016 | 293 |
| 800 | 3300010375 | Ga0105239_10000834 | Ga0105239_100008345 | 293 |
| 801 | 3300011119 | Ga0105246_10000050 | Ga0105246_100000504 | 293 |
| 802 | 3300011119 | Ga0105246_10264170 | Ga0105246_102641701 | 293 |
| 803 | 3300012507 | Ga0157342_1001628 | Ga0157342_10016282 | 293 |
| 804 | 3300013102 | Ga0157371_10004767 | Ga0157371_100047671 | 293 |
| 805 | 3300013296 | Ga0157374_10016814 | Ga0157374_100168144 | 293 |
| 806 | 3300013297 | Ga0157378_10000717 | Ga0157378_100007171 | 293 |
| 807 | 3300013306 | Ga0163162_10000222 | Ga0163162_100002228 | 293 |
| 808 | 3300013306 | Ga0163162_10008882 | Ga0163162_100088823 | 293 |
| 809 | 3300013307 | Ga0157372_10001555 | Ga0157372_100015553 | 293 |
| 810 | 3300013308 | Ga0157375_10000355 | Ga0157375_1000035520 | 293 |
| 811 | 3300014325 | Ga0163163_10004121 | Ga0163163_1000412112 | 293 |
| 812 | 3300014326 | Ga0157380_10000166 | Ga0157380_1000016617 | 293 |
| 813 | 3300014326 | Ga0157380_10082205 | Ga0157380_100822053 | 293 |
| 814 | 3300014745 | Ga0157377_10000207 | Ga0157377_100002073 | 293 |
| 815 | 3300014968 | Ga0157379_10000036 | Ga0157379_1000003641 | 293 |
| 816 | 3300014969 | Ga0157376_10000062 | Ga0157376_1000006220 | 293 |
| 817 | 3300017792 | Ga0163161_10000363 | Ga0163161_100003634 | 293 |
| 818 | 3300025271 | Ga0207666_1000029 | Ga0207666_100002919 | 293 |
| 819 | 3300025290 | Ga0207673_1000443 | Ga0207673_10004432 | 293 |
| 820 | 3300025315 | Ga0207697_10000208 | Ga0207697_100002083 | 293 |
| 821 | 3300025315 | Ga0207697_10017795 | Ga0207697_100177953 | 293 |
| 822 | 3300025321 | Ga0207656_10011445 | Ga0207656_100114453 | 293 |
| 823 | 3300025893 | Ga0207682_10000004 | Ga0207682_1000000476 | 293 |
| 824 | 3300025899 | Ga0207642_10000556 | Ga0207642_100005562 | 293 |
| 825 | 3300025900 | Ga0207710_10003459 | Ga0207710_100034594 | 293 |
| 826 | 3300025901 | Ga0207688_10000042 | Ga0207688_1000004241 | 293 |
| 827 | 3300025903 | Ga0207680_10002676 | Ga0207680_100026763 | 293 |
| 828 | 3300025904 | Ga0207647_10033344 | Ga0207647_100333443 | 293 |
| 829 | 3300025907 | Ga0207645_10000061 | Ga0207645_1000006145 | 293 |
| 830 | 3300025908 | Ga0207643_10000012 | Ga0207643_10000012104 | 293 |
| 831 | 3300025911 | Ga0207654_10015120 | Ga0207654_100151204 | 293 |
| 832 | 3300025912 | Ga0207707_10000405 | Ga0207707_1000040519 | 293 |
| 833 | 3300025913 | Ga0207695_10062614 | Ga0207695_100626143 | 293 |
| 834 | 3300025914 | Ga0207671_10010683 | Ga0207671_100106833 | 293 |
| 835 | 3300025916 | Ga0207663_10338010 | Ga0207663_103380101 | 293 |
| 836 | 3300025917 | Ga0207660_10000008 | Ga0207660_1000000816 | 293 |
| 837 | 3300025918 | Ga0207662_10027345 | Ga0207662_100273452 | 293 |
| 838 | 3300025919 | Ga0207657_10034735 | Ga0207657_100347352 | 293 |
| 839 | 3300025919 | Ga0207657_10058101 | Ga0207657_100581013 | 293 |
| 840 | 3300025919 | Ga0207657_10058127 | Ga0207657_100581273 | 293 |
| 841 | 3300025920 | Ga0207649_10000099 | Ga0207649_100000993 | 293 |
| 842 | 3300025921 | Ga0207652_10005026 | Ga0207652_100050266 | 293 |
| 843 | 3300025921 | Ga0207652_10068951 | Ga0207652_100689512 | 293 |
| 844 | 3300025921 | Ga0207652_10116932 | Ga0207652_101169322 | 293 |
| 845 | 3300025923 | Ga0207681_10000141 | Ga0207681_1000014144 | 293 |
| 846 | 3300025925 | Ga0207650_10003620 | Ga0207650_100036205 | 293 |
| 847 | 3300025926 | Ga0207659_10000023 | Ga0207659_1000002316 | 293 |
| 848 | 3300025926 | Ga0207659_10047227 | Ga0207659_100472272 | 293 |
| 849 | 3300025927 | Ga0207687_10001943 | Ga0207687_100019435 | 293 |
| 850 | 3300025928 | Ga0207700_10057161 | Ga0207700_100571613 | 293 |
| 851 | 3300025931 | Ga0207644_10000286 | Ga0207644_100002865 | 293 |
| 852 | 3300025931 | Ga0207644_10014489 | Ga0207644_100144894 | 293 |
| 853 | 3300025932 | Ga0207690_10000105 | Ga0207690_1000010522 | 293 |
| 854 | 3300025933 | Ga0207706_10000438 | Ga0207706_1000043841 | 293 |
| 855 | 3300025934 | Ga0207686_10000140 | Ga0207686_100001408 | 293 |
| 856 | 3300025935 | Ga0207709_10000264 | Ga0207709_1000026427 | 293 |
| 857 | 3300025935 | Ga0207709_10059227 | Ga0207709_100592272 | 293 |
| 858 | 3300025936 | Ga0207670_10000108 | Ga0207670_1000010837 | 293 |
| 859 | 3300025937 | Ga0207669_10000110 | Ga0207669_100001103 | 293 |
| 860 | 3300025938 | Ga0207704_10000171 | Ga0207704_1000017126 | 293 |
| 861 | 3300025939 | Ga0207665_10152428 | Ga0207665_101524282 | 293 |
| 862 | 3300025940 | Ga0207691_10001221 | Ga0207691_100012212 | 293 |
| 863 | 3300025941 | Ga0207711_10003268 | Ga0207711_100032685 | 293 |
| 864 | 3300025941 | Ga0207711_10022702 | Ga0207711_100227022 | 293 |
| 865 | 3300025942 | Ga0207689_10000008 | Ga0207689_1000000890 | 293 |
| 866 | 3300025944 | Ga0207661_10000053 | Ga0207661_1000005316 | 293 |
| 867 | 3300025945 | Ga0207679_10000053 | Ga0207679_1000005379 | 293 |
| 868 | 3300025949 | Ga0207667_10095126 | Ga0207667_100951263 | 293 |
| 869 | 3300025949 | Ga0207667_10119092 | Ga0207667_101190922 | 293 |
| 870 | 3300025960 | Ga0207651_10000052 | Ga0207651_1000005226 | 293 |
| 871 | 3300025960 | Ga0207651_10005685 | Ga0207651_100056854 | 293 |
| 872 | 3300025961 | Ga0207712_10000317 | Ga0207712_1000031720 | 293 |
| 873 | 3300025972 | Ga0207668_10000160 | Ga0207668_1000016037 | 293 |
| 874 | 3300025981 | Ga0207640_10000232 | Ga0207640_1000023216 | 293 |
| 875 | 3300025986 | Ga0207658_10000890 | Ga0207658_1000089023 | 293 |
| 876 | 3300026023 | Ga0207677_10001309 | Ga0207677_100013092 | 293 |
| 877 | 3300026035 | Ga0207703_10006598 | Ga0207703_100065982 | 293 |
| 878 | 3300026041 | Ga0207639_10003340 | Ga0207639_100033404 | 293 |
| 879 | 3300026067 | Ga0207678_10000185 | Ga0207678_100001852 | 293 |
| 880 | 3300026067 | Ga0207678_10125249 | Ga0207678_101252492 | 293 |
| 881 | 3300026075 | Ga0207708_10045698 | Ga0207708_100456983 | 293 |
| 882 | 3300026075 | Ga0207708_10050476 | Ga0207708_100504762 | 293 |
| 883 | 3300026078 | Ga0207702_10000297 | Ga0207702_1000029728 | 293 |
| 884 | 3300026088 | Ga0207641_10000775 | Ga0207641_1000077526 | 293 |
| 885 | 3300026089 | Ga0207648_10059526 | Ga0207648_100595263 | 293 |
| 886 | 3300026089 | Ga0207648_10169675 | Ga0207648_101696752 | 293 |
| 887 | 3300026095 | Ga0207676_10000182 | Ga0207676_1000018244 | 293 |
| 888 | 3300026116 | Ga0207674_10001329 | Ga0207674_100013293 | 293 |
| 889 | 3300026118 | Ga0207675_100000342 | Ga0207675_10000034241 | 293 |
| 890 | 3300026118 | Ga0207675_100071547 | Ga0207675_1000715472 | 293 |
| 891 | 3300026121 | Ga0207683_10000006 | Ga0207683_1000000619 | 293 |
| 892 | 3300026121 | Ga0207683_10076290 | Ga0207683_100762902 | 293 |
| 893 | 3300026142 | Ga0207698_10000236 | Ga0207698_100002365 | 293 |
| 894 | 3300027252 | Ga0209973_1003406 | Ga0209973_10034061 | 293 |
| 895 | 3300027617 | Ga0210002_1000806 | Ga0210002_10008062 | 293 |
| 896 | 3300027695 | Ga0209966_1001141 | Ga0209966_10011414 | 293 |
| 897 | 3300027717 | Ga0209998_10010506 | Ga0209998_100105062 | 293 |
| 898 | 3300027907 | Ga0207428_10000112 | Ga0207428_1000011280 | 293 |
| 899 | 3300027907 | Ga0207428_10000480 | Ga0207428_100004809 | 293 |
| 900 | 3300027907 | Ga0207428_10001796 | Ga0207428_100017964 | 293 |
| 901 | 3300028379 | Ga0268266_10047404 | Ga0268266_100474044 | 293 |
| 902 | 3300028380 | Ga0268265_10000257 | Ga0268265_1000025716 | 293 |
| 903 | 3300028381 | Ga0268264_10000579 | Ga0268264_1000057914 | 293 |
| 904 | 3300028381 | Ga0268264_10221945 | Ga0268264_102219452 | 293 |
| 905 | 3300034817 | Ga0373948_0000208 | Ga0373948_0000208_5452_6333 | 293 |
| 906 | 3300034818 | Ga0373950_0000236 | Ga0373950_0000236_1793_2674 | 293 |
| 907 | 3300034819 | Ga0373958_0000783 | Ga0373958_0000783_46_927 | 293 |
| 908 | 3300034957 | Ga0373938_0000241 | Ga0373938_0000241_2989_3870 | 293 |
| 909 | 3300034957 | Ga0373938_0000618 | Ga0373938_0000618_2458_3339 | 293 |
| 910 | 3300035084 | Ga0373928_0001002 | Ga0373928_0001002_3733_4614 | 293 |
| 911 | 3300035085 | Ga0373929_0000730 | Ga0373929_0000730_4914_5795 | 293 |
| 912 | 3300035086 | Ga0373934_0083248 | Ga0373934_0083248_97_1014 | 293 |
| 913 | 3300035088 | Ga0373940_0001277 | Ga0373940_0001277_2723_3604 | 293 |
| 914 | 3300035088 | Ga0373940_0007382 | Ga0373940_0007382_580_1461 | 293 |
| 915 | 3300035090 | Ga0373949_0003478 | Ga0373949_0003478_761_1642 | 293 |
| 916 | 3300035091 | Ga0373951_0004638 | Ga0373951_0004638_1688_2569 | 293 |
| 917 | 3300035092 | Ga0373952_0000999 | Ga0373952_0000999_1261_2142 | 293 |
| 918 | 3300035092 | Ga0373952_0001835 | Ga0373952_0001835_1874_2755 | 293 |
| 919 | 3300035112 | Ga0373932_0000083 | Ga0373932_0000083_8377_9258 | 293 |
| 920 | 3300035112 | Ga0373932_0001722 | Ga0373932_0001722_1850_2731 | 293 |
| 921 | 3300035114 | Ga0373939_0000284 | Ga0373939_0000284_4312_5193 | 293 |
| 922 | 3300035114 | Ga0373939_0003206 | Ga0373939_0003206_993_1874 | 293 |
| 923 | 3300035115 | Ga0373941_0000052 | Ga0373941_0000052_15185_16066 | 293 |
| 924 | 3300035121 | Ga0373960_0001413 | Ga0373960_0001413_11_892 | 293 |
| 925 | 3300035121 | Ga0373960_0001868 | Ga0373960_0001868_3559_4440 | 293 |
| 926 | 3300035207 | Ga0373942_0000221 | Ga0373942_0000221_8089_8970 | 293 |
| 927 | 3300035241 | Ga0373961_0004414 | Ga0373961_0004414_709_1590 | 293 |
| 928 | 3300035241 | Ga0373961_0018473 | Ga0373961_0018473_690_1571 | 293 |
| 929 | 3300035242 | Ga0373962_0000218 | Ga0373962_0000218_2066_2947 | 293 |
| 930 | 3300035242 | Ga0373962_0005140 | Ga0373962_0005140_1913_2794 | 293 |
| 931 | 3300035691 | Ga0373931_0005439 | Ga0373931_0005439_3019_3900 | 293 |
| 932 | 3300038996 | Ga0242420_001067 | Ga0242420_001067_2185_3066 | 293 |
| 933 | 3300046538 | Ga0495609_0052605 | Ga0495609_0052605_232_1113 | 293 |
| 934 | 3300046684 | Ga0495669_0063344 | Ga0495669_0063344_553_1434 | 293 |
| 935 | 3300047445 | Ga0495677_0079755 | Ga0495677_0079755_255_1136 | 293 |
| 936 | 3300048903 | Ga0496100_0000249 | Ga0496100_0000249_19495_20376 | 293 |
| 937 | 3300048904 | Ga0496101_0000526 | Ga0496101_0000526_15018_15899 | 293 |
| 938 | 3300048905 | Ga0496102_0000433 | Ga0496102_0000433_26432_27313 | 293 |
| 939 | 3300048905 | Ga0496102_0058306 | Ga0496102_0058306_1598_2479 | 293 |
| 940 | 3300048906 | Ga0496103_0000537 | Ga0496103_0000537_7763_8644 | 293 |
| 941 | 3300048907 | Ga0496104_0042787 | Ga0496104_0042787_2691_3572 | 293 |
| 942 | 3300048909 | Ga0496106_0001596 | Ga0496106_0001596_1817_2698 | 293 |
| 943 | 3300048909 | Ga0496106_0052013 | Ga0496106_0052013_1664_2545 | 293 |
| 944 | 3300048910 | Ga0496107_0000078 | Ga0496107_0000078_19557_20438 | 293 |
| 945 | 3300048910 | Ga0496107_0019236 | Ga0496107_0019236_398_1279 | 293 |
| 946 | 3300048911 | Ga0496108_0007917 | Ga0496108_0007917_6657_7538 | 293 |
| 947 | 3300048911 | Ga0496108_0261851 | Ga0496108_0261851_347_1228 | 293 |
| 948 | 3300048912 | Ga0496109_0000406 | Ga0496109_0000406_7572_8453 | 293 |
| 949 | 3300048912 | Ga0496109_0052682 | Ga0496109_0052682_2487_3368 | 293 |
| 950 | 3300048913 | Ga0496110_0025351 | Ga0496110_0025351_2464_3345 | 293 |
| 951 | 3300048914 | Ga0496111_0055008 | Ga0496111_0055008_918_1799 | 293 |
| 952 | 3300048915 | Ga0496112_0038727 | Ga0496112_0038727_2663_3544 | 293 |
| 953 | 3300048916 | Ga0496113_0042358 | Ga0496113_0042358_1813_2694 | 293 |
| 954 | 3300048916 | Ga0496113_0053458 | Ga0496113_0053458_182_1063 | 293 |
| 955 | 3300048917 | Ga0496114_0000418 | Ga0496114_0000418_24200_25081 | 293 |
| 956 | 3300048918 | Ga0496115_0000437 | Ga0496115_0000437_8707_9588 | 293 |
| 957 | 3300050511 | nmdc:mga08y16_111019_c1 | nmdc:mga08y16_111019_c1_1509_2390 | 293 |
| 958 | 3300050511 | nmdc:mga08y16_11459_c1 | nmdc:mga08y16_11459_c1_7954_8835 | 293 |
| 959 | 3300050512 | nmdc:mga0n895_12135_c1 | nmdc:mga0n895_12135_c1_2369_3250 | 293 |
| 960 | 3300050513 | nmdc:mga0rr50_18874_c1 | nmdc:mga0rr50_18874_c1_664_1545 | 293 |
| 961 | 3300050513 | nmdc:mga0rr50_298628_c1 | nmdc:mga0rr50_298628_c1_18_935 | 293 |
| 962 | 3300050515 | nmdc:mga0a205_3474_c1 | nmdc:mga0a205_3474_c1_7935_8816 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hd1-assembly1.cif.gz_A | crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius | 0.8518 | 5 | 249 |
| 7vwt-assembly1.cif.gz_B | carbazole prenyl transferase cqsb4 | 0.8277 | 23 | 278 |
| 3acx-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-673 | 0.8253 | 21 | 274 |
| 3adz-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp | 0.8245 | 21 | 274 |
| 3wcc-assembly1.cif.gz_C | the complex structure of tcsqs with ligand, e5700 | 0.8222 | 21 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHP3_1_280_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8784 | 23 | 272 | 1.10.600.10 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8602 | 21 | 248 | 1.10.600.10 |
| af_Q17477_122_396_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8557 | 21 | 245 | 1.10.600.10 |
| 4hd1A00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8498 | 5 | 249 | 1.10.600.10 |
| af_A4ID42_69_319_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.836 | 27 | 255 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838UGN9-F1-model_v4 | Squalene/phytoene synthase family protein | 0.98 | 63 | 287 |
GO:0008299
|
| AF-A0A1L7AF82-F1-model_v4 | Squalene synthase HpnC | 0.9793 | 3 | 280 |
GO:0004311
GO:0008299 GO:0051996 |
| AF-A0A327KRZ7-F1-model_v4 | Squalene synthase HpnC | 0.9777 | 2 | 279 |
GO:0004311
GO:0008299 GO:0051996 |
| AF-A0A7C7FS03-F1-model_v4 | Squalene synthase HpnC | 0.9764 | 68 | 277 |
GO:0008299
|
| AF-A0A537UHM7-F1-model_v4 | Squalene synthase HpnC (EC 2.5.1.21) | 0.9756 | 26 | 293 |
GO:0004311
GO:0008299 GO:0051996 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar