F486842
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 960 | 440 | 945 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300015265|Ga0182005_1000689|Ga0182005_100068912 |
| Length | 329 |
| Sequence | MRRLVKPLACAFDYQSFIFCAYNKNKWPEQNANADIAMTIPDWRRRRSGRGNALQSHDPFPLSQKNAPIPRSHASCATTWHSQNHRTGTGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIHELIWFLAGSTNIKYLKDNDVKIWDEWADSDGNLGPIYGFQWRSWPAPGGAHIDQIKQVVEQIKHNPDSRRLIVSAWNVADIPQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTHMMAQQCGLEVGDFIWTGGDCHLYSNHAAQVEEQLSRSPGPLPRLEIKRKPESIFDYRFADFEILDYHPQAHIKAPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 3 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 4 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 5 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 6 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 7 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 8 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 9 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 10 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 11 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 12 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 13 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 14 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 15 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 110 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 111 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 112 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 220 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 248 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 249 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 256 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 257 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 260 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 417 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 429 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 432 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 433 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 436 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 437 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 440 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.73 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 5.21 |
| Nodule | 1.98 |
| Rhizoplane | 3.85 |
| Rhizosphere | 77.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2690628 | 2162886007 | Bacteria | 1011 |
| 2 | SwRhRL2b_contig_465629 | 2162886007 | Bacteria | 1363 |
| 3 | SwRhRL2b_contig_565865 | 2162886007 | Bacteria | 1925 |
| 4 | JGI24740J21852_10035601 | 3300001979 | Bacteria | 1554 |
| 5 | JGI24735J21928_10015140 | 3300002067 | Bacteria | 2409 |
| 6 | JGI25155J39150_1000694 | 3300002704 | Bacteria | 6224 |
| 7 | JGI25156J39149_1006009 | 3300002705 | Bacteria | 3391 |
| 8 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 9 | JGI25154J39366_1000800 | 3300002738 | Bacteria | 13831 |
| 10 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 11 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 12 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 13 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 14 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 15 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 16 | Ga0058692_1000209 | 3300003856 | Bacteria | 34844 |
| 17 | Ga0058692_1000390 | 3300003856 | Bacteria | 21046 |
| 18 | Ga0058692_1001340 | 3300003856 | Bacteria | 9191 |
| 19 | Ga0058692_1001368 | 3300003856 | Bacteria | 9046 |
| 20 | Ga0065165_1000270 | 3300005262 | Bacteria | 88828 |
| 21 | Ga0065714_10069175 | 3300005288 | Bacteria | 4356 |
| 22 | Ga0065704_10002801 | 3300005289 | Bacteria | 7427 |
| 23 | Ga0065704_10007448 | 3300005289 | Bacteria | 3802 |
| 24 | Ga0065704_10082129 | 3300005289 | Bacteria | 3650 |
| 25 | Ga0065704_10086266 | 3300005289 | Bacteria | 3137 |
| 26 | Ga0065704_10136785 | 3300005289 | Bacteria | 1562 |
| 27 | Ga0070658_10250068 | 3300005327 | Bacteria | 1504 |
| 28 | Ga0070676_10007986 | 3300005328 | Bacteria | 5689 |
| 29 | Ga0070676_10098984 | 3300005328 | Bacteria | 1799 |
| 30 | Ga0070683_100144424 | 3300005329 | Bacteria | 2254 |
| 31 | Ga0070670_100002234 | 3300005331 | Bacteria | 15919 |
| 32 | Ga0070670_100043662 | 3300005331 | Bacteria | 3853 |
| 33 | Ga0070670_100060341 | 3300005331 | Bacteria | 3256 |
| 34 | Ga0070666_10025023 | 3300005335 | Bacteria | 3890 |
| 35 | Ga0070666_10091078 | 3300005335 | Bacteria | 2095 |
| 36 | Ga0070680_100001582 | 3300005336 | Bacteria | 16611 |
| 37 | Ga0070682_100124953 | 3300005337 | Bacteria | 1732 |
| 38 | Ga0070660_100042137 | 3300005339 | Bacteria | 3483 |
| 39 | Ga0070661_100027710 | 3300005344 | Bacteria | 4081 |
| 40 | Ga0070661_100342969 | 3300005344 | Bacteria | 1171 |
| 41 | Ga0070668_100184401 | 3300005347 | Bacteria | 1706 |
| 42 | Ga0070669_100073736 | 3300005353 | Bacteria | 2529 |
| 43 | Ga0070675_100182860 | 3300005354 | Bacteria | 1813 |
| 44 | Ga0070671_100052534 | 3300005355 | Bacteria | 3388 |
| 45 | Ga0070674_100021190 | 3300005356 | Bacteria | 4168 |
| 46 | Ga0070674_100471836 | 3300005356 | Bacteria | 1040 |
| 47 | Ga0070673_100056731 | 3300005364 | Bacteria | 3091 |
| 48 | Ga0070659_100046515 | 3300005366 | Bacteria | 3401 |
| 49 | Ga0070667_100053674 | 3300005367 | Bacteria | 3402 |
| 50 | Ga0070667_100063446 | 3300005367 | Bacteria | 3131 |
| 51 | Ga0070709_10000012 | 3300005434 | Bacteria | 163026 |
| 52 | Ga0070709_10125538 | 3300005434 | Bacteria | 1745 |
| 53 | Ga0070714_100052293 | 3300005435 | Bacteria | 3483 |
| 54 | Ga0070714_100064477 | 3300005435 | Bacteria | 3153 |
| 55 | Ga0070714_100208226 | 3300005435 | Bacteria | 1792 |
| 56 | Ga0070713_100001813 | 3300005436 | Bacteria | 13792 |
| 57 | Ga0070678_100015524 | 3300005456 | Bacteria | 4844 |
| 58 | Ga0070678_100028505 | 3300005456 | Bacteria | 3809 |
| 59 | Ga0070662_100022103 | 3300005457 | Bacteria | 4350 |
| 60 | Ga0070681_10028427 | 3300005458 | Bacteria | 5621 |
| 61 | Ga0070681_10461519 | 3300005458 | Bacteria | 1182 |
| 62 | Ga0068867_100282921 | 3300005459 | Bacteria | 1360 |
| 63 | Ga0070679_100012756 | 3300005530 | Bacteria | 8038 |
| 64 | Ga0070679_100065499 | 3300005530 | Bacteria | 3622 |
| 65 | Ga0070679_100082818 | 3300005530 | Bacteria | 3198 |
| 66 | Ga0070684_100190969 | 3300005535 | Bacteria | 1864 |
| 67 | Ga0068853_100000194 | 3300005539 | Bacteria | 42877 |
| 68 | Ga0070672_100045872 | 3300005543 | Bacteria | 3384 |
| 69 | Ga0070672_100052614 | 3300005543 | Bacteria | 3180 |
| 70 | Ga0070695_100199753 | 3300005545 | Bacteria | 1428 |
| 71 | Ga0070665_100000033 | 3300005548 | Bacteria | 332530 |
| 72 | Ga0070665_100012974 | 3300005548 | Bacteria | 8393 |
| 73 | Ga0070665_100447316 | 3300005548 | Bacteria | 1301 |
| 74 | Ga0070665_100451629 | 3300005548 | Bacteria | 1295 |
| 75 | Ga0070665_100952501 | 3300005548 | Bacteria | 871 |
| 76 | Ga0068855_100132425 | 3300005563 | Bacteria | 2846 |
| 77 | Ga0070664_100057086 | 3300005564 | Bacteria | 3318 |
| 78 | Ga0070664_100082623 | 3300005564 | Bacteria | 2770 |
| 79 | Ga0068857_100000814 | 3300005577 | Bacteria | 23350 |
| 80 | Ga0068857_100011113 | 3300005577 | Bacteria | 7831 |
| 81 | Ga0068857_100067657 | 3300005577 | Bacteria | 3179 |
| 82 | Ga0068854_100009368 | 3300005578 | Bacteria | 6321 |
| 83 | Ga0068854_100017438 | 3300005578 | Bacteria | 4805 |
| 84 | Ga0068856_100059442 | 3300005614 | Bacteria | 3776 |
| 85 | Ga0068856_100063764 | 3300005614 | Bacteria | 3640 |
| 86 | Ga0068856_100075706 | 3300005614 | Bacteria | 3334 |
| 87 | Ga0068856_100287368 | 3300005614 | Bacteria | 1661 |
| 88 | Ga0068856_100558675 | 3300005614 | Bacteria | 1166 |
| 89 | Ga0068852_100046087 | 3300005616 | Bacteria | 3713 |
| 90 | Ga0068852_100480299 | 3300005616 | Bacteria | 1235 |
| 91 | Ga0068864_100023945 | 3300005618 | Bacteria | 5131 |
| 92 | Ga0068851_10006890 | 3300005834 | Bacteria | 5207 |
| 93 | Ga0068863_100003644 | 3300005841 | Bacteria | 15215 |
| 94 | Ga0068863_100013348 | 3300005841 | Bacteria | 7920 |
| 95 | Ga0068860_100402766 | 3300005843 | Bacteria | 1354 |
| 96 | Ga0081539_10047180 | 3300005985 | Bacteria | 2463 |
| 97 | Ga0070717_10156227 | 3300006028 | Bacteria | 1976 |
| 98 | Ga0075365_10166098 | 3300006038 | Bacteria | 1540 |
| 99 | Ga0075368_10087636 | 3300006042 | Bacteria | 1271 |
| 100 | Ga0075364_10000454 | 3300006051 | Bacteria | 20673 |
| 101 | Ga0075364_10000761 | 3300006051 | Bacteria | 16900 |
| 102 | Ga0075364_10031035 | 3300006051 | Bacteria | 3433 |
| 103 | Ga0075364_10048076 | 3300006051 | Bacteria | 2779 |
| 104 | Ga0070716_100016923 | 3300006173 | Bacteria | 3771 |
| 105 | Ga0070712_100299327 | 3300006175 | Bacteria | 1301 |
| 106 | Ga0075366_10016396 | 3300006195 | Bacteria | 4258 |
| 107 | Ga0075366_10024516 | 3300006195 | Bacteria | 3518 |
| 108 | Ga0075370_10077074 | 3300006353 | Bacteria | 1913 |
| 109 | Ga0068871_100534576 | 3300006358 | Bacteria | 1060 |
| 110 | Ga0075428_100522032 | 3300006844 | Bacteria | 1270 |
| 111 | Ga0075434_100269286 | 3300006871 | Bacteria | 1723 |
| 112 | Ga0068865_100400665 | 3300006881 | Bacteria | 1124 |
| 113 | Ga0079104_1000039 | 3300006946 | Bacteria | 188434 |
| 114 | Ga0079104_1000255 | 3300006946 | Bacteria | 71067 |
| 115 | Ga0079104_1000895 | 3300006946 | Bacteria | 24364 |
| 116 | Ga0079104_1001436 | 3300006946 | Bacteria | 15975 |
| 117 | Ga0079104_1001499 | 3300006946 | Bacteria | 15520 |
| 118 | Ga0079104_1003597 | 3300006946 | Bacteria | 7103 |
| 119 | Ga0105251_10000036 | 3300009011 | Bacteria | 117656 |
| 120 | Ga0105251_10001204 | 3300009011 | Bacteria | 22361 |
| 121 | Ga0105251_10001316 | 3300009011 | Bacteria | 21465 |
| 122 | Ga0105251_10001736 | 3300009011 | Bacteria | 18191 |
| 123 | Ga0105251_10002897 | 3300009011 | Bacteria | 12889 |
| 124 | Ga0105251_10004074 | 3300009011 | Bacteria | 10252 |
| 125 | Ga0105251_10006180 | 3300009011 | Bacteria | 7694 |
| 126 | Ga0105251_10013300 | 3300009011 | Bacteria | 4609 |
| 127 | Ga0105251_10022957 | 3300009011 | Bacteria | 3229 |
| 128 | Ga0105251_10039578 | 3300009011 | Bacteria | 2302 |
| 129 | Ga0105251_10074566 | 3300009011 | Bacteria | 1576 |
| 130 | Ga0105251_10093476 | 3300009011 | Bacteria | 1380 |
| 131 | Ga0105244_10000193 | 3300009036 | Bacteria | 61620 |
| 132 | Ga0105244_10000225 | 3300009036 | Bacteria | 58370 |
| 133 | Ga0105244_10001179 | 3300009036 | Bacteria | 21636 |
| 134 | Ga0105244_10002608 | 3300009036 | Bacteria | 13508 |
| 135 | Ga0105244_10003766 | 3300009036 | Bacteria | 10702 |
| 136 | Ga0105244_10005574 | 3300009036 | Bacteria | 8328 |
| 137 | Ga0105244_10007009 | 3300009036 | Bacteria | 7213 |
| 138 | Ga0105244_10014009 | 3300009036 | Bacteria | 4655 |
| 139 | Ga0105244_10024115 | 3300009036 | Bacteria | 3324 |
| 140 | Ga0105244_10076162 | 3300009036 | Bacteria | 1666 |
| 141 | Ga0105244_10088327 | 3300009036 | Bacteria | 1527 |
| 142 | Ga0105244_10153717 | 3300009036 | Bacteria | 1101 |
| 143 | Ga0105250_10000021 | 3300009092 | Bacteria | 239960 |
| 144 | Ga0105250_10000086 | 3300009092 | Bacteria | 81683 |
| 145 | Ga0105250_10000490 | 3300009092 | Bacteria | 27810 |
| 146 | Ga0105250_10005159 | 3300009092 | Bacteria | 5895 |
| 147 | Ga0105250_10044379 | 3300009092 | Bacteria | 1783 |
| 148 | Ga0105250_10088433 | 3300009092 | Bacteria | 1258 |
| 149 | Ga0105240_10003481 | 3300009093 | Bacteria | 24428 |
| 150 | Ga0105240_10024207 | 3300009093 | Bacteria | 8012 |
| 151 | Ga0105240_10138922 | 3300009093 | Bacteria | 2907 |
| 152 | Ga0105240_10205416 | 3300009093 | Bacteria | 2306 |
| 153 | Ga0105243_10037401 | 3300009148 | Bacteria | 3772 |
| 154 | Ga0105241_10000012 | 3300009174 | Bacteria | 221790 |
| 155 | Ga0105242_10028956 | 3300009176 | Bacteria | 4413 |
| 156 | Ga0105242_10138250 | 3300009176 | Bacteria | 2111 |
| 157 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 158 | Ga0105248_10046312 | 3300009177 | Bacteria | 4874 |
| 159 | Ga0105238_10016032 | 3300009551 | Bacteria | 7579 |
| 160 | Ga0105238_10184008 | 3300009551 | Bacteria | 2066 |
| 161 | Ga0105249_10838785 | 3300009553 | Bacteria | 984 |
| 162 | Ga0105246_10031289 | 3300011119 | Bacteria | 3521 |
| 163 | Ga0105246_10137213 | 3300011119 | Bacteria | 1835 |
| 164 | Ga0157373_10000745 | 3300013100 | Bacteria | 25255 |
| 165 | Ga0157373_10002600 | 3300013100 | Bacteria | 13707 |
| 166 | Ga0157373_10013651 | 3300013100 | Bacteria | 5956 |
| 167 | Ga0157373_10036245 | 3300013100 | Bacteria | 3541 |
| 168 | Ga0157373_10140815 | 3300013100 | Bacteria | 1696 |
| 169 | Ga0157371_10001118 | 3300013102 | Bacteria | 29066 |
| 170 | Ga0157371_10001344 | 3300013102 | Bacteria | 25903 |
| 171 | Ga0157371_10011341 | 3300013102 | Bacteria | 6874 |
| 172 | Ga0157371_10018105 | 3300013102 | Bacteria | 5215 |
| 173 | Ga0157371_10028822 | 3300013102 | Bacteria | 4019 |
| 174 | Ga0157371_10038542 | 3300013102 | Bacteria | 3419 |
| 175 | Ga0157371_10072349 | 3300013102 | Bacteria | 2441 |
| 176 | Ga0157371_10145211 | 3300013102 | Bacteria | 1690 |
| 177 | Ga0157370_10000297 | 3300013104 | Bacteria | 63075 |
| 178 | Ga0157370_10009096 | 3300013104 | Bacteria | 10653 |
| 179 | Ga0157370_10051542 | 3300013104 | Bacteria | 3931 |
| 180 | Ga0157369_10006274 | 3300013105 | Bacteria | 13802 |
| 181 | Ga0157369_10006328 | 3300013105 | Bacteria | 13744 |
| 182 | Ga0157369_10081465 | 3300013105 | Bacteria | 3464 |
| 183 | Ga0157369_10175771 | 3300013105 | Bacteria | 2254 |
| 184 | Ga0157369_10370511 | 3300013105 | Bacteria | 1487 |
| 185 | Ga0157369_10456162 | 3300013105 | Bacteria | 1324 |
| 186 | Ga0157369_10710137 | 3300013105 | Bacteria | 1035 |
| 187 | Ga0157369_10715397 | 3300013105 | Bacteria | 1031 |
| 188 | Ga0163162_10048767 | 3300013306 | Bacteria | 4243 |
| 189 | Ga0163162_10058596 | 3300013306 | Bacteria | 3881 |
| 190 | Ga0163162_10235532 | 3300013306 | Bacteria | 1961 |
| 191 | Ga0157372_10003156 | 3300013307 | Bacteria | 17772 |
| 192 | Ga0157372_10006737 | 3300013307 | Bacteria | 12214 |
| 193 | Ga0157372_10007335 | 3300013307 | Bacteria | 11734 |
| 194 | Ga0157372_10009960 | 3300013307 | Bacteria | 10107 |
| 195 | Ga0157372_10065105 | 3300013307 | Bacteria | 4091 |
| 196 | Ga0157372_10078123 | 3300013307 | Bacteria | 3739 |
| 197 | Ga0157372_10080415 | 3300013307 | Bacteria | 3687 |
| 198 | Ga0157372_10101024 | 3300013307 | Bacteria | 3292 |
| 199 | Ga0157372_10159344 | 3300013307 | Bacteria | 2607 |
| 200 | Ga0157375_10181147 | 3300013308 | Bacteria | 2258 |
| 201 | Ga0157375_10775296 | 3300013308 | Bacteria | 1109 |
| 202 | Ga0163163_10037028 | 3300014325 | Bacteria | 4744 |
| 203 | Ga0182008_10040781 | 3300014497 | Bacteria | 2316 |
| 204 | Ga0182006_1000013 | 3300015261 | Bacteria | 363224 |
| 205 | Ga0182006_1013921 | 3300015261 | Bacteria | 3476 |
| 206 | Ga0182006_1053529 | 3300015261 | Bacteria | 1546 |
| 207 | Ga0182007_10003679 | 3300015262 | Bacteria | 7179 |
| 208 | Ga0182005_1000689 | 3300015265 | Bacteria | 15763 |
| 209 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 210 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 211 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 212 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 213 | Ga0163161_10000038 | 3300017792 | Bacteria | 149076 |
| 214 | Ga0163161_10000494 | 3300017792 | Bacteria | 32399 |
| 215 | Ga0163161_10026412 | 3300017792 | Bacteria | 4112 |
| 216 | Ga0206356_11131871 | 3300020070 | Bacteria | 1454 |
| 217 | Ga0206350_11351559 | 3300020080 | Bacteria | 870 |
| 218 | Ga0213876_10000103 | 3300021384 | Bacteria | 94164 |
| 219 | Ga0209435_100116 | 3300025206 | Bacteria | 30323 |
| 220 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 221 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 222 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 223 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 224 | Ga0207427_100784 | 3300025231 | Bacteria | 14485 |
| 225 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 226 | Ga0209437_100110 | 3300025233 | Bacteria | 215040 |
| 227 | Ga0209646_1000130 | 3300025246 | Bacteria | 128556 |
| 228 | Ga0209026_1002093 | 3300025250 | Bacteria | 7846 |
| 229 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 230 | Ga0209759_1000456 | 3300025256 | Bacteria | 46592 |
| 231 | Ga0209129_1000010 | 3300025258 | Bacteria | 583357 |
| 232 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 233 | Ga0209025_1000849 | 3300025294 | Bacteria | 48335 |
| 234 | Ga0209256_1000873 | 3300025299 | Bacteria | 37313 |
| 235 | Ga0207697_10002399 | 3300025315 | Bacteria | 9764 |
| 236 | Ga0207656_10040793 | 3300025321 | Bacteria | 1969 |
| 237 | Ga0207696_1000024 | 3300025711 | Bacteria | 420123 |
| 238 | Ga0207696_1000061 | 3300025711 | Bacteria | 241730 |
| 239 | Ga0207696_1000079 | 3300025711 | Bacteria | 199842 |
| 240 | Ga0207696_1000436 | 3300025711 | Bacteria | 37358 |
| 241 | Ga0207696_1002594 | 3300025711 | Bacteria | 8760 |
| 242 | Ga0207696_1009243 | 3300025711 | Bacteria | 3686 |
| 243 | Ga0207655_1000020 | 3300025728 | Bacteria | 524503 |
| 244 | Ga0207655_1000025 | 3300025728 | Bacteria | 449261 |
| 245 | Ga0207655_1000044 | 3300025728 | Bacteria | 327511 |
| 246 | Ga0207655_1000047 | 3300025728 | Bacteria | 302548 |
| 247 | Ga0207655_1000079 | 3300025728 | Bacteria | 219036 |
| 248 | Ga0207655_1000088 | 3300025728 | Bacteria | 205698 |
| 249 | Ga0207655_1000150 | 3300025728 | Bacteria | 128025 |
| 250 | Ga0207655_1000382 | 3300025728 | Bacteria | 61846 |
| 251 | Ga0207655_1002063 | 3300025728 | Bacteria | 16863 |
| 252 | Ga0207655_1003957 | 3300025728 | Bacteria | 10741 |
| 253 | Ga0207655_1004443 | 3300025728 | Bacteria | 9940 |
| 254 | Ga0207655_1014279 | 3300025728 | Bacteria | 4499 |
| 255 | Ga0207655_1026831 | 3300025728 | Bacteria | 2757 |
| 256 | Ga0207655_1042138 | 3300025728 | Bacteria | 1947 |
| 257 | Ga0207713_1000028 | 3300025735 | Bacteria | 309074 |
| 258 | Ga0207713_1000033 | 3300025735 | Bacteria | 273751 |
| 259 | Ga0207713_1000051 | 3300025735 | Bacteria | 225973 |
| 260 | Ga0207713_1000054 | 3300025735 | Bacteria | 222042 |
| 261 | Ga0207713_1000082 | 3300025735 | Bacteria | 164992 |
| 262 | Ga0207713_1001326 | 3300025735 | Bacteria | 20298 |
| 263 | Ga0207713_1001432 | 3300025735 | Bacteria | 19085 |
| 264 | Ga0207713_1020708 | 3300025735 | Bacteria | 3175 |
| 265 | Ga0207713_1021697 | 3300025735 | Bacteria | 3071 |
| 266 | Ga0207713_1041556 | 3300025735 | Bacteria | 1917 |
| 267 | Ga0207682_10020483 | 3300025893 | Bacteria | 2597 |
| 268 | Ga0207710_10000042 | 3300025900 | Bacteria | 223734 |
| 269 | Ga0207647_10040161 | 3300025904 | Bacteria | 2948 |
| 270 | Ga0207699_10000087 | 3300025906 | Bacteria | 69697 |
| 271 | Ga0207645_10000903 | 3300025907 | Bacteria | 24610 |
| 272 | Ga0207645_10148890 | 3300025907 | Bacteria | 1527 |
| 273 | Ga0207705_10047691 | 3300025909 | Bacteria | 3080 |
| 274 | Ga0207705_10226511 | 3300025909 | Bacteria | 1421 |
| 275 | Ga0207654_10000015 | 3300025911 | Bacteria | 221799 |
| 276 | Ga0207707_10010873 | 3300025912 | Bacteria | 7911 |
| 277 | Ga0207695_10002294 | 3300025913 | Bacteria | 28544 |
| 278 | Ga0207695_10161596 | 3300025913 | Bacteria | 2171 |
| 279 | Ga0207695_10197062 | 3300025913 | Bacteria | 1930 |
| 280 | Ga0207693_10008546 | 3300025915 | Bacteria | 8380 |
| 281 | Ga0207693_10370477 | 3300025915 | Bacteria | 1120 |
| 282 | Ga0207660_10086835 | 3300025917 | Bacteria | 2310 |
| 283 | Ga0207657_10012629 | 3300025919 | Bacteria | 8325 |
| 284 | Ga0207657_10021933 | 3300025919 | Bacteria | 5996 |
| 285 | Ga0207649_10035183 | 3300025920 | Bacteria | 3008 |
| 286 | Ga0207649_10443453 | 3300025920 | Bacteria | 978 |
| 287 | Ga0207652_10039042 | 3300025921 | Bacteria | 4028 |
| 288 | Ga0207652_10102751 | 3300025921 | Bacteria | 2526 |
| 289 | Ga0207652_10160815 | 3300025921 | Bacteria | 2013 |
| 290 | Ga0207646_10227450 | 3300025922 | Bacteria | 1685 |
| 291 | Ga0207681_10065868 | 3300025923 | Bacteria | 2506 |
| 292 | Ga0207694_10155401 | 3300025924 | Bacteria | 1845 |
| 293 | Ga0207650_10002884 | 3300025925 | Bacteria | 11877 |
| 294 | Ga0207650_10070846 | 3300025925 | Bacteria | 2621 |
| 295 | Ga0207650_10076110 | 3300025925 | Bacteria | 2535 |
| 296 | Ga0207650_10147743 | 3300025925 | Bacteria | 1853 |
| 297 | Ga0207659_10056797 | 3300025926 | Bacteria | 2804 |
| 298 | Ga0207659_10184631 | 3300025926 | Bacteria | 1655 |
| 299 | Ga0207700_10017057 | 3300025928 | Bacteria | 4839 |
| 300 | Ga0207664_10021636 | 3300025929 | Bacteria | 4787 |
| 301 | Ga0207664_10039614 | 3300025929 | Bacteria | 3659 |
| 302 | Ga0207664_10356385 | 3300025929 | Bacteria | 1295 |
| 303 | Ga0207690_10042597 | 3300025932 | Bacteria | 2983 |
| 304 | Ga0207706_10019655 | 3300025933 | Bacteria | 6076 |
| 305 | Ga0207706_10039451 | 3300025933 | Bacteria | 4186 |
| 306 | Ga0207706_10059992 | 3300025933 | Bacteria | 3350 |
| 307 | Ga0207706_10185017 | 3300025933 | Bacteria | 1829 |
| 308 | Ga0207686_10029977 | 3300025934 | Bacteria | 3216 |
| 309 | Ga0207686_10069316 | 3300025934 | Bacteria | 2262 |
| 310 | Ga0207686_10302652 | 3300025934 | Bacteria | 1188 |
| 311 | Ga0207709_10489262 | 3300025935 | Bacteria | 958 |
| 312 | Ga0207669_10200730 | 3300025937 | Bacteria | 1447 |
| 313 | Ga0207704_10254324 | 3300025938 | Bacteria | 1321 |
| 314 | Ga0207691_10000137 | 3300025940 | Bacteria | 66901 |
| 315 | Ga0207691_10006161 | 3300025940 | Bacteria | 11600 |
| 316 | Ga0207691_10115192 | 3300025940 | Bacteria | 2387 |
| 317 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 318 | Ga0207711_10017576 | 3300025941 | Bacteria | 5941 |
| 319 | Ga0207711_10316600 | 3300025941 | Bacteria | 1441 |
| 320 | Ga0207679_10020313 | 3300025945 | Bacteria | 4481 |
| 321 | Ga0207679_10033555 | 3300025945 | Bacteria | 3613 |
| 322 | Ga0207679_10279030 | 3300025945 | Bacteria | 1432 |
| 323 | Ga0207667_10058404 | 3300025949 | Bacteria | 4046 |
| 324 | Ga0207667_10071359 | 3300025949 | Bacteria | 3611 |
| 325 | Ga0207651_10298927 | 3300025960 | Bacteria | 1338 |
| 326 | Ga0207712_10582060 | 3300025961 | Bacteria | 966 |
| 327 | Ga0207668_10013400 | 3300025972 | Bacteria | 5048 |
| 328 | Ga0207658_10090265 | 3300025986 | Bacteria | 2374 |
| 329 | Ga0207639_10000462 | 3300026041 | Bacteria | 28094 |
| 330 | Ga0207678_10060377 | 3300026067 | Bacteria | 3261 |
| 331 | Ga0207702_10005398 | 3300026078 | Bacteria | 11196 |
| 332 | Ga0207702_10077746 | 3300026078 | Bacteria | 2871 |
| 333 | Ga0207702_10135098 | 3300026078 | Bacteria | 2224 |
| 334 | Ga0207702_10212597 | 3300026078 | Bacteria | 1799 |
| 335 | Ga0207641_10005715 | 3300026088 | Bacteria | 10570 |
| 336 | Ga0207641_10010661 | 3300026088 | Bacteria | 7540 |
| 337 | Ga0207648_10032321 | 3300026089 | Bacteria | 4621 |
| 338 | Ga0207676_10001289 | 3300026095 | Bacteria | 18643 |
| 339 | Ga0207674_10002466 | 3300026116 | Bacteria | 23350 |
| 340 | Ga0207674_10019429 | 3300026116 | Bacteria | 7357 |
| 341 | Ga0207674_10045539 | 3300026116 | Bacteria | 4511 |
| 342 | Ga0207674_10206492 | 3300026116 | Bacteria | 1914 |
| 343 | Ga0207683_10007029 | 3300026121 | Bacteria | 9651 |
| 344 | Ga0207683_10009456 | 3300026121 | Bacteria | 8305 |
| 345 | Ga0207683_10119885 | 3300026121 | Bacteria | 2361 |
| 346 | Ga0207683_10226064 | 3300026121 | Bacteria | 1706 |
| 347 | Ga0207698_10026189 | 3300026142 | Bacteria | 4122 |
| 348 | Ga0207698_10048178 | 3300026142 | Bacteria | 3233 |
| 349 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 350 | Ga0209281_1000025 | 3300027111 | Bacteria | 488275 |
| 351 | Ga0209281_1000048 | 3300027111 | Bacteria | 322698 |
| 352 | Ga0209281_1000066 | 3300027111 | Bacteria | 284953 |
| 353 | Ga0209281_1000092 | 3300027111 | Bacteria | 241437 |
| 354 | Ga0209281_1000133 | 3300027111 | Bacteria | 188455 |
| 355 | Ga0209281_1000593 | 3300027111 | Bacteria | 41747 |
| 356 | Ga0209281_1000990 | 3300027111 | Bacteria | 22554 |
| 357 | Ga0209281_1001123 | 3300027111 | Bacteria | 19220 |
| 358 | Ga0209281_1001194 | 3300027111 | Bacteria | 17717 |
| 359 | Ga0209281_1002152 | 3300027111 | Bacteria | 8652 |
| 360 | Ga0209281_1002761 | 3300027111 | Bacteria | 6552 |
| 361 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 362 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 363 | Ga0209371_1000019 | 3300027312 | Bacteria | 583561 |
| 364 | Ga0209371_1000020 | 3300027312 | Bacteria | 556282 |
| 365 | Ga0209371_1000254 | 3300027312 | Bacteria | 64787 |
| 366 | Ga0209371_1000335 | 3300027312 | Bacteria | 51288 |
| 367 | Ga0209371_1000384 | 3300027312 | Bacteria | 46760 |
| 368 | Ga0209371_1001152 | 3300027312 | Bacteria | 19342 |
| 369 | Ga0209371_1001568 | 3300027312 | Bacteria | 15034 |
| 370 | Ga0209371_1004089 | 3300027312 | Bacteria | 6568 |
| 371 | Ga0209969_1000315 | 3300027360 | Bacteria | 6466 |
| 372 | Ga0209967_1002256 | 3300027364 | Bacteria | 2503 |
| 373 | Ga0210000_1004231 | 3300027462 | Bacteria | 2075 |
| 374 | Ga0209968_1007518 | 3300027526 | Bacteria | 1649 |
| 375 | Ga0209999_1001909 | 3300027543 | Bacteria | 3623 |
| 376 | Ga0209970_1000079 | 3300027614 | Bacteria | 13348 |
| 377 | Ga0209974_10001694 | 3300027876 | Bacteria | 7985 |
| 378 | Ga0268266_10000041 | 3300028379 | Bacteria | 322311 |
| 379 | Ga0268266_10000058 | 3300028379 | Bacteria | 277346 |
| 380 | Ga0268266_10194541 | 3300028379 | Bacteria | 1853 |
| 381 | Ga0268266_10320560 | 3300028379 | Bacteria | 1450 |
| 382 | Ga0265337_1001493 | 3300028556 | Bacteria | 11469 |
| 383 | Ga0265318_10027709 | 3300028577 | Bacteria | 2223 |
| 384 | Ga0307515_10071160 | 3300028794 | Bacteria | 4718 |
| 385 | Ga0307515_10169646 | 3300028794 | Bacteria | 2182 |
| 386 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 387 | Ga0268256_1000024 | 3300030500 | Bacteria | 488637 |
| 388 | Ga0268256_1000057 | 3300030500 | Bacteria | 229991 |
| 389 | Ga0268256_1000110 | 3300030500 | Bacteria | 119426 |
| 390 | Ga0268256_1000346 | 3300030500 | Bacteria | 44957 |
| 391 | Ga0268256_1000983 | 3300030500 | Bacteria | 19342 |
| 392 | Ga0268256_1000993 | 3300030500 | Bacteria | 19263 |
| 393 | Ga0268256_1001344 | 3300030500 | Bacteria | 15034 |
| 394 | Ga0268256_1001953 | 3300030500 | Bacteria | 11279 |
| 395 | Ga0268256_1002231 | 3300030500 | Bacteria | 10181 |
| 396 | Ga0268256_1003822 | 3300030500 | Bacteria | 6567 |
| 397 | Ga0268256_1011667 | 3300030500 | Bacteria | 2764 |
| 398 | Ga0307511_10000620 | 3300030521 | Bacteria | 37972 |
| 399 | Ga0316182_1346215 | 3300030745 | Bacteria | 1900 |
| 400 | Ga0265332_10003432 | 3300031238 | Bacteria | 7655 |
| 401 | Ga0265328_10002271 | 3300031239 | Bacteria | 8656 |
| 402 | Ga0265320_10013376 | 3300031240 | Bacteria | 4724 |
| 403 | Ga0265340_10053567 | 3300031247 | Bacteria | 1948 |
| 404 | Ga0265339_10016795 | 3300031249 | Bacteria | 4354 |
| 405 | Ga0265331_10000055 | 3300031250 | Bacteria | 177693 |
| 406 | Ga0265331_10002356 | 3300031250 | Bacteria | 12840 |
| 407 | Ga0265327_10000045 | 3300031251 | Bacteria | 282880 |
| 408 | Ga0265327_10003148 | 3300031251 | Bacteria | 16186 |
| 409 | Ga0265327_10007016 | 3300031251 | Bacteria | 8832 |
| 410 | Ga0265327_10008612 | 3300031251 | Bacteria | 7562 |
| 411 | Ga0265327_10033638 | 3300031251 | Bacteria | 2854 |
| 412 | Ga0307408_100009128 | 3300031548 | Bacteria | 6540 |
| 413 | Ga0307408_100053288 | 3300031548 | Bacteria | 2920 |
| 414 | Ga0307408_100295688 | 3300031548 | Bacteria | 1354 |
| 415 | Ga0265313_10008665 | 3300031595 | Bacteria | 6726 |
| 416 | Ga0316575_10002561 | 3300031665 | Bacteria | 6111 |
| 417 | Ga0316575_10041573 | 3300031665 | Bacteria | 1819 |
| 418 | Ga0316576_10055130 | 3300031727 | Bacteria | 2900 |
| 419 | Ga0307405_10020703 | 3300031731 | Bacteria | 3681 |
| 420 | Ga0307405_10130859 | 3300031731 | Bacteria | 1733 |
| 421 | Ga0307405_10149915 | 3300031731 | Bacteria | 1638 |
| 422 | Ga0307405_10232859 | 3300031731 | Bacteria | 1359 |
| 423 | Ga0307413_10012718 | 3300031824 | Bacteria | 4199 |
| 424 | Ga0307413_10107016 | 3300031824 | Bacteria | 1862 |
| 425 | Ga0307410_10013387 | 3300031852 | Bacteria | 4784 |
| 426 | Ga0307410_10025506 | 3300031852 | Bacteria | 3710 |
| 427 | Ga0307410_10030981 | 3300031852 | Bacteria | 3425 |
| 428 | Ga0307410_10321702 | 3300031852 | Bacteria | 1227 |
| 429 | Ga0307406_10113216 | 3300031901 | Bacteria | 1872 |
| 430 | Ga0307407_10043531 | 3300031903 | Bacteria | 2524 |
| 431 | Ga0307407_10265341 | 3300031903 | Bacteria | 1183 |
| 432 | Ga0307412_10199933 | 3300031911 | Bacteria | 1517 |
| 433 | Ga0307409_100024912 | 3300031995 | Bacteria | 4184 |
| 434 | Ga0307409_100101515 | 3300031995 | Bacteria | 2387 |
| 435 | Ga0307409_100514325 | 3300031995 | Bacteria | 1168 |
| 436 | Ga0307416_100005598 | 3300032002 | Bacteria | 7743 |
| 437 | Ga0307416_100085930 | 3300032002 | Bacteria | 2680 |
| 438 | Ga0307416_100724931 | 3300032002 | Bacteria | 1085 |
| 439 | Ga0307414_10174633 | 3300032004 | Bacteria | 1722 |
| 440 | Ga0307414_10300127 | 3300032004 | Bacteria | 1358 |
| 441 | Ga0307411_10009499 | 3300032005 | Bacteria | 5118 |
| 442 | Ga0307411_10157542 | 3300032005 | Bacteria | 1696 |
| 443 | Ga0307415_100000718 | 3300032126 | Bacteria | 14833 |
| 444 | Ga0307415_100028637 | 3300032126 | Bacteria | 3547 |
| 445 | Ga0307415_100505564 | 3300032126 | Bacteria | 1057 |
| 446 | Ga0316583_10005256 | 3300032133 | Bacteria | 4642 |
| 447 | Ga0316583_10033334 | 3300032133 | Bacteria | 1830 |
| 448 | Ga0316593_10000900 | 3300032168 | Bacteria | 6073 |
| 449 | Ga0316593_10032516 | 3300032168 | Bacteria | 1704 |
| 450 | Ga0373950_0004424 | 3300034818 | Bacteria | 2057 |
| 451 | Ga0373944_0005254 | 3300035089 | Bacteria | 3404 |
| 452 | Ga0373923_0000792 | 3300035111 | Bacteria | 8234 |
| 453 | Ga0373936_0001246 | 3300035113 | Bacteria | 9176 |
| 454 | Ga0373939_0000033 | 3300035114 | Bacteria | 49449 |
| 455 | Ga0373939_0003966 | 3300035114 | Bacteria | 3484 |
| 456 | Ga0373945_0002836 | 3300035116 | Bacteria | 5447 |
| 457 | Ga0373954_0009128 | 3300035118 | Bacteria | 4363 |
| 458 | Ga0373956_0070534 | 3300035119 | Bacteria | 1594 |
| 459 | Ga0373960_0000774 | 3300035121 | Bacteria | 6707 |
| 460 | Ga0373943_0007158 | 3300035170 | Bacteria | 5005 |
| 461 | Ga0373946_0001845 | 3300035171 | Bacteria | 7409 |
| 462 | Ga0373955_0037791 | 3300035172 | Bacteria | 2568 |
| 463 | Ga0373962_0006886 | 3300035242 | Bacteria | 2767 |
| 464 | Ga0316574_0027516 | 3300035398 | Bacteria | 3426 |
| 465 | Ga0316574_0041517 | 3300035398 | Bacteria | 2837 |
| 466 | Ga0316574_0083970 | 3300035398 | Bacteria | 2025 |
| 467 | Ga0316574_0205324 | 3300035398 | Bacteria | 1265 |
| 468 | Ga0373924_0020351 | 3300035410 | Bacteria | 2578 |
| 469 | Ga0373931_0000478 | 3300035691 | Bacteria | 16299 |
| 470 | Ga0373935_0005968 | 3300035692 | Bacteria | 7226 |
| 471 | Ga0373927_0004839 | 3300035695 | Bacteria | 9361 |
| 472 | Ga0373933_0035802 | 3300035724 | Bacteria | 2902 |
| 473 | Ga0316582_0005223 | 3300036647 | Bacteria | 6654 |
| 474 | Ga0373925_0023646 | 3300037068 | Bacteria | 4483 |
| 475 | Ga0395899_0001908 | 3300037312 | Bacteria | 17203 |
| 476 | Ga0395899_0002251 | 3300037312 | Bacteria | 15775 |
| 477 | Ga0395899_0008511 | 3300037312 | Bacteria | 7902 |
| 478 | Ga0395899_0020604 | 3300037312 | Bacteria | 4999 |
| 479 | Ga0395899_0030956 | 3300037312 | Bacteria | 4023 |
| 480 | Ga0395899_0200264 | 3300037312 | Bacteria | 1393 |
| 481 | Ga0395900_0000221 | 3300037418 | Bacteria | 89883 |
| 482 | Ga0395900_0002564 | 3300037418 | Bacteria | 19910 |
| 483 | Ga0395900_0017051 | 3300037418 | Bacteria | 7415 |
| 484 | Ga0395900_0022497 | 3300037418 | Bacteria | 6448 |
| 485 | Ga0395900_0092496 | 3300037418 | Bacteria | 3107 |
| 486 | Ga0395900_0122907 | 3300037418 | Bacteria | 2662 |
| 487 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 488 | Ga0395898_0027810 | 3300037466 | Bacteria | 5670 |
| 489 | Ga0395898_0058142 | 3300037466 | Bacteria | 3765 |
| 490 | Ga0395898_0106921 | 3300037466 | Bacteria | 2683 |
| 491 | Ga0395898_0119137 | 3300037466 | Bacteria | 2528 |
| 492 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 493 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 494 | Ga0395905_0002276 | 3300037471 | Bacteria | 21549 |
| 495 | Ga0395905_0003830 | 3300037471 | Bacteria | 15893 |
| 496 | Ga0395905_0010954 | 3300037471 | Bacteria | 8777 |
| 497 | Ga0395905_0017189 | 3300037471 | Bacteria | 6870 |
| 498 | Ga0395905_0047544 | 3300037471 | Bacteria | 4020 |
| 499 | Ga0395905_0078961 | 3300037471 | Bacteria | 3084 |
| 500 | Ga0395905_0287986 | 3300037471 | Bacteria | 1529 |
| 501 | Ga0395905_0692986 | 3300037471 | Bacteria | 921 |
| 502 | Ga0395901_0000163 | 3300038443 | Bacteria | 87103 |
| 503 | Ga0395901_0018049 | 3300038443 | Bacteria | 7201 |
| 504 | Ga0395901_0018431 | 3300038443 | Bacteria | 7125 |
| 505 | Ga0395901_0133193 | 3300038443 | Bacteria | 2612 |
| 506 | Ga0395901_0202149 | 3300038443 | Bacteria | 2082 |
| 507 | Ga0400490_27390 | 3300038726 | Bacteria | 20125 |
| 508 | Ga0400490_44394 | 3300038726 | Bacteria | 1984 |
| 509 | Ga0400485_18763 | 3300038735 | Bacteria | 145645 |
| 510 | Ga0400488_13388 | 3300038741 | Bacteria | 3082 |
| 511 | Ga0400488_17616 | 3300038741 | Bacteria | 1737 |
| 512 | Ga0400486_28155 | 3300038742 | Bacteria | 181974 |
| 513 | Ga0400486_30217 | 3300038742 | Bacteria | 2898 |
| 514 | Ga0400483_287441 | 3300039062 | Bacteria | 31618 |
| 515 | Ga0400487_52424 | 3300039110 | Bacteria | 66024 |
| 516 | Ga0400487_54158 | 3300039110 | Bacteria | 56280 |
| 517 | Ga0436365_1861022 | 3300039437 | Bacteria | 74232 |
| 518 | Ga0439436_0038897 | 3300041404 | Bacteria | 1367 |
| 519 | Ga0439438_000059 | 3300041405 | Bacteria | 51384 |
| 520 | Ga0439438_000165 | 3300041405 | Bacteria | 30229 |
| 521 | Ga0439438_059606 | 3300041405 | Bacteria | 957 |
| 522 | Ga0451795_0735138 | 3300041456 | Bacteria | 3177 |
| 523 | Ga0439449_0002757 | 3300042007 | Bacteria | 6836 |
| 524 | Ga0439449_0011505 | 3300042007 | Bacteria | 3329 |
| 525 | Ga0439452_000006 | 3300042010 | Bacteria | 645083 |
| 526 | Ga0439452_000013 | 3300042010 | Bacteria | 364058 |
| 527 | Ga0439452_000187 | 3300042010 | Bacteria | 45688 |
| 528 | Ga0439452_000189 | 3300042010 | Bacteria | 45513 |
| 529 | Ga0439452_000375 | 3300042010 | Bacteria | 26934 |
| 530 | Ga0439452_006248 | 3300042010 | Bacteria | 3744 |
| 531 | Ga0450907_000024 | 3300042146 | Bacteria | 73273 |
| 532 | Ga0439434_0032604 | 3300042435 | Bacteria | 1586 |
| 533 | Ga0439464_0085984 | 3300042439 | Bacteria | 943 |
| 534 | Ga0439464_0098273 | 3300042439 | Bacteria | 887 |
| 535 | Ga0451577_0138257 | 3300042876 | Bacteria | 2188 |
| 536 | Ga0451577_0452894 | 3300042876 | Bacteria | 1165 |
| 537 | Ga0466972_0006867 | 3300044658 | Bacteria | 5713 |
| 538 | Ga0466981_0000001 | 3300044669 | Bacteria | 367980 |
| 539 | Ga0453683_0002974 | 3300044673 | Bacteria | 12719 |
| 540 | Ga0466965_0000627 | 3300044683 | Bacteria | 12889 |
| 541 | Ga0466966_0014463 | 3300044684 | Bacteria | 5224 |
| 542 | Ga0466963_0029926 | 3300044694 | Bacteria | 3508 |
| 543 | Ga0466963_0051127 | 3300044694 | Bacteria | 2738 |
| 544 | Ga0466963_0054385 | 3300044694 | Bacteria | 2660 |
| 545 | Ga0466963_0057692 | 3300044694 | Bacteria | 2586 |
| 546 | Ga0466964_0010649 | 3300044706 | Bacteria | 3469 |
| 547 | Ga0453684_0000334 | 3300044712 | Bacteria | 196444 |
| 548 | Ga0453684_0010323 | 3300044712 | Bacteria | 15988 |
| 549 | Ga0453684_0045851 | 3300044712 | Bacteria | 5825 |
| 550 | Ga0453684_0063618 | 3300044712 | Bacteria | 4718 |
| 551 | Ga0453684_0187951 | 3300044712 | Bacteria | 2419 |
| 552 | Ga0466957_0025756 | 3300044842 | Bacteria | 3487 |
| 553 | Ga0466959_0060564 | 3300045049 | Bacteria | 2754 |
| 554 | Ga0451576_0004288 | 3300045051 | Bacteria | 18679 |
| 555 | Ga0451576_0010387 | 3300045051 | Bacteria | 10690 |
| 556 | Ga0451576_0011887 | 3300045051 | Bacteria | 9847 |
| 557 | Ga0451576_0192414 | 3300045051 | Bacteria | 2131 |
| 558 | Ga0451576_0401764 | 3300045051 | Bacteria | 1437 |
| 559 | Ga0466958_0122038 | 3300045836 | Bacteria | 1632 |
| 560 | Ga0466958_0340745 | 3300045836 | Bacteria | 964 |
| 561 | Ga0466967_0016064 | 3300045976 | Bacteria | 5890 |
| 562 | Ga0466967_0034090 | 3300045976 | Bacteria | 4317 |
| 563 | Ga0466967_0109664 | 3300045976 | Bacteria | 2534 |
| 564 | Ga0466967_0683151 | 3300045976 | Bacteria | 1016 |
| 565 | Ga0466967_0759790 | 3300045976 | Bacteria | 962 |
| 566 | Ga0495617_000475 | 3300046452 | Bacteria | 21325 |
| 567 | Ga0495627_000048 | 3300046453 | Bacteria | 169824 |
| 568 | Ga0495627_000651 | 3300046453 | Bacteria | 26838 |
| 569 | Ga0495592_0006856 | 3300046454 | Bacteria | 8504 |
| 570 | Ga0495603_0003401 | 3300046455 | Bacteria | 9474 |
| 571 | Ga0495590_0000206 | 3300046457 | Bacteria | 32748 |
| 572 | Ga0495590_0010257 | 3300046457 | Bacteria | 3528 |
| 573 | Ga0495591_000045 | 3300046458 | Bacteria | 145091 |
| 574 | Ga0495591_000102 | 3300046458 | Bacteria | 98697 |
| 575 | Ga0495591_002789 | 3300046458 | Bacteria | 9419 |
| 576 | Ga0495629_0075992 | 3300046459 | Bacteria | 2345 |
| 577 | Ga0495638_0002096 | 3300046460 | Bacteria | 16885 |
| 578 | Ga0495638_0078912 | 3300046460 | Bacteria | 2003 |
| 579 | Ga0495638_0213420 | 3300046460 | Bacteria | 1083 |
| 580 | Ga0495641_0008644 | 3300046461 | Bacteria | 6164 |
| 581 | Ga0495651_0029605 | 3300046462 | Bacteria | 4270 |
| 582 | Ga0495651_0030714 | 3300046462 | Bacteria | 4189 |
| 583 | Ga0495653_0003798 | 3300046463 | Bacteria | 12220 |
| 584 | Ga0495653_0005421 | 3300046463 | Bacteria | 10385 |
| 585 | Ga0495653_0052096 | 3300046463 | Bacteria | 3138 |
| 586 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 587 | Ga0495650_0000059 | 3300046471 | Bacteria | 296253 |
| 588 | Ga0495650_0006347 | 3300046471 | Bacteria | 7388 |
| 589 | Ga0495650_0013027 | 3300046471 | Bacteria | 4432 |
| 590 | Ga0495580_0015940 | 3300046472 | Bacteria | 5655 |
| 591 | Ga0495580_0086190 | 3300046472 | Bacteria | 2187 |
| 592 | Ga0495582_0021241 | 3300046473 | Bacteria | 3554 |
| 593 | Ga0495582_0205358 | 3300046473 | Bacteria | 1125 |
| 594 | Ga0495605_0001064 | 3300046474 | Bacteria | 18325 |
| 595 | Ga0495605_0122051 | 3300046474 | Bacteria | 1180 |
| 596 | Ga0495639_0004976 | 3300046475 | Bacteria | 5700 |
| 597 | Ga0495639_0040522 | 3300046475 | Bacteria | 2095 |
| 598 | Ga0495662_0019363 | 3300046476 | Bacteria | 3291 |
| 599 | Ga0495585_0000026 | 3300046492 | Bacteria | 148243 |
| 600 | Ga0495585_0000649 | 3300046492 | Bacteria | 31919 |
| 601 | Ga0495585_0004130 | 3300046492 | Bacteria | 9503 |
| 602 | Ga0495585_0006530 | 3300046492 | Bacteria | 7218 |
| 603 | Ga0495585_0034852 | 3300046492 | Bacteria | 2845 |
| 604 | Ga0495594_0013331 | 3300046499 | Bacteria | 4290 |
| 605 | Ga0495594_0068505 | 3300046499 | Bacteria | 1971 |
| 606 | Ga0495594_0086848 | 3300046499 | Bacteria | 1750 |
| 607 | Ga0495596_0002772 | 3300046500 | Bacteria | 9177 |
| 608 | Ga0495596_0011391 | 3300046500 | Bacteria | 3839 |
| 609 | Ga0495607_0016352 | 3300046501 | Bacteria | 4787 |
| 610 | Ga0495607_0035777 | 3300046501 | Bacteria | 3000 |
| 611 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 612 | Ga0495606_0000308 | 3300046507 | Bacteria | 84218 |
| 613 | Ga0495606_0001127 | 3300046507 | Bacteria | 38097 |
| 614 | Ga0495606_0023693 | 3300046507 | Bacteria | 4441 |
| 615 | Ga0495616_0000569 | 3300046513 | Bacteria | 27955 |
| 616 | Ga0495616_0090309 | 3300046513 | Bacteria | 1451 |
| 617 | Ga0495618_0038370 | 3300046514 | Bacteria | 3010 |
| 618 | Ga0495618_0060088 | 3300046514 | Bacteria | 2409 |
| 619 | Ga0495620_0048904 | 3300046515 | Bacteria | 1812 |
| 620 | Ga0495628_0002411 | 3300046516 | Bacteria | 16861 |
| 621 | Ga0495628_0006745 | 3300046516 | Bacteria | 10002 |
| 622 | Ga0495628_0114553 | 3300046516 | Bacteria | 2071 |
| 623 | Ga0495630_0007589 | 3300046517 | Bacteria | 7754 |
| 624 | Ga0495631_0000366 | 3300046518 | Bacteria | 31016 |
| 625 | Ga0495631_0001045 | 3300046518 | Bacteria | 17172 |
| 626 | Ga0495631_0001198 | 3300046518 | Bacteria | 16006 |
| 627 | Ga0495631_0008656 | 3300046518 | Bacteria | 5121 |
| 628 | Ga0495631_0084917 | 3300046518 | Bacteria | 1364 |
| 629 | Ga0495632_0001867 | 3300046519 | Bacteria | 16905 |
| 630 | Ga0495632_0049306 | 3300046519 | Bacteria | 2082 |
| 631 | Ga0495637_0000891 | 3300046520 | Bacteria | 19260 |
| 632 | Ga0495643_0000898 | 3300046522 | Bacteria | 31694 |
| 633 | Ga0495643_0095840 | 3300046522 | Bacteria | 1526 |
| 634 | Ga0495643_0111068 | 3300046522 | Bacteria | 1394 |
| 635 | Ga0495644_0034753 | 3300046523 | Bacteria | 1903 |
| 636 | Ga0495644_0050986 | 3300046523 | Bacteria | 1553 |
| 637 | Ga0495648_0000866 | 3300046524 | Bacteria | 31938 |
| 638 | Ga0495648_0001470 | 3300046524 | Bacteria | 23040 |
| 639 | Ga0495648_0001615 | 3300046524 | Bacteria | 21921 |
| 640 | Ga0495648_0001800 | 3300046524 | Bacteria | 20623 |
| 641 | Ga0495648_0012590 | 3300046524 | Bacteria | 6299 |
| 642 | Ga0495648_0013244 | 3300046524 | Bacteria | 6109 |
| 643 | Ga0495648_0082379 | 3300046524 | Bacteria | 1826 |
| 644 | Ga0495666_0001193 | 3300046526 | Bacteria | 12527 |
| 645 | Ga0495666_0002138 | 3300046526 | Bacteria | 9818 |
| 646 | Ga0495642_0001287 | 3300046528 | Bacteria | 11316 |
| 647 | Ga0495642_0025390 | 3300046528 | Bacteria | 2348 |
| 648 | Ga0495642_0026145 | 3300046528 | Bacteria | 2317 |
| 649 | Ga0495642_0051777 | 3300046528 | Bacteria | 1690 |
| 650 | Ga0495652_0177263 | 3300046529 | Bacteria | 1639 |
| 651 | Ga0495654_0000073 | 3300046530 | Bacteria | 115044 |
| 652 | Ga0495654_0000101 | 3300046530 | Bacteria | 98257 |
| 653 | Ga0495654_0001104 | 3300046530 | Bacteria | 19508 |
| 654 | Ga0495654_0005457 | 3300046530 | Bacteria | 7381 |
| 655 | Ga0495654_0015625 | 3300046530 | Bacteria | 4028 |
| 656 | Ga0495665_0009870 | 3300046531 | Bacteria | 5168 |
| 657 | Ga0495586_0011839 | 3300046535 | Bacteria | 4636 |
| 658 | Ga0495586_0012833 | 3300046535 | Bacteria | 4441 |
| 659 | Ga0495586_0041722 | 3300046535 | Bacteria | 2471 |
| 660 | Ga0495587_0059624 | 3300046536 | Bacteria | 2239 |
| 661 | Ga0495609_0006494 | 3300046538 | Bacteria | 5960 |
| 662 | Ga0495609_0012215 | 3300046538 | Bacteria | 4074 |
| 663 | Ga0495609_0051534 | 3300046538 | Bacteria | 1832 |
| 664 | Ga0495609_0077001 | 3300046538 | Bacteria | 1461 |
| 665 | Ga0495597_0000590 | 3300046542 | Bacteria | 30015 |
| 666 | Ga0495597_0017841 | 3300046542 | Bacteria | 3334 |
| 667 | Ga0495597_0030835 | 3300046542 | Bacteria | 2441 |
| 668 | Ga0495645_0011685 | 3300046543 | Bacteria | 6181 |
| 669 | Ga0495645_0041973 | 3300046543 | Bacteria | 3335 |
| 670 | Ga0495645_0060598 | 3300046543 | Bacteria | 2743 |
| 671 | Ga0495622_0004018 | 3300046557 | Bacteria | 6866 |
| 672 | Ga0495622_0021048 | 3300046557 | Bacteria | 3038 |
| 673 | Ga0495633_0012233 | 3300046558 | Bacteria | 4576 |
| 674 | Ga0495633_0050210 | 3300046558 | Bacteria | 1967 |
| 675 | Ga0495633_0105505 | 3300046558 | Bacteria | 1307 |
| 676 | Ga0495667_0037944 | 3300046559 | Bacteria | 3209 |
| 677 | Ga0495656_0000005 | 3300046615 | Bacteria | 238208 |
| 678 | Ga0495656_0053133 | 3300046615 | Bacteria | 1740 |
| 679 | Ga0495668_0000848 | 3300046616 | Bacteria | 34526 |
| 680 | Ga0495668_0001034 | 3300046616 | Bacteria | 29500 |
| 681 | Ga0495668_0054345 | 3300046616 | Bacteria | 2214 |
| 682 | Ga0495668_0057450 | 3300046616 | Bacteria | 2147 |
| 683 | Ga0495634_0114502 | 3300046642 | Bacteria | 1731 |
| 684 | Ga0495611_0005346 | 3300046648 | Bacteria | 5496 |
| 685 | Ga0495611_0200252 | 3300046648 | Bacteria | 931 |
| 686 | Ga0495625_0004807 | 3300046660 | Bacteria | 12633 |
| 687 | Ga0495625_0007834 | 3300046660 | Bacteria | 9206 |
| 688 | Ga0495625_0044149 | 3300046660 | Bacteria | 3228 |
| 689 | Ga0495635_0022810 | 3300046663 | Bacteria | 4363 |
| 690 | Ga0495661_0004648 | 3300046665 | Bacteria | 9870 |
| 691 | Ga0495661_0064576 | 3300046665 | Bacteria | 2159 |
| 692 | Ga0495661_0158402 | 3300046665 | Bacteria | 1217 |
| 693 | Ga0495588_0009232 | 3300046674 | Bacteria | 4554 |
| 694 | Ga0495588_0015483 | 3300046674 | Bacteria | 3671 |
| 695 | Ga0495588_0027406 | 3300046674 | Bacteria | 2847 |
| 696 | Ga0495588_0083915 | 3300046674 | Bacteria | 1664 |
| 697 | Ga0495623_0002899 | 3300046679 | Bacteria | 11291 |
| 698 | Ga0495623_0014822 | 3300046679 | Bacteria | 5041 |
| 699 | Ga0495623_0151278 | 3300046679 | Bacteria | 1371 |
| 700 | Ga0495646_0002496 | 3300046680 | Bacteria | 11293 |
| 701 | Ga0495646_0004584 | 3300046680 | Bacteria | 8710 |
| 702 | Ga0495647_0000801 | 3300046681 | Bacteria | 9394 |
| 703 | Ga0495658_0002290 | 3300046683 | Bacteria | 9656 |
| 704 | Ga0495669_0008127 | 3300046684 | Bacteria | 4402 |
| 705 | Ga0495613_0047268 | 3300046689 | Bacteria | 3179 |
| 706 | Ga0495613_0053577 | 3300046689 | Bacteria | 2968 |
| 707 | Ga0495624_0004714 | 3300046690 | Bacteria | 9919 |
| 708 | Ga0495624_0012600 | 3300046690 | Bacteria | 5772 |
| 709 | Ga0495624_0221095 | 3300046690 | Bacteria | 1148 |
| 710 | Ga0495670_0000473 | 3300046691 | Bacteria | 19093 |
| 711 | Ga0495670_0020968 | 3300046691 | Bacteria | 3222 |
| 712 | Ga0495670_0032948 | 3300046691 | Bacteria | 2577 |
| 713 | Ga0495670_0040762 | 3300046691 | Bacteria | 2316 |
| 714 | Ga0495670_0254929 | 3300046691 | Bacteria | 936 |
| 715 | Ga0495671_0000354 | 3300046692 | Bacteria | 38143 |
| 716 | Ga0495671_0021640 | 3300046692 | Bacteria | 3374 |
| 717 | Ga0495649_0003899 | 3300046694 | Bacteria | 9869 |
| 718 | Ga0495649_0007912 | 3300046694 | Bacteria | 6432 |
| 719 | Ga0495649_0011769 | 3300046694 | Bacteria | 5119 |
| 720 | Ga0495589_0000025 | 3300046794 | Bacteria | 185024 |
| 721 | Ga0495589_0000354 | 3300046794 | Bacteria | 35716 |
| 722 | Ga0495589_0001682 | 3300046794 | Bacteria | 12644 |
| 723 | Ga0495589_0009736 | 3300046794 | Bacteria | 4992 |
| 724 | Ga0495600_0008466 | 3300046809 | Bacteria | 6320 |
| 725 | Ga0495600_0067886 | 3300046809 | Bacteria | 2330 |
| 726 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 727 | Ga0495660_0137950 | 3300046810 | Bacteria | 1216 |
| 728 | Ga0495581_0000444 | 3300047315 | Bacteria | 21134 |
| 729 | Ga0495581_0035891 | 3300047315 | Bacteria | 2867 |
| 730 | Ga0495581_0067907 | 3300047315 | Bacteria | 2062 |
| 731 | Ga0495581_0078947 | 3300047315 | Bacteria | 1904 |
| 732 | Ga0495604_0050124 | 3300047317 | Bacteria | 3242 |
| 733 | Ga0495604_0052766 | 3300047317 | Bacteria | 3146 |
| 734 | Ga0495604_0112847 | 3300047317 | Bacteria | 1979 |
| 735 | Ga0495636_0071108 | 3300047318 | Bacteria | 1485 |
| 736 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 737 | Ga0495672_0000200 | 3300047320 | Bacteria | 85505 |
| 738 | Ga0495672_0002537 | 3300047320 | Bacteria | 16653 |
| 739 | Ga0495672_0005433 | 3300047320 | Bacteria | 10113 |
| 740 | Ga0495676_0042371 | 3300047321 | Bacteria | 3737 |
| 741 | Ga0495676_0098159 | 3300047321 | Bacteria | 2174 |
| 742 | Ga0495680_0267559 | 3300047322 | Bacteria | 1207 |
| 743 | Ga0495680_0433284 | 3300047322 | Bacteria | 902 |
| 744 | Ga0495683_0005888 | 3300047323 | Bacteria | 6735 |
| 745 | Ga0495683_0030033 | 3300047323 | Bacteria | 2775 |
| 746 | Ga0495683_0043527 | 3300047323 | Bacteria | 2260 |
| 747 | Ga0495687_000034 | 3300047443 | Bacteria | 257321 |
| 748 | Ga0495687_000081 | 3300047443 | Bacteria | 147362 |
| 749 | Ga0495687_104901 | 3300047443 | Bacteria | 1052 |
| 750 | Ga0495675_0111005 | 3300047444 | Bacteria | 1711 |
| 751 | Ga0495679_000089 | 3300047446 | Bacteria | 83016 |
| 752 | Ga0495679_001212 | 3300047446 | Bacteria | 15299 |
| 753 | Ga0495679_009181 | 3300047446 | Bacteria | 3976 |
| 754 | Ga0495679_048717 | 3300047446 | Bacteria | 1280 |
| 755 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 756 | Ga0495673_0000124 | 3300047469 | Bacteria | 142007 |
| 757 | Ga0495681_0000144 | 3300047470 | Bacteria | 60089 |
| 758 | Ga0495681_0008644 | 3300047470 | Bacteria | 6358 |
| 759 | Ga0495681_0034978 | 3300047470 | Bacteria | 2498 |
| 760 | Ga0495681_0037875 | 3300047470 | Bacteria | 2370 |
| 761 | Ga0495681_0114378 | 3300047470 | Bacteria | 1165 |
| 762 | Ga0495684_0052768 | 3300047471 | Bacteria | 3102 |
| 763 | Ga0495686_0009775 | 3300047472 | Bacteria | 6883 |
| 764 | Ga0495593_0005464 | 3300047673 | Bacteria | 7504 |
| 765 | Ga0495602_0074513 | 3300048088 | Bacteria | 2884 |
| 766 | Ga0495626_0002847 | 3300048091 | Bacteria | 11563 |
| 767 | Ga0496100_0022394 | 3300048903 | Bacteria | 3823 |
| 768 | Ga0496100_0120972 | 3300048903 | Bacteria | 1831 |
| 769 | Ga0496101_0000070 | 3300048904 | Bacteria | 120089 |
| 770 | Ga0496101_0021478 | 3300048904 | Bacteria | 4436 |
| 771 | Ga0496101_0068504 | 3300048904 | Bacteria | 2594 |
| 772 | Ga0496101_0080062 | 3300048904 | Bacteria | 2413 |
| 773 | Ga0496102_0001658 | 3300048905 | Bacteria | 19568 |
| 774 | Ga0496102_0083328 | 3300048905 | Bacteria | 2950 |
| 775 | Ga0496102_0099565 | 3300048905 | Bacteria | 2698 |
| 776 | Ga0496103_0007660 | 3300048906 | Bacteria | 6423 |
| 777 | Ga0496103_0037337 | 3300048906 | Bacteria | 2976 |
| 778 | Ga0496103_0138528 | 3300048906 | Bacteria | 1555 |
| 779 | Ga0496104_0001190 | 3300048907 | Bacteria | 22376 |
| 780 | Ga0496104_0025817 | 3300048907 | Bacteria | 5417 |
| 781 | Ga0496105_0033165 | 3300048908 | Bacteria | 4239 |
| 782 | Ga0496106_0265593 | 3300048909 | Bacteria | 1373 |
| 783 | Ga0496106_0299856 | 3300048909 | Bacteria | 1289 |
| 784 | Ga0496107_0509329 | 3300048910 | Bacteria | 892 |
| 785 | Ga0496108_0033619 | 3300048911 | Bacteria | 4259 |
| 786 | Ga0496109_0169718 | 3300048912 | Bacteria | 2046 |
| 787 | Ga0496109_0209862 | 3300048912 | Bacteria | 1831 |
| 788 | Ga0496110_0069026 | 3300048913 | Bacteria | 3129 |
| 789 | Ga0496110_0118655 | 3300048913 | Bacteria | 2382 |
| 790 | Ga0496111_0047620 | 3300048914 | Bacteria | 3087 |
| 791 | Ga0496111_0107234 | 3300048914 | Bacteria | 2056 |
| 792 | Ga0496112_0063022 | 3300048915 | Bacteria | 3657 |
| 793 | Ga0496112_0109011 | 3300048915 | Bacteria | 2739 |
| 794 | Ga0496113_0049574 | 3300048916 | Bacteria | 3127 |
| 795 | Ga0496113_0383144 | 3300048916 | Bacteria | 1128 |
| 796 | Ga0496114_0134333 | 3300048917 | Bacteria | 2138 |
| 797 | Ga0496114_0213102 | 3300048917 | Bacteria | 1694 |
| 798 | Ga0496115_0069779 | 3300048918 | Bacteria | 2847 |
| 799 | Ga0496115_0079844 | 3300048918 | Bacteria | 2663 |
| 800 | Ga0496115_0141854 | 3300048918 | Bacteria | 1982 |
| 801 | Ga0496115_0311737 | 3300048918 | Bacteria | 1288 |
| 802 | Ga0496115_0419580 | 3300048918 | Bacteria | 1084 |
| 803 | Ga0496116_0000244 | 3300048919 | Bacteria | 98664 |
| 804 | Ga0496116_0001934 | 3300048919 | Bacteria | 22325 |
| 805 | Ga0496116_0002132 | 3300048919 | Bacteria | 21044 |
| 806 | Ga0496116_0004982 | 3300048919 | Bacteria | 12509 |
| 807 | Ga0496116_0006593 | 3300048919 | Bacteria | 10507 |
| 808 | Ga0496117_0000043 | 3300048920 | Bacteria | 309583 |
| 809 | Ga0496117_0000168 | 3300048920 | Bacteria | 137886 |
| 810 | Ga0496117_0002568 | 3300048920 | Bacteria | 22605 |
| 811 | Ga0496117_0003691 | 3300048920 | Bacteria | 17577 |
| 812 | Ga0496117_0013621 | 3300048920 | Bacteria | 7081 |
| 813 | Ga0496117_0261953 | 3300048920 | Bacteria | 936 |
| 814 | Ga0496118_0000075 | 3300048921 | Bacteria | 196228 |
| 815 | Ga0496118_0000997 | 3300048921 | Bacteria | 44150 |
| 816 | Ga0496118_0004430 | 3300048921 | Bacteria | 16663 |
| 817 | Ga0496118_0020648 | 3300048921 | Bacteria | 5833 |
| 818 | Ga0496118_0102221 | 3300048921 | Bacteria | 1932 |
| 819 | Ga0496119_0000009 | 3300048922 | Bacteria | 443128 |
| 820 | Ga0496119_0001670 | 3300048922 | Bacteria | 25930 |
| 821 | Ga0496119_0002299 | 3300048922 | Bacteria | 21135 |
| 822 | Ga0496119_0002763 | 3300048922 | Bacteria | 18877 |
| 823 | Ga0496119_0003037 | 3300048922 | Bacteria | 17767 |
| 824 | Ga0496119_0004240 | 3300048922 | Bacteria | 14385 |
| 825 | Ga0496119_0040741 | 3300048922 | Bacteria | 2966 |
| 826 | Ga0496119_0047483 | 3300048922 | Bacteria | 2671 |
| 827 | Ga0496119_0051033 | 3300048922 | Bacteria | 2545 |
| 828 | Ga0496119_0052628 | 3300048922 | Bacteria | 2493 |
| 829 | Ga0496119_0054916 | 3300048922 | Bacteria | 2422 |
| 830 | Ga0496120_0000044 | 3300048923 | Bacteria | 192292 |
| 831 | Ga0496120_0000066 | 3300048923 | Bacteria | 167784 |
| 832 | Ga0496120_0000645 | 3300048923 | Bacteria | 51434 |
| 833 | Ga0496120_0001316 | 3300048923 | Bacteria | 30737 |
| 834 | Ga0496120_0001317 | 3300048923 | Bacteria | 30737 |
| 835 | Ga0496120_0002117 | 3300048923 | Bacteria | 21235 |
| 836 | Ga0496120_0002630 | 3300048923 | Bacteria | 17786 |
| 837 | Ga0496120_0003636 | 3300048923 | Bacteria | 13830 |
| 838 | Ga0496120_0004666 | 3300048923 | Bacteria | 11318 |
| 839 | Ga0496120_0015824 | 3300048923 | Bacteria | 4956 |
| 840 | Ga0496120_0016305 | 3300048923 | Bacteria | 4860 |
| 841 | Ga0496121_0003294 | 3300048924 | Bacteria | 23192 |
| 842 | Ga0496121_0003770 | 3300048924 | Bacteria | 21180 |
| 843 | Ga0496121_0004311 | 3300048924 | Bacteria | 19263 |
| 844 | Ga0496121_0020778 | 3300048924 | Bacteria | 6473 |
| 845 | Ga0496121_0023512 | 3300048924 | Bacteria | 5931 |
| 846 | Ga0496121_0039163 | 3300048924 | Bacteria | 4183 |
| 847 | Ga0496121_0074185 | 3300048924 | Bacteria | 2723 |
| 848 | Ga0496122_0000016 | 3300048925 | Bacteria | 443353 |
| 849 | Ga0496122_0000339 | 3300048925 | Bacteria | 101614 |
| 850 | Ga0496122_0002667 | 3300048925 | Bacteria | 24878 |
| 851 | Ga0496122_0034566 | 3300048925 | Bacteria | 4134 |
| 852 | Ga0496122_0045673 | 3300048925 | Bacteria | 3401 |
| 853 | Ga0496122_0057792 | 3300048925 | Bacteria | 2877 |
| 854 | Ga0496122_0168214 | 3300048925 | Bacteria | 1325 |
| 855 | Ga0496123_0000444 | 3300048926 | Bacteria | 74191 |
| 856 | Ga0496123_0000506 | 3300048926 | Bacteria | 67807 |
| 857 | Ga0496123_0000661 | 3300048926 | Bacteria | 57023 |
| 858 | Ga0496123_0002548 | 3300048926 | Bacteria | 22226 |
| 859 | Ga0496123_0004933 | 3300048926 | Bacteria | 13685 |
| 860 | Ga0496123_0012294 | 3300048926 | Bacteria | 7314 |
| 861 | Ga0496123_0014727 | 3300048926 | Bacteria | 6461 |
| 862 | Ga0496123_0033475 | 3300048926 | Bacteria | 3697 |
| 863 | Ga0496124_0000069 | 3300048927 | Bacteria | 221585 |
| 864 | Ga0496124_0000164 | 3300048927 | Bacteria | 134754 |
| 865 | Ga0496124_0000544 | 3300048927 | Bacteria | 63735 |
| 866 | Ga0496124_0001338 | 3300048927 | Bacteria | 37019 |
| 867 | Ga0496124_0001912 | 3300048927 | Bacteria | 28579 |
| 868 | Ga0496124_0008345 | 3300048927 | Bacteria | 10850 |
| 869 | Ga0496124_0045655 | 3300048927 | Bacteria | 3755 |
| 870 | Ga0496124_0086212 | 3300048927 | Bacteria | 2570 |
| 871 | Ga0496124_0196274 | 3300048927 | Bacteria | 1539 |
| 872 | Ga0496125_0000081 | 3300048928 | Bacteria | 228069 |
| 873 | Ga0496125_0004962 | 3300048928 | Bacteria | 15049 |
| 874 | Ga0496125_0013881 | 3300048928 | Bacteria | 7883 |
| 875 | Ga0496125_0034260 | 3300048928 | Bacteria | 4478 |
| 876 | Ga0496126_0000983 | 3300048929 | Bacteria | 48840 |
| 877 | Ga0496126_0003685 | 3300048929 | Bacteria | 19134 |
| 878 | Ga0496126_0023761 | 3300048929 | Bacteria | 5935 |
| 879 | Ga0496126_0025797 | 3300048929 | Bacteria | 5647 |
| 880 | Ga0496126_0030792 | 3300048929 | Bacteria | 5079 |
| 881 | Ga0496126_0034102 | 3300048929 | Bacteria | 4784 |
| 882 | Ga0496126_0135833 | 3300048929 | Bacteria | 2121 |
| 883 | Ga0501305_017969 | 3300049161 | Bacteria | 1020 |
| 884 | Ga0495678_000094 | 3300049459 | Bacteria | 111548 |
| 885 | Ga0495678_000214 | 3300049459 | Bacteria | 67205 |
| 886 | Ga0495678_000294 | 3300049459 | Bacteria | 54947 |
| 887 | Ga0495682_0000017 | 3300049460 | Bacteria | 233333 |
| 888 | Ga0501031_0169943 | 3300049568 | Bacteria | 1425 |
| 889 | Ga0501032_0000057 | 3300049569 | Bacteria | 98201 |
| 890 | Ga0501033_0081633 | 3300049570 | Bacteria | 2371 |
| 891 | Ga0501033_0095114 | 3300049570 | Bacteria | 2177 |
| 892 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 893 | Ga0501034_0000188 | 3300049571 | Bacteria | 115935 |
| 894 | Ga0501036_0004036 | 3300049572 | Bacteria | 11799 |
| 895 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 896 | Ga0501038_0048075 | 3300049574 | Bacteria | 3693 |
| 897 | Ga0501039_0000001 | 3300049575 | Bacteria | 449008 |
| 898 | Ga0501041_0002567 | 3300049577 | Bacteria | 10350 |
| 899 | Ga0501042_0004940 | 3300049578 | Bacteria | 8538 |
| 900 | Ga0501047_0156291 | 3300049581 | Bacteria | 2154 |
| 901 | Ga0501048_0008525 | 3300049582 | Bacteria | 7750 |
| 902 | Ga0501068_0068876 | 3300049584 | Bacteria | 2157 |
| 903 | Ga0501069_0281648 | 3300049585 | Bacteria | 973 |
| 904 | Ga0501070_0001515 | 3300049586 | Bacteria | 20712 |
| 905 | Ga0501070_0145894 | 3300049586 | Bacteria | 1953 |
| 906 | Ga0501071_0005029 | 3300049587 | Bacteria | 8454 |
| 907 | Ga0501074_0201203 | 3300049590 | Bacteria | 1419 |
| 908 | Ga0501074_0364388 | 3300049590 | Bacteria | 1025 |
| 909 | Ga0501075_0001026 | 3300049591 | Bacteria | 17906 |
| 910 | Ga0501076_0000823 | 3300049592 | Bacteria | 20155 |
| 911 | Ga0501077_0188828 | 3300049593 | Bacteria | 1309 |
| 912 | Ga0501080_0057081 | 3300049742 | Bacteria | 3635 |
| 913 | Ga0501083_0137128 | 3300049744 | Bacteria | 1603 |
| 914 | Ga0501035_0001118 | 3300049822 | Bacteria | 28029 |
| 915 | Ga0501044_0259584 | 3300049823 | Bacteria | 1676 |
| 916 | Ga0501045_0003259 | 3300049824 | Bacteria | 11087 |
| 917 | nmdc:mga03n38_8480_c1 | 3300050490 | Bacteria | 3691 |
| 918 | nmdc:mga00v17_181653_c1 | 3300050491 | Bacteria | 1357 |
| 919 | nmdc:mga00v17_249_c1 | 3300050491 | Bacteria | 31713 |
| 920 | nmdc:mga00v17_487_c1 | 3300050491 | Bacteria | 22256 |
| 921 | nmdc:mga00v17_56930_c1 | 3300050491 | Bacteria | 2391 |
| 922 | nmdc:mga0yw44_67004_c1 | 3300050492 | Bacteria | 2218 |
| 923 | nmdc:mga0k408_120948_c1 | 3300050493 | Bacteria | 1551 |
| 924 | nmdc:mga0k408_33082_c2 | 3300050493 | Bacteria | 2132 |
| 925 | nmdc:mga06z11_199016_c1 | 3300050494 | Bacteria | 1163 |
| 926 | nmdc:mga07m45_43858_c1 | 3300050496 | Bacteria | 2508 |
| 927 | nmdc:mga0n895_388760_c1 | 3300050512 | Bacteria | 1411 |
| 928 | nmdc:mga0sz30_67760_c1 | 3300050516 | Bacteria | 1533 |
| 929 | Ga0495601_0017945 | 3300053077 | Bacteria | 4302 |
| 930 | Ga0495612_0004226 | 3300053078 | Bacteria | 5958 |
| 931 | Ga0495595_0097167 | 3300053084 | Bacteria | 1418 |
| 932 | Ga0495619_0390423 | 3300053085 | Bacteria | 961 |
| 933 | Ga0500578_0014630 | 3300053086 | Bacteria | 5045 |
| 934 | Ga0500566_0121985 | 3300053094 | Bacteria | 1404 |
| 935 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 936 | Ga0500595_001547 | 3300053119 | Bacteria | 12180 |
| 937 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 938 | Ga0500573_0122153 | 3300053140 | Bacteria | 1449 |
| 939 | Ga0500616_0000458 | 3300053153 | Bacteria | 53402 |
| 940 | Ga0500619_000417 | 3300053154 | Bacteria | 7693 |
| 941 | Ga0500622_0001910 | 3300053156 | Bacteria | 15718 |
| 942 | Ga0500645_000102 | 3300053730 | Bacteria | 67660 |
| 943 | Ga0587084_004455 | 3300059477 | Bacteria | 1605 |
| 944 | Ga0587098_007484 | 3300059604 | Bacteria | 1138 |
| 945 | Ga0530510_0001520 | 3300061734 | Bacteria | 15616 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100451629 | Ga0070665_1004516292 | 263 |
| 2 | 3300005614 | Ga0068856_100558675 | Ga0068856_1005586752 | 263 |
| 3 | 3300026078 | Ga0207702_10212597 | Ga0207702_102125972 | 263 |
| 4 | 3300048911 | Ga0496108_0033619 | Ga0496108_0033619_1936_2742 | 263 |
| 5 | 3300048913 | Ga0496110_0069026 | Ga0496110_0069026_271_1077 | 263 |
| 6 | 3300048918 | Ga0496115_0419580 | Ga0496115_0419580_264_1064 | 263 |
| 7 | 3300048929 | Ga0496126_0025797 | Ga0496126_0025797_1589_2401 | 263 |
| 8 | iso_pu_bacteria | 2751185788 | 2753301396 | 263 |
| 9 | iso_pu_bacteria | 2904501621 | 2904503745 | 263 |
| 10 | iso_pu_bacteria | 2908674828 | 2908675385 | 263 |
| 11 | iso_pu_bacteria | 2919042368 | 2919045023 | 263 |
| 12 | iso_pu_bacteria | 2928500415 | 2928501410 | 263 |
| 13 | iso_pu_bacteria | 2932431166 | 2932434885 | 263 |
| 14 | iso_pu_bacteria | 2984551494 | 2984553582 | 263 |
| 15 | iso_pu_bacteria | 8002811521 | 8002813837 | 263 |
| 16 | 2162886007 | SwRhRL2b_contig_2690628 | SwRhRL2b_0703.00006900 | 264 |
| 17 | 2162886007 | SwRhRL2b_contig_465629 | SwRhRL2b_0009.00007180 | 264 |
| 18 | 2162886007 | SwRhRL2b_contig_565865 | SwRhRL2b_0350.00005970 | 264 |
| 19 | 3300001979 | JGI24740J21852_10035601 | JGI24740J21852_100356013 | 264 |
| 20 | 3300002067 | JGI24735J21928_10015140 | JGI24735J21928_100151404 | 264 |
| 21 | 3300002704 | JGI25155J39150_1000694 | JGI25155J39150_10006942 | 264 |
| 22 | 3300002705 | JGI25156J39149_1006009 | JGI25156J39149_10060093 | 264 |
| 23 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001475 | 264 |
| 24 | 3300002738 | JGI25154J39366_1000800 | JGI25154J39366_100080013 | 264 |
| 25 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001465 | 264 |
| 26 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001568 | 264 |
| 27 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001568 | 264 |
| 28 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003465 | 264 |
| 29 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003465 | 264 |
| 30 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001465 | 264 |
| 31 | 3300003856 | Ga0058692_1000209 | Ga0058692_100020913 | 264 |
| 32 | 3300003856 | Ga0058692_1000390 | Ga0058692_10003903 | 264 |
| 33 | 3300003856 | Ga0058692_1001340 | Ga0058692_10013408 | 264 |
| 34 | 3300003856 | Ga0058692_1001368 | Ga0058692_10013681 | 264 |
| 35 | 3300005262 | Ga0065165_1000270 | Ga0065165_100027044 | 264 |
| 36 | 3300005288 | Ga0065714_10069175 | Ga0065714_100691755 | 264 |
| 37 | 3300005289 | Ga0065704_10002801 | Ga0065704_100028017 | 264 |
| 38 | 3300005289 | Ga0065704_10007448 | Ga0065704_100074483 | 264 |
| 39 | 3300005289 | Ga0065704_10082129 | Ga0065704_100821291 | 264 |
| 40 | 3300005289 | Ga0065704_10086266 | Ga0065704_100862663 | 264 |
| 41 | 3300005289 | Ga0065704_10136785 | Ga0065704_101367852 | 264 |
| 42 | 3300005327 | Ga0070658_10250068 | Ga0070658_102500682 | 264 |
| 43 | 3300005328 | Ga0070676_10007986 | Ga0070676_100079864 | 264 |
| 44 | 3300005328 | Ga0070676_10098984 | Ga0070676_100989842 | 264 |
| 45 | 3300005329 | Ga0070683_100144424 | Ga0070683_1001444243 | 264 |
| 46 | 3300005331 | Ga0070670_100002234 | Ga0070670_1000022348 | 264 |
| 47 | 3300005331 | Ga0070670_100043662 | Ga0070670_1000436623 | 264 |
| 48 | 3300005331 | Ga0070670_100060341 | Ga0070670_1000603414 | 264 |
| 49 | 3300005335 | Ga0070666_10025023 | Ga0070666_100250233 | 264 |
| 50 | 3300005335 | Ga0070666_10091078 | Ga0070666_100910781 | 264 |
| 51 | 3300005336 | Ga0070680_100001582 | Ga0070680_1000015828 | 264 |
| 52 | 3300005337 | Ga0070682_100124953 | Ga0070682_1001249531 | 264 |
| 53 | 3300005339 | Ga0070660_100042137 | Ga0070660_1000421372 | 264 |
| 54 | 3300005344 | Ga0070661_100027710 | Ga0070661_1000277101 | 264 |
| 55 | 3300005344 | Ga0070661_100342969 | Ga0070661_1003429692 | 264 |
| 56 | 3300005347 | Ga0070668_100184401 | Ga0070668_1001844011 | 264 |
| 57 | 3300005353 | Ga0070669_100073736 | Ga0070669_1000737363 | 264 |
| 58 | 3300005354 | Ga0070675_100182860 | Ga0070675_1001828602 | 264 |
| 59 | 3300005355 | Ga0070671_100052534 | Ga0070671_1000525342 | 264 |
| 60 | 3300005356 | Ga0070674_100021190 | Ga0070674_1000211903 | 264 |
| 61 | 3300005356 | Ga0070674_100471836 | Ga0070674_1004718361 | 264 |
| 62 | 3300005364 | Ga0070673_100056731 | Ga0070673_1000567313 | 264 |
| 63 | 3300005366 | Ga0070659_100046515 | Ga0070659_1000465155 | 264 |
| 64 | 3300005367 | Ga0070667_100053674 | Ga0070667_1000536744 | 264 |
| 65 | 3300005367 | Ga0070667_100063446 | Ga0070667_1000634463 | 264 |
| 66 | 3300005434 | Ga0070709_10000012 | Ga0070709_1000001242 | 264 |
| 67 | 3300005434 | Ga0070709_10125538 | Ga0070709_101255383 | 264 |
| 68 | 3300005435 | Ga0070714_100052293 | Ga0070714_1000522932 | 264 |
| 69 | 3300005435 | Ga0070714_100064477 | Ga0070714_1000644774 | 264 |
| 70 | 3300005435 | Ga0070714_100208226 | Ga0070714_1002082262 | 264 |
| 71 | 3300005436 | Ga0070713_100001813 | Ga0070713_1000018134 | 264 |
| 72 | 3300005456 | Ga0070678_100015524 | Ga0070678_1000155243 | 264 |
| 73 | 3300005456 | Ga0070678_100028505 | Ga0070678_1000285055 | 264 |
| 74 | 3300005457 | Ga0070662_100022103 | Ga0070662_1000221035 | 264 |
| 75 | 3300005458 | Ga0070681_10028427 | Ga0070681_100284273 | 264 |
| 76 | 3300005458 | Ga0070681_10461519 | Ga0070681_104615191 | 264 |
| 77 | 3300005459 | Ga0068867_100282921 | Ga0068867_1002829212 | 264 |
| 78 | 3300005530 | Ga0070679_100012756 | Ga0070679_1000127561 | 264 |
| 79 | 3300005530 | Ga0070679_100065499 | Ga0070679_1000654994 | 264 |
| 80 | 3300005530 | Ga0070679_100082818 | Ga0070679_1000828182 | 264 |
| 81 | 3300005535 | Ga0070684_100190969 | Ga0070684_1001909692 | 264 |
| 82 | 3300005539 | Ga0068853_100000194 | Ga0068853_10000019423 | 264 |
| 83 | 3300005543 | Ga0070672_100045872 | Ga0070672_1000458724 | 264 |
| 84 | 3300005543 | Ga0070672_100052614 | Ga0070672_1000526144 | 264 |
| 85 | 3300005545 | Ga0070695_100199753 | Ga0070695_1001997532 | 264 |
| 86 | 3300005548 | Ga0070665_100000033 | Ga0070665_100000033115 | 264 |
| 87 | 3300005548 | Ga0070665_100012974 | Ga0070665_1000129749 | 264 |
| 88 | 3300005548 | Ga0070665_100447316 | Ga0070665_1004473162 | 264 |
| 89 | 3300005548 | Ga0070665_100952501 | Ga0070665_1009525011 | 264 |
| 90 | 3300005563 | Ga0068855_100132425 | Ga0068855_1001324252 | 264 |
| 91 | 3300005564 | Ga0070664_100057086 | Ga0070664_1000570864 | 264 |
| 92 | 3300005564 | Ga0070664_100082623 | Ga0070664_1000826232 | 264 |
| 93 | 3300005577 | Ga0068857_100000814 | Ga0068857_1000008147 | 264 |
| 94 | 3300005577 | Ga0068857_100011113 | Ga0068857_1000111134 | 264 |
| 95 | 3300005577 | Ga0068857_100067657 | Ga0068857_1000676574 | 264 |
| 96 | 3300005578 | Ga0068854_100009368 | Ga0068854_1000093685 | 264 |
| 97 | 3300005578 | Ga0068854_100017438 | Ga0068854_1000174384 | 264 |
| 98 | 3300005614 | Ga0068856_100059442 | Ga0068856_1000594422 | 264 |
| 99 | 3300005614 | Ga0068856_100063764 | Ga0068856_1000637643 | 264 |
| 100 | 3300005614 | Ga0068856_100075706 | Ga0068856_1000757063 | 264 |
| 101 | 3300005614 | Ga0068856_100287368 | Ga0068856_1002873682 | 264 |
| 102 | 3300005616 | Ga0068852_100046087 | Ga0068852_1000460874 | 264 |
| 103 | 3300005616 | Ga0068852_100480299 | Ga0068852_1004802991 | 264 |
| 104 | 3300005618 | Ga0068864_100023945 | Ga0068864_1000239455 | 264 |
| 105 | 3300005834 | Ga0068851_10006890 | Ga0068851_100068902 | 264 |
| 106 | 3300005841 | Ga0068863_100003644 | Ga0068863_1000036449 | 264 |
| 107 | 3300005841 | Ga0068863_100013348 | Ga0068863_1000133484 | 264 |
| 108 | 3300005843 | Ga0068860_100402766 | Ga0068860_1004027662 | 264 |
| 109 | 3300005985 | Ga0081539_10047180 | Ga0081539_100471804 | 264 |
| 110 | 3300006028 | Ga0070717_10156227 | Ga0070717_101562274 | 264 |
| 111 | 3300006038 | Ga0075365_10166098 | Ga0075365_101660982 | 264 |
| 112 | 3300006042 | Ga0075368_10087636 | Ga0075368_100876361 | 264 |
| 113 | 3300006051 | Ga0075364_10000454 | Ga0075364_100004549 | 264 |
| 114 | 3300006051 | Ga0075364_10000761 | Ga0075364_1000076116 | 264 |
| 115 | 3300006051 | Ga0075364_10031035 | Ga0075364_100310352 | 264 |
| 116 | 3300006051 | Ga0075364_10048076 | Ga0075364_100480762 | 264 |
| 117 | 3300006173 | Ga0070716_100016923 | Ga0070716_1000169234 | 264 |
| 118 | 3300006175 | Ga0070712_100299327 | Ga0070712_1002993272 | 264 |
| 119 | 3300006195 | Ga0075366_10016396 | Ga0075366_100163963 | 264 |
| 120 | 3300006195 | Ga0075366_10024516 | Ga0075366_100245163 | 264 |
| 121 | 3300006353 | Ga0075370_10077074 | Ga0075370_100770742 | 264 |
| 122 | 3300006358 | Ga0068871_100534576 | Ga0068871_1005345761 | 264 |
| 123 | 3300006844 | Ga0075428_100522032 | Ga0075428_1005220322 | 264 |
| 124 | 3300006871 | Ga0075434_100269286 | Ga0075434_1002692862 | 264 |
| 125 | 3300006881 | Ga0068865_100400665 | Ga0068865_1004006652 | 264 |
| 126 | 3300006946 | Ga0079104_1000039 | Ga0079104_1000039149 | 264 |
| 127 | 3300006946 | Ga0079104_1000255 | Ga0079104_100025539 | 264 |
| 128 | 3300006946 | Ga0079104_1000895 | Ga0079104_100089513 | 264 |
| 129 | 3300006946 | Ga0079104_1001436 | Ga0079104_100143610 | 264 |
| 130 | 3300006946 | Ga0079104_1001499 | Ga0079104_10014999 | 264 |
| 131 | 3300006946 | Ga0079104_1003597 | Ga0079104_10035971 | 264 |
| 132 | 3300009011 | Ga0105251_10000036 | Ga0105251_1000003693 | 264 |
| 133 | 3300009011 | Ga0105251_10001204 | Ga0105251_1000120413 | 264 |
| 134 | 3300009011 | Ga0105251_10001316 | Ga0105251_1000131613 | 264 |
| 135 | 3300009011 | Ga0105251_10001736 | Ga0105251_100017365 | 264 |
| 136 | 3300009011 | Ga0105251_10002897 | Ga0105251_100028975 | 264 |
| 137 | 3300009011 | Ga0105251_10004074 | Ga0105251_100040747 | 264 |
| 138 | 3300009011 | Ga0105251_10006180 | Ga0105251_100061805 | 264 |
| 139 | 3300009011 | Ga0105251_10013300 | Ga0105251_100133001 | 264 |
| 140 | 3300009011 | Ga0105251_10022957 | Ga0105251_100229575 | 264 |
| 141 | 3300009011 | Ga0105251_10039578 | Ga0105251_100395782 | 264 |
| 142 | 3300009011 | Ga0105251_10074566 | Ga0105251_100745662 | 264 |
| 143 | 3300009011 | Ga0105251_10093476 | Ga0105251_100934763 | 264 |
| 144 | 3300009036 | Ga0105244_10000193 | Ga0105244_1000019357 | 264 |
| 145 | 3300009036 | Ga0105244_10000225 | Ga0105244_1000022538 | 264 |
| 146 | 3300009036 | Ga0105244_10001179 | Ga0105244_1000117912 | 264 |
| 147 | 3300009036 | Ga0105244_10002608 | Ga0105244_100026088 | 264 |
| 148 | 3300009036 | Ga0105244_10003766 | Ga0105244_100037668 | 264 |
| 149 | 3300009036 | Ga0105244_10005574 | Ga0105244_100055747 | 264 |
| 150 | 3300009036 | Ga0105244_10007009 | Ga0105244_100070094 | 264 |
| 151 | 3300009036 | Ga0105244_10014009 | Ga0105244_100140092 | 264 |
| 152 | 3300009036 | Ga0105244_10024115 | Ga0105244_100241151 | 264 |
| 153 | 3300009036 | Ga0105244_10076162 | Ga0105244_100761622 | 264 |
| 154 | 3300009036 | Ga0105244_10088327 | Ga0105244_100883272 | 264 |
| 155 | 3300009036 | Ga0105244_10153717 | Ga0105244_101537171 | 264 |
| 156 | 3300009092 | Ga0105250_10000021 | Ga0105250_1000002168 | 264 |
| 157 | 3300009092 | Ga0105250_10000086 | Ga0105250_1000008619 | 264 |
| 158 | 3300009092 | Ga0105250_10000490 | Ga0105250_1000049019 | 264 |
| 159 | 3300009092 | Ga0105250_10005159 | Ga0105250_100051593 | 264 |
| 160 | 3300009092 | Ga0105250_10044379 | Ga0105250_100443792 | 264 |
| 161 | 3300009092 | Ga0105250_10088433 | Ga0105250_100884332 | 264 |
| 162 | 3300009093 | Ga0105240_10003481 | Ga0105240_1000348118 | 264 |
| 163 | 3300009093 | Ga0105240_10024207 | Ga0105240_100242073 | 264 |
| 164 | 3300009093 | Ga0105240_10138922 | Ga0105240_101389225 | 264 |
| 165 | 3300009093 | Ga0105240_10205416 | Ga0105240_102054162 | 264 |
| 166 | 3300009148 | Ga0105243_10037401 | Ga0105243_100374016 | 264 |
| 167 | 3300009174 | Ga0105241_10000012 | Ga0105241_1000001276 | 264 |
| 168 | 3300009176 | Ga0105242_10028956 | Ga0105242_100289562 | 264 |
| 169 | 3300009176 | Ga0105242_10138250 | Ga0105242_101382502 | 264 |
| 170 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011290 | 264 |
| 171 | 3300009177 | Ga0105248_10046312 | Ga0105248_100463125 | 264 |
| 172 | 3300009551 | Ga0105238_10016032 | Ga0105238_100160328 | 264 |
| 173 | 3300009551 | Ga0105238_10184008 | Ga0105238_101840083 | 264 |
| 174 | 3300009553 | Ga0105249_10838785 | Ga0105249_108387852 | 264 |
| 175 | 3300011119 | Ga0105246_10031289 | Ga0105246_100312892 | 264 |
| 176 | 3300011119 | Ga0105246_10137213 | Ga0105246_101372133 | 264 |
| 177 | 3300013100 | Ga0157373_10000745 | Ga0157373_1000074516 | 264 |
| 178 | 3300013100 | Ga0157373_10002600 | Ga0157373_1000260011 | 264 |
| 179 | 3300013100 | Ga0157373_10013651 | Ga0157373_100136512 | 264 |
| 180 | 3300013100 | Ga0157373_10036245 | Ga0157373_100362451 | 264 |
| 181 | 3300013100 | Ga0157373_10140815 | Ga0157373_101408152 | 264 |
| 182 | 3300013102 | Ga0157371_10001118 | Ga0157371_1000111812 | 264 |
| 183 | 3300013102 | Ga0157371_10001344 | Ga0157371_1000134414 | 264 |
| 184 | 3300013102 | Ga0157371_10011341 | Ga0157371_100113411 | 264 |
| 185 | 3300013102 | Ga0157371_10018105 | Ga0157371_100181055 | 264 |
| 186 | 3300013102 | Ga0157371_10028822 | Ga0157371_100288222 | 264 |
| 187 | 3300013102 | Ga0157371_10038542 | Ga0157371_100385424 | 264 |
| 188 | 3300013102 | Ga0157371_10072349 | Ga0157371_100723492 | 264 |
| 189 | 3300013102 | Ga0157371_10145211 | Ga0157371_101452112 | 264 |
| 190 | 3300013104 | Ga0157370_10000297 | Ga0157370_1000029721 | 264 |
| 191 | 3300013104 | Ga0157370_10009096 | Ga0157370_100090962 | 264 |
| 192 | 3300013104 | Ga0157370_10051542 | Ga0157370_100515424 | 264 |
| 193 | 3300013105 | Ga0157369_10006274 | Ga0157369_100062742 | 264 |
| 194 | 3300013105 | Ga0157369_10006328 | Ga0157369_100063289 | 264 |
| 195 | 3300013105 | Ga0157369_10081465 | Ga0157369_100814653 | 264 |
| 196 | 3300013105 | Ga0157369_10175771 | Ga0157369_101757713 | 264 |
| 197 | 3300013105 | Ga0157369_10370511 | Ga0157369_103705112 | 264 |
| 198 | 3300013105 | Ga0157369_10456162 | Ga0157369_104561622 | 264 |
| 199 | 3300013105 | Ga0157369_10710137 | Ga0157369_107101372 | 264 |
| 200 | 3300013105 | Ga0157369_10715397 | Ga0157369_107153971 | 264 |
| 201 | 3300013306 | Ga0163162_10048767 | Ga0163162_100487673 | 264 |
| 202 | 3300013306 | Ga0163162_10058596 | Ga0163162_100585963 | 264 |
| 203 | 3300013306 | Ga0163162_10235532 | Ga0163162_102355322 | 264 |
| 204 | 3300013307 | Ga0157372_10003156 | Ga0157372_1000315614 | 264 |
| 205 | 3300013307 | Ga0157372_10006737 | Ga0157372_1000673710 | 264 |
| 206 | 3300013307 | Ga0157372_10007335 | Ga0157372_100073353 | 264 |
| 207 | 3300013307 | Ga0157372_10009960 | Ga0157372_100099604 | 264 |
| 208 | 3300013307 | Ga0157372_10065105 | Ga0157372_100651052 | 264 |
| 209 | 3300013307 | Ga0157372_10078123 | Ga0157372_100781235 | 264 |
| 210 | 3300013307 | Ga0157372_10080415 | Ga0157372_100804152 | 264 |
| 211 | 3300013307 | Ga0157372_10101024 | Ga0157372_101010242 | 264 |
| 212 | 3300013307 | Ga0157372_10159344 | Ga0157372_101593443 | 264 |
| 213 | 3300013308 | Ga0157375_10181147 | Ga0157375_101811472 | 264 |
| 214 | 3300013308 | Ga0157375_10775296 | Ga0157375_107752961 | 264 |
| 215 | 3300014325 | Ga0163163_10037028 | Ga0163163_100370283 | 264 |
| 216 | 3300014497 | Ga0182008_10040781 | Ga0182008_100407812 | 264 |
| 217 | 3300015261 | Ga0182006_1000013 | Ga0182006_1000013261 | 264 |
| 218 | 3300015261 | Ga0182006_1013921 | Ga0182006_10139214 | 264 |
| 219 | 3300015261 | Ga0182006_1053529 | Ga0182006_10535292 | 264 |
| 220 | 3300015262 | Ga0182007_10003679 | Ga0182007_100036793 | 264 |
| 221 | 3300015265 | Ga0182005_1000689 | Ga0182005_100068912 | 264 |
| 222 | 3300015679 | Ga0183366_1002 | Ga0183366_1002283 | 264 |
| 223 | 3300015680 | Ga0183370_1002 | Ga0183370_1002283 | 264 |
| 224 | 3300015685 | Ga0183369_1002 | Ga0183369_1002283 | 264 |
| 225 | 3300015687 | Ga0183368_1005 | Ga0183368_1005283 | 264 |
| 226 | 3300017792 | Ga0163161_10000038 | Ga0163161_1000003871 | 264 |
| 227 | 3300017792 | Ga0163161_10000494 | Ga0163161_1000049412 | 264 |
| 228 | 3300017792 | Ga0163161_10026412 | Ga0163161_100264122 | 264 |
| 229 | 3300020070 | Ga0206356_11131871 | Ga0206356_111318712 | 264 |
| 230 | 3300020080 | Ga0206350_11351559 | Ga0206350_113515591 | 264 |
| 231 | 3300021384 | Ga0213876_10000103 | Ga0213876_1000010348 | 264 |
| 232 | 3300025206 | Ga0209435_100116 | Ga0209435_10011620 | 264 |
| 233 | 3300025224 | Ga0209784_100004 | Ga0209784_100004464 | 264 |
| 234 | 3300025225 | Ga0209566_100004 | Ga0209566_100004621 | 264 |
| 235 | 3300025226 | Ga0209674_100006 | Ga0209674_100006621 | 264 |
| 236 | 3300025230 | Ga0209563_100009 | Ga0209563_100009464 | 264 |
| 237 | 3300025231 | Ga0207427_100784 | Ga0207427_1007849 | 264 |
| 238 | 3300025233 | Ga0209437_100004 | Ga0209437_100004464 | 264 |
| 239 | 3300025233 | Ga0209437_100110 | Ga0209437_100110103 | 264 |
| 240 | 3300025246 | Ga0209646_1000130 | Ga0209646_100013035 | 264 |
| 241 | 3300025250 | Ga0209026_1002093 | Ga0209026_10020938 | 264 |
| 242 | 3300025253 | Ga0209677_100005 | Ga0209677_100005464 | 264 |
| 243 | 3300025256 | Ga0209759_1000456 | Ga0209759_100045617 | 264 |
| 244 | 3300025258 | Ga0209129_1000010 | Ga0209129_1000010402 | 264 |
| 245 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005621 | 264 |
| 246 | 3300025294 | Ga0209025_1000849 | Ga0209025_100084929 | 264 |
| 247 | 3300025299 | Ga0209256_1000873 | Ga0209256_100087329 | 264 |
| 248 | 3300025315 | Ga0207697_10002399 | Ga0207697_100023992 | 264 |
| 249 | 3300025321 | Ga0207656_10040793 | Ga0207656_100407932 | 264 |
| 250 | 3300025711 | Ga0207696_1000024 | Ga0207696_1000024149 | 264 |
| 251 | 3300025711 | Ga0207696_1000061 | Ga0207696_100006168 | 264 |
| 252 | 3300025711 | Ga0207696_1000079 | Ga0207696_1000079123 | 264 |
| 253 | 3300025711 | Ga0207696_1000436 | Ga0207696_100043628 | 264 |
| 254 | 3300025711 | Ga0207696_1002594 | Ga0207696_10025947 | 264 |
| 255 | 3300025711 | Ga0207696_1009243 | Ga0207696_10092433 | 264 |
| 256 | 3300025728 | Ga0207655_1000020 | Ga0207655_1000020236 | 264 |
| 257 | 3300025728 | Ga0207655_1000025 | Ga0207655_1000025359 | 264 |
| 258 | 3300025728 | Ga0207655_1000044 | Ga0207655_1000044103 | 264 |
| 259 | 3300025728 | Ga0207655_1000047 | Ga0207655_1000047236 | 264 |
| 260 | 3300025728 | Ga0207655_1000079 | Ga0207655_1000079134 | 264 |
| 261 | 3300025728 | Ga0207655_1000088 | Ga0207655_100008838 | 264 |
| 262 | 3300025728 | Ga0207655_1000150 | Ga0207655_100015035 | 264 |
| 263 | 3300025728 | Ga0207655_1000382 | Ga0207655_100038246 | 264 |
| 264 | 3300025728 | Ga0207655_1002063 | Ga0207655_10020637 | 264 |
| 265 | 3300025728 | Ga0207655_1003957 | Ga0207655_10039573 | 264 |
| 266 | 3300025728 | Ga0207655_1004443 | Ga0207655_10044437 | 264 |
| 267 | 3300025728 | Ga0207655_1014279 | Ga0207655_10142792 | 264 |
| 268 | 3300025728 | Ga0207655_1026831 | Ga0207655_10268312 | 264 |
| 269 | 3300025728 | Ga0207655_1042138 | Ga0207655_10421382 | 264 |
| 270 | 3300025735 | Ga0207713_1000028 | Ga0207713_1000028189 | 264 |
| 271 | 3300025735 | Ga0207713_1000033 | Ga0207713_1000033145 | 264 |
| 272 | 3300025735 | Ga0207713_1000051 | Ga0207713_100005169 | 264 |
| 273 | 3300025735 | Ga0207713_1000054 | Ga0207713_100005476 | 264 |
| 274 | 3300025735 | Ga0207713_1000082 | Ga0207713_100008297 | 264 |
| 275 | 3300025735 | Ga0207713_1001326 | Ga0207713_100132611 | 264 |
| 276 | 3300025735 | Ga0207713_1001432 | Ga0207713_10014323 | 264 |
| 277 | 3300025735 | Ga0207713_1020708 | Ga0207713_10207083 | 264 |
| 278 | 3300025735 | Ga0207713_1021697 | Ga0207713_10216972 | 264 |
| 279 | 3300025735 | Ga0207713_1041556 | Ga0207713_10415562 | 264 |
| 280 | 3300025893 | Ga0207682_10020483 | Ga0207682_100204832 | 264 |
| 281 | 3300025900 | Ga0207710_10000042 | Ga0207710_1000004269 | 264 |
| 282 | 3300025904 | Ga0207647_10040161 | Ga0207647_100401614 | 264 |
| 283 | 3300025906 | Ga0207699_10000087 | Ga0207699_1000008722 | 264 |
| 284 | 3300025907 | Ga0207645_10000903 | Ga0207645_1000090316 | 264 |
| 285 | 3300025907 | Ga0207645_10148890 | Ga0207645_101488902 | 264 |
| 286 | 3300025909 | Ga0207705_10047691 | Ga0207705_100476913 | 264 |
| 287 | 3300025909 | Ga0207705_10226511 | Ga0207705_102265112 | 264 |
| 288 | 3300025911 | Ga0207654_10000015 | Ga0207654_1000001576 | 264 |
| 289 | 3300025912 | Ga0207707_10010873 | Ga0207707_100108732 | 264 |
| 290 | 3300025913 | Ga0207695_10002294 | Ga0207695_1000229424 | 264 |
| 291 | 3300025913 | Ga0207695_10161596 | Ga0207695_101615963 | 264 |
| 292 | 3300025913 | Ga0207695_10197062 | Ga0207695_101970623 | 264 |
| 293 | 3300025915 | Ga0207693_10008546 | Ga0207693_100085464 | 264 |
| 294 | 3300025915 | Ga0207693_10370477 | Ga0207693_103704772 | 264 |
| 295 | 3300025917 | Ga0207660_10086835 | Ga0207660_100868352 | 264 |
| 296 | 3300025919 | Ga0207657_10012629 | Ga0207657_100126294 | 264 |
| 297 | 3300025919 | Ga0207657_10021933 | Ga0207657_100219335 | 264 |
| 298 | 3300025920 | Ga0207649_10035183 | Ga0207649_100351833 | 264 |
| 299 | 3300025920 | Ga0207649_10443453 | Ga0207649_104434531 | 264 |
| 300 | 3300025921 | Ga0207652_10039042 | Ga0207652_100390422 | 264 |
| 301 | 3300025921 | Ga0207652_10102751 | Ga0207652_101027513 | 264 |
| 302 | 3300025921 | Ga0207652_10160815 | Ga0207652_101608153 | 264 |
| 303 | 3300025922 | Ga0207646_10227450 | Ga0207646_102274503 | 264 |
| 304 | 3300025923 | Ga0207681_10065868 | Ga0207681_100658684 | 264 |
| 305 | 3300025924 | Ga0207694_10155401 | Ga0207694_101554013 | 264 |
| 306 | 3300025925 | Ga0207650_10002884 | Ga0207650_100028848 | 264 |
| 307 | 3300025925 | Ga0207650_10070846 | Ga0207650_100708464 | 264 |
| 308 | 3300025925 | Ga0207650_10076110 | Ga0207650_100761102 | 264 |
| 309 | 3300025925 | Ga0207650_10147743 | Ga0207650_101477433 | 264 |
| 310 | 3300025926 | Ga0207659_10056797 | Ga0207659_100567972 | 264 |
| 311 | 3300025926 | Ga0207659_10184631 | Ga0207659_101846312 | 264 |
| 312 | 3300025928 | Ga0207700_10017057 | Ga0207700_100170574 | 264 |
| 313 | 3300025929 | Ga0207664_10021636 | Ga0207664_100216365 | 264 |
| 314 | 3300025929 | Ga0207664_10039614 | Ga0207664_100396143 | 264 |
| 315 | 3300025929 | Ga0207664_10356385 | Ga0207664_103563852 | 264 |
| 316 | 3300025932 | Ga0207690_10042597 | Ga0207690_100425976 | 264 |
| 317 | 3300025933 | Ga0207706_10019655 | Ga0207706_100196554 | 264 |
| 318 | 3300025933 | Ga0207706_10039451 | Ga0207706_100394515 | 264 |
| 319 | 3300025933 | Ga0207706_10059992 | Ga0207706_100599924 | 264 |
| 320 | 3300025933 | Ga0207706_10185017 | Ga0207706_101850172 | 264 |
| 321 | 3300025934 | Ga0207686_10029977 | Ga0207686_100299772 | 264 |
| 322 | 3300025934 | Ga0207686_10069316 | Ga0207686_100693161 | 264 |
| 323 | 3300025934 | Ga0207686_10302652 | Ga0207686_103026522 | 264 |
| 324 | 3300025935 | Ga0207709_10489262 | Ga0207709_104892622 | 264 |
| 325 | 3300025937 | Ga0207669_10200730 | Ga0207669_102007302 | 264 |
| 326 | 3300025938 | Ga0207704_10254324 | Ga0207704_102543241 | 264 |
| 327 | 3300025940 | Ga0207691_10000137 | Ga0207691_1000013719 | 264 |
| 328 | 3300025940 | Ga0207691_10006161 | Ga0207691_100061614 | 264 |
| 329 | 3300025940 | Ga0207691_10115192 | Ga0207691_101151922 | 264 |
| 330 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001581 | 264 |
| 331 | 3300025941 | Ga0207711_10017576 | Ga0207711_100175765 | 264 |
| 332 | 3300025941 | Ga0207711_10316600 | Ga0207711_103166002 | 264 |
| 333 | 3300025945 | Ga0207679_10020313 | Ga0207679_100203135 | 264 |
| 334 | 3300025945 | Ga0207679_10033555 | Ga0207679_100335553 | 264 |
| 335 | 3300025945 | Ga0207679_10279030 | Ga0207679_102790302 | 264 |
| 336 | 3300025949 | Ga0207667_10058404 | Ga0207667_100584044 | 264 |
| 337 | 3300025949 | Ga0207667_10071359 | Ga0207667_100713592 | 264 |
| 338 | 3300025960 | Ga0207651_10298927 | Ga0207651_102989272 | 264 |
| 339 | 3300025961 | Ga0207712_10582060 | Ga0207712_105820601 | 264 |
| 340 | 3300025972 | Ga0207668_10013400 | Ga0207668_100134002 | 264 |
| 341 | 3300025986 | Ga0207658_10090265 | Ga0207658_100902653 | 264 |
| 342 | 3300026041 | Ga0207639_10000462 | Ga0207639_1000046221 | 264 |
| 343 | 3300026067 | Ga0207678_10060377 | Ga0207678_100603774 | 264 |
| 344 | 3300026078 | Ga0207702_10005398 | Ga0207702_100053984 | 264 |
| 345 | 3300026078 | Ga0207702_10077746 | Ga0207702_100777463 | 264 |
| 346 | 3300026078 | Ga0207702_10135098 | Ga0207702_101350982 | 264 |
| 347 | 3300026088 | Ga0207641_10005715 | Ga0207641_100057155 | 264 |
| 348 | 3300026088 | Ga0207641_10010661 | Ga0207641_100106614 | 264 |
| 349 | 3300026089 | Ga0207648_10032321 | Ga0207648_100323216 | 264 |
| 350 | 3300026095 | Ga0207676_10001289 | Ga0207676_1000128910 | 264 |
| 351 | 3300026116 | Ga0207674_10002466 | Ga0207674_1000246612 | 264 |
| 352 | 3300026116 | Ga0207674_10019429 | Ga0207674_100194291 | 264 |
| 353 | 3300026116 | Ga0207674_10045539 | Ga0207674_100455394 | 264 |
| 354 | 3300026116 | Ga0207674_10206492 | Ga0207674_102064922 | 264 |
| 355 | 3300026121 | Ga0207683_10007029 | Ga0207683_100070297 | 264 |
| 356 | 3300026121 | Ga0207683_10009456 | Ga0207683_100094565 | 264 |
| 357 | 3300026121 | Ga0207683_10119885 | Ga0207683_101198853 | 264 |
| 358 | 3300026121 | Ga0207683_10226064 | Ga0207683_102260641 | 264 |
| 359 | 3300026142 | Ga0207698_10026189 | Ga0207698_100261894 | 264 |
| 360 | 3300026142 | Ga0207698_10048178 | Ga0207698_100481785 | 264 |
| 361 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007240 | 264 |
| 362 | 3300027111 | Ga0209281_1000025 | Ga0209281_1000025419 | 264 |
| 363 | 3300027111 | Ga0209281_1000048 | Ga0209281_1000048154 | 264 |
| 364 | 3300027111 | Ga0209281_1000066 | Ga0209281_100006683 | 264 |
| 365 | 3300027111 | Ga0209281_1000092 | Ga0209281_100009277 | 264 |
| 366 | 3300027111 | Ga0209281_1000133 | Ga0209281_1000133148 | 264 |
| 367 | 3300027111 | Ga0209281_1000593 | Ga0209281_100059313 | 264 |
| 368 | 3300027111 | Ga0209281_1000990 | Ga0209281_10009905 | 264 |
| 369 | 3300027111 | Ga0209281_1001123 | Ga0209281_10011232 | 264 |
| 370 | 3300027111 | Ga0209281_1001194 | Ga0209281_10011942 | 264 |
| 371 | 3300027111 | Ga0209281_1002152 | Ga0209281_10021528 | 264 |
| 372 | 3300027111 | Ga0209281_1002761 | Ga0209281_10027616 | 264 |
| 373 | 3300027312 | Ga0209371_1000010 | Ga0209371_1000010870 | 264 |
| 374 | 3300027312 | Ga0209371_1000013 | Ga0209371_1000013223 | 264 |
| 375 | 3300027312 | Ga0209371_1000019 | Ga0209371_1000019107 | 264 |
| 376 | 3300027312 | Ga0209371_1000020 | Ga0209371_1000020338 | 264 |
| 377 | 3300027312 | Ga0209371_1000254 | Ga0209371_100025413 | 264 |
| 378 | 3300027312 | Ga0209371_1000335 | Ga0209371_10003354 | 264 |
| 379 | 3300027312 | Ga0209371_1000384 | Ga0209371_100038434 | 264 |
| 380 | 3300027312 | Ga0209371_1001152 | Ga0209371_10011524 | 264 |
| 381 | 3300027312 | Ga0209371_1001568 | Ga0209371_10015687 | 264 |
| 382 | 3300027312 | Ga0209371_1004089 | Ga0209371_10040895 | 264 |
| 383 | 3300027360 | Ga0209969_1000315 | Ga0209969_10003155 | 264 |
| 384 | 3300027364 | Ga0209967_1002256 | Ga0209967_10022561 | 264 |
| 385 | 3300027462 | Ga0210000_1004231 | Ga0210000_10042312 | 264 |
| 386 | 3300027526 | Ga0209968_1007518 | Ga0209968_10075182 | 264 |
| 387 | 3300027543 | Ga0209999_1001909 | Ga0209999_10019092 | 264 |
| 388 | 3300027614 | Ga0209970_1000079 | Ga0209970_10000794 | 264 |
| 389 | 3300027876 | Ga0209974_10001694 | Ga0209974_100016943 | 264 |
| 390 | 3300028379 | Ga0268266_10000041 | Ga0268266_1000004114 | 264 |
| 391 | 3300028379 | Ga0268266_10000058 | Ga0268266_10000058197 | 264 |
| 392 | 3300028379 | Ga0268266_10194541 | Ga0268266_101945412 | 264 |
| 393 | 3300028379 | Ga0268266_10320560 | Ga0268266_103205602 | 264 |
| 394 | 3300028556 | Ga0265337_1001493 | Ga0265337_100149312 | 264 |
| 395 | 3300028577 | Ga0265318_10027709 | Ga0265318_100277093 | 264 |
| 396 | 3300028794 | Ga0307515_10071160 | Ga0307515_100711604 | 264 |
| 397 | 3300028794 | Ga0307515_10169646 | Ga0307515_101696462 | 264 |
| 398 | 3300030500 | Ga0268256_1000014 | Ga0268256_1000014455 | 264 |
| 399 | 3300030500 | Ga0268256_1000024 | Ga0268256_1000024418 | 264 |
| 400 | 3300030500 | Ga0268256_1000057 | Ga0268256_1000057174 | 264 |
| 401 | 3300030500 | Ga0268256_1000110 | Ga0268256_1000110102 | 264 |
| 402 | 3300030500 | Ga0268256_1000346 | Ga0268256_10003467 | 264 |
| 403 | 3300030500 | Ga0268256_1000983 | Ga0268256_100098310 | 264 |
| 404 | 3300030500 | Ga0268256_1000993 | Ga0268256_10009936 | 264 |
| 405 | 3300030500 | Ga0268256_1001344 | Ga0268256_10013449 | 264 |
| 406 | 3300030500 | Ga0268256_1001953 | Ga0268256_10019535 | 264 |
| 407 | 3300030500 | Ga0268256_1002231 | Ga0268256_10022317 | 264 |
| 408 | 3300030500 | Ga0268256_1003822 | Ga0268256_10038222 | 264 |
| 409 | 3300030500 | Ga0268256_1011667 | Ga0268256_10116673 | 264 |
| 410 | 3300030521 | Ga0307511_10000620 | Ga0307511_100006205 | 264 |
| 411 | 3300030745 | Ga0316182_1346215 | Ga0316182_13462152 | 264 |
| 412 | 3300031238 | Ga0265332_10003432 | Ga0265332_100034327 | 264 |
| 413 | 3300031239 | Ga0265328_10002271 | Ga0265328_100022716 | 264 |
| 414 | 3300031240 | Ga0265320_10013376 | Ga0265320_100133763 | 264 |
| 415 | 3300031247 | Ga0265340_10053567 | Ga0265340_100535673 | 264 |
| 416 | 3300031249 | Ga0265339_10016795 | Ga0265339_100167953 | 264 |
| 417 | 3300031250 | Ga0265331_10000055 | Ga0265331_10000055132 | 264 |
| 418 | 3300031250 | Ga0265331_10002356 | Ga0265331_100023569 | 264 |
| 419 | 3300031251 | Ga0265327_10000045 | Ga0265327_10000045234 | 264 |
| 420 | 3300031251 | Ga0265327_10003148 | Ga0265327_100031483 | 264 |
| 421 | 3300031251 | Ga0265327_10007016 | Ga0265327_100070169 | 264 |
| 422 | 3300031251 | Ga0265327_10008612 | Ga0265327_100086126 | 264 |
| 423 | 3300031251 | Ga0265327_10033638 | Ga0265327_100336384 | 264 |
| 424 | 3300031548 | Ga0307408_100009128 | Ga0307408_1000091283 | 264 |
| 425 | 3300031548 | Ga0307408_100053288 | Ga0307408_1000532883 | 264 |
| 426 | 3300031548 | Ga0307408_100295688 | Ga0307408_1002956881 | 264 |
| 427 | 3300031595 | Ga0265313_10008665 | Ga0265313_100086655 | 264 |
| 428 | 3300031665 | Ga0316575_10002561 | Ga0316575_100025615 | 264 |
| 429 | 3300031665 | Ga0316575_10041573 | Ga0316575_100415733 | 264 |
| 430 | 3300031727 | Ga0316576_10055130 | Ga0316576_100551302 | 264 |
| 431 | 3300031731 | Ga0307405_10020703 | Ga0307405_100207032 | 264 |
| 432 | 3300031731 | Ga0307405_10130859 | Ga0307405_101308591 | 264 |
| 433 | 3300031731 | Ga0307405_10149915 | Ga0307405_101499153 | 264 |
| 434 | 3300031731 | Ga0307405_10232859 | Ga0307405_102328592 | 264 |
| 435 | 3300031824 | Ga0307413_10012718 | Ga0307413_100127185 | 264 |
| 436 | 3300031824 | Ga0307413_10107016 | Ga0307413_101070164 | 264 |
| 437 | 3300031852 | Ga0307410_10013387 | Ga0307410_100133874 | 264 |
| 438 | 3300031852 | Ga0307410_10025506 | Ga0307410_100255062 | 264 |
| 439 | 3300031852 | Ga0307410_10030981 | Ga0307410_100309815 | 264 |
| 440 | 3300031852 | Ga0307410_10321702 | Ga0307410_103217021 | 264 |
| 441 | 3300031901 | Ga0307406_10113216 | Ga0307406_101132161 | 264 |
| 442 | 3300031903 | Ga0307407_10043531 | Ga0307407_100435311 | 264 |
| 443 | 3300031903 | Ga0307407_10265341 | Ga0307407_102653412 | 264 |
| 444 | 3300031911 | Ga0307412_10199933 | Ga0307412_101999332 | 264 |
| 445 | 3300031995 | Ga0307409_100024912 | Ga0307409_1000249124 | 264 |
| 446 | 3300031995 | Ga0307409_100101515 | Ga0307409_1001015152 | 264 |
| 447 | 3300031995 | Ga0307409_100514325 | Ga0307409_1005143252 | 264 |
| 448 | 3300032002 | Ga0307416_100005598 | Ga0307416_1000055985 | 264 |
| 449 | 3300032002 | Ga0307416_100085930 | Ga0307416_1000859303 | 264 |
| 450 | 3300032002 | Ga0307416_100724931 | Ga0307416_1007249312 | 264 |
| 451 | 3300032004 | Ga0307414_10174633 | Ga0307414_101746332 | 264 |
| 452 | 3300032004 | Ga0307414_10300127 | Ga0307414_103001272 | 264 |
| 453 | 3300032005 | Ga0307411_10009499 | Ga0307411_100094995 | 264 |
| 454 | 3300032005 | Ga0307411_10157542 | Ga0307411_101575421 | 264 |
| 455 | 3300032126 | Ga0307415_100000718 | Ga0307415_1000007185 | 264 |
| 456 | 3300032126 | Ga0307415_100028637 | Ga0307415_1000286375 | 264 |
| 457 | 3300032126 | Ga0307415_100505564 | Ga0307415_1005055641 | 264 |
| 458 | 3300032133 | Ga0316583_10005256 | Ga0316583_100052565 | 264 |
| 459 | 3300032133 | Ga0316583_10033334 | Ga0316583_100333342 | 264 |
| 460 | 3300032168 | Ga0316593_10000900 | Ga0316593_100009003 | 264 |
| 461 | 3300032168 | Ga0316593_10032516 | Ga0316593_100325161 | 264 |
| 462 | 3300034818 | Ga0373950_0004424 | Ga0373950_0004424_443_1267 | 264 |
| 463 | 3300035089 | Ga0373944_0005254 | Ga0373944_0005254_2381_3175 | 264 |
| 464 | 3300035111 | Ga0373923_0000792 | Ga0373923_0000792_4700_5494 | 264 |
| 465 | 3300035113 | Ga0373936_0001246 | Ga0373936_0001246_6947_7741 | 264 |
| 466 | 3300035114 | Ga0373939_0000033 | Ga0373939_0000033_38366_39190 | 264 |
| 467 | 3300035114 | Ga0373939_0003966 | Ga0373939_0003966_1537_2331 | 264 |
| 468 | 3300035116 | Ga0373945_0002836 | Ga0373945_0002836_123_917 | 264 |
| 469 | 3300035118 | Ga0373954_0009128 | Ga0373954_0009128_1281_2075 | 264 |
| 470 | 3300035119 | Ga0373956_0070534 | Ga0373956_0070534_658_1452 | 264 |
| 471 | 3300035121 | Ga0373960_0000774 | Ga0373960_0000774_2588_3412 | 264 |
| 472 | 3300035170 | Ga0373943_0007158 | Ga0373943_0007158_2881_3675 | 264 |
| 473 | 3300035171 | Ga0373946_0001845 | Ga0373946_0001845_5191_5985 | 264 |
| 474 | 3300035172 | Ga0373955_0037791 | Ga0373955_0037791_641_1435 | 264 |
| 475 | 3300035242 | Ga0373962_0006886 | Ga0373962_0006886_856_1680 | 264 |
| 476 | 3300035398 | Ga0316574_0027516 | Ga0316574_0027516_984_1778 | 264 |
| 477 | 3300035398 | Ga0316574_0041517 | Ga0316574_0041517_689_1483 | 264 |
| 478 | 3300035398 | Ga0316574_0083970 | Ga0316574_0083970_272_1066 | 264 |
| 479 | 3300035398 | Ga0316574_0205324 | Ga0316574_0205324_61_855 | 264 |
| 480 | 3300035410 | Ga0373924_0020351 | Ga0373924_0020351_182_976 | 264 |
| 481 | 3300035691 | Ga0373931_0000478 | Ga0373931_0000478_2487_3311 | 264 |
| 482 | 3300035692 | Ga0373935_0005968 | Ga0373935_0005968_3811_4605 | 264 |
| 483 | 3300035695 | Ga0373927_0004839 | Ga0373927_0004839_5380_6174 | 264 |
| 484 | 3300035724 | Ga0373933_0035802 | Ga0373933_0035802_713_1507 | 264 |
| 485 | 3300036647 | Ga0316582_0005223 | Ga0316582_0005223_4210_5004 | 264 |
| 486 | 3300037068 | Ga0373925_0023646 | Ga0373925_0023646_995_1789 | 264 |
| 487 | 3300037312 | Ga0395899_0001908 | Ga0395899_0001908_3032_3826 | 264 |
| 488 | 3300037312 | Ga0395899_0002251 | Ga0395899_0002251_10443_11237 | 264 |
| 489 | 3300037312 | Ga0395899_0008511 | Ga0395899_0008511_3314_4108 | 264 |
| 490 | 3300037312 | Ga0395899_0020604 | Ga0395899_0020604_878_1672 | 264 |
| 491 | 3300037312 | Ga0395899_0030956 | Ga0395899_0030956_1407_2201 | 264 |
| 492 | 3300037312 | Ga0395899_0200264 | Ga0395899_0200264_434_1228 | 264 |
| 493 | 3300037418 | Ga0395900_0000221 | Ga0395900_0000221_42388_43182 | 264 |
| 494 | 3300037418 | Ga0395900_0002564 | Ga0395900_0002564_16232_17026 | 264 |
| 495 | 3300037418 | Ga0395900_0017051 | Ga0395900_0017051_1394_2188 | 264 |
| 496 | 3300037418 | Ga0395900_0022497 | Ga0395900_0022497_2286_3080 | 264 |
| 497 | 3300037418 | Ga0395900_0092496 | Ga0395900_0092496_1235_2029 | 264 |
| 498 | 3300037418 | Ga0395900_0122907 | Ga0395900_0122907_29_823 | 264 |
| 499 | 3300037466 | Ga0395898_0000053 | Ga0395898_0000053_236419_237213 | 264 |
| 500 | 3300037466 | Ga0395898_0027810 | Ga0395898_0027810_1351_2145 | 264 |
| 501 | 3300037466 | Ga0395898_0058142 | Ga0395898_0058142_2658_3452 | 264 |
| 502 | 3300037466 | Ga0395898_0106921 | Ga0395898_0106921_1530_2324 | 264 |
| 503 | 3300037466 | Ga0395898_0119137 | Ga0395898_0119137_362_1156 | 264 |
| 504 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_441957_442751 | 264 |
| 505 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_49545_50339 | 264 |
| 506 | 3300037471 | Ga0395905_0002276 | Ga0395905_0002276_6700_7494 | 264 |
| 507 | 3300037471 | Ga0395905_0003830 | Ga0395905_0003830_12642_13436 | 264 |
| 508 | 3300037471 | Ga0395905_0010954 | Ga0395905_0010954_7269_8063 | 264 |
| 509 | 3300037471 | Ga0395905_0017189 | Ga0395905_0017189_4119_4913 | 264 |
| 510 | 3300037471 | Ga0395905_0047544 | Ga0395905_0047544_385_1179 | 264 |
| 511 | 3300037471 | Ga0395905_0078961 | Ga0395905_0078961_1191_1985 | 264 |
| 512 | 3300037471 | Ga0395905_0287986 | Ga0395905_0287986_132_926 | 264 |
| 513 | 3300037471 | Ga0395905_0692986 | Ga0395905_0692986_61_855 | 264 |
| 514 | 3300038443 | Ga0395901_0000163 | Ga0395901_0000163_10361_11155 | 264 |
| 515 | 3300038443 | Ga0395901_0018049 | Ga0395901_0018049_109_903 | 264 |
| 516 | 3300038443 | Ga0395901_0018431 | Ga0395901_0018431_1439_2233 | 264 |
| 517 | 3300038443 | Ga0395901_0133193 | Ga0395901_0133193_810_1604 | 264 |
| 518 | 3300038443 | Ga0395901_0202149 | Ga0395901_0202149_910_1704 | 264 |
| 519 | 3300038726 | Ga0400490_27390 | Ga0400490_27390_19122_19916 | 264 |
| 520 | 3300038726 | Ga0400490_44394 | Ga0400490_44394_493_1287 | 264 |
| 521 | 3300038735 | Ga0400485_18763 | Ga0400485_18763_29097_29891 | 264 |
| 522 | 3300038741 | Ga0400488_13388 | Ga0400488_13388_1885_2679 | 264 |
| 523 | 3300038741 | Ga0400488_17616 | Ga0400488_17616_77_871 | 264 |
| 524 | 3300038742 | Ga0400486_28155 | Ga0400486_28155_66472_67266 | 264 |
| 525 | 3300038742 | Ga0400486_30217 | Ga0400486_30217_1326_2120 | 264 |
| 526 | 3300039062 | Ga0400483_287441 | Ga0400483_287441_2617_3411 | 264 |
| 527 | 3300039110 | Ga0400487_52424 | Ga0400487_52424_51510_52304 | 264 |
| 528 | 3300039110 | Ga0400487_54158 | Ga0400487_54158_19600_20394 | 264 |
| 529 | 3300039437 | Ga0436365_1861022 | Ga0436365_1861022_16806_17600 | 264 |
| 530 | 3300041404 | Ga0439436_0038897 | Ga0439436_0038897_71_874 | 264 |
| 531 | 3300041405 | Ga0439438_000059 | Ga0439438_000059_10523_11317 | 264 |
| 532 | 3300041405 | Ga0439438_000165 | Ga0439438_000165_14463_15257 | 264 |
| 533 | 3300041405 | Ga0439438_059606 | Ga0439438_059606_59_853 | 264 |
| 534 | 3300041456 | Ga0451795_0735138 | Ga0451795_0735138_455_1249 | 264 |
| 535 | 3300042007 | Ga0439449_0002757 | Ga0439449_0002757_494_1297 | 264 |
| 536 | 3300042007 | Ga0439449_0011505 | Ga0439449_0011505_1079_1882 | 264 |
| 537 | 3300042010 | Ga0439452_000006 | Ga0439452_000006_372823_373617 | 264 |
| 538 | 3300042010 | Ga0439452_000013 | Ga0439452_000013_112423_113217 | 264 |
| 539 | 3300042010 | Ga0439452_000187 | Ga0439452_000187_23685_24479 | 264 |
| 540 | 3300042010 | Ga0439452_000189 | Ga0439452_000189_23375_24169 | 264 |
| 541 | 3300042010 | Ga0439452_000375 | Ga0439452_000375_2524_3318 | 264 |
| 542 | 3300042010 | Ga0439452_006248 | Ga0439452_006248_382_1176 | 264 |
| 543 | 3300042146 | Ga0450907_000024 | Ga0450907_000024_5856_6650 | 264 |
| 544 | 3300042435 | Ga0439434_0032604 | Ga0439434_0032604_409_1203 | 264 |
| 545 | 3300042439 | Ga0439464_0085984 | Ga0439464_0085984_59_853 | 264 |
| 546 | 3300042439 | Ga0439464_0098273 | Ga0439464_0098273_79_873 | 264 |
| 547 | 3300042876 | Ga0451577_0138257 | Ga0451577_0138257_101_895 | 264 |
| 548 | 3300042876 | Ga0451577_0452894 | Ga0451577_0452894_84_878 | 264 |
| 549 | 3300044658 | Ga0466972_0006867 | Ga0466972_0006867_3209_4003 | 264 |
| 550 | 3300044669 | Ga0466981_0000001 | Ga0466981_0000001_57553_58347 | 264 |
| 551 | 3300044673 | Ga0453683_0002974 | Ga0453683_0002974_1797_2612 | 264 |
| 552 | 3300044683 | Ga0466965_0000627 | Ga0466965_0000627_6208_7002 | 264 |
| 553 | 3300044684 | Ga0466966_0014463 | Ga0466966_0014463_1762_2556 | 264 |
| 554 | 3300044694 | Ga0466963_0029926 | Ga0466963_0029926_757_1551 | 264 |
| 555 | 3300044694 | Ga0466963_0051127 | Ga0466963_0051127_112_906 | 264 |
| 556 | 3300044694 | Ga0466963_0054385 | Ga0466963_0054385_464_1258 | 264 |
| 557 | 3300044694 | Ga0466963_0057692 | Ga0466963_0057692_680_1474 | 264 |
| 558 | 3300044706 | Ga0466964_0010649 | Ga0466964_0010649_788_1582 | 264 |
| 559 | 3300044712 | Ga0453684_0000334 | Ga0453684_0000334_47888_48682 | 264 |
| 560 | 3300044712 | Ga0453684_0010323 | Ga0453684_0010323_7155_7949 | 264 |
| 561 | 3300044712 | Ga0453684_0045851 | Ga0453684_0045851_679_1473 | 264 |
| 562 | 3300044712 | Ga0453684_0063618 | Ga0453684_0063618_516_1310 | 264 |
| 563 | 3300044712 | Ga0453684_0187951 | Ga0453684_0187951_19_813 | 264 |
| 564 | 3300044842 | Ga0466957_0025756 | Ga0466957_0025756_546_1340 | 264 |
| 565 | 3300045049 | Ga0466959_0060564 | Ga0466959_0060564_1756_2550 | 264 |
| 566 | 3300045051 | Ga0451576_0004288 | Ga0451576_0004288_6810_7604 | 264 |
| 567 | 3300045051 | Ga0451576_0010387 | Ga0451576_0010387_8003_8797 | 264 |
| 568 | 3300045051 | Ga0451576_0011887 | Ga0451576_0011887_812_1627 | 264 |
| 569 | 3300045051 | Ga0451576_0192414 | Ga0451576_0192414_327_1121 | 264 |
| 570 | 3300045051 | Ga0451576_0401764 | Ga0451576_0401764_205_999 | 264 |
| 571 | 3300045836 | Ga0466958_0122038 | Ga0466958_0122038_99_893 | 264 |
| 572 | 3300045836 | Ga0466958_0340745 | Ga0466958_0340745_90_884 | 264 |
| 573 | 3300045976 | Ga0466967_0016064 | Ga0466967_0016064_2179_2973 | 264 |
| 574 | 3300045976 | Ga0466967_0034090 | Ga0466967_0034090_3128_3922 | 264 |
| 575 | 3300045976 | Ga0466967_0109664 | Ga0466967_0109664_1248_2042 | 264 |
| 576 | 3300045976 | Ga0466967_0683151 | Ga0466967_0683151_192_986 | 264 |
| 577 | 3300045976 | Ga0466967_0759790 | Ga0466967_0759790_25_819 | 264 |
| 578 | 3300046452 | Ga0495617_000475 | Ga0495617_000475_19990_20784 | 264 |
| 579 | 3300046453 | Ga0495627_000048 | Ga0495627_000048_17229_18023 | 264 |
| 580 | 3300046453 | Ga0495627_000651 | Ga0495627_000651_19646_20440 | 264 |
| 581 | 3300046454 | Ga0495592_0006856 | Ga0495592_0006856_4931_5725 | 264 |
| 582 | 3300046455 | Ga0495603_0003401 | Ga0495603_0003401_640_1434 | 264 |
| 583 | 3300046457 | Ga0495590_0000206 | Ga0495590_0000206_3836_4630 | 264 |
| 584 | 3300046457 | Ga0495590_0010257 | Ga0495590_0010257_923_1717 | 264 |
| 585 | 3300046458 | Ga0495591_000045 | Ga0495591_000045_68693_69487 | 264 |
| 586 | 3300046458 | Ga0495591_000102 | Ga0495591_000102_23665_24459 | 264 |
| 587 | 3300046458 | Ga0495591_002789 | Ga0495591_002789_4763_5557 | 264 |
| 588 | 3300046459 | Ga0495629_0075992 | Ga0495629_0075992_118_912 | 264 |
| 589 | 3300046460 | Ga0495638_0002096 | Ga0495638_0002096_15736_16530 | 264 |
| 590 | 3300046460 | Ga0495638_0078912 | Ga0495638_0078912_1099_1893 | 264 |
| 591 | 3300046460 | Ga0495638_0213420 | Ga0495638_0213420_51_878 | 264 |
| 592 | 3300046461 | Ga0495641_0008644 | Ga0495641_0008644_4977_5771 | 264 |
| 593 | 3300046462 | Ga0495651_0029605 | Ga0495651_0029605_178_972 | 264 |
| 594 | 3300046462 | Ga0495651_0030714 | Ga0495651_0030714_1958_2824 | 264 |
| 595 | 3300046463 | Ga0495653_0003798 | Ga0495653_0003798_709_1503 | 264 |
| 596 | 3300046463 | Ga0495653_0005421 | Ga0495653_0005421_9371_10207 | 264 |
| 597 | 3300046463 | Ga0495653_0052096 | Ga0495653_0052096_2179_2973 | 264 |
| 598 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_543557_544351 | 264 |
| 599 | 3300046471 | Ga0495650_0000059 | Ga0495650_0000059_96252_97046 | 264 |
| 600 | 3300046471 | Ga0495650_0006347 | Ga0495650_0006347_3554_4348 | 264 |
| 601 | 3300046471 | Ga0495650_0013027 | Ga0495650_0013027_1427_2221 | 264 |
| 602 | 3300046472 | Ga0495580_0015940 | Ga0495580_0015940_4744_5538 | 264 |
| 603 | 3300046472 | Ga0495580_0086190 | Ga0495580_0086190_734_1537 | 264 |
| 604 | 3300046473 | Ga0495582_0021241 | Ga0495582_0021241_2123_2926 | 264 |
| 605 | 3300046473 | Ga0495582_0205358 | Ga0495582_0205358_147_941 | 264 |
| 606 | 3300046474 | Ga0495605_0001064 | Ga0495605_0001064_6120_6914 | 264 |
| 607 | 3300046474 | Ga0495605_0122051 | Ga0495605_0122051_220_1014 | 264 |
| 608 | 3300046475 | Ga0495639_0004976 | Ga0495639_0004976_4449_5243 | 264 |
| 609 | 3300046475 | Ga0495639_0040522 | Ga0495639_0040522_927_1730 | 264 |
| 610 | 3300046476 | Ga0495662_0019363 | Ga0495662_0019363_743_1537 | 264 |
| 611 | 3300046492 | Ga0495585_0000026 | Ga0495585_0000026_6153_6947 | 264 |
| 612 | 3300046492 | Ga0495585_0000649 | Ga0495585_0000649_1974_2768 | 264 |
| 613 | 3300046492 | Ga0495585_0004130 | Ga0495585_0004130_7594_8388 | 264 |
| 614 | 3300046492 | Ga0495585_0006530 | Ga0495585_0006530_2329_3123 | 264 |
| 615 | 3300046492 | Ga0495585_0034852 | Ga0495585_0034852_392_1186 | 264 |
| 616 | 3300046499 | Ga0495594_0013331 | Ga0495594_0013331_779_1573 | 264 |
| 617 | 3300046499 | Ga0495594_0068505 | Ga0495594_0068505_987_1790 | 264 |
| 618 | 3300046499 | Ga0495594_0086848 | Ga0495594_0086848_742_1536 | 264 |
| 619 | 3300046500 | Ga0495596_0002772 | Ga0495596_0002772_2289_3083 | 264 |
| 620 | 3300046500 | Ga0495596_0011391 | Ga0495596_0011391_1786_2580 | 264 |
| 621 | 3300046501 | Ga0495607_0016352 | Ga0495607_0016352_464_1258 | 264 |
| 622 | 3300046501 | Ga0495607_0035777 | Ga0495607_0035777_431_1225 | 264 |
| 623 | 3300046506 | Ga0495583_0000009 | Ga0495583_0000009_2099_2893 | 264 |
| 624 | 3300046507 | Ga0495606_0000308 | Ga0495606_0000308_48086_48880 | 264 |
| 625 | 3300046507 | Ga0495606_0001127 | Ga0495606_0001127_1518_2312 | 264 |
| 626 | 3300046507 | Ga0495606_0023693 | Ga0495606_0023693_1076_1870 | 264 |
| 627 | 3300046513 | Ga0495616_0000569 | Ga0495616_0000569_1988_2782 | 264 |
| 628 | 3300046513 | Ga0495616_0090309 | Ga0495616_0090309_74_868 | 264 |
| 629 | 3300046514 | Ga0495618_0038370 | Ga0495618_0038370_462_1256 | 264 |
| 630 | 3300046514 | Ga0495618_0060088 | Ga0495618_0060088_102_938 | 264 |
| 631 | 3300046515 | Ga0495620_0048904 | Ga0495620_0048904_176_970 | 264 |
| 632 | 3300046516 | Ga0495628_0002411 | Ga0495628_0002411_1768_2634 | 264 |
| 633 | 3300046516 | Ga0495628_0006745 | Ga0495628_0006745_7611_8447 | 264 |
| 634 | 3300046516 | Ga0495628_0114553 | Ga0495628_0114553_293_1087 | 264 |
| 635 | 3300046517 | Ga0495630_0007589 | Ga0495630_0007589_1397_2191 | 264 |
| 636 | 3300046518 | Ga0495631_0000366 | Ga0495631_0000366_1960_2754 | 264 |
| 637 | 3300046518 | Ga0495631_0001045 | Ga0495631_0001045_13096_13890 | 264 |
| 638 | 3300046518 | Ga0495631_0001198 | Ga0495631_0001198_14795_15589 | 264 |
| 639 | 3300046518 | Ga0495631_0008656 | Ga0495631_0008656_413_1207 | 264 |
| 640 | 3300046518 | Ga0495631_0084917 | Ga0495631_0084917_190_993 | 264 |
| 641 | 3300046519 | Ga0495632_0001867 | Ga0495632_0001867_13539_14333 | 264 |
| 642 | 3300046519 | Ga0495632_0049306 | Ga0495632_0049306_579_1373 | 264 |
| 643 | 3300046520 | Ga0495637_0000891 | Ga0495637_0000891_9303_10097 | 264 |
| 644 | 3300046522 | Ga0495643_0000898 | Ga0495643_0000898_28810_29604 | 264 |
| 645 | 3300046522 | Ga0495643_0095840 | Ga0495643_0095840_422_1225 | 264 |
| 646 | 3300046522 | Ga0495643_0111068 | Ga0495643_0111068_581_1375 | 264 |
| 647 | 3300046523 | Ga0495644_0034753 | Ga0495644_0034753_175_969 | 264 |
| 648 | 3300046523 | Ga0495644_0050986 | Ga0495644_0050986_43_837 | 264 |
| 649 | 3300046524 | Ga0495648_0000866 | Ga0495648_0000866_29149_29943 | 264 |
| 650 | 3300046524 | Ga0495648_0001470 | Ga0495648_0001470_6144_6938 | 264 |
| 651 | 3300046524 | Ga0495648_0001615 | Ga0495648_0001615_17306_18100 | 264 |
| 652 | 3300046524 | Ga0495648_0001800 | Ga0495648_0001800_17973_18767 | 264 |
| 653 | 3300046524 | Ga0495648_0012590 | Ga0495648_0012590_1155_1949 | 264 |
| 654 | 3300046524 | Ga0495648_0013244 | Ga0495648_0013244_416_1210 | 264 |
| 655 | 3300046524 | Ga0495648_0082379 | Ga0495648_0082379_575_1369 | 264 |
| 656 | 3300046526 | Ga0495666_0001193 | Ga0495666_0001193_7636_8430 | 264 |
| 657 | 3300046526 | Ga0495666_0002138 | Ga0495666_0002138_7257_8051 | 264 |
| 658 | 3300046528 | Ga0495642_0001287 | Ga0495642_0001287_4428_5222 | 264 |
| 659 | 3300046528 | Ga0495642_0025390 | Ga0495642_0025390_116_910 | 264 |
| 660 | 3300046528 | Ga0495642_0026145 | Ga0495642_0026145_652_1446 | 264 |
| 661 | 3300046528 | Ga0495642_0051777 | Ga0495642_0051777_241_1044 | 264 |
| 662 | 3300046529 | Ga0495652_0177263 | Ga0495652_0177263_135_929 | 264 |
| 663 | 3300046530 | Ga0495654_0000073 | Ga0495654_0000073_67906_68700 | 264 |
| 664 | 3300046530 | Ga0495654_0000101 | Ga0495654_0000101_26227_27021 | 264 |
| 665 | 3300046530 | Ga0495654_0001104 | Ga0495654_0001104_15317_16111 | 264 |
| 666 | 3300046530 | Ga0495654_0005457 | Ga0495654_0005457_5036_5830 | 264 |
| 667 | 3300046530 | Ga0495654_0015625 | Ga0495654_0015625_947_1741 | 264 |
| 668 | 3300046531 | Ga0495665_0009870 | Ga0495665_0009870_4243_5037 | 264 |
| 669 | 3300046535 | Ga0495586_0011839 | Ga0495586_0011839_1907_2701 | 264 |
| 670 | 3300046535 | Ga0495586_0012833 | Ga0495586_0012833_136_930 | 264 |
| 671 | 3300046535 | Ga0495586_0041722 | Ga0495586_0041722_1349_2152 | 264 |
| 672 | 3300046536 | Ga0495587_0059624 | Ga0495587_0059624_318_1112 | 264 |
| 673 | 3300046538 | Ga0495609_0006494 | Ga0495609_0006494_3378_4172 | 264 |
| 674 | 3300046538 | Ga0495609_0012215 | Ga0495609_0012215_839_1633 | 264 |
| 675 | 3300046538 | Ga0495609_0051534 | Ga0495609_0051534_733_1527 | 264 |
| 676 | 3300046538 | Ga0495609_0077001 | Ga0495609_0077001_225_1019 | 264 |
| 677 | 3300046542 | Ga0495597_0000590 | Ga0495597_0000590_7151_7945 | 264 |
| 678 | 3300046542 | Ga0495597_0017841 | Ga0495597_0017841_1461_2255 | 264 |
| 679 | 3300046542 | Ga0495597_0030835 | Ga0495597_0030835_1080_1874 | 264 |
| 680 | 3300046543 | Ga0495645_0011685 | Ga0495645_0011685_5143_5979 | 264 |
| 681 | 3300046543 | Ga0495645_0041973 | Ga0495645_0041973_847_1641 | 264 |
| 682 | 3300046543 | Ga0495645_0060598 | Ga0495645_0060598_468_1262 | 264 |
| 683 | 3300046557 | Ga0495622_0004018 | Ga0495622_0004018_477_1271 | 264 |
| 684 | 3300046557 | Ga0495622_0021048 | Ga0495622_0021048_1401_2195 | 264 |
| 685 | 3300046558 | Ga0495633_0012233 | Ga0495633_0012233_1220_2014 | 264 |
| 686 | 3300046558 | Ga0495633_0050210 | Ga0495633_0050210_1026_1820 | 264 |
| 687 | 3300046558 | Ga0495633_0105505 | Ga0495633_0105505_148_951 | 264 |
| 688 | 3300046559 | Ga0495667_0037944 | Ga0495667_0037944_369_1163 | 264 |
| 689 | 3300046615 | Ga0495656_0000005 | Ga0495656_0000005_137719_138513 | 264 |
| 690 | 3300046615 | Ga0495656_0053133 | Ga0495656_0053133_470_1264 | 264 |
| 691 | 3300046616 | Ga0495668_0000848 | Ga0495668_0000848_2284_3078 | 264 |
| 692 | 3300046616 | Ga0495668_0001034 | Ga0495668_0001034_28241_29035 | 264 |
| 693 | 3300046616 | Ga0495668_0054345 | Ga0495668_0054345_1261_2055 | 264 |
| 694 | 3300046616 | Ga0495668_0057450 | Ga0495668_0057450_208_1011 | 264 |
| 695 | 3300046642 | Ga0495634_0114502 | Ga0495634_0114502_755_1549 | 264 |
| 696 | 3300046648 | Ga0495611_0005346 | Ga0495611_0005346_2254_3048 | 264 |
| 697 | 3300046648 | Ga0495611_0200252 | Ga0495611_0200252_61_855 | 264 |
| 698 | 3300046660 | Ga0495625_0004807 | Ga0495625_0004807_10267_11061 | 264 |
| 699 | 3300046660 | Ga0495625_0007834 | Ga0495625_0007834_7762_8556 | 264 |
| 700 | 3300046660 | Ga0495625_0044149 | Ga0495625_0044149_1634_2428 | 264 |
| 701 | 3300046663 | Ga0495635_0022810 | Ga0495635_0022810_2491_3285 | 264 |
| 702 | 3300046665 | Ga0495661_0004648 | Ga0495661_0004648_6676_7470 | 264 |
| 703 | 3300046665 | Ga0495661_0064576 | Ga0495661_0064576_71_865 | 264 |
| 704 | 3300046665 | Ga0495661_0158402 | Ga0495661_0158402_411_1205 | 264 |
| 705 | 3300046674 | Ga0495588_0009232 | Ga0495588_0009232_3417_4211 | 264 |
| 706 | 3300046674 | Ga0495588_0015483 | Ga0495588_0015483_211_1014 | 264 |
| 707 | 3300046674 | Ga0495588_0027406 | Ga0495588_0027406_1603_2397 | 264 |
| 708 | 3300046674 | Ga0495588_0083915 | Ga0495588_0083915_525_1319 | 264 |
| 709 | 3300046679 | Ga0495623_0002899 | Ga0495623_0002899_6786_7652 | 264 |
| 710 | 3300046679 | Ga0495623_0014822 | Ga0495623_0014822_181_1017 | 264 |
| 711 | 3300046679 | Ga0495623_0151278 | Ga0495623_0151278_491_1285 | 264 |
| 712 | 3300046680 | Ga0495646_0002496 | Ga0495646_0002496_7366_8202 | 264 |
| 713 | 3300046680 | Ga0495646_0004584 | Ga0495646_0004584_369_1163 | 264 |
| 714 | 3300046681 | Ga0495647_0000801 | Ga0495647_0000801_2708_3502 | 264 |
| 715 | 3300046683 | Ga0495658_0002290 | Ga0495658_0002290_7333_8127 | 264 |
| 716 | 3300046684 | Ga0495669_0008127 | Ga0495669_0008127_337_1131 | 264 |
| 717 | 3300046689 | Ga0495613_0047268 | Ga0495613_0047268_1603_2397 | 264 |
| 718 | 3300046689 | Ga0495613_0053577 | Ga0495613_0053577_1987_2781 | 264 |
| 719 | 3300046690 | Ga0495624_0004714 | Ga0495624_0004714_8837_9631 | 264 |
| 720 | 3300046690 | Ga0495624_0012600 | Ga0495624_0012600_2837_3631 | 264 |
| 721 | 3300046690 | Ga0495624_0221095 | Ga0495624_0221095_182_1018 | 264 |
| 722 | 3300046691 | Ga0495670_0000473 | Ga0495670_0000473_10919_11722 | 264 |
| 723 | 3300046691 | Ga0495670_0020968 | Ga0495670_0020968_1845_2639 | 264 |
| 724 | 3300046691 | Ga0495670_0032948 | Ga0495670_0032948_1413_2207 | 264 |
| 725 | 3300046691 | Ga0495670_0040762 | Ga0495670_0040762_529_1368 | 264 |
| 726 | 3300046691 | Ga0495670_0254929 | Ga0495670_0254929_25_819 | 264 |
| 727 | 3300046692 | Ga0495671_0000354 | Ga0495671_0000354_6169_6963 | 264 |
| 728 | 3300046692 | Ga0495671_0021640 | Ga0495671_0021640_696_1490 | 264 |
| 729 | 3300046694 | Ga0495649_0003899 | Ga0495649_0003899_5445_6239 | 264 |
| 730 | 3300046694 | Ga0495649_0007912 | Ga0495649_0007912_116_910 | 264 |
| 731 | 3300046694 | Ga0495649_0011769 | Ga0495649_0011769_3039_3833 | 264 |
| 732 | 3300046794 | Ga0495589_0000025 | Ga0495589_0000025_54564_55358 | 264 |
| 733 | 3300046794 | Ga0495589_0000354 | Ga0495589_0000354_33240_34034 | 264 |
| 734 | 3300046794 | Ga0495589_0001682 | Ga0495589_0001682_11385_12179 | 264 |
| 735 | 3300046794 | Ga0495589_0009736 | Ga0495589_0009736_3705_4499 | 264 |
| 736 | 3300046809 | Ga0495600_0008466 | Ga0495600_0008466_2287_3081 | 264 |
| 737 | 3300046809 | Ga0495600_0067886 | Ga0495600_0067886_369_1163 | 264 |
| 738 | 3300046810 | Ga0495660_0000019 | Ga0495660_0000019_167263_168057 | 264 |
| 739 | 3300046810 | Ga0495660_0137950 | Ga0495660_0137950_396_1190 | 264 |
| 740 | 3300047315 | Ga0495581_0000444 | Ga0495581_0000444_1648_2442 | 264 |
| 741 | 3300047315 | Ga0495581_0035891 | Ga0495581_0035891_1933_2727 | 264 |
| 742 | 3300047315 | Ga0495581_0067907 | Ga0495581_0067907_1159_1962 | 264 |
| 743 | 3300047315 | Ga0495581_0078947 | Ga0495581_0078947_367_1170 | 264 |
| 744 | 3300047317 | Ga0495604_0050124 | Ga0495604_0050124_528_1322 | 264 |
| 745 | 3300047317 | Ga0495604_0052766 | Ga0495604_0052766_462_1256 | 264 |
| 746 | 3300047317 | Ga0495604_0112847 | Ga0495604_0112847_772_1566 | 264 |
| 747 | 3300047318 | Ga0495636_0071108 | Ga0495636_0071108_632_1426 | 264 |
| 748 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_143972_144766 | 264 |
| 749 | 3300047320 | Ga0495672_0000200 | Ga0495672_0000200_55839_56633 | 264 |
| 750 | 3300047320 | Ga0495672_0002537 | Ga0495672_0002537_13739_14533 | 264 |
| 751 | 3300047320 | Ga0495672_0005433 | Ga0495672_0005433_7599_8393 | 264 |
| 752 | 3300047321 | Ga0495676_0042371 | Ga0495676_0042371_2493_3287 | 264 |
| 753 | 3300047321 | Ga0495676_0098159 | Ga0495676_0098159_1131_1925 | 264 |
| 754 | 3300047322 | Ga0495680_0267559 | Ga0495680_0267559_161_955 | 264 |
| 755 | 3300047322 | Ga0495680_0433284 | Ga0495680_0433284_54_848 | 264 |
| 756 | 3300047323 | Ga0495683_0005888 | Ga0495683_0005888_5874_6668 | 264 |
| 757 | 3300047323 | Ga0495683_0030033 | Ga0495683_0030033_721_1515 | 264 |
| 758 | 3300047323 | Ga0495683_0043527 | Ga0495683_0043527_935_1729 | 264 |
| 759 | 3300047443 | Ga0495687_000034 | Ga0495687_000034_61639_62433 | 264 |
| 760 | 3300047443 | Ga0495687_000081 | Ga0495687_000081_1945_2739 | 264 |
| 761 | 3300047443 | Ga0495687_104901 | Ga0495687_104901_222_1016 | 264 |
| 762 | 3300047444 | Ga0495675_0111005 | Ga0495675_0111005_278_1072 | 264 |
| 763 | 3300047446 | Ga0495679_000089 | Ga0495679_000089_17233_18027 | 264 |
| 764 | 3300047446 | Ga0495679_001212 | Ga0495679_001212_6446_7240 | 264 |
| 765 | 3300047446 | Ga0495679_009181 | Ga0495679_009181_1691_2485 | 264 |
| 766 | 3300047446 | Ga0495679_048717 | Ga0495679_048717_456_1250 | 264 |
| 767 | 3300047469 | Ga0495673_0000011 | Ga0495673_0000011_529730_530524 | 264 |
| 768 | 3300047469 | Ga0495673_0000124 | Ga0495673_0000124_39356_40150 | 264 |
| 769 | 3300047470 | Ga0495681_0000144 | Ga0495681_0000144_56908_57702 | 264 |
| 770 | 3300047470 | Ga0495681_0008644 | Ga0495681_0008644_2994_3788 | 264 |
| 771 | 3300047470 | Ga0495681_0034978 | Ga0495681_0034978_1361_2155 | 264 |
| 772 | 3300047470 | Ga0495681_0037875 | Ga0495681_0037875_72_866 | 264 |
| 773 | 3300047470 | Ga0495681_0114378 | Ga0495681_0114378_105_899 | 264 |
| 774 | 3300047471 | Ga0495684_0052768 | Ga0495684_0052768_1517_2311 | 264 |
| 775 | 3300047472 | Ga0495686_0009775 | Ga0495686_0009775_368_1162 | 264 |
| 776 | 3300047673 | Ga0495593_0005464 | Ga0495593_0005464_4144_4938 | 264 |
| 777 | 3300048088 | Ga0495602_0074513 | Ga0495602_0074513_487_1323 | 264 |
| 778 | 3300048091 | Ga0495626_0002847 | Ga0495626_0002847_8960_9754 | 264 |
| 779 | 3300048903 | Ga0496100_0022394 | Ga0496100_0022394_734_1537 | 264 |
| 780 | 3300048903 | Ga0496100_0120972 | Ga0496100_0120972_533_1327 | 264 |
| 781 | 3300048904 | Ga0496101_0000070 | Ga0496101_0000070_56285_57079 | 264 |
| 782 | 3300048904 | Ga0496101_0021478 | Ga0496101_0021478_1536_2330 | 264 |
| 783 | 3300048904 | Ga0496101_0068504 | Ga0496101_0068504_18_821 | 264 |
| 784 | 3300048904 | Ga0496101_0080062 | Ga0496101_0080062_146_940 | 264 |
| 785 | 3300048905 | Ga0496102_0001658 | Ga0496102_0001658_14727_15521 | 264 |
| 786 | 3300048905 | Ga0496102_0083328 | Ga0496102_0083328_1152_1955 | 264 |
| 787 | 3300048905 | Ga0496102_0099565 | Ga0496102_0099565_815_1618 | 264 |
| 788 | 3300048906 | Ga0496103_0007660 | Ga0496103_0007660_1514_2317 | 264 |
| 789 | 3300048906 | Ga0496103_0037337 | Ga0496103_0037337_2138_2941 | 264 |
| 790 | 3300048906 | Ga0496103_0138528 | Ga0496103_0138528_428_1231 | 264 |
| 791 | 3300048907 | Ga0496104_0001190 | Ga0496104_0001190_17174_17968 | 264 |
| 792 | 3300048907 | Ga0496104_0025817 | Ga0496104_0025817_4325_5128 | 264 |
| 793 | 3300048908 | Ga0496105_0033165 | Ga0496105_0033165_2441_3244 | 264 |
| 794 | 3300048909 | Ga0496106_0265593 | Ga0496106_0265593_535_1338 | 264 |
| 795 | 3300048909 | Ga0496106_0299856 | Ga0496106_0299856_371_1165 | 264 |
| 796 | 3300048910 | Ga0496107_0509329 | Ga0496107_0509329_36_839 | 264 |
| 797 | 3300048912 | Ga0496109_0169718 | Ga0496109_0169718_1225_2028 | 264 |
| 798 | 3300048912 | Ga0496109_0209862 | Ga0496109_0209862_975_1778 | 264 |
| 799 | 3300048913 | Ga0496110_0118655 | Ga0496110_0118655_1520_2323 | 264 |
| 800 | 3300048914 | Ga0496111_0047620 | Ga0496111_0047620_1990_2793 | 264 |
| 801 | 3300048914 | Ga0496111_0107234 | Ga0496111_0107234_1234_2037 | 264 |
| 802 | 3300048915 | Ga0496112_0063022 | Ga0496112_0063022_1264_2058 | 264 |
| 803 | 3300048915 | Ga0496112_0109011 | Ga0496112_0109011_1074_1877 | 264 |
| 804 | 3300048916 | Ga0496113_0049574 | Ga0496113_0049574_1380_2174 | 264 |
| 805 | 3300048916 | Ga0496113_0383144 | Ga0496113_0383144_290_1093 | 264 |
| 806 | 3300048917 | Ga0496114_0134333 | Ga0496114_0134333_1095_1898 | 264 |
| 807 | 3300048917 | Ga0496114_0213102 | Ga0496114_0213102_443_1237 | 264 |
| 808 | 3300048918 | Ga0496115_0069779 | Ga0496115_0069779_57_860 | 264 |
| 809 | 3300048918 | Ga0496115_0079844 | Ga0496115_0079844_1847_2641 | 264 |
| 810 | 3300048918 | Ga0496115_0141854 | Ga0496115_0141854_635_1429 | 264 |
| 811 | 3300048918 | Ga0496115_0311737 | Ga0496115_0311737_225_1019 | 264 |
| 812 | 3300048919 | Ga0496116_0000244 | Ga0496116_0000244_12655_13449 | 264 |
| 813 | 3300048919 | Ga0496116_0001934 | Ga0496116_0001934_4452_5246 | 264 |
| 814 | 3300048919 | Ga0496116_0002132 | Ga0496116_0002132_16725_17519 | 264 |
| 815 | 3300048919 | Ga0496116_0004982 | Ga0496116_0004982_4001_4795 | 264 |
| 816 | 3300048919 | Ga0496116_0006593 | Ga0496116_0006593_4092_4886 | 264 |
| 817 | 3300048920 | Ga0496117_0000043 | Ga0496117_0000043_111306_112100 | 264 |
| 818 | 3300048920 | Ga0496117_0000168 | Ga0496117_0000168_46498_47292 | 264 |
| 819 | 3300048920 | Ga0496117_0002568 | Ga0496117_0002568_275_1069 | 264 |
| 820 | 3300048920 | Ga0496117_0003691 | Ga0496117_0003691_2811_3605 | 264 |
| 821 | 3300048920 | Ga0496117_0013621 | Ga0496117_0013621_1579_2373 | 264 |
| 822 | 3300048920 | Ga0496117_0261953 | Ga0496117_0261953_90_884 | 264 |
| 823 | 3300048921 | Ga0496118_0000075 | Ga0496118_0000075_111306_112100 | 264 |
| 824 | 3300048921 | Ga0496118_0000997 | Ga0496118_0000997_32378_33172 | 264 |
| 825 | 3300048921 | Ga0496118_0004430 | Ga0496118_0004430_6521_7315 | 264 |
| 826 | 3300048921 | Ga0496118_0020648 | Ga0496118_0020648_444_1238 | 264 |
| 827 | 3300048921 | Ga0496118_0102221 | Ga0496118_0102221_149_943 | 264 |
| 828 | 3300048922 | Ga0496119_0000009 | Ga0496119_0000009_320494_321288 | 264 |
| 829 | 3300048922 | Ga0496119_0001670 | Ga0496119_0001670_21845_22639 | 264 |
| 830 | 3300048922 | Ga0496119_0002299 | Ga0496119_0002299_3339_4133 | 264 |
| 831 | 3300048922 | Ga0496119_0002763 | Ga0496119_0002763_17151_17945 | 264 |
| 832 | 3300048922 | Ga0496119_0003037 | Ga0496119_0003037_3421_4215 | 264 |
| 833 | 3300048922 | Ga0496119_0004240 | Ga0496119_0004240_11109_11903 | 264 |
| 834 | 3300048922 | Ga0496119_0040741 | Ga0496119_0040741_944_1738 | 264 |
| 835 | 3300048922 | Ga0496119_0047483 | Ga0496119_0047483_867_1661 | 264 |
| 836 | 3300048922 | Ga0496119_0051033 | Ga0496119_0051033_525_1319 | 264 |
| 837 | 3300048922 | Ga0496119_0052628 | Ga0496119_0052628_875_1678 | 264 |
| 838 | 3300048922 | Ga0496119_0054916 | Ga0496119_0054916_1058_1852 | 264 |
| 839 | 3300048923 | Ga0496120_0000044 | Ga0496120_0000044_114400_115194 | 264 |
| 840 | 3300048923 | Ga0496120_0000066 | Ga0496120_0000066_68938_69732 | 264 |
| 841 | 3300048923 | Ga0496120_0000645 | Ga0496120_0000645_17891_18685 | 264 |
| 842 | 3300048923 | Ga0496120_0001316 | Ga0496120_0001316_26652_27446 | 264 |
| 843 | 3300048923 | Ga0496120_0001317 | Ga0496120_0001317_3293_4087 | 264 |
| 844 | 3300048923 | Ga0496120_0002117 | Ga0496120_0002117_17037_17831 | 264 |
| 845 | 3300048923 | Ga0496120_0002630 | Ga0496120_0002630_290_1084 | 264 |
| 846 | 3300048923 | Ga0496120_0003636 | Ga0496120_0003636_3277_4071 | 264 |
| 847 | 3300048923 | Ga0496120_0004666 | Ga0496120_0004666_7248_8042 | 264 |
| 848 | 3300048923 | Ga0496120_0015824 | Ga0496120_0015824_4076_4870 | 264 |
| 849 | 3300048923 | Ga0496120_0016305 | Ga0496120_0016305_3028_3822 | 264 |
| 850 | 3300048924 | Ga0496121_0003294 | Ga0496121_0003294_12897_13691 | 264 |
| 851 | 3300048924 | Ga0496121_0003770 | Ga0496121_0003770_3423_4217 | 264 |
| 852 | 3300048924 | Ga0496121_0004311 | Ga0496121_0004311_3484_4278 | 264 |
| 853 | 3300048924 | Ga0496121_0020778 | Ga0496121_0020778_2003_2797 | 264 |
| 854 | 3300048924 | Ga0496121_0023512 | Ga0496121_0023512_1957_2751 | 264 |
| 855 | 3300048924 | Ga0496121_0039163 | Ga0496121_0039163_2787_3581 | 264 |
| 856 | 3300048924 | Ga0496121_0074185 | Ga0496121_0074185_165_959 | 264 |
| 857 | 3300048925 | Ga0496122_0000016 | Ga0496122_0000016_49625_50419 | 264 |
| 858 | 3300048925 | Ga0496122_0000339 | Ga0496122_0000339_45896_46690 | 264 |
| 859 | 3300048925 | Ga0496122_0002667 | Ga0496122_0002667_7809_8603 | 264 |
| 860 | 3300048925 | Ga0496122_0034566 | Ga0496122_0034566_1207_2001 | 264 |
| 861 | 3300048925 | Ga0496122_0045673 | Ga0496122_0045673_320_1114 | 264 |
| 862 | 3300048925 | Ga0496122_0057792 | Ga0496122_0057792_394_1188 | 264 |
| 863 | 3300048925 | Ga0496122_0168214 | Ga0496122_0168214_514_1308 | 264 |
| 864 | 3300048926 | Ga0496123_0000444 | Ga0496123_0000444_23773_24567 | 264 |
| 865 | 3300048926 | Ga0496123_0000506 | Ga0496123_0000506_54135_54929 | 264 |
| 866 | 3300048926 | Ga0496123_0000661 | Ga0496123_0000661_18536_19330 | 264 |
| 867 | 3300048926 | Ga0496123_0002548 | Ga0496123_0002548_4073_4867 | 264 |
| 868 | 3300048926 | Ga0496123_0004933 | Ga0496123_0004933_2682_3476 | 264 |
| 869 | 3300048926 | Ga0496123_0012294 | Ga0496123_0012294_2929_3723 | 264 |
| 870 | 3300048926 | Ga0496123_0014727 | Ga0496123_0014727_5601_6395 | 264 |
| 871 | 3300048926 | Ga0496123_0033475 | Ga0496123_0033475_480_1274 | 264 |
| 872 | 3300048927 | Ga0496124_0000069 | Ga0496124_0000069_86108_86902 | 264 |
| 873 | 3300048927 | Ga0496124_0000164 | Ga0496124_0000164_104831_105625 | 264 |
| 874 | 3300048927 | Ga0496124_0000544 | Ga0496124_0000544_62892_63686 | 264 |
| 875 | 3300048927 | Ga0496124_0001338 | Ga0496124_0001338_20707_21501 | 264 |
| 876 | 3300048927 | Ga0496124_0001912 | Ga0496124_0001912_23629_24423 | 264 |
| 877 | 3300048927 | Ga0496124_0008345 | Ga0496124_0008345_4474_5301 | 264 |
| 878 | 3300048927 | Ga0496124_0045655 | Ga0496124_0045655_942_1736 | 264 |
| 879 | 3300048927 | Ga0496124_0086212 | Ga0496124_0086212_1201_1995 | 264 |
| 880 | 3300048927 | Ga0496124_0196274 | Ga0496124_0196274_684_1478 | 264 |
| 881 | 3300048928 | Ga0496125_0000081 | Ga0496125_0000081_129174_129968 | 264 |
| 882 | 3300048928 | Ga0496125_0004962 | Ga0496125_0004962_5362_6156 | 264 |
| 883 | 3300048928 | Ga0496125_0013881 | Ga0496125_0013881_1970_2764 | 264 |
| 884 | 3300048928 | Ga0496125_0034260 | Ga0496125_0034260_1071_1865 | 264 |
| 885 | 3300048929 | Ga0496126_0000983 | Ga0496126_0000983_33375_34169 | 264 |
| 886 | 3300048929 | Ga0496126_0003685 | Ga0496126_0003685_3355_4149 | 264 |
| 887 | 3300048929 | Ga0496126_0023761 | Ga0496126_0023761_2770_3564 | 264 |
| 888 | 3300048929 | Ga0496126_0030792 | Ga0496126_0030792_3101_3895 | 264 |
| 889 | 3300048929 | Ga0496126_0034102 | Ga0496126_0034102_2313_3107 | 264 |
| 890 | 3300048929 | Ga0496126_0135833 | Ga0496126_0135833_699_1493 | 264 |
| 891 | 3300049161 | Ga0501305_017969 | Ga0501305_017969_143_937 | 264 |
| 892 | 3300049459 | Ga0495678_000094 | Ga0495678_000094_3272_4066 | 264 |
| 893 | 3300049459 | Ga0495678_000214 | Ga0495678_000214_41661_42455 | 264 |
| 894 | 3300049459 | Ga0495678_000294 | Ga0495678_000294_52793_53587 | 264 |
| 895 | 3300049460 | Ga0495682_0000017 | Ga0495682_0000017_88581_89375 | 264 |
| 896 | 3300049568 | Ga0501031_0169943 | Ga0501031_0169943_317_1111 | 264 |
| 897 | 3300049569 | Ga0501032_0000057 | Ga0501032_0000057_77897_78691 | 264 |
| 898 | 3300049570 | Ga0501033_0081633 | Ga0501033_0081633_625_1419 | 264 |
| 899 | 3300049570 | Ga0501033_0095114 | Ga0501033_0095114_1082_1876 | 264 |
| 900 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_778951_779745 | 264 |
| 901 | 3300049571 | Ga0501034_0000188 | Ga0501034_0000188_81760_82554 | 264 |
| 902 | 3300049572 | Ga0501036_0004036 | Ga0501036_0004036_9586_10380 | 264 |
| 903 | 3300049573 | Ga0501037_0000001 | Ga0501037_0000001_410714_411526 | 264 |
| 904 | 3300049574 | Ga0501038_0048075 | Ga0501038_0048075_2044_2847 | 264 |
| 905 | 3300049575 | Ga0501039_0000001 | Ga0501039_0000001_119932_120726 | 264 |
| 906 | 3300049577 | Ga0501041_0002567 | Ga0501041_0002567_9351_10169 | 264 |
| 907 | 3300049578 | Ga0501042_0004940 | Ga0501042_0004940_1952_2770 | 264 |
| 908 | 3300049581 | Ga0501047_0156291 | Ga0501047_0156291_938_1732 | 264 |
| 909 | 3300049582 | Ga0501048_0008525 | Ga0501048_0008525_289_1107 | 264 |
| 910 | 3300049584 | Ga0501068_0068876 | Ga0501068_0068876_774_1568 | 264 |
| 911 | 3300049585 | Ga0501069_0281648 | Ga0501069_0281648_48_842 | 264 |
| 912 | 3300049586 | Ga0501070_0001515 | Ga0501070_0001515_16389_17183 | 264 |
| 913 | 3300049586 | Ga0501070_0145894 | Ga0501070_0145894_896_1690 | 264 |
| 914 | 3300049587 | Ga0501071_0005029 | Ga0501071_0005029_1713_2531 | 264 |
| 915 | 3300049590 | Ga0501074_0201203 | Ga0501074_0201203_607_1401 | 264 |
| 916 | 3300049590 | Ga0501074_0364388 | Ga0501074_0364388_191_985 | 264 |
| 917 | 3300049591 | Ga0501075_0001026 | Ga0501075_0001026_12236_13054 | 264 |
| 918 | 3300049592 | Ga0501076_0000823 | Ga0501076_0000823_249_1067 | 264 |
| 919 | 3300049593 | Ga0501077_0188828 | Ga0501077_0188828_157_975 | 264 |
| 920 | 3300049742 | Ga0501080_0057081 | Ga0501080_0057081_606_1400 | 264 |
| 921 | 3300049744 | Ga0501083_0137128 | Ga0501083_0137128_33_833 | 264 |
| 922 | 3300049822 | Ga0501035_0001118 | Ga0501035_0001118_12583_13377 | 264 |
| 923 | 3300049823 | Ga0501044_0259584 | Ga0501044_0259584_803_1597 | 264 |
| 924 | 3300049824 | Ga0501045_0003259 | Ga0501045_0003259_7111_7929 | 264 |
| 925 | 3300050490 | nmdc:mga03n38_8480_c1 | nmdc:mga03n38_8480_c1_2127_2921 | 264 |
| 926 | 3300050491 | nmdc:mga00v17_181653_c1 | nmdc:mga00v17_181653_c1_102_896 | 264 |
| 927 | 3300050491 | nmdc:mga00v17_249_c1 | nmdc:mga00v17_249_c1_23832_24626 | 264 |
| 928 | 3300050491 | nmdc:mga00v17_487_c1 | nmdc:mga00v17_487_c1_13335_14129 | 264 |
| 929 | 3300050491 | nmdc:mga00v17_56930_c1 | nmdc:mga00v17_56930_c1_1374_2168 | 264 |
| 930 | 3300050492 | nmdc:mga0yw44_67004_c1 | nmdc:mga0yw44_67004_c1_771_1565 | 264 |
| 931 | 3300050493 | nmdc:mga0k408_120948_c1 | nmdc:mga0k408_120948_c1_265_1059 | 264 |
| 932 | 3300050493 | nmdc:mga0k408_33082_c2 | nmdc:mga0k408_33082_c2_678_1472 | 264 |
| 933 | 3300050494 | nmdc:mga06z11_199016_c1 | nmdc:mga06z11_199016_c1_154_948 | 264 |
| 934 | 3300050496 | nmdc:mga07m45_43858_c1 | nmdc:mga07m45_43858_c1_1692_2486 | 264 |
| 935 | 3300050512 | nmdc:mga0n895_388760_c1 | nmdc:mga0n895_388760_c1_267_1061 | 264 |
| 936 | 3300050516 | nmdc:mga0sz30_67760_c1 | nmdc:mga0sz30_67760_c1_548_1342 | 264 |
| 937 | 3300053077 | Ga0495601_0017945 | Ga0495601_0017945_1495_2331 | 264 |
| 938 | 3300053078 | Ga0495612_0004226 | Ga0495612_0004226_4939_5733 | 264 |
| 939 | 3300053084 | Ga0495595_0097167 | Ga0495595_0097167_368_1162 | 264 |
| 940 | 3300053085 | Ga0495619_0390423 | Ga0495619_0390423_118_912 | 264 |
| 941 | 3300053086 | Ga0500578_0014630 | Ga0500578_0014630_233_1027 | 264 |
| 942 | 3300053094 | Ga0500566_0121985 | Ga0500566_0121985_369_1163 | 264 |
| 943 | 3300053119 | Ga0500595_000024 | Ga0500595_000024_44221_45015 | 264 |
| 944 | 3300053119 | Ga0500595_001547 | Ga0500595_001547_11221_12057 | 264 |
| 945 | 3300053126 | Ga0500621_000004 | Ga0500621_000004_130919_131713 | 264 |
| 946 | 3300053140 | Ga0500573_0122153 | Ga0500573_0122153_96_890 | 264 |
| 947 | 3300053153 | Ga0500616_0000458 | Ga0500616_0000458_30777_31571 | 264 |
| 948 | 3300053154 | Ga0500619_000417 | Ga0500619_000417_157_993 | 264 |
| 949 | 3300053156 | Ga0500622_0001910 | Ga0500622_0001910_3856_4695 | 264 |
| 950 | 3300053730 | Ga0500645_000102 | Ga0500645_000102_48694_49488 | 264 |
| 951 | 3300059477 | Ga0587084_004455 | Ga0587084_004455_289_1083 | 264 |
| 952 | 3300059604 | Ga0587098_007484 | Ga0587098_007484_237_1040 | 264 |
| 953 | 3300061734 | Ga0530510_0001520 | Ga0530510_0001520_5794_6612 | 264 |
| 954 | iso_pu_bacteria | 2721755523 | 2722882528 | 264 |
| 955 | iso_pu_bacteria | 2738541337 | 2739057318 | 264 |
| 956 | iso_pu_bacteria | 2818991436 | 2819543957 | 264 |
| 957 | iso_pu_bacteria | 2831864461 | 2831867462 | 264 |
| 958 | iso_pu_bacteria | 2839138175 | 2839141210 | 264 |
| 959 | iso_pu_bacteria | 2939631187 | 2939631389 | 264 |
| 960 | iso_pu_bacteria | 2939664404 | 2939664826 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g8x-assembly1.cif.gz_B | escherichia coli y209w apoprotein | 0.987 | 3 | 262 |
| 1nce-assembly1.cif.gz_B | crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 | 0.9854 | 3 | 264 |
| 1f4g-assembly1.cif.gz_B | crystal structure of e. coli thymidylate synthase complexed with sp-876 | 0.9849 | 3 | 261 |
| 1zpr-assembly1.cif.gz_B | e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump) | 0.9846 | 3 | 264 |
| 1f4d-assembly1.cif.gz_B | crystal structure of e. coli thymidylate synthase c146s, l143c covalently modified at c143 with n-[tosyl-d-prolinyl]amino-ethanethiol | 0.9843 | 3 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9697 | 2 | 264 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9671 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9625 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9602 | 2 | 262 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.952 | 2 | 259 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377CVI5-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9932 | 99 | 229 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A3Q3X194-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.99 | 107 | 243 |
GO:0004799
GO:0005739 GO:0005829 GO:0006231 GO:0006235 GO:0032259 |
| AF-A0A059WNC8-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9877 | 116 | 238 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2J0MA32-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9867 | 1 | 228 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A355C418-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9866 | 1 | 222 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar