F486842

General Info

Members Datasets Scaffolds Average Seq Length
960 440 945 266

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1000689|Ga0182005_100068912
Length 329
Sequence MRRLVKPLACAFDYQSFIFCAYNKNKWPEQNANADIAMTIPDWRRRRSGRGNALQSHDPFPLSQKNAPIPRSHASCATTWHSQNHRTGTGTRSVFGYQMRFNLQDGFPLLTTKKLHLRSIIHELIWFLAGSTNIKYLKDNDVKIWDEWADSDGNLGPIYGFQWRSWPAPGGAHIDQIKQVVEQIKHNPDSRRLIVSAWNVADIPQMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTHMMAQQCGLEVGDFIWTGGDCHLYSNHAAQVEEQLSRSPGPLPRLEIKRKPESIFDYRFADFEILDYHPQAHIKAPVAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755523 Delftia sp. HK171 Isolate Unclassified
3 2738541337 Pelomonas sp. BT06 Isolate Unclassified
4 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
5 2818991436 Collimonas arenae 515 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
8 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
9 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
10 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
11 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
12 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
13 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
14 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
15 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
110 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
111 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
112 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
192 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
248 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
249 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
252 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
256 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
260 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
390 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
391 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
408 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
409 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
410 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
419 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
429 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
432 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
433 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
434 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
435 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
436 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
437 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.73
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 5.21
Nodule 1.98
Rhizoplane 3.85
Rhizosphere 77.4
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2690628 2162886007 Bacteria 1011
2 SwRhRL2b_contig_465629 2162886007 Bacteria 1363
3 SwRhRL2b_contig_565865 2162886007 Bacteria 1925
4 JGI24740J21852_10035601 3300001979 Bacteria 1554
5 JGI24735J21928_10015140 3300002067 Bacteria 2409
6 JGI25155J39150_1000694 3300002704 Bacteria 6224
7 JGI25156J39149_1006009 3300002705 Bacteria 3391
8 JGI25162J39368_1000001 3300002737 Bacteria 740113
9 JGI25154J39366_1000800 3300002738 Bacteria 13831
10 JGI25165J46597_1000001 3300003214 Bacteria 1111887
11 Ga0055538_1000001 3300003751 Bacteria 1111887
12 Ga0055539_1000001 3300003752 Bacteria 1111887
13 Ga0055533_1000003 3300003756 Bacteria 1111887
14 Ga0055525_1000003 3300003759 Bacteria 962094
15 Ga0055541_1000001 3300003841 Bacteria 1111887
16 Ga0058692_1000209 3300003856 Bacteria 34844
17 Ga0058692_1000390 3300003856 Bacteria 21046
18 Ga0058692_1001340 3300003856 Bacteria 9191
19 Ga0058692_1001368 3300003856 Bacteria 9046
20 Ga0065165_1000270 3300005262 Bacteria 88828
21 Ga0065714_10069175 3300005288 Bacteria 4356
22 Ga0065704_10002801 3300005289 Bacteria 7427
23 Ga0065704_10007448 3300005289 Bacteria 3802
24 Ga0065704_10082129 3300005289 Bacteria 3650
25 Ga0065704_10086266 3300005289 Bacteria 3137
26 Ga0065704_10136785 3300005289 Bacteria 1562
27 Ga0070658_10250068 3300005327 Bacteria 1504
28 Ga0070676_10007986 3300005328 Bacteria 5689
29 Ga0070676_10098984 3300005328 Bacteria 1799
30 Ga0070683_100144424 3300005329 Bacteria 2254
31 Ga0070670_100002234 3300005331 Bacteria 15919
32 Ga0070670_100043662 3300005331 Bacteria 3853
33 Ga0070670_100060341 3300005331 Bacteria 3256
34 Ga0070666_10025023 3300005335 Bacteria 3890
35 Ga0070666_10091078 3300005335 Bacteria 2095
36 Ga0070680_100001582 3300005336 Bacteria 16611
37 Ga0070682_100124953 3300005337 Bacteria 1732
38 Ga0070660_100042137 3300005339 Bacteria 3483
39 Ga0070661_100027710 3300005344 Bacteria 4081
40 Ga0070661_100342969 3300005344 Bacteria 1171
41 Ga0070668_100184401 3300005347 Bacteria 1706
42 Ga0070669_100073736 3300005353 Bacteria 2529
43 Ga0070675_100182860 3300005354 Bacteria 1813
44 Ga0070671_100052534 3300005355 Bacteria 3388
45 Ga0070674_100021190 3300005356 Bacteria 4168
46 Ga0070674_100471836 3300005356 Bacteria 1040
47 Ga0070673_100056731 3300005364 Bacteria 3091
48 Ga0070659_100046515 3300005366 Bacteria 3401
49 Ga0070667_100053674 3300005367 Bacteria 3402
50 Ga0070667_100063446 3300005367 Bacteria 3131
51 Ga0070709_10000012 3300005434 Bacteria 163026
52 Ga0070709_10125538 3300005434 Bacteria 1745
53 Ga0070714_100052293 3300005435 Bacteria 3483
54 Ga0070714_100064477 3300005435 Bacteria 3153
55 Ga0070714_100208226 3300005435 Bacteria 1792
56 Ga0070713_100001813 3300005436 Bacteria 13792
57 Ga0070678_100015524 3300005456 Bacteria 4844
58 Ga0070678_100028505 3300005456 Bacteria 3809
59 Ga0070662_100022103 3300005457 Bacteria 4350
60 Ga0070681_10028427 3300005458 Bacteria 5621
61 Ga0070681_10461519 3300005458 Bacteria 1182
62 Ga0068867_100282921 3300005459 Bacteria 1360
63 Ga0070679_100012756 3300005530 Bacteria 8038
64 Ga0070679_100065499 3300005530 Bacteria 3622
65 Ga0070679_100082818 3300005530 Bacteria 3198
66 Ga0070684_100190969 3300005535 Bacteria 1864
67 Ga0068853_100000194 3300005539 Bacteria 42877
68 Ga0070672_100045872 3300005543 Bacteria 3384
69 Ga0070672_100052614 3300005543 Bacteria 3180
70 Ga0070695_100199753 3300005545 Bacteria 1428
71 Ga0070665_100000033 3300005548 Bacteria 332530
72 Ga0070665_100012974 3300005548 Bacteria 8393
73 Ga0070665_100447316 3300005548 Bacteria 1301
74 Ga0070665_100451629 3300005548 Bacteria 1295
75 Ga0070665_100952501 3300005548 Bacteria 871
76 Ga0068855_100132425 3300005563 Bacteria 2846
77 Ga0070664_100057086 3300005564 Bacteria 3318
78 Ga0070664_100082623 3300005564 Bacteria 2770
79 Ga0068857_100000814 3300005577 Bacteria 23350
80 Ga0068857_100011113 3300005577 Bacteria 7831
81 Ga0068857_100067657 3300005577 Bacteria 3179
82 Ga0068854_100009368 3300005578 Bacteria 6321
83 Ga0068854_100017438 3300005578 Bacteria 4805
84 Ga0068856_100059442 3300005614 Bacteria 3776
85 Ga0068856_100063764 3300005614 Bacteria 3640
86 Ga0068856_100075706 3300005614 Bacteria 3334
87 Ga0068856_100287368 3300005614 Bacteria 1661
88 Ga0068856_100558675 3300005614 Bacteria 1166
89 Ga0068852_100046087 3300005616 Bacteria 3713
90 Ga0068852_100480299 3300005616 Bacteria 1235
91 Ga0068864_100023945 3300005618 Bacteria 5131
92 Ga0068851_10006890 3300005834 Bacteria 5207
93 Ga0068863_100003644 3300005841 Bacteria 15215
94 Ga0068863_100013348 3300005841 Bacteria 7920
95 Ga0068860_100402766 3300005843 Bacteria 1354
96 Ga0081539_10047180 3300005985 Bacteria 2463
97 Ga0070717_10156227 3300006028 Bacteria 1976
98 Ga0075365_10166098 3300006038 Bacteria 1540
99 Ga0075368_10087636 3300006042 Bacteria 1271
100 Ga0075364_10000454 3300006051 Bacteria 20673
101 Ga0075364_10000761 3300006051 Bacteria 16900
102 Ga0075364_10031035 3300006051 Bacteria 3433
103 Ga0075364_10048076 3300006051 Bacteria 2779
104 Ga0070716_100016923 3300006173 Bacteria 3771
105 Ga0070712_100299327 3300006175 Bacteria 1301
106 Ga0075366_10016396 3300006195 Bacteria 4258
107 Ga0075366_10024516 3300006195 Bacteria 3518
108 Ga0075370_10077074 3300006353 Bacteria 1913
109 Ga0068871_100534576 3300006358 Bacteria 1060
110 Ga0075428_100522032 3300006844 Bacteria 1270
111 Ga0075434_100269286 3300006871 Bacteria 1723
112 Ga0068865_100400665 3300006881 Bacteria 1124
113 Ga0079104_1000039 3300006946 Bacteria 188434
114 Ga0079104_1000255 3300006946 Bacteria 71067
115 Ga0079104_1000895 3300006946 Bacteria 24364
116 Ga0079104_1001436 3300006946 Bacteria 15975
117 Ga0079104_1001499 3300006946 Bacteria 15520
118 Ga0079104_1003597 3300006946 Bacteria 7103
119 Ga0105251_10000036 3300009011 Bacteria 117656
120 Ga0105251_10001204 3300009011 Bacteria 22361
121 Ga0105251_10001316 3300009011 Bacteria 21465
122 Ga0105251_10001736 3300009011 Bacteria 18191
123 Ga0105251_10002897 3300009011 Bacteria 12889
124 Ga0105251_10004074 3300009011 Bacteria 10252
125 Ga0105251_10006180 3300009011 Bacteria 7694
126 Ga0105251_10013300 3300009011 Bacteria 4609
127 Ga0105251_10022957 3300009011 Bacteria 3229
128 Ga0105251_10039578 3300009011 Bacteria 2302
129 Ga0105251_10074566 3300009011 Bacteria 1576
130 Ga0105251_10093476 3300009011 Bacteria 1380
131 Ga0105244_10000193 3300009036 Bacteria 61620
132 Ga0105244_10000225 3300009036 Bacteria 58370
133 Ga0105244_10001179 3300009036 Bacteria 21636
134 Ga0105244_10002608 3300009036 Bacteria 13508
135 Ga0105244_10003766 3300009036 Bacteria 10702
136 Ga0105244_10005574 3300009036 Bacteria 8328
137 Ga0105244_10007009 3300009036 Bacteria 7213
138 Ga0105244_10014009 3300009036 Bacteria 4655
139 Ga0105244_10024115 3300009036 Bacteria 3324
140 Ga0105244_10076162 3300009036 Bacteria 1666
141 Ga0105244_10088327 3300009036 Bacteria 1527
142 Ga0105244_10153717 3300009036 Bacteria 1101
143 Ga0105250_10000021 3300009092 Bacteria 239960
144 Ga0105250_10000086 3300009092 Bacteria 81683
145 Ga0105250_10000490 3300009092 Bacteria 27810
146 Ga0105250_10005159 3300009092 Bacteria 5895
147 Ga0105250_10044379 3300009092 Bacteria 1783
148 Ga0105250_10088433 3300009092 Bacteria 1258
149 Ga0105240_10003481 3300009093 Bacteria 24428
150 Ga0105240_10024207 3300009093 Bacteria 8012
151 Ga0105240_10138922 3300009093 Bacteria 2907
152 Ga0105240_10205416 3300009093 Bacteria 2306
153 Ga0105243_10037401 3300009148 Bacteria 3772
154 Ga0105241_10000012 3300009174 Bacteria 221790
155 Ga0105242_10028956 3300009176 Bacteria 4413
156 Ga0105242_10138250 3300009176 Bacteria 2111
157 Ga0105248_10000001 3300009177 Bacteria 1881304
158 Ga0105248_10046312 3300009177 Bacteria 4874
159 Ga0105238_10016032 3300009551 Bacteria 7579
160 Ga0105238_10184008 3300009551 Bacteria 2066
161 Ga0105249_10838785 3300009553 Bacteria 984
162 Ga0105246_10031289 3300011119 Bacteria 3521
163 Ga0105246_10137213 3300011119 Bacteria 1835
164 Ga0157373_10000745 3300013100 Bacteria 25255
165 Ga0157373_10002600 3300013100 Bacteria 13707
166 Ga0157373_10013651 3300013100 Bacteria 5956
167 Ga0157373_10036245 3300013100 Bacteria 3541
168 Ga0157373_10140815 3300013100 Bacteria 1696
169 Ga0157371_10001118 3300013102 Bacteria 29066
170 Ga0157371_10001344 3300013102 Bacteria 25903
171 Ga0157371_10011341 3300013102 Bacteria 6874
172 Ga0157371_10018105 3300013102 Bacteria 5215
173 Ga0157371_10028822 3300013102 Bacteria 4019
174 Ga0157371_10038542 3300013102 Bacteria 3419
175 Ga0157371_10072349 3300013102 Bacteria 2441
176 Ga0157371_10145211 3300013102 Bacteria 1690
177 Ga0157370_10000297 3300013104 Bacteria 63075
178 Ga0157370_10009096 3300013104 Bacteria 10653
179 Ga0157370_10051542 3300013104 Bacteria 3931
180 Ga0157369_10006274 3300013105 Bacteria 13802
181 Ga0157369_10006328 3300013105 Bacteria 13744
182 Ga0157369_10081465 3300013105 Bacteria 3464
183 Ga0157369_10175771 3300013105 Bacteria 2254
184 Ga0157369_10370511 3300013105 Bacteria 1487
185 Ga0157369_10456162 3300013105 Bacteria 1324
186 Ga0157369_10710137 3300013105 Bacteria 1035
187 Ga0157369_10715397 3300013105 Bacteria 1031
188 Ga0163162_10048767 3300013306 Bacteria 4243
189 Ga0163162_10058596 3300013306 Bacteria 3881
190 Ga0163162_10235532 3300013306 Bacteria 1961
191 Ga0157372_10003156 3300013307 Bacteria 17772
192 Ga0157372_10006737 3300013307 Bacteria 12214
193 Ga0157372_10007335 3300013307 Bacteria 11734
194 Ga0157372_10009960 3300013307 Bacteria 10107
195 Ga0157372_10065105 3300013307 Bacteria 4091
196 Ga0157372_10078123 3300013307 Bacteria 3739
197 Ga0157372_10080415 3300013307 Bacteria 3687
198 Ga0157372_10101024 3300013307 Bacteria 3292
199 Ga0157372_10159344 3300013307 Bacteria 2607
200 Ga0157375_10181147 3300013308 Bacteria 2258
201 Ga0157375_10775296 3300013308 Bacteria 1109
202 Ga0163163_10037028 3300014325 Bacteria 4744
203 Ga0182008_10040781 3300014497 Bacteria 2316
204 Ga0182006_1000013 3300015261 Bacteria 363224
205 Ga0182006_1013921 3300015261 Bacteria 3476
206 Ga0182006_1053529 3300015261 Bacteria 1546
207 Ga0182007_10003679 3300015262 Bacteria 7179
208 Ga0182005_1000689 3300015265 Bacteria 15763
209 Ga0183366_1002 3300015679 Bacteria 791639
210 Ga0183370_1002 3300015680 Bacteria 791639
211 Ga0183369_1002 3300015685 Bacteria 791621
212 Ga0183368_1005 3300015687 Bacteria 791621
213 Ga0163161_10000038 3300017792 Bacteria 149076
214 Ga0163161_10000494 3300017792 Bacteria 32399
215 Ga0163161_10026412 3300017792 Bacteria 4112
216 Ga0206356_11131871 3300020070 Bacteria 1454
217 Ga0206350_11351559 3300020080 Bacteria 870
218 Ga0213876_10000103 3300021384 Bacteria 94164
219 Ga0209435_100116 3300025206 Bacteria 30323
220 Ga0209784_100004 3300025224 Bacteria 1378156
221 Ga0209566_100004 3300025225 Bacteria 1531866
222 Ga0209674_100006 3300025226 Bacteria 1531866
223 Ga0209563_100009 3300025230 Bacteria 1378156
224 Ga0207427_100784 3300025231 Bacteria 14485
225 Ga0209437_100004 3300025233 Bacteria 1378156
226 Ga0209437_100110 3300025233 Bacteria 215040
227 Ga0209646_1000130 3300025246 Bacteria 128556
228 Ga0209026_1002093 3300025250 Bacteria 7846
229 Ga0209677_100005 3300025253 Bacteria 1378156
230 Ga0209759_1000456 3300025256 Bacteria 46592
231 Ga0209129_1000010 3300025258 Bacteria 583357
232 Ga0209233_1000005 3300025261 Bacteria 1531866
233 Ga0209025_1000849 3300025294 Bacteria 48335
234 Ga0209256_1000873 3300025299 Bacteria 37313
235 Ga0207697_10002399 3300025315 Bacteria 9764
236 Ga0207656_10040793 3300025321 Bacteria 1969
237 Ga0207696_1000024 3300025711 Bacteria 420123
238 Ga0207696_1000061 3300025711 Bacteria 241730
239 Ga0207696_1000079 3300025711 Bacteria 199842
240 Ga0207696_1000436 3300025711 Bacteria 37358
241 Ga0207696_1002594 3300025711 Bacteria 8760
242 Ga0207696_1009243 3300025711 Bacteria 3686
243 Ga0207655_1000020 3300025728 Bacteria 524503
244 Ga0207655_1000025 3300025728 Bacteria 449261
245 Ga0207655_1000044 3300025728 Bacteria 327511
246 Ga0207655_1000047 3300025728 Bacteria 302548
247 Ga0207655_1000079 3300025728 Bacteria 219036
248 Ga0207655_1000088 3300025728 Bacteria 205698
249 Ga0207655_1000150 3300025728 Bacteria 128025
250 Ga0207655_1000382 3300025728 Bacteria 61846
251 Ga0207655_1002063 3300025728 Bacteria 16863
252 Ga0207655_1003957 3300025728 Bacteria 10741
253 Ga0207655_1004443 3300025728 Bacteria 9940
254 Ga0207655_1014279 3300025728 Bacteria 4499
255 Ga0207655_1026831 3300025728 Bacteria 2757
256 Ga0207655_1042138 3300025728 Bacteria 1947
257 Ga0207713_1000028 3300025735 Bacteria 309074
258 Ga0207713_1000033 3300025735 Bacteria 273751
259 Ga0207713_1000051 3300025735 Bacteria 225973
260 Ga0207713_1000054 3300025735 Bacteria 222042
261 Ga0207713_1000082 3300025735 Bacteria 164992
262 Ga0207713_1001326 3300025735 Bacteria 20298
263 Ga0207713_1001432 3300025735 Bacteria 19085
264 Ga0207713_1020708 3300025735 Bacteria 3175
265 Ga0207713_1021697 3300025735 Bacteria 3071
266 Ga0207713_1041556 3300025735 Bacteria 1917
267 Ga0207682_10020483 3300025893 Bacteria 2597
268 Ga0207710_10000042 3300025900 Bacteria 223734
269 Ga0207647_10040161 3300025904 Bacteria 2948
270 Ga0207699_10000087 3300025906 Bacteria 69697
271 Ga0207645_10000903 3300025907 Bacteria 24610
272 Ga0207645_10148890 3300025907 Bacteria 1527
273 Ga0207705_10047691 3300025909 Bacteria 3080
274 Ga0207705_10226511 3300025909 Bacteria 1421
275 Ga0207654_10000015 3300025911 Bacteria 221799
276 Ga0207707_10010873 3300025912 Bacteria 7911
277 Ga0207695_10002294 3300025913 Bacteria 28544
278 Ga0207695_10161596 3300025913 Bacteria 2171
279 Ga0207695_10197062 3300025913 Bacteria 1930
280 Ga0207693_10008546 3300025915 Bacteria 8380
281 Ga0207693_10370477 3300025915 Bacteria 1120
282 Ga0207660_10086835 3300025917 Bacteria 2310
283 Ga0207657_10012629 3300025919 Bacteria 8325
284 Ga0207657_10021933 3300025919 Bacteria 5996
285 Ga0207649_10035183 3300025920 Bacteria 3008
286 Ga0207649_10443453 3300025920 Bacteria 978
287 Ga0207652_10039042 3300025921 Bacteria 4028
288 Ga0207652_10102751 3300025921 Bacteria 2526
289 Ga0207652_10160815 3300025921 Bacteria 2013
290 Ga0207646_10227450 3300025922 Bacteria 1685
291 Ga0207681_10065868 3300025923 Bacteria 2506
292 Ga0207694_10155401 3300025924 Bacteria 1845
293 Ga0207650_10002884 3300025925 Bacteria 11877
294 Ga0207650_10070846 3300025925 Bacteria 2621
295 Ga0207650_10076110 3300025925 Bacteria 2535
296 Ga0207650_10147743 3300025925 Bacteria 1853
297 Ga0207659_10056797 3300025926 Bacteria 2804
298 Ga0207659_10184631 3300025926 Bacteria 1655
299 Ga0207700_10017057 3300025928 Bacteria 4839
300 Ga0207664_10021636 3300025929 Bacteria 4787
301 Ga0207664_10039614 3300025929 Bacteria 3659
302 Ga0207664_10356385 3300025929 Bacteria 1295
303 Ga0207690_10042597 3300025932 Bacteria 2983
304 Ga0207706_10019655 3300025933 Bacteria 6076
305 Ga0207706_10039451 3300025933 Bacteria 4186
306 Ga0207706_10059992 3300025933 Bacteria 3350
307 Ga0207706_10185017 3300025933 Bacteria 1829
308 Ga0207686_10029977 3300025934 Bacteria 3216
309 Ga0207686_10069316 3300025934 Bacteria 2262
310 Ga0207686_10302652 3300025934 Bacteria 1188
311 Ga0207709_10489262 3300025935 Bacteria 958
312 Ga0207669_10200730 3300025937 Bacteria 1447
313 Ga0207704_10254324 3300025938 Bacteria 1321
314 Ga0207691_10000137 3300025940 Bacteria 66901
315 Ga0207691_10006161 3300025940 Bacteria 11600
316 Ga0207691_10115192 3300025940 Bacteria 2387
317 Ga0207711_10000001 3300025941 Bacteria 1325674
318 Ga0207711_10017576 3300025941 Bacteria 5941
319 Ga0207711_10316600 3300025941 Bacteria 1441
320 Ga0207679_10020313 3300025945 Bacteria 4481
321 Ga0207679_10033555 3300025945 Bacteria 3613
322 Ga0207679_10279030 3300025945 Bacteria 1432
323 Ga0207667_10058404 3300025949 Bacteria 4046
324 Ga0207667_10071359 3300025949 Bacteria 3611
325 Ga0207651_10298927 3300025960 Bacteria 1338
326 Ga0207712_10582060 3300025961 Bacteria 966
327 Ga0207668_10013400 3300025972 Bacteria 5048
328 Ga0207658_10090265 3300025986 Bacteria 2374
329 Ga0207639_10000462 3300026041 Bacteria 28094
330 Ga0207678_10060377 3300026067 Bacteria 3261
331 Ga0207702_10005398 3300026078 Bacteria 11196
332 Ga0207702_10077746 3300026078 Bacteria 2871
333 Ga0207702_10135098 3300026078 Bacteria 2224
334 Ga0207702_10212597 3300026078 Bacteria 1799
335 Ga0207641_10005715 3300026088 Bacteria 10570
336 Ga0207641_10010661 3300026088 Bacteria 7540
337 Ga0207648_10032321 3300026089 Bacteria 4621
338 Ga0207676_10001289 3300026095 Bacteria 18643
339 Ga0207674_10002466 3300026116 Bacteria 23350
340 Ga0207674_10019429 3300026116 Bacteria 7357
341 Ga0207674_10045539 3300026116 Bacteria 4511
342 Ga0207674_10206492 3300026116 Bacteria 1914
343 Ga0207683_10007029 3300026121 Bacteria 9651
344 Ga0207683_10009456 3300026121 Bacteria 8305
345 Ga0207683_10119885 3300026121 Bacteria 2361
346 Ga0207683_10226064 3300026121 Bacteria 1706
347 Ga0207698_10026189 3300026142 Bacteria 4122
348 Ga0207698_10048178 3300026142 Bacteria 3233
349 Ga0209281_1000007 3300027111 Bacteria 938265
350 Ga0209281_1000025 3300027111 Bacteria 488275
351 Ga0209281_1000048 3300027111 Bacteria 322698
352 Ga0209281_1000066 3300027111 Bacteria 284953
353 Ga0209281_1000092 3300027111 Bacteria 241437
354 Ga0209281_1000133 3300027111 Bacteria 188455
355 Ga0209281_1000593 3300027111 Bacteria 41747
356 Ga0209281_1000990 3300027111 Bacteria 22554
357 Ga0209281_1001123 3300027111 Bacteria 19220
358 Ga0209281_1001194 3300027111 Bacteria 17717
359 Ga0209281_1002152 3300027111 Bacteria 8652
360 Ga0209281_1002761 3300027111 Bacteria 6552
361 Ga0209371_1000010 3300027312 Bacteria 922021
362 Ga0209371_1000013 3300027312 Bacteria 691516
363 Ga0209371_1000019 3300027312 Bacteria 583561
364 Ga0209371_1000020 3300027312 Bacteria 556282
365 Ga0209371_1000254 3300027312 Bacteria 64787
366 Ga0209371_1000335 3300027312 Bacteria 51288
367 Ga0209371_1000384 3300027312 Bacteria 46760
368 Ga0209371_1001152 3300027312 Bacteria 19342
369 Ga0209371_1001568 3300027312 Bacteria 15034
370 Ga0209371_1004089 3300027312 Bacteria 6568
371 Ga0209969_1000315 3300027360 Bacteria 6466
372 Ga0209967_1002256 3300027364 Bacteria 2503
373 Ga0210000_1004231 3300027462 Bacteria 2075
374 Ga0209968_1007518 3300027526 Bacteria 1649
375 Ga0209999_1001909 3300027543 Bacteria 3623
376 Ga0209970_1000079 3300027614 Bacteria 13348
377 Ga0209974_10001694 3300027876 Bacteria 7985
378 Ga0268266_10000041 3300028379 Bacteria 322311
379 Ga0268266_10000058 3300028379 Bacteria 277346
380 Ga0268266_10194541 3300028379 Bacteria 1853
381 Ga0268266_10320560 3300028379 Bacteria 1450
382 Ga0265337_1001493 3300028556 Bacteria 11469
383 Ga0265318_10027709 3300028577 Bacteria 2223
384 Ga0307515_10071160 3300028794 Bacteria 4718
385 Ga0307515_10169646 3300028794 Bacteria 2182
386 Ga0268256_1000014 3300030500 Bacteria 691435
387 Ga0268256_1000024 3300030500 Bacteria 488637
388 Ga0268256_1000057 3300030500 Bacteria 229991
389 Ga0268256_1000110 3300030500 Bacteria 119426
390 Ga0268256_1000346 3300030500 Bacteria 44957
391 Ga0268256_1000983 3300030500 Bacteria 19342
392 Ga0268256_1000993 3300030500 Bacteria 19263
393 Ga0268256_1001344 3300030500 Bacteria 15034
394 Ga0268256_1001953 3300030500 Bacteria 11279
395 Ga0268256_1002231 3300030500 Bacteria 10181
396 Ga0268256_1003822 3300030500 Bacteria 6567
397 Ga0268256_1011667 3300030500 Bacteria 2764
398 Ga0307511_10000620 3300030521 Bacteria 37972
399 Ga0316182_1346215 3300030745 Bacteria 1900
400 Ga0265332_10003432 3300031238 Bacteria 7655
401 Ga0265328_10002271 3300031239 Bacteria 8656
402 Ga0265320_10013376 3300031240 Bacteria 4724
403 Ga0265340_10053567 3300031247 Bacteria 1948
404 Ga0265339_10016795 3300031249 Bacteria 4354
405 Ga0265331_10000055 3300031250 Bacteria 177693
406 Ga0265331_10002356 3300031250 Bacteria 12840
407 Ga0265327_10000045 3300031251 Bacteria 282880
408 Ga0265327_10003148 3300031251 Bacteria 16186
409 Ga0265327_10007016 3300031251 Bacteria 8832
410 Ga0265327_10008612 3300031251 Bacteria 7562
411 Ga0265327_10033638 3300031251 Bacteria 2854
412 Ga0307408_100009128 3300031548 Bacteria 6540
413 Ga0307408_100053288 3300031548 Bacteria 2920
414 Ga0307408_100295688 3300031548 Bacteria 1354
415 Ga0265313_10008665 3300031595 Bacteria 6726
416 Ga0316575_10002561 3300031665 Bacteria 6111
417 Ga0316575_10041573 3300031665 Bacteria 1819
418 Ga0316576_10055130 3300031727 Bacteria 2900
419 Ga0307405_10020703 3300031731 Bacteria 3681
420 Ga0307405_10130859 3300031731 Bacteria 1733
421 Ga0307405_10149915 3300031731 Bacteria 1638
422 Ga0307405_10232859 3300031731 Bacteria 1359
423 Ga0307413_10012718 3300031824 Bacteria 4199
424 Ga0307413_10107016 3300031824 Bacteria 1862
425 Ga0307410_10013387 3300031852 Bacteria 4784
426 Ga0307410_10025506 3300031852 Bacteria 3710
427 Ga0307410_10030981 3300031852 Bacteria 3425
428 Ga0307410_10321702 3300031852 Bacteria 1227
429 Ga0307406_10113216 3300031901 Bacteria 1872
430 Ga0307407_10043531 3300031903 Bacteria 2524
431 Ga0307407_10265341 3300031903 Bacteria 1183
432 Ga0307412_10199933 3300031911 Bacteria 1517
433 Ga0307409_100024912 3300031995 Bacteria 4184
434 Ga0307409_100101515 3300031995 Bacteria 2387
435 Ga0307409_100514325 3300031995 Bacteria 1168
436 Ga0307416_100005598 3300032002 Bacteria 7743
437 Ga0307416_100085930 3300032002 Bacteria 2680
438 Ga0307416_100724931 3300032002 Bacteria 1085
439 Ga0307414_10174633 3300032004 Bacteria 1722
440 Ga0307414_10300127 3300032004 Bacteria 1358
441 Ga0307411_10009499 3300032005 Bacteria 5118
442 Ga0307411_10157542 3300032005 Bacteria 1696
443 Ga0307415_100000718 3300032126 Bacteria 14833
444 Ga0307415_100028637 3300032126 Bacteria 3547
445 Ga0307415_100505564 3300032126 Bacteria 1057
446 Ga0316583_10005256 3300032133 Bacteria 4642
447 Ga0316583_10033334 3300032133 Bacteria 1830
448 Ga0316593_10000900 3300032168 Bacteria 6073
449 Ga0316593_10032516 3300032168 Bacteria 1704
450 Ga0373950_0004424 3300034818 Bacteria 2057
451 Ga0373944_0005254 3300035089 Bacteria 3404
452 Ga0373923_0000792 3300035111 Bacteria 8234
453 Ga0373936_0001246 3300035113 Bacteria 9176
454 Ga0373939_0000033 3300035114 Bacteria 49449
455 Ga0373939_0003966 3300035114 Bacteria 3484
456 Ga0373945_0002836 3300035116 Bacteria 5447
457 Ga0373954_0009128 3300035118 Bacteria 4363
458 Ga0373956_0070534 3300035119 Bacteria 1594
459 Ga0373960_0000774 3300035121 Bacteria 6707
460 Ga0373943_0007158 3300035170 Bacteria 5005
461 Ga0373946_0001845 3300035171 Bacteria 7409
462 Ga0373955_0037791 3300035172 Bacteria 2568
463 Ga0373962_0006886 3300035242 Bacteria 2767
464 Ga0316574_0027516 3300035398 Bacteria 3426
465 Ga0316574_0041517 3300035398 Bacteria 2837
466 Ga0316574_0083970 3300035398 Bacteria 2025
467 Ga0316574_0205324 3300035398 Bacteria 1265
468 Ga0373924_0020351 3300035410 Bacteria 2578
469 Ga0373931_0000478 3300035691 Bacteria 16299
470 Ga0373935_0005968 3300035692 Bacteria 7226
471 Ga0373927_0004839 3300035695 Bacteria 9361
472 Ga0373933_0035802 3300035724 Bacteria 2902
473 Ga0316582_0005223 3300036647 Bacteria 6654
474 Ga0373925_0023646 3300037068 Bacteria 4483
475 Ga0395899_0001908 3300037312 Bacteria 17203
476 Ga0395899_0002251 3300037312 Bacteria 15775
477 Ga0395899_0008511 3300037312 Bacteria 7902
478 Ga0395899_0020604 3300037312 Bacteria 4999
479 Ga0395899_0030956 3300037312 Bacteria 4023
480 Ga0395899_0200264 3300037312 Bacteria 1393
481 Ga0395900_0000221 3300037418 Bacteria 89883
482 Ga0395900_0002564 3300037418 Bacteria 19910
483 Ga0395900_0017051 3300037418 Bacteria 7415
484 Ga0395900_0022497 3300037418 Bacteria 6448
485 Ga0395900_0092496 3300037418 Bacteria 3107
486 Ga0395900_0122907 3300037418 Bacteria 2662
487 Ga0395898_0000053 3300037466 Bacteria 279600
488 Ga0395898_0027810 3300037466 Bacteria 5670
489 Ga0395898_0058142 3300037466 Bacteria 3765
490 Ga0395898_0106921 3300037466 Bacteria 2683
491 Ga0395898_0119137 3300037466 Bacteria 2528
492 Ga0395905_0000001 3300037471 Bacteria 2037079
493 Ga0395905_0000031 3300037471 Bacteria 286757
494 Ga0395905_0002276 3300037471 Bacteria 21549
495 Ga0395905_0003830 3300037471 Bacteria 15893
496 Ga0395905_0010954 3300037471 Bacteria 8777
497 Ga0395905_0017189 3300037471 Bacteria 6870
498 Ga0395905_0047544 3300037471 Bacteria 4020
499 Ga0395905_0078961 3300037471 Bacteria 3084
500 Ga0395905_0287986 3300037471 Bacteria 1529
501 Ga0395905_0692986 3300037471 Bacteria 921
502 Ga0395901_0000163 3300038443 Bacteria 87103
503 Ga0395901_0018049 3300038443 Bacteria 7201
504 Ga0395901_0018431 3300038443 Bacteria 7125
505 Ga0395901_0133193 3300038443 Bacteria 2612
506 Ga0395901_0202149 3300038443 Bacteria 2082
507 Ga0400490_27390 3300038726 Bacteria 20125
508 Ga0400490_44394 3300038726 Bacteria 1984
509 Ga0400485_18763 3300038735 Bacteria 145645
510 Ga0400488_13388 3300038741 Bacteria 3082
511 Ga0400488_17616 3300038741 Bacteria 1737
512 Ga0400486_28155 3300038742 Bacteria 181974
513 Ga0400486_30217 3300038742 Bacteria 2898
514 Ga0400483_287441 3300039062 Bacteria 31618
515 Ga0400487_52424 3300039110 Bacteria 66024
516 Ga0400487_54158 3300039110 Bacteria 56280
517 Ga0436365_1861022 3300039437 Bacteria 74232
518 Ga0439436_0038897 3300041404 Bacteria 1367
519 Ga0439438_000059 3300041405 Bacteria 51384
520 Ga0439438_000165 3300041405 Bacteria 30229
521 Ga0439438_059606 3300041405 Bacteria 957
522 Ga0451795_0735138 3300041456 Bacteria 3177
523 Ga0439449_0002757 3300042007 Bacteria 6836
524 Ga0439449_0011505 3300042007 Bacteria 3329
525 Ga0439452_000006 3300042010 Bacteria 645083
526 Ga0439452_000013 3300042010 Bacteria 364058
527 Ga0439452_000187 3300042010 Bacteria 45688
528 Ga0439452_000189 3300042010 Bacteria 45513
529 Ga0439452_000375 3300042010 Bacteria 26934
530 Ga0439452_006248 3300042010 Bacteria 3744
531 Ga0450907_000024 3300042146 Bacteria 73273
532 Ga0439434_0032604 3300042435 Bacteria 1586
533 Ga0439464_0085984 3300042439 Bacteria 943
534 Ga0439464_0098273 3300042439 Bacteria 887
535 Ga0451577_0138257 3300042876 Bacteria 2188
536 Ga0451577_0452894 3300042876 Bacteria 1165
537 Ga0466972_0006867 3300044658 Bacteria 5713
538 Ga0466981_0000001 3300044669 Bacteria 367980
539 Ga0453683_0002974 3300044673 Bacteria 12719
540 Ga0466965_0000627 3300044683 Bacteria 12889
541 Ga0466966_0014463 3300044684 Bacteria 5224
542 Ga0466963_0029926 3300044694 Bacteria 3508
543 Ga0466963_0051127 3300044694 Bacteria 2738
544 Ga0466963_0054385 3300044694 Bacteria 2660
545 Ga0466963_0057692 3300044694 Bacteria 2586
546 Ga0466964_0010649 3300044706 Bacteria 3469
547 Ga0453684_0000334 3300044712 Bacteria 196444
548 Ga0453684_0010323 3300044712 Bacteria 15988
549 Ga0453684_0045851 3300044712 Bacteria 5825
550 Ga0453684_0063618 3300044712 Bacteria 4718
551 Ga0453684_0187951 3300044712 Bacteria 2419
552 Ga0466957_0025756 3300044842 Bacteria 3487
553 Ga0466959_0060564 3300045049 Bacteria 2754
554 Ga0451576_0004288 3300045051 Bacteria 18679
555 Ga0451576_0010387 3300045051 Bacteria 10690
556 Ga0451576_0011887 3300045051 Bacteria 9847
557 Ga0451576_0192414 3300045051 Bacteria 2131
558 Ga0451576_0401764 3300045051 Bacteria 1437
559 Ga0466958_0122038 3300045836 Bacteria 1632
560 Ga0466958_0340745 3300045836 Bacteria 964
561 Ga0466967_0016064 3300045976 Bacteria 5890
562 Ga0466967_0034090 3300045976 Bacteria 4317
563 Ga0466967_0109664 3300045976 Bacteria 2534
564 Ga0466967_0683151 3300045976 Bacteria 1016
565 Ga0466967_0759790 3300045976 Bacteria 962
566 Ga0495617_000475 3300046452 Bacteria 21325
567 Ga0495627_000048 3300046453 Bacteria 169824
568 Ga0495627_000651 3300046453 Bacteria 26838
569 Ga0495592_0006856 3300046454 Bacteria 8504
570 Ga0495603_0003401 3300046455 Bacteria 9474
571 Ga0495590_0000206 3300046457 Bacteria 32748
572 Ga0495590_0010257 3300046457 Bacteria 3528
573 Ga0495591_000045 3300046458 Bacteria 145091
574 Ga0495591_000102 3300046458 Bacteria 98697
575 Ga0495591_002789 3300046458 Bacteria 9419
576 Ga0495629_0075992 3300046459 Bacteria 2345
577 Ga0495638_0002096 3300046460 Bacteria 16885
578 Ga0495638_0078912 3300046460 Bacteria 2003
579 Ga0495638_0213420 3300046460 Bacteria 1083
580 Ga0495641_0008644 3300046461 Bacteria 6164
581 Ga0495651_0029605 3300046462 Bacteria 4270
582 Ga0495651_0030714 3300046462 Bacteria 4189
583 Ga0495653_0003798 3300046463 Bacteria 12220
584 Ga0495653_0005421 3300046463 Bacteria 10385
585 Ga0495653_0052096 3300046463 Bacteria 3138
586 Ga0495650_0000008 3300046471 Bacteria 688246
587 Ga0495650_0000059 3300046471 Bacteria 296253
588 Ga0495650_0006347 3300046471 Bacteria 7388
589 Ga0495650_0013027 3300046471 Bacteria 4432
590 Ga0495580_0015940 3300046472 Bacteria 5655
591 Ga0495580_0086190 3300046472 Bacteria 2187
592 Ga0495582_0021241 3300046473 Bacteria 3554
593 Ga0495582_0205358 3300046473 Bacteria 1125
594 Ga0495605_0001064 3300046474 Bacteria 18325
595 Ga0495605_0122051 3300046474 Bacteria 1180
596 Ga0495639_0004976 3300046475 Bacteria 5700
597 Ga0495639_0040522 3300046475 Bacteria 2095
598 Ga0495662_0019363 3300046476 Bacteria 3291
599 Ga0495585_0000026 3300046492 Bacteria 148243
600 Ga0495585_0000649 3300046492 Bacteria 31919
601 Ga0495585_0004130 3300046492 Bacteria 9503
602 Ga0495585_0006530 3300046492 Bacteria 7218
603 Ga0495585_0034852 3300046492 Bacteria 2845
604 Ga0495594_0013331 3300046499 Bacteria 4290
605 Ga0495594_0068505 3300046499 Bacteria 1971
606 Ga0495594_0086848 3300046499 Bacteria 1750
607 Ga0495596_0002772 3300046500 Bacteria 9177
608 Ga0495596_0011391 3300046500 Bacteria 3839
609 Ga0495607_0016352 3300046501 Bacteria 4787
610 Ga0495607_0035777 3300046501 Bacteria 3000
611 Ga0495583_0000009 3300046506 Bacteria 372527
612 Ga0495606_0000308 3300046507 Bacteria 84218
613 Ga0495606_0001127 3300046507 Bacteria 38097
614 Ga0495606_0023693 3300046507 Bacteria 4441
615 Ga0495616_0000569 3300046513 Bacteria 27955
616 Ga0495616_0090309 3300046513 Bacteria 1451
617 Ga0495618_0038370 3300046514 Bacteria 3010
618 Ga0495618_0060088 3300046514 Bacteria 2409
619 Ga0495620_0048904 3300046515 Bacteria 1812
620 Ga0495628_0002411 3300046516 Bacteria 16861
621 Ga0495628_0006745 3300046516 Bacteria 10002
622 Ga0495628_0114553 3300046516 Bacteria 2071
623 Ga0495630_0007589 3300046517 Bacteria 7754
624 Ga0495631_0000366 3300046518 Bacteria 31016
625 Ga0495631_0001045 3300046518 Bacteria 17172
626 Ga0495631_0001198 3300046518 Bacteria 16006
627 Ga0495631_0008656 3300046518 Bacteria 5121
628 Ga0495631_0084917 3300046518 Bacteria 1364
629 Ga0495632_0001867 3300046519 Bacteria 16905
630 Ga0495632_0049306 3300046519 Bacteria 2082
631 Ga0495637_0000891 3300046520 Bacteria 19260
632 Ga0495643_0000898 3300046522 Bacteria 31694
633 Ga0495643_0095840 3300046522 Bacteria 1526
634 Ga0495643_0111068 3300046522 Bacteria 1394
635 Ga0495644_0034753 3300046523 Bacteria 1903
636 Ga0495644_0050986 3300046523 Bacteria 1553
637 Ga0495648_0000866 3300046524 Bacteria 31938
638 Ga0495648_0001470 3300046524 Bacteria 23040
639 Ga0495648_0001615 3300046524 Bacteria 21921
640 Ga0495648_0001800 3300046524 Bacteria 20623
641 Ga0495648_0012590 3300046524 Bacteria 6299
642 Ga0495648_0013244 3300046524 Bacteria 6109
643 Ga0495648_0082379 3300046524 Bacteria 1826
644 Ga0495666_0001193 3300046526 Bacteria 12527
645 Ga0495666_0002138 3300046526 Bacteria 9818
646 Ga0495642_0001287 3300046528 Bacteria 11316
647 Ga0495642_0025390 3300046528 Bacteria 2348
648 Ga0495642_0026145 3300046528 Bacteria 2317
649 Ga0495642_0051777 3300046528 Bacteria 1690
650 Ga0495652_0177263 3300046529 Bacteria 1639
651 Ga0495654_0000073 3300046530 Bacteria 115044
652 Ga0495654_0000101 3300046530 Bacteria 98257
653 Ga0495654_0001104 3300046530 Bacteria 19508
654 Ga0495654_0005457 3300046530 Bacteria 7381
655 Ga0495654_0015625 3300046530 Bacteria 4028
656 Ga0495665_0009870 3300046531 Bacteria 5168
657 Ga0495586_0011839 3300046535 Bacteria 4636
658 Ga0495586_0012833 3300046535 Bacteria 4441
659 Ga0495586_0041722 3300046535 Bacteria 2471
660 Ga0495587_0059624 3300046536 Bacteria 2239
661 Ga0495609_0006494 3300046538 Bacteria 5960
662 Ga0495609_0012215 3300046538 Bacteria 4074
663 Ga0495609_0051534 3300046538 Bacteria 1832
664 Ga0495609_0077001 3300046538 Bacteria 1461
665 Ga0495597_0000590 3300046542 Bacteria 30015
666 Ga0495597_0017841 3300046542 Bacteria 3334
667 Ga0495597_0030835 3300046542 Bacteria 2441
668 Ga0495645_0011685 3300046543 Bacteria 6181
669 Ga0495645_0041973 3300046543 Bacteria 3335
670 Ga0495645_0060598 3300046543 Bacteria 2743
671 Ga0495622_0004018 3300046557 Bacteria 6866
672 Ga0495622_0021048 3300046557 Bacteria 3038
673 Ga0495633_0012233 3300046558 Bacteria 4576
674 Ga0495633_0050210 3300046558 Bacteria 1967
675 Ga0495633_0105505 3300046558 Bacteria 1307
676 Ga0495667_0037944 3300046559 Bacteria 3209
677 Ga0495656_0000005 3300046615 Bacteria 238208
678 Ga0495656_0053133 3300046615 Bacteria 1740
679 Ga0495668_0000848 3300046616 Bacteria 34526
680 Ga0495668_0001034 3300046616 Bacteria 29500
681 Ga0495668_0054345 3300046616 Bacteria 2214
682 Ga0495668_0057450 3300046616 Bacteria 2147
683 Ga0495634_0114502 3300046642 Bacteria 1731
684 Ga0495611_0005346 3300046648 Bacteria 5496
685 Ga0495611_0200252 3300046648 Bacteria 931
686 Ga0495625_0004807 3300046660 Bacteria 12633
687 Ga0495625_0007834 3300046660 Bacteria 9206
688 Ga0495625_0044149 3300046660 Bacteria 3228
689 Ga0495635_0022810 3300046663 Bacteria 4363
690 Ga0495661_0004648 3300046665 Bacteria 9870
691 Ga0495661_0064576 3300046665 Bacteria 2159
692 Ga0495661_0158402 3300046665 Bacteria 1217
693 Ga0495588_0009232 3300046674 Bacteria 4554
694 Ga0495588_0015483 3300046674 Bacteria 3671
695 Ga0495588_0027406 3300046674 Bacteria 2847
696 Ga0495588_0083915 3300046674 Bacteria 1664
697 Ga0495623_0002899 3300046679 Bacteria 11291
698 Ga0495623_0014822 3300046679 Bacteria 5041
699 Ga0495623_0151278 3300046679 Bacteria 1371
700 Ga0495646_0002496 3300046680 Bacteria 11293
701 Ga0495646_0004584 3300046680 Bacteria 8710
702 Ga0495647_0000801 3300046681 Bacteria 9394
703 Ga0495658_0002290 3300046683 Bacteria 9656
704 Ga0495669_0008127 3300046684 Bacteria 4402
705 Ga0495613_0047268 3300046689 Bacteria 3179
706 Ga0495613_0053577 3300046689 Bacteria 2968
707 Ga0495624_0004714 3300046690 Bacteria 9919
708 Ga0495624_0012600 3300046690 Bacteria 5772
709 Ga0495624_0221095 3300046690 Bacteria 1148
710 Ga0495670_0000473 3300046691 Bacteria 19093
711 Ga0495670_0020968 3300046691 Bacteria 3222
712 Ga0495670_0032948 3300046691 Bacteria 2577
713 Ga0495670_0040762 3300046691 Bacteria 2316
714 Ga0495670_0254929 3300046691 Bacteria 936
715 Ga0495671_0000354 3300046692 Bacteria 38143
716 Ga0495671_0021640 3300046692 Bacteria 3374
717 Ga0495649_0003899 3300046694 Bacteria 9869
718 Ga0495649_0007912 3300046694 Bacteria 6432
719 Ga0495649_0011769 3300046694 Bacteria 5119
720 Ga0495589_0000025 3300046794 Bacteria 185024
721 Ga0495589_0000354 3300046794 Bacteria 35716
722 Ga0495589_0001682 3300046794 Bacteria 12644
723 Ga0495589_0009736 3300046794 Bacteria 4992
724 Ga0495600_0008466 3300046809 Bacteria 6320
725 Ga0495600_0067886 3300046809 Bacteria 2330
726 Ga0495660_0000019 3300046810 Bacteria 311047
727 Ga0495660_0137950 3300046810 Bacteria 1216
728 Ga0495581_0000444 3300047315 Bacteria 21134
729 Ga0495581_0035891 3300047315 Bacteria 2867
730 Ga0495581_0067907 3300047315 Bacteria 2062
731 Ga0495581_0078947 3300047315 Bacteria 1904
732 Ga0495604_0050124 3300047317 Bacteria 3242
733 Ga0495604_0052766 3300047317 Bacteria 3146
734 Ga0495604_0112847 3300047317 Bacteria 1979
735 Ga0495636_0071108 3300047318 Bacteria 1485
736 Ga0495672_0000003 3300047320 Bacteria 728845
737 Ga0495672_0000200 3300047320 Bacteria 85505
738 Ga0495672_0002537 3300047320 Bacteria 16653
739 Ga0495672_0005433 3300047320 Bacteria 10113
740 Ga0495676_0042371 3300047321 Bacteria 3737
741 Ga0495676_0098159 3300047321 Bacteria 2174
742 Ga0495680_0267559 3300047322 Bacteria 1207
743 Ga0495680_0433284 3300047322 Bacteria 902
744 Ga0495683_0005888 3300047323 Bacteria 6735
745 Ga0495683_0030033 3300047323 Bacteria 2775
746 Ga0495683_0043527 3300047323 Bacteria 2260
747 Ga0495687_000034 3300047443 Bacteria 257321
748 Ga0495687_000081 3300047443 Bacteria 147362
749 Ga0495687_104901 3300047443 Bacteria 1052
750 Ga0495675_0111005 3300047444 Bacteria 1711
751 Ga0495679_000089 3300047446 Bacteria 83016
752 Ga0495679_001212 3300047446 Bacteria 15299
753 Ga0495679_009181 3300047446 Bacteria 3976
754 Ga0495679_048717 3300047446 Bacteria 1280
755 Ga0495673_0000011 3300047469 Bacteria 674140
756 Ga0495673_0000124 3300047469 Bacteria 142007
757 Ga0495681_0000144 3300047470 Bacteria 60089
758 Ga0495681_0008644 3300047470 Bacteria 6358
759 Ga0495681_0034978 3300047470 Bacteria 2498
760 Ga0495681_0037875 3300047470 Bacteria 2370
761 Ga0495681_0114378 3300047470 Bacteria 1165
762 Ga0495684_0052768 3300047471 Bacteria 3102
763 Ga0495686_0009775 3300047472 Bacteria 6883
764 Ga0495593_0005464 3300047673 Bacteria 7504
765 Ga0495602_0074513 3300048088 Bacteria 2884
766 Ga0495626_0002847 3300048091 Bacteria 11563
767 Ga0496100_0022394 3300048903 Bacteria 3823
768 Ga0496100_0120972 3300048903 Bacteria 1831
769 Ga0496101_0000070 3300048904 Bacteria 120089
770 Ga0496101_0021478 3300048904 Bacteria 4436
771 Ga0496101_0068504 3300048904 Bacteria 2594
772 Ga0496101_0080062 3300048904 Bacteria 2413
773 Ga0496102_0001658 3300048905 Bacteria 19568
774 Ga0496102_0083328 3300048905 Bacteria 2950
775 Ga0496102_0099565 3300048905 Bacteria 2698
776 Ga0496103_0007660 3300048906 Bacteria 6423
777 Ga0496103_0037337 3300048906 Bacteria 2976
778 Ga0496103_0138528 3300048906 Bacteria 1555
779 Ga0496104_0001190 3300048907 Bacteria 22376
780 Ga0496104_0025817 3300048907 Bacteria 5417
781 Ga0496105_0033165 3300048908 Bacteria 4239
782 Ga0496106_0265593 3300048909 Bacteria 1373
783 Ga0496106_0299856 3300048909 Bacteria 1289
784 Ga0496107_0509329 3300048910 Bacteria 892
785 Ga0496108_0033619 3300048911 Bacteria 4259
786 Ga0496109_0169718 3300048912 Bacteria 2046
787 Ga0496109_0209862 3300048912 Bacteria 1831
788 Ga0496110_0069026 3300048913 Bacteria 3129
789 Ga0496110_0118655 3300048913 Bacteria 2382
790 Ga0496111_0047620 3300048914 Bacteria 3087
791 Ga0496111_0107234 3300048914 Bacteria 2056
792 Ga0496112_0063022 3300048915 Bacteria 3657
793 Ga0496112_0109011 3300048915 Bacteria 2739
794 Ga0496113_0049574 3300048916 Bacteria 3127
795 Ga0496113_0383144 3300048916 Bacteria 1128
796 Ga0496114_0134333 3300048917 Bacteria 2138
797 Ga0496114_0213102 3300048917 Bacteria 1694
798 Ga0496115_0069779 3300048918 Bacteria 2847
799 Ga0496115_0079844 3300048918 Bacteria 2663
800 Ga0496115_0141854 3300048918 Bacteria 1982
801 Ga0496115_0311737 3300048918 Bacteria 1288
802 Ga0496115_0419580 3300048918 Bacteria 1084
803 Ga0496116_0000244 3300048919 Bacteria 98664
804 Ga0496116_0001934 3300048919 Bacteria 22325
805 Ga0496116_0002132 3300048919 Bacteria 21044
806 Ga0496116_0004982 3300048919 Bacteria 12509
807 Ga0496116_0006593 3300048919 Bacteria 10507
808 Ga0496117_0000043 3300048920 Bacteria 309583
809 Ga0496117_0000168 3300048920 Bacteria 137886
810 Ga0496117_0002568 3300048920 Bacteria 22605
811 Ga0496117_0003691 3300048920 Bacteria 17577
812 Ga0496117_0013621 3300048920 Bacteria 7081
813 Ga0496117_0261953 3300048920 Bacteria 936
814 Ga0496118_0000075 3300048921 Bacteria 196228
815 Ga0496118_0000997 3300048921 Bacteria 44150
816 Ga0496118_0004430 3300048921 Bacteria 16663
817 Ga0496118_0020648 3300048921 Bacteria 5833
818 Ga0496118_0102221 3300048921 Bacteria 1932
819 Ga0496119_0000009 3300048922 Bacteria 443128
820 Ga0496119_0001670 3300048922 Bacteria 25930
821 Ga0496119_0002299 3300048922 Bacteria 21135
822 Ga0496119_0002763 3300048922 Bacteria 18877
823 Ga0496119_0003037 3300048922 Bacteria 17767
824 Ga0496119_0004240 3300048922 Bacteria 14385
825 Ga0496119_0040741 3300048922 Bacteria 2966
826 Ga0496119_0047483 3300048922 Bacteria 2671
827 Ga0496119_0051033 3300048922 Bacteria 2545
828 Ga0496119_0052628 3300048922 Bacteria 2493
829 Ga0496119_0054916 3300048922 Bacteria 2422
830 Ga0496120_0000044 3300048923 Bacteria 192292
831 Ga0496120_0000066 3300048923 Bacteria 167784
832 Ga0496120_0000645 3300048923 Bacteria 51434
833 Ga0496120_0001316 3300048923 Bacteria 30737
834 Ga0496120_0001317 3300048923 Bacteria 30737
835 Ga0496120_0002117 3300048923 Bacteria 21235
836 Ga0496120_0002630 3300048923 Bacteria 17786
837 Ga0496120_0003636 3300048923 Bacteria 13830
838 Ga0496120_0004666 3300048923 Bacteria 11318
839 Ga0496120_0015824 3300048923 Bacteria 4956
840 Ga0496120_0016305 3300048923 Bacteria 4860
841 Ga0496121_0003294 3300048924 Bacteria 23192
842 Ga0496121_0003770 3300048924 Bacteria 21180
843 Ga0496121_0004311 3300048924 Bacteria 19263
844 Ga0496121_0020778 3300048924 Bacteria 6473
845 Ga0496121_0023512 3300048924 Bacteria 5931
846 Ga0496121_0039163 3300048924 Bacteria 4183
847 Ga0496121_0074185 3300048924 Bacteria 2723
848 Ga0496122_0000016 3300048925 Bacteria 443353
849 Ga0496122_0000339 3300048925 Bacteria 101614
850 Ga0496122_0002667 3300048925 Bacteria 24878
851 Ga0496122_0034566 3300048925 Bacteria 4134
852 Ga0496122_0045673 3300048925 Bacteria 3401
853 Ga0496122_0057792 3300048925 Bacteria 2877
854 Ga0496122_0168214 3300048925 Bacteria 1325
855 Ga0496123_0000444 3300048926 Bacteria 74191
856 Ga0496123_0000506 3300048926 Bacteria 67807
857 Ga0496123_0000661 3300048926 Bacteria 57023
858 Ga0496123_0002548 3300048926 Bacteria 22226
859 Ga0496123_0004933 3300048926 Bacteria 13685
860 Ga0496123_0012294 3300048926 Bacteria 7314
861 Ga0496123_0014727 3300048926 Bacteria 6461
862 Ga0496123_0033475 3300048926 Bacteria 3697
863 Ga0496124_0000069 3300048927 Bacteria 221585
864 Ga0496124_0000164 3300048927 Bacteria 134754
865 Ga0496124_0000544 3300048927 Bacteria 63735
866 Ga0496124_0001338 3300048927 Bacteria 37019
867 Ga0496124_0001912 3300048927 Bacteria 28579
868 Ga0496124_0008345 3300048927 Bacteria 10850
869 Ga0496124_0045655 3300048927 Bacteria 3755
870 Ga0496124_0086212 3300048927 Bacteria 2570
871 Ga0496124_0196274 3300048927 Bacteria 1539
872 Ga0496125_0000081 3300048928 Bacteria 228069
873 Ga0496125_0004962 3300048928 Bacteria 15049
874 Ga0496125_0013881 3300048928 Bacteria 7883
875 Ga0496125_0034260 3300048928 Bacteria 4478
876 Ga0496126_0000983 3300048929 Bacteria 48840
877 Ga0496126_0003685 3300048929 Bacteria 19134
878 Ga0496126_0023761 3300048929 Bacteria 5935
879 Ga0496126_0025797 3300048929 Bacteria 5647
880 Ga0496126_0030792 3300048929 Bacteria 5079
881 Ga0496126_0034102 3300048929 Bacteria 4784
882 Ga0496126_0135833 3300048929 Bacteria 2121
883 Ga0501305_017969 3300049161 Bacteria 1020
884 Ga0495678_000094 3300049459 Bacteria 111548
885 Ga0495678_000214 3300049459 Bacteria 67205
886 Ga0495678_000294 3300049459 Bacteria 54947
887 Ga0495682_0000017 3300049460 Bacteria 233333
888 Ga0501031_0169943 3300049568 Bacteria 1425
889 Ga0501032_0000057 3300049569 Bacteria 98201
890 Ga0501033_0081633 3300049570 Bacteria 2371
891 Ga0501033_0095114 3300049570 Bacteria 2177
892 Ga0501034_0000001 3300049571 Bacteria 2184493
893 Ga0501034_0000188 3300049571 Bacteria 115935
894 Ga0501036_0004036 3300049572 Bacteria 11799
895 Ga0501037_0000001 3300049573 Bacteria 753276
896 Ga0501038_0048075 3300049574 Bacteria 3693
897 Ga0501039_0000001 3300049575 Bacteria 449008
898 Ga0501041_0002567 3300049577 Bacteria 10350
899 Ga0501042_0004940 3300049578 Bacteria 8538
900 Ga0501047_0156291 3300049581 Bacteria 2154
901 Ga0501048_0008525 3300049582 Bacteria 7750
902 Ga0501068_0068876 3300049584 Bacteria 2157
903 Ga0501069_0281648 3300049585 Bacteria 973
904 Ga0501070_0001515 3300049586 Bacteria 20712
905 Ga0501070_0145894 3300049586 Bacteria 1953
906 Ga0501071_0005029 3300049587 Bacteria 8454
907 Ga0501074_0201203 3300049590 Bacteria 1419
908 Ga0501074_0364388 3300049590 Bacteria 1025
909 Ga0501075_0001026 3300049591 Bacteria 17906
910 Ga0501076_0000823 3300049592 Bacteria 20155
911 Ga0501077_0188828 3300049593 Bacteria 1309
912 Ga0501080_0057081 3300049742 Bacteria 3635
913 Ga0501083_0137128 3300049744 Bacteria 1603
914 Ga0501035_0001118 3300049822 Bacteria 28029
915 Ga0501044_0259584 3300049823 Bacteria 1676
916 Ga0501045_0003259 3300049824 Bacteria 11087
917 nmdc:mga03n38_8480_c1 3300050490 Bacteria 3691
918 nmdc:mga00v17_181653_c1 3300050491 Bacteria 1357
919 nmdc:mga00v17_249_c1 3300050491 Bacteria 31713
920 nmdc:mga00v17_487_c1 3300050491 Bacteria 22256
921 nmdc:mga00v17_56930_c1 3300050491 Bacteria 2391
922 nmdc:mga0yw44_67004_c1 3300050492 Bacteria 2218
923 nmdc:mga0k408_120948_c1 3300050493 Bacteria 1551
924 nmdc:mga0k408_33082_c2 3300050493 Bacteria 2132
925 nmdc:mga06z11_199016_c1 3300050494 Bacteria 1163
926 nmdc:mga07m45_43858_c1 3300050496 Bacteria 2508
927 nmdc:mga0n895_388760_c1 3300050512 Bacteria 1411
928 nmdc:mga0sz30_67760_c1 3300050516 Bacteria 1533
929 Ga0495601_0017945 3300053077 Bacteria 4302
930 Ga0495612_0004226 3300053078 Bacteria 5958
931 Ga0495595_0097167 3300053084 Bacteria 1418
932 Ga0495619_0390423 3300053085 Bacteria 961
933 Ga0500578_0014630 3300053086 Bacteria 5045
934 Ga0500566_0121985 3300053094 Bacteria 1404
935 Ga0500595_000024 3300053119 Bacteria 144160
936 Ga0500595_001547 3300053119 Bacteria 12180
937 Ga0500621_000004 3300053126 Bacteria 485792
938 Ga0500573_0122153 3300053140 Bacteria 1449
939 Ga0500616_0000458 3300053153 Bacteria 53402
940 Ga0500619_000417 3300053154 Bacteria 7693
941 Ga0500622_0001910 3300053156 Bacteria 15718
942 Ga0500645_000102 3300053730 Bacteria 67660
943 Ga0587084_004455 3300059477 Bacteria 1605
944 Ga0587098_007484 3300059604 Bacteria 1138
945 Ga0530510_0001520 3300061734 Bacteria 15616

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100451629 Ga0070665_1004516292 263
2 3300005614 Ga0068856_100558675 Ga0068856_1005586752 263
3 3300026078 Ga0207702_10212597 Ga0207702_102125972 263
4 3300048911 Ga0496108_0033619 Ga0496108_0033619_1936_2742 263
5 3300048913 Ga0496110_0069026 Ga0496110_0069026_271_1077 263
6 3300048918 Ga0496115_0419580 Ga0496115_0419580_264_1064 263
7 3300048929 Ga0496126_0025797 Ga0496126_0025797_1589_2401 263
8 iso_pu_bacteria 2751185788 2753301396 263
9 iso_pu_bacteria 2904501621 2904503745 263
10 iso_pu_bacteria 2908674828 2908675385 263
11 iso_pu_bacteria 2919042368 2919045023 263
12 iso_pu_bacteria 2928500415 2928501410 263
13 iso_pu_bacteria 2932431166 2932434885 263
14 iso_pu_bacteria 2984551494 2984553582 263
15 iso_pu_bacteria 8002811521 8002813837 263
16 2162886007 SwRhRL2b_contig_2690628 SwRhRL2b_0703.00006900 264
17 2162886007 SwRhRL2b_contig_465629 SwRhRL2b_0009.00007180 264
18 2162886007 SwRhRL2b_contig_565865 SwRhRL2b_0350.00005970 264
19 3300001979 JGI24740J21852_10035601 JGI24740J21852_100356013 264
20 3300002067 JGI24735J21928_10015140 JGI24735J21928_100151404 264
21 3300002704 JGI25155J39150_1000694 JGI25155J39150_10006942 264
22 3300002705 JGI25156J39149_1006009 JGI25156J39149_10060093 264
23 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001475 264
24 3300002738 JGI25154J39366_1000800 JGI25154J39366_100080013 264
25 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001465 264
26 3300003751 Ga0055538_1000001 Ga0055538_1000001568 264
27 3300003752 Ga0055539_1000001 Ga0055539_1000001568 264
28 3300003756 Ga0055533_1000003 Ga0055533_1000003465 264
29 3300003759 Ga0055525_1000003 Ga0055525_1000003465 264
30 3300003841 Ga0055541_1000001 Ga0055541_1000001465 264
31 3300003856 Ga0058692_1000209 Ga0058692_100020913 264
32 3300003856 Ga0058692_1000390 Ga0058692_10003903 264
33 3300003856 Ga0058692_1001340 Ga0058692_10013408 264
34 3300003856 Ga0058692_1001368 Ga0058692_10013681 264
35 3300005262 Ga0065165_1000270 Ga0065165_100027044 264
36 3300005288 Ga0065714_10069175 Ga0065714_100691755 264
37 3300005289 Ga0065704_10002801 Ga0065704_100028017 264
38 3300005289 Ga0065704_10007448 Ga0065704_100074483 264
39 3300005289 Ga0065704_10082129 Ga0065704_100821291 264
40 3300005289 Ga0065704_10086266 Ga0065704_100862663 264
41 3300005289 Ga0065704_10136785 Ga0065704_101367852 264
42 3300005327 Ga0070658_10250068 Ga0070658_102500682 264
43 3300005328 Ga0070676_10007986 Ga0070676_100079864 264
44 3300005328 Ga0070676_10098984 Ga0070676_100989842 264
45 3300005329 Ga0070683_100144424 Ga0070683_1001444243 264
46 3300005331 Ga0070670_100002234 Ga0070670_1000022348 264
47 3300005331 Ga0070670_100043662 Ga0070670_1000436623 264
48 3300005331 Ga0070670_100060341 Ga0070670_1000603414 264
49 3300005335 Ga0070666_10025023 Ga0070666_100250233 264
50 3300005335 Ga0070666_10091078 Ga0070666_100910781 264
51 3300005336 Ga0070680_100001582 Ga0070680_1000015828 264
52 3300005337 Ga0070682_100124953 Ga0070682_1001249531 264
53 3300005339 Ga0070660_100042137 Ga0070660_1000421372 264
54 3300005344 Ga0070661_100027710 Ga0070661_1000277101 264
55 3300005344 Ga0070661_100342969 Ga0070661_1003429692 264
56 3300005347 Ga0070668_100184401 Ga0070668_1001844011 264
57 3300005353 Ga0070669_100073736 Ga0070669_1000737363 264
58 3300005354 Ga0070675_100182860 Ga0070675_1001828602 264
59 3300005355 Ga0070671_100052534 Ga0070671_1000525342 264
60 3300005356 Ga0070674_100021190 Ga0070674_1000211903 264
61 3300005356 Ga0070674_100471836 Ga0070674_1004718361 264
62 3300005364 Ga0070673_100056731 Ga0070673_1000567313 264
63 3300005366 Ga0070659_100046515 Ga0070659_1000465155 264
64 3300005367 Ga0070667_100053674 Ga0070667_1000536744 264
65 3300005367 Ga0070667_100063446 Ga0070667_1000634463 264
66 3300005434 Ga0070709_10000012 Ga0070709_1000001242 264
67 3300005434 Ga0070709_10125538 Ga0070709_101255383 264
68 3300005435 Ga0070714_100052293 Ga0070714_1000522932 264
69 3300005435 Ga0070714_100064477 Ga0070714_1000644774 264
70 3300005435 Ga0070714_100208226 Ga0070714_1002082262 264
71 3300005436 Ga0070713_100001813 Ga0070713_1000018134 264
72 3300005456 Ga0070678_100015524 Ga0070678_1000155243 264
73 3300005456 Ga0070678_100028505 Ga0070678_1000285055 264
74 3300005457 Ga0070662_100022103 Ga0070662_1000221035 264
75 3300005458 Ga0070681_10028427 Ga0070681_100284273 264
76 3300005458 Ga0070681_10461519 Ga0070681_104615191 264
77 3300005459 Ga0068867_100282921 Ga0068867_1002829212 264
78 3300005530 Ga0070679_100012756 Ga0070679_1000127561 264
79 3300005530 Ga0070679_100065499 Ga0070679_1000654994 264
80 3300005530 Ga0070679_100082818 Ga0070679_1000828182 264
81 3300005535 Ga0070684_100190969 Ga0070684_1001909692 264
82 3300005539 Ga0068853_100000194 Ga0068853_10000019423 264
83 3300005543 Ga0070672_100045872 Ga0070672_1000458724 264
84 3300005543 Ga0070672_100052614 Ga0070672_1000526144 264
85 3300005545 Ga0070695_100199753 Ga0070695_1001997532 264
86 3300005548 Ga0070665_100000033 Ga0070665_100000033115 264
87 3300005548 Ga0070665_100012974 Ga0070665_1000129749 264
88 3300005548 Ga0070665_100447316 Ga0070665_1004473162 264
89 3300005548 Ga0070665_100952501 Ga0070665_1009525011 264
90 3300005563 Ga0068855_100132425 Ga0068855_1001324252 264
91 3300005564 Ga0070664_100057086 Ga0070664_1000570864 264
92 3300005564 Ga0070664_100082623 Ga0070664_1000826232 264
93 3300005577 Ga0068857_100000814 Ga0068857_1000008147 264
94 3300005577 Ga0068857_100011113 Ga0068857_1000111134 264
95 3300005577 Ga0068857_100067657 Ga0068857_1000676574 264
96 3300005578 Ga0068854_100009368 Ga0068854_1000093685 264
97 3300005578 Ga0068854_100017438 Ga0068854_1000174384 264
98 3300005614 Ga0068856_100059442 Ga0068856_1000594422 264
99 3300005614 Ga0068856_100063764 Ga0068856_1000637643 264
100 3300005614 Ga0068856_100075706 Ga0068856_1000757063 264
101 3300005614 Ga0068856_100287368 Ga0068856_1002873682 264
102 3300005616 Ga0068852_100046087 Ga0068852_1000460874 264
103 3300005616 Ga0068852_100480299 Ga0068852_1004802991 264
104 3300005618 Ga0068864_100023945 Ga0068864_1000239455 264
105 3300005834 Ga0068851_10006890 Ga0068851_100068902 264
106 3300005841 Ga0068863_100003644 Ga0068863_1000036449 264
107 3300005841 Ga0068863_100013348 Ga0068863_1000133484 264
108 3300005843 Ga0068860_100402766 Ga0068860_1004027662 264
109 3300005985 Ga0081539_10047180 Ga0081539_100471804 264
110 3300006028 Ga0070717_10156227 Ga0070717_101562274 264
111 3300006038 Ga0075365_10166098 Ga0075365_101660982 264
112 3300006042 Ga0075368_10087636 Ga0075368_100876361 264
113 3300006051 Ga0075364_10000454 Ga0075364_100004549 264
114 3300006051 Ga0075364_10000761 Ga0075364_1000076116 264
115 3300006051 Ga0075364_10031035 Ga0075364_100310352 264
116 3300006051 Ga0075364_10048076 Ga0075364_100480762 264
117 3300006173 Ga0070716_100016923 Ga0070716_1000169234 264
118 3300006175 Ga0070712_100299327 Ga0070712_1002993272 264
119 3300006195 Ga0075366_10016396 Ga0075366_100163963 264
120 3300006195 Ga0075366_10024516 Ga0075366_100245163 264
121 3300006353 Ga0075370_10077074 Ga0075370_100770742 264
122 3300006358 Ga0068871_100534576 Ga0068871_1005345761 264
123 3300006844 Ga0075428_100522032 Ga0075428_1005220322 264
124 3300006871 Ga0075434_100269286 Ga0075434_1002692862 264
125 3300006881 Ga0068865_100400665 Ga0068865_1004006652 264
126 3300006946 Ga0079104_1000039 Ga0079104_1000039149 264
127 3300006946 Ga0079104_1000255 Ga0079104_100025539 264
128 3300006946 Ga0079104_1000895 Ga0079104_100089513 264
129 3300006946 Ga0079104_1001436 Ga0079104_100143610 264
130 3300006946 Ga0079104_1001499 Ga0079104_10014999 264
131 3300006946 Ga0079104_1003597 Ga0079104_10035971 264
132 3300009011 Ga0105251_10000036 Ga0105251_1000003693 264
133 3300009011 Ga0105251_10001204 Ga0105251_1000120413 264
134 3300009011 Ga0105251_10001316 Ga0105251_1000131613 264
135 3300009011 Ga0105251_10001736 Ga0105251_100017365 264
136 3300009011 Ga0105251_10002897 Ga0105251_100028975 264
137 3300009011 Ga0105251_10004074 Ga0105251_100040747 264
138 3300009011 Ga0105251_10006180 Ga0105251_100061805 264
139 3300009011 Ga0105251_10013300 Ga0105251_100133001 264
140 3300009011 Ga0105251_10022957 Ga0105251_100229575 264
141 3300009011 Ga0105251_10039578 Ga0105251_100395782 264
142 3300009011 Ga0105251_10074566 Ga0105251_100745662 264
143 3300009011 Ga0105251_10093476 Ga0105251_100934763 264
144 3300009036 Ga0105244_10000193 Ga0105244_1000019357 264
145 3300009036 Ga0105244_10000225 Ga0105244_1000022538 264
146 3300009036 Ga0105244_10001179 Ga0105244_1000117912 264
147 3300009036 Ga0105244_10002608 Ga0105244_100026088 264
148 3300009036 Ga0105244_10003766 Ga0105244_100037668 264
149 3300009036 Ga0105244_10005574 Ga0105244_100055747 264
150 3300009036 Ga0105244_10007009 Ga0105244_100070094 264
151 3300009036 Ga0105244_10014009 Ga0105244_100140092 264
152 3300009036 Ga0105244_10024115 Ga0105244_100241151 264
153 3300009036 Ga0105244_10076162 Ga0105244_100761622 264
154 3300009036 Ga0105244_10088327 Ga0105244_100883272 264
155 3300009036 Ga0105244_10153717 Ga0105244_101537171 264
156 3300009092 Ga0105250_10000021 Ga0105250_1000002168 264
157 3300009092 Ga0105250_10000086 Ga0105250_1000008619 264
158 3300009092 Ga0105250_10000490 Ga0105250_1000049019 264
159 3300009092 Ga0105250_10005159 Ga0105250_100051593 264
160 3300009092 Ga0105250_10044379 Ga0105250_100443792 264
161 3300009092 Ga0105250_10088433 Ga0105250_100884332 264
162 3300009093 Ga0105240_10003481 Ga0105240_1000348118 264
163 3300009093 Ga0105240_10024207 Ga0105240_100242073 264
164 3300009093 Ga0105240_10138922 Ga0105240_101389225 264
165 3300009093 Ga0105240_10205416 Ga0105240_102054162 264
166 3300009148 Ga0105243_10037401 Ga0105243_100374016 264
167 3300009174 Ga0105241_10000012 Ga0105241_1000001276 264
168 3300009176 Ga0105242_10028956 Ga0105242_100289562 264
169 3300009176 Ga0105242_10138250 Ga0105242_101382502 264
170 3300009177 Ga0105248_10000001 Ga0105248_100000011290 264
171 3300009177 Ga0105248_10046312 Ga0105248_100463125 264
172 3300009551 Ga0105238_10016032 Ga0105238_100160328 264
173 3300009551 Ga0105238_10184008 Ga0105238_101840083 264
174 3300009553 Ga0105249_10838785 Ga0105249_108387852 264
175 3300011119 Ga0105246_10031289 Ga0105246_100312892 264
176 3300011119 Ga0105246_10137213 Ga0105246_101372133 264
177 3300013100 Ga0157373_10000745 Ga0157373_1000074516 264
178 3300013100 Ga0157373_10002600 Ga0157373_1000260011 264
179 3300013100 Ga0157373_10013651 Ga0157373_100136512 264
180 3300013100 Ga0157373_10036245 Ga0157373_100362451 264
181 3300013100 Ga0157373_10140815 Ga0157373_101408152 264
182 3300013102 Ga0157371_10001118 Ga0157371_1000111812 264
183 3300013102 Ga0157371_10001344 Ga0157371_1000134414 264
184 3300013102 Ga0157371_10011341 Ga0157371_100113411 264
185 3300013102 Ga0157371_10018105 Ga0157371_100181055 264
186 3300013102 Ga0157371_10028822 Ga0157371_100288222 264
187 3300013102 Ga0157371_10038542 Ga0157371_100385424 264
188 3300013102 Ga0157371_10072349 Ga0157371_100723492 264
189 3300013102 Ga0157371_10145211 Ga0157371_101452112 264
190 3300013104 Ga0157370_10000297 Ga0157370_1000029721 264
191 3300013104 Ga0157370_10009096 Ga0157370_100090962 264
192 3300013104 Ga0157370_10051542 Ga0157370_100515424 264
193 3300013105 Ga0157369_10006274 Ga0157369_100062742 264
194 3300013105 Ga0157369_10006328 Ga0157369_100063289 264
195 3300013105 Ga0157369_10081465 Ga0157369_100814653 264
196 3300013105 Ga0157369_10175771 Ga0157369_101757713 264
197 3300013105 Ga0157369_10370511 Ga0157369_103705112 264
198 3300013105 Ga0157369_10456162 Ga0157369_104561622 264
199 3300013105 Ga0157369_10710137 Ga0157369_107101372 264
200 3300013105 Ga0157369_10715397 Ga0157369_107153971 264
201 3300013306 Ga0163162_10048767 Ga0163162_100487673 264
202 3300013306 Ga0163162_10058596 Ga0163162_100585963 264
203 3300013306 Ga0163162_10235532 Ga0163162_102355322 264
204 3300013307 Ga0157372_10003156 Ga0157372_1000315614 264
205 3300013307 Ga0157372_10006737 Ga0157372_1000673710 264
206 3300013307 Ga0157372_10007335 Ga0157372_100073353 264
207 3300013307 Ga0157372_10009960 Ga0157372_100099604 264
208 3300013307 Ga0157372_10065105 Ga0157372_100651052 264
209 3300013307 Ga0157372_10078123 Ga0157372_100781235 264
210 3300013307 Ga0157372_10080415 Ga0157372_100804152 264
211 3300013307 Ga0157372_10101024 Ga0157372_101010242 264
212 3300013307 Ga0157372_10159344 Ga0157372_101593443 264
213 3300013308 Ga0157375_10181147 Ga0157375_101811472 264
214 3300013308 Ga0157375_10775296 Ga0157375_107752961 264
215 3300014325 Ga0163163_10037028 Ga0163163_100370283 264
216 3300014497 Ga0182008_10040781 Ga0182008_100407812 264
217 3300015261 Ga0182006_1000013 Ga0182006_1000013261 264
218 3300015261 Ga0182006_1013921 Ga0182006_10139214 264
219 3300015261 Ga0182006_1053529 Ga0182006_10535292 264
220 3300015262 Ga0182007_10003679 Ga0182007_100036793 264
221 3300015265 Ga0182005_1000689 Ga0182005_100068912 264
222 3300015679 Ga0183366_1002 Ga0183366_1002283 264
223 3300015680 Ga0183370_1002 Ga0183370_1002283 264
224 3300015685 Ga0183369_1002 Ga0183369_1002283 264
225 3300015687 Ga0183368_1005 Ga0183368_1005283 264
226 3300017792 Ga0163161_10000038 Ga0163161_1000003871 264
227 3300017792 Ga0163161_10000494 Ga0163161_1000049412 264
228 3300017792 Ga0163161_10026412 Ga0163161_100264122 264
229 3300020070 Ga0206356_11131871 Ga0206356_111318712 264
230 3300020080 Ga0206350_11351559 Ga0206350_113515591 264
231 3300021384 Ga0213876_10000103 Ga0213876_1000010348 264
232 3300025206 Ga0209435_100116 Ga0209435_10011620 264
233 3300025224 Ga0209784_100004 Ga0209784_100004464 264
234 3300025225 Ga0209566_100004 Ga0209566_100004621 264
235 3300025226 Ga0209674_100006 Ga0209674_100006621 264
236 3300025230 Ga0209563_100009 Ga0209563_100009464 264
237 3300025231 Ga0207427_100784 Ga0207427_1007849 264
238 3300025233 Ga0209437_100004 Ga0209437_100004464 264
239 3300025233 Ga0209437_100110 Ga0209437_100110103 264
240 3300025246 Ga0209646_1000130 Ga0209646_100013035 264
241 3300025250 Ga0209026_1002093 Ga0209026_10020938 264
242 3300025253 Ga0209677_100005 Ga0209677_100005464 264
243 3300025256 Ga0209759_1000456 Ga0209759_100045617 264
244 3300025258 Ga0209129_1000010 Ga0209129_1000010402 264
245 3300025261 Ga0209233_1000005 Ga0209233_1000005621 264
246 3300025294 Ga0209025_1000849 Ga0209025_100084929 264
247 3300025299 Ga0209256_1000873 Ga0209256_100087329 264
248 3300025315 Ga0207697_10002399 Ga0207697_100023992 264
249 3300025321 Ga0207656_10040793 Ga0207656_100407932 264
250 3300025711 Ga0207696_1000024 Ga0207696_1000024149 264
251 3300025711 Ga0207696_1000061 Ga0207696_100006168 264
252 3300025711 Ga0207696_1000079 Ga0207696_1000079123 264
253 3300025711 Ga0207696_1000436 Ga0207696_100043628 264
254 3300025711 Ga0207696_1002594 Ga0207696_10025947 264
255 3300025711 Ga0207696_1009243 Ga0207696_10092433 264
256 3300025728 Ga0207655_1000020 Ga0207655_1000020236 264
257 3300025728 Ga0207655_1000025 Ga0207655_1000025359 264
258 3300025728 Ga0207655_1000044 Ga0207655_1000044103 264
259 3300025728 Ga0207655_1000047 Ga0207655_1000047236 264
260 3300025728 Ga0207655_1000079 Ga0207655_1000079134 264
261 3300025728 Ga0207655_1000088 Ga0207655_100008838 264
262 3300025728 Ga0207655_1000150 Ga0207655_100015035 264
263 3300025728 Ga0207655_1000382 Ga0207655_100038246 264
264 3300025728 Ga0207655_1002063 Ga0207655_10020637 264
265 3300025728 Ga0207655_1003957 Ga0207655_10039573 264
266 3300025728 Ga0207655_1004443 Ga0207655_10044437 264
267 3300025728 Ga0207655_1014279 Ga0207655_10142792 264
268 3300025728 Ga0207655_1026831 Ga0207655_10268312 264
269 3300025728 Ga0207655_1042138 Ga0207655_10421382 264
270 3300025735 Ga0207713_1000028 Ga0207713_1000028189 264
271 3300025735 Ga0207713_1000033 Ga0207713_1000033145 264
272 3300025735 Ga0207713_1000051 Ga0207713_100005169 264
273 3300025735 Ga0207713_1000054 Ga0207713_100005476 264
274 3300025735 Ga0207713_1000082 Ga0207713_100008297 264
275 3300025735 Ga0207713_1001326 Ga0207713_100132611 264
276 3300025735 Ga0207713_1001432 Ga0207713_10014323 264
277 3300025735 Ga0207713_1020708 Ga0207713_10207083 264
278 3300025735 Ga0207713_1021697 Ga0207713_10216972 264
279 3300025735 Ga0207713_1041556 Ga0207713_10415562 264
280 3300025893 Ga0207682_10020483 Ga0207682_100204832 264
281 3300025900 Ga0207710_10000042 Ga0207710_1000004269 264
282 3300025904 Ga0207647_10040161 Ga0207647_100401614 264
283 3300025906 Ga0207699_10000087 Ga0207699_1000008722 264
284 3300025907 Ga0207645_10000903 Ga0207645_1000090316 264
285 3300025907 Ga0207645_10148890 Ga0207645_101488902 264
286 3300025909 Ga0207705_10047691 Ga0207705_100476913 264
287 3300025909 Ga0207705_10226511 Ga0207705_102265112 264
288 3300025911 Ga0207654_10000015 Ga0207654_1000001576 264
289 3300025912 Ga0207707_10010873 Ga0207707_100108732 264
290 3300025913 Ga0207695_10002294 Ga0207695_1000229424 264
291 3300025913 Ga0207695_10161596 Ga0207695_101615963 264
292 3300025913 Ga0207695_10197062 Ga0207695_101970623 264
293 3300025915 Ga0207693_10008546 Ga0207693_100085464 264
294 3300025915 Ga0207693_10370477 Ga0207693_103704772 264
295 3300025917 Ga0207660_10086835 Ga0207660_100868352 264
296 3300025919 Ga0207657_10012629 Ga0207657_100126294 264
297 3300025919 Ga0207657_10021933 Ga0207657_100219335 264
298 3300025920 Ga0207649_10035183 Ga0207649_100351833 264
299 3300025920 Ga0207649_10443453 Ga0207649_104434531 264
300 3300025921 Ga0207652_10039042 Ga0207652_100390422 264
301 3300025921 Ga0207652_10102751 Ga0207652_101027513 264
302 3300025921 Ga0207652_10160815 Ga0207652_101608153 264
303 3300025922 Ga0207646_10227450 Ga0207646_102274503 264
304 3300025923 Ga0207681_10065868 Ga0207681_100658684 264
305 3300025924 Ga0207694_10155401 Ga0207694_101554013 264
306 3300025925 Ga0207650_10002884 Ga0207650_100028848 264
307 3300025925 Ga0207650_10070846 Ga0207650_100708464 264
308 3300025925 Ga0207650_10076110 Ga0207650_100761102 264
309 3300025925 Ga0207650_10147743 Ga0207650_101477433 264
310 3300025926 Ga0207659_10056797 Ga0207659_100567972 264
311 3300025926 Ga0207659_10184631 Ga0207659_101846312 264
312 3300025928 Ga0207700_10017057 Ga0207700_100170574 264
313 3300025929 Ga0207664_10021636 Ga0207664_100216365 264
314 3300025929 Ga0207664_10039614 Ga0207664_100396143 264
315 3300025929 Ga0207664_10356385 Ga0207664_103563852 264
316 3300025932 Ga0207690_10042597 Ga0207690_100425976 264
317 3300025933 Ga0207706_10019655 Ga0207706_100196554 264
318 3300025933 Ga0207706_10039451 Ga0207706_100394515 264
319 3300025933 Ga0207706_10059992 Ga0207706_100599924 264
320 3300025933 Ga0207706_10185017 Ga0207706_101850172 264
321 3300025934 Ga0207686_10029977 Ga0207686_100299772 264
322 3300025934 Ga0207686_10069316 Ga0207686_100693161 264
323 3300025934 Ga0207686_10302652 Ga0207686_103026522 264
324 3300025935 Ga0207709_10489262 Ga0207709_104892622 264
325 3300025937 Ga0207669_10200730 Ga0207669_102007302 264
326 3300025938 Ga0207704_10254324 Ga0207704_102543241 264
327 3300025940 Ga0207691_10000137 Ga0207691_1000013719 264
328 3300025940 Ga0207691_10006161 Ga0207691_100061614 264
329 3300025940 Ga0207691_10115192 Ga0207691_101151922 264
330 3300025941 Ga0207711_10000001 Ga0207711_10000001581 264
331 3300025941 Ga0207711_10017576 Ga0207711_100175765 264
332 3300025941 Ga0207711_10316600 Ga0207711_103166002 264
333 3300025945 Ga0207679_10020313 Ga0207679_100203135 264
334 3300025945 Ga0207679_10033555 Ga0207679_100335553 264
335 3300025945 Ga0207679_10279030 Ga0207679_102790302 264
336 3300025949 Ga0207667_10058404 Ga0207667_100584044 264
337 3300025949 Ga0207667_10071359 Ga0207667_100713592 264
338 3300025960 Ga0207651_10298927 Ga0207651_102989272 264
339 3300025961 Ga0207712_10582060 Ga0207712_105820601 264
340 3300025972 Ga0207668_10013400 Ga0207668_100134002 264
341 3300025986 Ga0207658_10090265 Ga0207658_100902653 264
342 3300026041 Ga0207639_10000462 Ga0207639_1000046221 264
343 3300026067 Ga0207678_10060377 Ga0207678_100603774 264
344 3300026078 Ga0207702_10005398 Ga0207702_100053984 264
345 3300026078 Ga0207702_10077746 Ga0207702_100777463 264
346 3300026078 Ga0207702_10135098 Ga0207702_101350982 264
347 3300026088 Ga0207641_10005715 Ga0207641_100057155 264
348 3300026088 Ga0207641_10010661 Ga0207641_100106614 264
349 3300026089 Ga0207648_10032321 Ga0207648_100323216 264
350 3300026095 Ga0207676_10001289 Ga0207676_1000128910 264
351 3300026116 Ga0207674_10002466 Ga0207674_1000246612 264
352 3300026116 Ga0207674_10019429 Ga0207674_100194291 264
353 3300026116 Ga0207674_10045539 Ga0207674_100455394 264
354 3300026116 Ga0207674_10206492 Ga0207674_102064922 264
355 3300026121 Ga0207683_10007029 Ga0207683_100070297 264
356 3300026121 Ga0207683_10009456 Ga0207683_100094565 264
357 3300026121 Ga0207683_10119885 Ga0207683_101198853 264
358 3300026121 Ga0207683_10226064 Ga0207683_102260641 264
359 3300026142 Ga0207698_10026189 Ga0207698_100261894 264
360 3300026142 Ga0207698_10048178 Ga0207698_100481785 264
361 3300027111 Ga0209281_1000007 Ga0209281_1000007240 264
362 3300027111 Ga0209281_1000025 Ga0209281_1000025419 264
363 3300027111 Ga0209281_1000048 Ga0209281_1000048154 264
364 3300027111 Ga0209281_1000066 Ga0209281_100006683 264
365 3300027111 Ga0209281_1000092 Ga0209281_100009277 264
366 3300027111 Ga0209281_1000133 Ga0209281_1000133148 264
367 3300027111 Ga0209281_1000593 Ga0209281_100059313 264
368 3300027111 Ga0209281_1000990 Ga0209281_10009905 264
369 3300027111 Ga0209281_1001123 Ga0209281_10011232 264
370 3300027111 Ga0209281_1001194 Ga0209281_10011942 264
371 3300027111 Ga0209281_1002152 Ga0209281_10021528 264
372 3300027111 Ga0209281_1002761 Ga0209281_10027616 264
373 3300027312 Ga0209371_1000010 Ga0209371_1000010870 264
374 3300027312 Ga0209371_1000013 Ga0209371_1000013223 264
375 3300027312 Ga0209371_1000019 Ga0209371_1000019107 264
376 3300027312 Ga0209371_1000020 Ga0209371_1000020338 264
377 3300027312 Ga0209371_1000254 Ga0209371_100025413 264
378 3300027312 Ga0209371_1000335 Ga0209371_10003354 264
379 3300027312 Ga0209371_1000384 Ga0209371_100038434 264
380 3300027312 Ga0209371_1001152 Ga0209371_10011524 264
381 3300027312 Ga0209371_1001568 Ga0209371_10015687 264
382 3300027312 Ga0209371_1004089 Ga0209371_10040895 264
383 3300027360 Ga0209969_1000315 Ga0209969_10003155 264
384 3300027364 Ga0209967_1002256 Ga0209967_10022561 264
385 3300027462 Ga0210000_1004231 Ga0210000_10042312 264
386 3300027526 Ga0209968_1007518 Ga0209968_10075182 264
387 3300027543 Ga0209999_1001909 Ga0209999_10019092 264
388 3300027614 Ga0209970_1000079 Ga0209970_10000794 264
389 3300027876 Ga0209974_10001694 Ga0209974_100016943 264
390 3300028379 Ga0268266_10000041 Ga0268266_1000004114 264
391 3300028379 Ga0268266_10000058 Ga0268266_10000058197 264
392 3300028379 Ga0268266_10194541 Ga0268266_101945412 264
393 3300028379 Ga0268266_10320560 Ga0268266_103205602 264
394 3300028556 Ga0265337_1001493 Ga0265337_100149312 264
395 3300028577 Ga0265318_10027709 Ga0265318_100277093 264
396 3300028794 Ga0307515_10071160 Ga0307515_100711604 264
397 3300028794 Ga0307515_10169646 Ga0307515_101696462 264
398 3300030500 Ga0268256_1000014 Ga0268256_1000014455 264
399 3300030500 Ga0268256_1000024 Ga0268256_1000024418 264
400 3300030500 Ga0268256_1000057 Ga0268256_1000057174 264
401 3300030500 Ga0268256_1000110 Ga0268256_1000110102 264
402 3300030500 Ga0268256_1000346 Ga0268256_10003467 264
403 3300030500 Ga0268256_1000983 Ga0268256_100098310 264
404 3300030500 Ga0268256_1000993 Ga0268256_10009936 264
405 3300030500 Ga0268256_1001344 Ga0268256_10013449 264
406 3300030500 Ga0268256_1001953 Ga0268256_10019535 264
407 3300030500 Ga0268256_1002231 Ga0268256_10022317 264
408 3300030500 Ga0268256_1003822 Ga0268256_10038222 264
409 3300030500 Ga0268256_1011667 Ga0268256_10116673 264
410 3300030521 Ga0307511_10000620 Ga0307511_100006205 264
411 3300030745 Ga0316182_1346215 Ga0316182_13462152 264
412 3300031238 Ga0265332_10003432 Ga0265332_100034327 264
413 3300031239 Ga0265328_10002271 Ga0265328_100022716 264
414 3300031240 Ga0265320_10013376 Ga0265320_100133763 264
415 3300031247 Ga0265340_10053567 Ga0265340_100535673 264
416 3300031249 Ga0265339_10016795 Ga0265339_100167953 264
417 3300031250 Ga0265331_10000055 Ga0265331_10000055132 264
418 3300031250 Ga0265331_10002356 Ga0265331_100023569 264
419 3300031251 Ga0265327_10000045 Ga0265327_10000045234 264
420 3300031251 Ga0265327_10003148 Ga0265327_100031483 264
421 3300031251 Ga0265327_10007016 Ga0265327_100070169 264
422 3300031251 Ga0265327_10008612 Ga0265327_100086126 264
423 3300031251 Ga0265327_10033638 Ga0265327_100336384 264
424 3300031548 Ga0307408_100009128 Ga0307408_1000091283 264
425 3300031548 Ga0307408_100053288 Ga0307408_1000532883 264
426 3300031548 Ga0307408_100295688 Ga0307408_1002956881 264
427 3300031595 Ga0265313_10008665 Ga0265313_100086655 264
428 3300031665 Ga0316575_10002561 Ga0316575_100025615 264
429 3300031665 Ga0316575_10041573 Ga0316575_100415733 264
430 3300031727 Ga0316576_10055130 Ga0316576_100551302 264
431 3300031731 Ga0307405_10020703 Ga0307405_100207032 264
432 3300031731 Ga0307405_10130859 Ga0307405_101308591 264
433 3300031731 Ga0307405_10149915 Ga0307405_101499153 264
434 3300031731 Ga0307405_10232859 Ga0307405_102328592 264
435 3300031824 Ga0307413_10012718 Ga0307413_100127185 264
436 3300031824 Ga0307413_10107016 Ga0307413_101070164 264
437 3300031852 Ga0307410_10013387 Ga0307410_100133874 264
438 3300031852 Ga0307410_10025506 Ga0307410_100255062 264
439 3300031852 Ga0307410_10030981 Ga0307410_100309815 264
440 3300031852 Ga0307410_10321702 Ga0307410_103217021 264
441 3300031901 Ga0307406_10113216 Ga0307406_101132161 264
442 3300031903 Ga0307407_10043531 Ga0307407_100435311 264
443 3300031903 Ga0307407_10265341 Ga0307407_102653412 264
444 3300031911 Ga0307412_10199933 Ga0307412_101999332 264
445 3300031995 Ga0307409_100024912 Ga0307409_1000249124 264
446 3300031995 Ga0307409_100101515 Ga0307409_1001015152 264
447 3300031995 Ga0307409_100514325 Ga0307409_1005143252 264
448 3300032002 Ga0307416_100005598 Ga0307416_1000055985 264
449 3300032002 Ga0307416_100085930 Ga0307416_1000859303 264
450 3300032002 Ga0307416_100724931 Ga0307416_1007249312 264
451 3300032004 Ga0307414_10174633 Ga0307414_101746332 264
452 3300032004 Ga0307414_10300127 Ga0307414_103001272 264
453 3300032005 Ga0307411_10009499 Ga0307411_100094995 264
454 3300032005 Ga0307411_10157542 Ga0307411_101575421 264
455 3300032126 Ga0307415_100000718 Ga0307415_1000007185 264
456 3300032126 Ga0307415_100028637 Ga0307415_1000286375 264
457 3300032126 Ga0307415_100505564 Ga0307415_1005055641 264
458 3300032133 Ga0316583_10005256 Ga0316583_100052565 264
459 3300032133 Ga0316583_10033334 Ga0316583_100333342 264
460 3300032168 Ga0316593_10000900 Ga0316593_100009003 264
461 3300032168 Ga0316593_10032516 Ga0316593_100325161 264
462 3300034818 Ga0373950_0004424 Ga0373950_0004424_443_1267 264
463 3300035089 Ga0373944_0005254 Ga0373944_0005254_2381_3175 264
464 3300035111 Ga0373923_0000792 Ga0373923_0000792_4700_5494 264
465 3300035113 Ga0373936_0001246 Ga0373936_0001246_6947_7741 264
466 3300035114 Ga0373939_0000033 Ga0373939_0000033_38366_39190 264
467 3300035114 Ga0373939_0003966 Ga0373939_0003966_1537_2331 264
468 3300035116 Ga0373945_0002836 Ga0373945_0002836_123_917 264
469 3300035118 Ga0373954_0009128 Ga0373954_0009128_1281_2075 264
470 3300035119 Ga0373956_0070534 Ga0373956_0070534_658_1452 264
471 3300035121 Ga0373960_0000774 Ga0373960_0000774_2588_3412 264
472 3300035170 Ga0373943_0007158 Ga0373943_0007158_2881_3675 264
473 3300035171 Ga0373946_0001845 Ga0373946_0001845_5191_5985 264
474 3300035172 Ga0373955_0037791 Ga0373955_0037791_641_1435 264
475 3300035242 Ga0373962_0006886 Ga0373962_0006886_856_1680 264
476 3300035398 Ga0316574_0027516 Ga0316574_0027516_984_1778 264
477 3300035398 Ga0316574_0041517 Ga0316574_0041517_689_1483 264
478 3300035398 Ga0316574_0083970 Ga0316574_0083970_272_1066 264
479 3300035398 Ga0316574_0205324 Ga0316574_0205324_61_855 264
480 3300035410 Ga0373924_0020351 Ga0373924_0020351_182_976 264
481 3300035691 Ga0373931_0000478 Ga0373931_0000478_2487_3311 264
482 3300035692 Ga0373935_0005968 Ga0373935_0005968_3811_4605 264
483 3300035695 Ga0373927_0004839 Ga0373927_0004839_5380_6174 264
484 3300035724 Ga0373933_0035802 Ga0373933_0035802_713_1507 264
485 3300036647 Ga0316582_0005223 Ga0316582_0005223_4210_5004 264
486 3300037068 Ga0373925_0023646 Ga0373925_0023646_995_1789 264
487 3300037312 Ga0395899_0001908 Ga0395899_0001908_3032_3826 264
488 3300037312 Ga0395899_0002251 Ga0395899_0002251_10443_11237 264
489 3300037312 Ga0395899_0008511 Ga0395899_0008511_3314_4108 264
490 3300037312 Ga0395899_0020604 Ga0395899_0020604_878_1672 264
491 3300037312 Ga0395899_0030956 Ga0395899_0030956_1407_2201 264
492 3300037312 Ga0395899_0200264 Ga0395899_0200264_434_1228 264
493 3300037418 Ga0395900_0000221 Ga0395900_0000221_42388_43182 264
494 3300037418 Ga0395900_0002564 Ga0395900_0002564_16232_17026 264
495 3300037418 Ga0395900_0017051 Ga0395900_0017051_1394_2188 264
496 3300037418 Ga0395900_0022497 Ga0395900_0022497_2286_3080 264
497 3300037418 Ga0395900_0092496 Ga0395900_0092496_1235_2029 264
498 3300037418 Ga0395900_0122907 Ga0395900_0122907_29_823 264
499 3300037466 Ga0395898_0000053 Ga0395898_0000053_236419_237213 264
500 3300037466 Ga0395898_0027810 Ga0395898_0027810_1351_2145 264
501 3300037466 Ga0395898_0058142 Ga0395898_0058142_2658_3452 264
502 3300037466 Ga0395898_0106921 Ga0395898_0106921_1530_2324 264
503 3300037466 Ga0395898_0119137 Ga0395898_0119137_362_1156 264
504 3300037471 Ga0395905_0000001 Ga0395905_0000001_441957_442751 264
505 3300037471 Ga0395905_0000031 Ga0395905_0000031_49545_50339 264
506 3300037471 Ga0395905_0002276 Ga0395905_0002276_6700_7494 264
507 3300037471 Ga0395905_0003830 Ga0395905_0003830_12642_13436 264
508 3300037471 Ga0395905_0010954 Ga0395905_0010954_7269_8063 264
509 3300037471 Ga0395905_0017189 Ga0395905_0017189_4119_4913 264
510 3300037471 Ga0395905_0047544 Ga0395905_0047544_385_1179 264
511 3300037471 Ga0395905_0078961 Ga0395905_0078961_1191_1985 264
512 3300037471 Ga0395905_0287986 Ga0395905_0287986_132_926 264
513 3300037471 Ga0395905_0692986 Ga0395905_0692986_61_855 264
514 3300038443 Ga0395901_0000163 Ga0395901_0000163_10361_11155 264
515 3300038443 Ga0395901_0018049 Ga0395901_0018049_109_903 264
516 3300038443 Ga0395901_0018431 Ga0395901_0018431_1439_2233 264
517 3300038443 Ga0395901_0133193 Ga0395901_0133193_810_1604 264
518 3300038443 Ga0395901_0202149 Ga0395901_0202149_910_1704 264
519 3300038726 Ga0400490_27390 Ga0400490_27390_19122_19916 264
520 3300038726 Ga0400490_44394 Ga0400490_44394_493_1287 264
521 3300038735 Ga0400485_18763 Ga0400485_18763_29097_29891 264
522 3300038741 Ga0400488_13388 Ga0400488_13388_1885_2679 264
523 3300038741 Ga0400488_17616 Ga0400488_17616_77_871 264
524 3300038742 Ga0400486_28155 Ga0400486_28155_66472_67266 264
525 3300038742 Ga0400486_30217 Ga0400486_30217_1326_2120 264
526 3300039062 Ga0400483_287441 Ga0400483_287441_2617_3411 264
527 3300039110 Ga0400487_52424 Ga0400487_52424_51510_52304 264
528 3300039110 Ga0400487_54158 Ga0400487_54158_19600_20394 264
529 3300039437 Ga0436365_1861022 Ga0436365_1861022_16806_17600 264
530 3300041404 Ga0439436_0038897 Ga0439436_0038897_71_874 264
531 3300041405 Ga0439438_000059 Ga0439438_000059_10523_11317 264
532 3300041405 Ga0439438_000165 Ga0439438_000165_14463_15257 264
533 3300041405 Ga0439438_059606 Ga0439438_059606_59_853 264
534 3300041456 Ga0451795_0735138 Ga0451795_0735138_455_1249 264
535 3300042007 Ga0439449_0002757 Ga0439449_0002757_494_1297 264
536 3300042007 Ga0439449_0011505 Ga0439449_0011505_1079_1882 264
537 3300042010 Ga0439452_000006 Ga0439452_000006_372823_373617 264
538 3300042010 Ga0439452_000013 Ga0439452_000013_112423_113217 264
539 3300042010 Ga0439452_000187 Ga0439452_000187_23685_24479 264
540 3300042010 Ga0439452_000189 Ga0439452_000189_23375_24169 264
541 3300042010 Ga0439452_000375 Ga0439452_000375_2524_3318 264
542 3300042010 Ga0439452_006248 Ga0439452_006248_382_1176 264
543 3300042146 Ga0450907_000024 Ga0450907_000024_5856_6650 264
544 3300042435 Ga0439434_0032604 Ga0439434_0032604_409_1203 264
545 3300042439 Ga0439464_0085984 Ga0439464_0085984_59_853 264
546 3300042439 Ga0439464_0098273 Ga0439464_0098273_79_873 264
547 3300042876 Ga0451577_0138257 Ga0451577_0138257_101_895 264
548 3300042876 Ga0451577_0452894 Ga0451577_0452894_84_878 264
549 3300044658 Ga0466972_0006867 Ga0466972_0006867_3209_4003 264
550 3300044669 Ga0466981_0000001 Ga0466981_0000001_57553_58347 264
551 3300044673 Ga0453683_0002974 Ga0453683_0002974_1797_2612 264
552 3300044683 Ga0466965_0000627 Ga0466965_0000627_6208_7002 264
553 3300044684 Ga0466966_0014463 Ga0466966_0014463_1762_2556 264
554 3300044694 Ga0466963_0029926 Ga0466963_0029926_757_1551 264
555 3300044694 Ga0466963_0051127 Ga0466963_0051127_112_906 264
556 3300044694 Ga0466963_0054385 Ga0466963_0054385_464_1258 264
557 3300044694 Ga0466963_0057692 Ga0466963_0057692_680_1474 264
558 3300044706 Ga0466964_0010649 Ga0466964_0010649_788_1582 264
559 3300044712 Ga0453684_0000334 Ga0453684_0000334_47888_48682 264
560 3300044712 Ga0453684_0010323 Ga0453684_0010323_7155_7949 264
561 3300044712 Ga0453684_0045851 Ga0453684_0045851_679_1473 264
562 3300044712 Ga0453684_0063618 Ga0453684_0063618_516_1310 264
563 3300044712 Ga0453684_0187951 Ga0453684_0187951_19_813 264
564 3300044842 Ga0466957_0025756 Ga0466957_0025756_546_1340 264
565 3300045049 Ga0466959_0060564 Ga0466959_0060564_1756_2550 264
566 3300045051 Ga0451576_0004288 Ga0451576_0004288_6810_7604 264
567 3300045051 Ga0451576_0010387 Ga0451576_0010387_8003_8797 264
568 3300045051 Ga0451576_0011887 Ga0451576_0011887_812_1627 264
569 3300045051 Ga0451576_0192414 Ga0451576_0192414_327_1121 264
570 3300045051 Ga0451576_0401764 Ga0451576_0401764_205_999 264
571 3300045836 Ga0466958_0122038 Ga0466958_0122038_99_893 264
572 3300045836 Ga0466958_0340745 Ga0466958_0340745_90_884 264
573 3300045976 Ga0466967_0016064 Ga0466967_0016064_2179_2973 264
574 3300045976 Ga0466967_0034090 Ga0466967_0034090_3128_3922 264
575 3300045976 Ga0466967_0109664 Ga0466967_0109664_1248_2042 264
576 3300045976 Ga0466967_0683151 Ga0466967_0683151_192_986 264
577 3300045976 Ga0466967_0759790 Ga0466967_0759790_25_819 264
578 3300046452 Ga0495617_000475 Ga0495617_000475_19990_20784 264
579 3300046453 Ga0495627_000048 Ga0495627_000048_17229_18023 264
580 3300046453 Ga0495627_000651 Ga0495627_000651_19646_20440 264
581 3300046454 Ga0495592_0006856 Ga0495592_0006856_4931_5725 264
582 3300046455 Ga0495603_0003401 Ga0495603_0003401_640_1434 264
583 3300046457 Ga0495590_0000206 Ga0495590_0000206_3836_4630 264
584 3300046457 Ga0495590_0010257 Ga0495590_0010257_923_1717 264
585 3300046458 Ga0495591_000045 Ga0495591_000045_68693_69487 264
586 3300046458 Ga0495591_000102 Ga0495591_000102_23665_24459 264
587 3300046458 Ga0495591_002789 Ga0495591_002789_4763_5557 264
588 3300046459 Ga0495629_0075992 Ga0495629_0075992_118_912 264
589 3300046460 Ga0495638_0002096 Ga0495638_0002096_15736_16530 264
590 3300046460 Ga0495638_0078912 Ga0495638_0078912_1099_1893 264
591 3300046460 Ga0495638_0213420 Ga0495638_0213420_51_878 264
592 3300046461 Ga0495641_0008644 Ga0495641_0008644_4977_5771 264
593 3300046462 Ga0495651_0029605 Ga0495651_0029605_178_972 264
594 3300046462 Ga0495651_0030714 Ga0495651_0030714_1958_2824 264
595 3300046463 Ga0495653_0003798 Ga0495653_0003798_709_1503 264
596 3300046463 Ga0495653_0005421 Ga0495653_0005421_9371_10207 264
597 3300046463 Ga0495653_0052096 Ga0495653_0052096_2179_2973 264
598 3300046471 Ga0495650_0000008 Ga0495650_0000008_543557_544351 264
599 3300046471 Ga0495650_0000059 Ga0495650_0000059_96252_97046 264
600 3300046471 Ga0495650_0006347 Ga0495650_0006347_3554_4348 264
601 3300046471 Ga0495650_0013027 Ga0495650_0013027_1427_2221 264
602 3300046472 Ga0495580_0015940 Ga0495580_0015940_4744_5538 264
603 3300046472 Ga0495580_0086190 Ga0495580_0086190_734_1537 264
604 3300046473 Ga0495582_0021241 Ga0495582_0021241_2123_2926 264
605 3300046473 Ga0495582_0205358 Ga0495582_0205358_147_941 264
606 3300046474 Ga0495605_0001064 Ga0495605_0001064_6120_6914 264
607 3300046474 Ga0495605_0122051 Ga0495605_0122051_220_1014 264
608 3300046475 Ga0495639_0004976 Ga0495639_0004976_4449_5243 264
609 3300046475 Ga0495639_0040522 Ga0495639_0040522_927_1730 264
610 3300046476 Ga0495662_0019363 Ga0495662_0019363_743_1537 264
611 3300046492 Ga0495585_0000026 Ga0495585_0000026_6153_6947 264
612 3300046492 Ga0495585_0000649 Ga0495585_0000649_1974_2768 264
613 3300046492 Ga0495585_0004130 Ga0495585_0004130_7594_8388 264
614 3300046492 Ga0495585_0006530 Ga0495585_0006530_2329_3123 264
615 3300046492 Ga0495585_0034852 Ga0495585_0034852_392_1186 264
616 3300046499 Ga0495594_0013331 Ga0495594_0013331_779_1573 264
617 3300046499 Ga0495594_0068505 Ga0495594_0068505_987_1790 264
618 3300046499 Ga0495594_0086848 Ga0495594_0086848_742_1536 264
619 3300046500 Ga0495596_0002772 Ga0495596_0002772_2289_3083 264
620 3300046500 Ga0495596_0011391 Ga0495596_0011391_1786_2580 264
621 3300046501 Ga0495607_0016352 Ga0495607_0016352_464_1258 264
622 3300046501 Ga0495607_0035777 Ga0495607_0035777_431_1225 264
623 3300046506 Ga0495583_0000009 Ga0495583_0000009_2099_2893 264
624 3300046507 Ga0495606_0000308 Ga0495606_0000308_48086_48880 264
625 3300046507 Ga0495606_0001127 Ga0495606_0001127_1518_2312 264
626 3300046507 Ga0495606_0023693 Ga0495606_0023693_1076_1870 264
627 3300046513 Ga0495616_0000569 Ga0495616_0000569_1988_2782 264
628 3300046513 Ga0495616_0090309 Ga0495616_0090309_74_868 264
629 3300046514 Ga0495618_0038370 Ga0495618_0038370_462_1256 264
630 3300046514 Ga0495618_0060088 Ga0495618_0060088_102_938 264
631 3300046515 Ga0495620_0048904 Ga0495620_0048904_176_970 264
632 3300046516 Ga0495628_0002411 Ga0495628_0002411_1768_2634 264
633 3300046516 Ga0495628_0006745 Ga0495628_0006745_7611_8447 264
634 3300046516 Ga0495628_0114553 Ga0495628_0114553_293_1087 264
635 3300046517 Ga0495630_0007589 Ga0495630_0007589_1397_2191 264
636 3300046518 Ga0495631_0000366 Ga0495631_0000366_1960_2754 264
637 3300046518 Ga0495631_0001045 Ga0495631_0001045_13096_13890 264
638 3300046518 Ga0495631_0001198 Ga0495631_0001198_14795_15589 264
639 3300046518 Ga0495631_0008656 Ga0495631_0008656_413_1207 264
640 3300046518 Ga0495631_0084917 Ga0495631_0084917_190_993 264
641 3300046519 Ga0495632_0001867 Ga0495632_0001867_13539_14333 264
642 3300046519 Ga0495632_0049306 Ga0495632_0049306_579_1373 264
643 3300046520 Ga0495637_0000891 Ga0495637_0000891_9303_10097 264
644 3300046522 Ga0495643_0000898 Ga0495643_0000898_28810_29604 264
645 3300046522 Ga0495643_0095840 Ga0495643_0095840_422_1225 264
646 3300046522 Ga0495643_0111068 Ga0495643_0111068_581_1375 264
647 3300046523 Ga0495644_0034753 Ga0495644_0034753_175_969 264
648 3300046523 Ga0495644_0050986 Ga0495644_0050986_43_837 264
649 3300046524 Ga0495648_0000866 Ga0495648_0000866_29149_29943 264
650 3300046524 Ga0495648_0001470 Ga0495648_0001470_6144_6938 264
651 3300046524 Ga0495648_0001615 Ga0495648_0001615_17306_18100 264
652 3300046524 Ga0495648_0001800 Ga0495648_0001800_17973_18767 264
653 3300046524 Ga0495648_0012590 Ga0495648_0012590_1155_1949 264
654 3300046524 Ga0495648_0013244 Ga0495648_0013244_416_1210 264
655 3300046524 Ga0495648_0082379 Ga0495648_0082379_575_1369 264
656 3300046526 Ga0495666_0001193 Ga0495666_0001193_7636_8430 264
657 3300046526 Ga0495666_0002138 Ga0495666_0002138_7257_8051 264
658 3300046528 Ga0495642_0001287 Ga0495642_0001287_4428_5222 264
659 3300046528 Ga0495642_0025390 Ga0495642_0025390_116_910 264
660 3300046528 Ga0495642_0026145 Ga0495642_0026145_652_1446 264
661 3300046528 Ga0495642_0051777 Ga0495642_0051777_241_1044 264
662 3300046529 Ga0495652_0177263 Ga0495652_0177263_135_929 264
663 3300046530 Ga0495654_0000073 Ga0495654_0000073_67906_68700 264
664 3300046530 Ga0495654_0000101 Ga0495654_0000101_26227_27021 264
665 3300046530 Ga0495654_0001104 Ga0495654_0001104_15317_16111 264
666 3300046530 Ga0495654_0005457 Ga0495654_0005457_5036_5830 264
667 3300046530 Ga0495654_0015625 Ga0495654_0015625_947_1741 264
668 3300046531 Ga0495665_0009870 Ga0495665_0009870_4243_5037 264
669 3300046535 Ga0495586_0011839 Ga0495586_0011839_1907_2701 264
670 3300046535 Ga0495586_0012833 Ga0495586_0012833_136_930 264
671 3300046535 Ga0495586_0041722 Ga0495586_0041722_1349_2152 264
672 3300046536 Ga0495587_0059624 Ga0495587_0059624_318_1112 264
673 3300046538 Ga0495609_0006494 Ga0495609_0006494_3378_4172 264
674 3300046538 Ga0495609_0012215 Ga0495609_0012215_839_1633 264
675 3300046538 Ga0495609_0051534 Ga0495609_0051534_733_1527 264
676 3300046538 Ga0495609_0077001 Ga0495609_0077001_225_1019 264
677 3300046542 Ga0495597_0000590 Ga0495597_0000590_7151_7945 264
678 3300046542 Ga0495597_0017841 Ga0495597_0017841_1461_2255 264
679 3300046542 Ga0495597_0030835 Ga0495597_0030835_1080_1874 264
680 3300046543 Ga0495645_0011685 Ga0495645_0011685_5143_5979 264
681 3300046543 Ga0495645_0041973 Ga0495645_0041973_847_1641 264
682 3300046543 Ga0495645_0060598 Ga0495645_0060598_468_1262 264
683 3300046557 Ga0495622_0004018 Ga0495622_0004018_477_1271 264
684 3300046557 Ga0495622_0021048 Ga0495622_0021048_1401_2195 264
685 3300046558 Ga0495633_0012233 Ga0495633_0012233_1220_2014 264
686 3300046558 Ga0495633_0050210 Ga0495633_0050210_1026_1820 264
687 3300046558 Ga0495633_0105505 Ga0495633_0105505_148_951 264
688 3300046559 Ga0495667_0037944 Ga0495667_0037944_369_1163 264
689 3300046615 Ga0495656_0000005 Ga0495656_0000005_137719_138513 264
690 3300046615 Ga0495656_0053133 Ga0495656_0053133_470_1264 264
691 3300046616 Ga0495668_0000848 Ga0495668_0000848_2284_3078 264
692 3300046616 Ga0495668_0001034 Ga0495668_0001034_28241_29035 264
693 3300046616 Ga0495668_0054345 Ga0495668_0054345_1261_2055 264
694 3300046616 Ga0495668_0057450 Ga0495668_0057450_208_1011 264
695 3300046642 Ga0495634_0114502 Ga0495634_0114502_755_1549 264
696 3300046648 Ga0495611_0005346 Ga0495611_0005346_2254_3048 264
697 3300046648 Ga0495611_0200252 Ga0495611_0200252_61_855 264
698 3300046660 Ga0495625_0004807 Ga0495625_0004807_10267_11061 264
699 3300046660 Ga0495625_0007834 Ga0495625_0007834_7762_8556 264
700 3300046660 Ga0495625_0044149 Ga0495625_0044149_1634_2428 264
701 3300046663 Ga0495635_0022810 Ga0495635_0022810_2491_3285 264
702 3300046665 Ga0495661_0004648 Ga0495661_0004648_6676_7470 264
703 3300046665 Ga0495661_0064576 Ga0495661_0064576_71_865 264
704 3300046665 Ga0495661_0158402 Ga0495661_0158402_411_1205 264
705 3300046674 Ga0495588_0009232 Ga0495588_0009232_3417_4211 264
706 3300046674 Ga0495588_0015483 Ga0495588_0015483_211_1014 264
707 3300046674 Ga0495588_0027406 Ga0495588_0027406_1603_2397 264
708 3300046674 Ga0495588_0083915 Ga0495588_0083915_525_1319 264
709 3300046679 Ga0495623_0002899 Ga0495623_0002899_6786_7652 264
710 3300046679 Ga0495623_0014822 Ga0495623_0014822_181_1017 264
711 3300046679 Ga0495623_0151278 Ga0495623_0151278_491_1285 264
712 3300046680 Ga0495646_0002496 Ga0495646_0002496_7366_8202 264
713 3300046680 Ga0495646_0004584 Ga0495646_0004584_369_1163 264
714 3300046681 Ga0495647_0000801 Ga0495647_0000801_2708_3502 264
715 3300046683 Ga0495658_0002290 Ga0495658_0002290_7333_8127 264
716 3300046684 Ga0495669_0008127 Ga0495669_0008127_337_1131 264
717 3300046689 Ga0495613_0047268 Ga0495613_0047268_1603_2397 264
718 3300046689 Ga0495613_0053577 Ga0495613_0053577_1987_2781 264
719 3300046690 Ga0495624_0004714 Ga0495624_0004714_8837_9631 264
720 3300046690 Ga0495624_0012600 Ga0495624_0012600_2837_3631 264
721 3300046690 Ga0495624_0221095 Ga0495624_0221095_182_1018 264
722 3300046691 Ga0495670_0000473 Ga0495670_0000473_10919_11722 264
723 3300046691 Ga0495670_0020968 Ga0495670_0020968_1845_2639 264
724 3300046691 Ga0495670_0032948 Ga0495670_0032948_1413_2207 264
725 3300046691 Ga0495670_0040762 Ga0495670_0040762_529_1368 264
726 3300046691 Ga0495670_0254929 Ga0495670_0254929_25_819 264
727 3300046692 Ga0495671_0000354 Ga0495671_0000354_6169_6963 264
728 3300046692 Ga0495671_0021640 Ga0495671_0021640_696_1490 264
729 3300046694 Ga0495649_0003899 Ga0495649_0003899_5445_6239 264
730 3300046694 Ga0495649_0007912 Ga0495649_0007912_116_910 264
731 3300046694 Ga0495649_0011769 Ga0495649_0011769_3039_3833 264
732 3300046794 Ga0495589_0000025 Ga0495589_0000025_54564_55358 264
733 3300046794 Ga0495589_0000354 Ga0495589_0000354_33240_34034 264
734 3300046794 Ga0495589_0001682 Ga0495589_0001682_11385_12179 264
735 3300046794 Ga0495589_0009736 Ga0495589_0009736_3705_4499 264
736 3300046809 Ga0495600_0008466 Ga0495600_0008466_2287_3081 264
737 3300046809 Ga0495600_0067886 Ga0495600_0067886_369_1163 264
738 3300046810 Ga0495660_0000019 Ga0495660_0000019_167263_168057 264
739 3300046810 Ga0495660_0137950 Ga0495660_0137950_396_1190 264
740 3300047315 Ga0495581_0000444 Ga0495581_0000444_1648_2442 264
741 3300047315 Ga0495581_0035891 Ga0495581_0035891_1933_2727 264
742 3300047315 Ga0495581_0067907 Ga0495581_0067907_1159_1962 264
743 3300047315 Ga0495581_0078947 Ga0495581_0078947_367_1170 264
744 3300047317 Ga0495604_0050124 Ga0495604_0050124_528_1322 264
745 3300047317 Ga0495604_0052766 Ga0495604_0052766_462_1256 264
746 3300047317 Ga0495604_0112847 Ga0495604_0112847_772_1566 264
747 3300047318 Ga0495636_0071108 Ga0495636_0071108_632_1426 264
748 3300047320 Ga0495672_0000003 Ga0495672_0000003_143972_144766 264
749 3300047320 Ga0495672_0000200 Ga0495672_0000200_55839_56633 264
750 3300047320 Ga0495672_0002537 Ga0495672_0002537_13739_14533 264
751 3300047320 Ga0495672_0005433 Ga0495672_0005433_7599_8393 264
752 3300047321 Ga0495676_0042371 Ga0495676_0042371_2493_3287 264
753 3300047321 Ga0495676_0098159 Ga0495676_0098159_1131_1925 264
754 3300047322 Ga0495680_0267559 Ga0495680_0267559_161_955 264
755 3300047322 Ga0495680_0433284 Ga0495680_0433284_54_848 264
756 3300047323 Ga0495683_0005888 Ga0495683_0005888_5874_6668 264
757 3300047323 Ga0495683_0030033 Ga0495683_0030033_721_1515 264
758 3300047323 Ga0495683_0043527 Ga0495683_0043527_935_1729 264
759 3300047443 Ga0495687_000034 Ga0495687_000034_61639_62433 264
760 3300047443 Ga0495687_000081 Ga0495687_000081_1945_2739 264
761 3300047443 Ga0495687_104901 Ga0495687_104901_222_1016 264
762 3300047444 Ga0495675_0111005 Ga0495675_0111005_278_1072 264
763 3300047446 Ga0495679_000089 Ga0495679_000089_17233_18027 264
764 3300047446 Ga0495679_001212 Ga0495679_001212_6446_7240 264
765 3300047446 Ga0495679_009181 Ga0495679_009181_1691_2485 264
766 3300047446 Ga0495679_048717 Ga0495679_048717_456_1250 264
767 3300047469 Ga0495673_0000011 Ga0495673_0000011_529730_530524 264
768 3300047469 Ga0495673_0000124 Ga0495673_0000124_39356_40150 264
769 3300047470 Ga0495681_0000144 Ga0495681_0000144_56908_57702 264
770 3300047470 Ga0495681_0008644 Ga0495681_0008644_2994_3788 264
771 3300047470 Ga0495681_0034978 Ga0495681_0034978_1361_2155 264
772 3300047470 Ga0495681_0037875 Ga0495681_0037875_72_866 264
773 3300047470 Ga0495681_0114378 Ga0495681_0114378_105_899 264
774 3300047471 Ga0495684_0052768 Ga0495684_0052768_1517_2311 264
775 3300047472 Ga0495686_0009775 Ga0495686_0009775_368_1162 264
776 3300047673 Ga0495593_0005464 Ga0495593_0005464_4144_4938 264
777 3300048088 Ga0495602_0074513 Ga0495602_0074513_487_1323 264
778 3300048091 Ga0495626_0002847 Ga0495626_0002847_8960_9754 264
779 3300048903 Ga0496100_0022394 Ga0496100_0022394_734_1537 264
780 3300048903 Ga0496100_0120972 Ga0496100_0120972_533_1327 264
781 3300048904 Ga0496101_0000070 Ga0496101_0000070_56285_57079 264
782 3300048904 Ga0496101_0021478 Ga0496101_0021478_1536_2330 264
783 3300048904 Ga0496101_0068504 Ga0496101_0068504_18_821 264
784 3300048904 Ga0496101_0080062 Ga0496101_0080062_146_940 264
785 3300048905 Ga0496102_0001658 Ga0496102_0001658_14727_15521 264
786 3300048905 Ga0496102_0083328 Ga0496102_0083328_1152_1955 264
787 3300048905 Ga0496102_0099565 Ga0496102_0099565_815_1618 264
788 3300048906 Ga0496103_0007660 Ga0496103_0007660_1514_2317 264
789 3300048906 Ga0496103_0037337 Ga0496103_0037337_2138_2941 264
790 3300048906 Ga0496103_0138528 Ga0496103_0138528_428_1231 264
791 3300048907 Ga0496104_0001190 Ga0496104_0001190_17174_17968 264
792 3300048907 Ga0496104_0025817 Ga0496104_0025817_4325_5128 264
793 3300048908 Ga0496105_0033165 Ga0496105_0033165_2441_3244 264
794 3300048909 Ga0496106_0265593 Ga0496106_0265593_535_1338 264
795 3300048909 Ga0496106_0299856 Ga0496106_0299856_371_1165 264
796 3300048910 Ga0496107_0509329 Ga0496107_0509329_36_839 264
797 3300048912 Ga0496109_0169718 Ga0496109_0169718_1225_2028 264
798 3300048912 Ga0496109_0209862 Ga0496109_0209862_975_1778 264
799 3300048913 Ga0496110_0118655 Ga0496110_0118655_1520_2323 264
800 3300048914 Ga0496111_0047620 Ga0496111_0047620_1990_2793 264
801 3300048914 Ga0496111_0107234 Ga0496111_0107234_1234_2037 264
802 3300048915 Ga0496112_0063022 Ga0496112_0063022_1264_2058 264
803 3300048915 Ga0496112_0109011 Ga0496112_0109011_1074_1877 264
804 3300048916 Ga0496113_0049574 Ga0496113_0049574_1380_2174 264
805 3300048916 Ga0496113_0383144 Ga0496113_0383144_290_1093 264
806 3300048917 Ga0496114_0134333 Ga0496114_0134333_1095_1898 264
807 3300048917 Ga0496114_0213102 Ga0496114_0213102_443_1237 264
808 3300048918 Ga0496115_0069779 Ga0496115_0069779_57_860 264
809 3300048918 Ga0496115_0079844 Ga0496115_0079844_1847_2641 264
810 3300048918 Ga0496115_0141854 Ga0496115_0141854_635_1429 264
811 3300048918 Ga0496115_0311737 Ga0496115_0311737_225_1019 264
812 3300048919 Ga0496116_0000244 Ga0496116_0000244_12655_13449 264
813 3300048919 Ga0496116_0001934 Ga0496116_0001934_4452_5246 264
814 3300048919 Ga0496116_0002132 Ga0496116_0002132_16725_17519 264
815 3300048919 Ga0496116_0004982 Ga0496116_0004982_4001_4795 264
816 3300048919 Ga0496116_0006593 Ga0496116_0006593_4092_4886 264
817 3300048920 Ga0496117_0000043 Ga0496117_0000043_111306_112100 264
818 3300048920 Ga0496117_0000168 Ga0496117_0000168_46498_47292 264
819 3300048920 Ga0496117_0002568 Ga0496117_0002568_275_1069 264
820 3300048920 Ga0496117_0003691 Ga0496117_0003691_2811_3605 264
821 3300048920 Ga0496117_0013621 Ga0496117_0013621_1579_2373 264
822 3300048920 Ga0496117_0261953 Ga0496117_0261953_90_884 264
823 3300048921 Ga0496118_0000075 Ga0496118_0000075_111306_112100 264
824 3300048921 Ga0496118_0000997 Ga0496118_0000997_32378_33172 264
825 3300048921 Ga0496118_0004430 Ga0496118_0004430_6521_7315 264
826 3300048921 Ga0496118_0020648 Ga0496118_0020648_444_1238 264
827 3300048921 Ga0496118_0102221 Ga0496118_0102221_149_943 264
828 3300048922 Ga0496119_0000009 Ga0496119_0000009_320494_321288 264
829 3300048922 Ga0496119_0001670 Ga0496119_0001670_21845_22639 264
830 3300048922 Ga0496119_0002299 Ga0496119_0002299_3339_4133 264
831 3300048922 Ga0496119_0002763 Ga0496119_0002763_17151_17945 264
832 3300048922 Ga0496119_0003037 Ga0496119_0003037_3421_4215 264
833 3300048922 Ga0496119_0004240 Ga0496119_0004240_11109_11903 264
834 3300048922 Ga0496119_0040741 Ga0496119_0040741_944_1738 264
835 3300048922 Ga0496119_0047483 Ga0496119_0047483_867_1661 264
836 3300048922 Ga0496119_0051033 Ga0496119_0051033_525_1319 264
837 3300048922 Ga0496119_0052628 Ga0496119_0052628_875_1678 264
838 3300048922 Ga0496119_0054916 Ga0496119_0054916_1058_1852 264
839 3300048923 Ga0496120_0000044 Ga0496120_0000044_114400_115194 264
840 3300048923 Ga0496120_0000066 Ga0496120_0000066_68938_69732 264
841 3300048923 Ga0496120_0000645 Ga0496120_0000645_17891_18685 264
842 3300048923 Ga0496120_0001316 Ga0496120_0001316_26652_27446 264
843 3300048923 Ga0496120_0001317 Ga0496120_0001317_3293_4087 264
844 3300048923 Ga0496120_0002117 Ga0496120_0002117_17037_17831 264
845 3300048923 Ga0496120_0002630 Ga0496120_0002630_290_1084 264
846 3300048923 Ga0496120_0003636 Ga0496120_0003636_3277_4071 264
847 3300048923 Ga0496120_0004666 Ga0496120_0004666_7248_8042 264
848 3300048923 Ga0496120_0015824 Ga0496120_0015824_4076_4870 264
849 3300048923 Ga0496120_0016305 Ga0496120_0016305_3028_3822 264
850 3300048924 Ga0496121_0003294 Ga0496121_0003294_12897_13691 264
851 3300048924 Ga0496121_0003770 Ga0496121_0003770_3423_4217 264
852 3300048924 Ga0496121_0004311 Ga0496121_0004311_3484_4278 264
853 3300048924 Ga0496121_0020778 Ga0496121_0020778_2003_2797 264
854 3300048924 Ga0496121_0023512 Ga0496121_0023512_1957_2751 264
855 3300048924 Ga0496121_0039163 Ga0496121_0039163_2787_3581 264
856 3300048924 Ga0496121_0074185 Ga0496121_0074185_165_959 264
857 3300048925 Ga0496122_0000016 Ga0496122_0000016_49625_50419 264
858 3300048925 Ga0496122_0000339 Ga0496122_0000339_45896_46690 264
859 3300048925 Ga0496122_0002667 Ga0496122_0002667_7809_8603 264
860 3300048925 Ga0496122_0034566 Ga0496122_0034566_1207_2001 264
861 3300048925 Ga0496122_0045673 Ga0496122_0045673_320_1114 264
862 3300048925 Ga0496122_0057792 Ga0496122_0057792_394_1188 264
863 3300048925 Ga0496122_0168214 Ga0496122_0168214_514_1308 264
864 3300048926 Ga0496123_0000444 Ga0496123_0000444_23773_24567 264
865 3300048926 Ga0496123_0000506 Ga0496123_0000506_54135_54929 264
866 3300048926 Ga0496123_0000661 Ga0496123_0000661_18536_19330 264
867 3300048926 Ga0496123_0002548 Ga0496123_0002548_4073_4867 264
868 3300048926 Ga0496123_0004933 Ga0496123_0004933_2682_3476 264
869 3300048926 Ga0496123_0012294 Ga0496123_0012294_2929_3723 264
870 3300048926 Ga0496123_0014727 Ga0496123_0014727_5601_6395 264
871 3300048926 Ga0496123_0033475 Ga0496123_0033475_480_1274 264
872 3300048927 Ga0496124_0000069 Ga0496124_0000069_86108_86902 264
873 3300048927 Ga0496124_0000164 Ga0496124_0000164_104831_105625 264
874 3300048927 Ga0496124_0000544 Ga0496124_0000544_62892_63686 264
875 3300048927 Ga0496124_0001338 Ga0496124_0001338_20707_21501 264
876 3300048927 Ga0496124_0001912 Ga0496124_0001912_23629_24423 264
877 3300048927 Ga0496124_0008345 Ga0496124_0008345_4474_5301 264
878 3300048927 Ga0496124_0045655 Ga0496124_0045655_942_1736 264
879 3300048927 Ga0496124_0086212 Ga0496124_0086212_1201_1995 264
880 3300048927 Ga0496124_0196274 Ga0496124_0196274_684_1478 264
881 3300048928 Ga0496125_0000081 Ga0496125_0000081_129174_129968 264
882 3300048928 Ga0496125_0004962 Ga0496125_0004962_5362_6156 264
883 3300048928 Ga0496125_0013881 Ga0496125_0013881_1970_2764 264
884 3300048928 Ga0496125_0034260 Ga0496125_0034260_1071_1865 264
885 3300048929 Ga0496126_0000983 Ga0496126_0000983_33375_34169 264
886 3300048929 Ga0496126_0003685 Ga0496126_0003685_3355_4149 264
887 3300048929 Ga0496126_0023761 Ga0496126_0023761_2770_3564 264
888 3300048929 Ga0496126_0030792 Ga0496126_0030792_3101_3895 264
889 3300048929 Ga0496126_0034102 Ga0496126_0034102_2313_3107 264
890 3300048929 Ga0496126_0135833 Ga0496126_0135833_699_1493 264
891 3300049161 Ga0501305_017969 Ga0501305_017969_143_937 264
892 3300049459 Ga0495678_000094 Ga0495678_000094_3272_4066 264
893 3300049459 Ga0495678_000214 Ga0495678_000214_41661_42455 264
894 3300049459 Ga0495678_000294 Ga0495678_000294_52793_53587 264
895 3300049460 Ga0495682_0000017 Ga0495682_0000017_88581_89375 264
896 3300049568 Ga0501031_0169943 Ga0501031_0169943_317_1111 264
897 3300049569 Ga0501032_0000057 Ga0501032_0000057_77897_78691 264
898 3300049570 Ga0501033_0081633 Ga0501033_0081633_625_1419 264
899 3300049570 Ga0501033_0095114 Ga0501033_0095114_1082_1876 264
900 3300049571 Ga0501034_0000001 Ga0501034_0000001_778951_779745 264
901 3300049571 Ga0501034_0000188 Ga0501034_0000188_81760_82554 264
902 3300049572 Ga0501036_0004036 Ga0501036_0004036_9586_10380 264
903 3300049573 Ga0501037_0000001 Ga0501037_0000001_410714_411526 264
904 3300049574 Ga0501038_0048075 Ga0501038_0048075_2044_2847 264
905 3300049575 Ga0501039_0000001 Ga0501039_0000001_119932_120726 264
906 3300049577 Ga0501041_0002567 Ga0501041_0002567_9351_10169 264
907 3300049578 Ga0501042_0004940 Ga0501042_0004940_1952_2770 264
908 3300049581 Ga0501047_0156291 Ga0501047_0156291_938_1732 264
909 3300049582 Ga0501048_0008525 Ga0501048_0008525_289_1107 264
910 3300049584 Ga0501068_0068876 Ga0501068_0068876_774_1568 264
911 3300049585 Ga0501069_0281648 Ga0501069_0281648_48_842 264
912 3300049586 Ga0501070_0001515 Ga0501070_0001515_16389_17183 264
913 3300049586 Ga0501070_0145894 Ga0501070_0145894_896_1690 264
914 3300049587 Ga0501071_0005029 Ga0501071_0005029_1713_2531 264
915 3300049590 Ga0501074_0201203 Ga0501074_0201203_607_1401 264
916 3300049590 Ga0501074_0364388 Ga0501074_0364388_191_985 264
917 3300049591 Ga0501075_0001026 Ga0501075_0001026_12236_13054 264
918 3300049592 Ga0501076_0000823 Ga0501076_0000823_249_1067 264
919 3300049593 Ga0501077_0188828 Ga0501077_0188828_157_975 264
920 3300049742 Ga0501080_0057081 Ga0501080_0057081_606_1400 264
921 3300049744 Ga0501083_0137128 Ga0501083_0137128_33_833 264
922 3300049822 Ga0501035_0001118 Ga0501035_0001118_12583_13377 264
923 3300049823 Ga0501044_0259584 Ga0501044_0259584_803_1597 264
924 3300049824 Ga0501045_0003259 Ga0501045_0003259_7111_7929 264
925 3300050490 nmdc:mga03n38_8480_c1 nmdc:mga03n38_8480_c1_2127_2921 264
926 3300050491 nmdc:mga00v17_181653_c1 nmdc:mga00v17_181653_c1_102_896 264
927 3300050491 nmdc:mga00v17_249_c1 nmdc:mga00v17_249_c1_23832_24626 264
928 3300050491 nmdc:mga00v17_487_c1 nmdc:mga00v17_487_c1_13335_14129 264
929 3300050491 nmdc:mga00v17_56930_c1 nmdc:mga00v17_56930_c1_1374_2168 264
930 3300050492 nmdc:mga0yw44_67004_c1 nmdc:mga0yw44_67004_c1_771_1565 264
931 3300050493 nmdc:mga0k408_120948_c1 nmdc:mga0k408_120948_c1_265_1059 264
932 3300050493 nmdc:mga0k408_33082_c2 nmdc:mga0k408_33082_c2_678_1472 264
933 3300050494 nmdc:mga06z11_199016_c1 nmdc:mga06z11_199016_c1_154_948 264
934 3300050496 nmdc:mga07m45_43858_c1 nmdc:mga07m45_43858_c1_1692_2486 264
935 3300050512 nmdc:mga0n895_388760_c1 nmdc:mga0n895_388760_c1_267_1061 264
936 3300050516 nmdc:mga0sz30_67760_c1 nmdc:mga0sz30_67760_c1_548_1342 264
937 3300053077 Ga0495601_0017945 Ga0495601_0017945_1495_2331 264
938 3300053078 Ga0495612_0004226 Ga0495612_0004226_4939_5733 264
939 3300053084 Ga0495595_0097167 Ga0495595_0097167_368_1162 264
940 3300053085 Ga0495619_0390423 Ga0495619_0390423_118_912 264
941 3300053086 Ga0500578_0014630 Ga0500578_0014630_233_1027 264
942 3300053094 Ga0500566_0121985 Ga0500566_0121985_369_1163 264
943 3300053119 Ga0500595_000024 Ga0500595_000024_44221_45015 264
944 3300053119 Ga0500595_001547 Ga0500595_001547_11221_12057 264
945 3300053126 Ga0500621_000004 Ga0500621_000004_130919_131713 264
946 3300053140 Ga0500573_0122153 Ga0500573_0122153_96_890 264
947 3300053153 Ga0500616_0000458 Ga0500616_0000458_30777_31571 264
948 3300053154 Ga0500619_000417 Ga0500619_000417_157_993 264
949 3300053156 Ga0500622_0001910 Ga0500622_0001910_3856_4695 264
950 3300053730 Ga0500645_000102 Ga0500645_000102_48694_49488 264
951 3300059477 Ga0587084_004455 Ga0587084_004455_289_1083 264
952 3300059604 Ga0587098_007484 Ga0587098_007484_237_1040 264
953 3300061734 Ga0530510_0001520 Ga0530510_0001520_5794_6612 264
954 iso_pu_bacteria 2721755523 2722882528 264
955 iso_pu_bacteria 2738541337 2739057318 264
956 iso_pu_bacteria 2818991436 2819543957 264
957 iso_pu_bacteria 2831864461 2831867462 264
958 iso_pu_bacteria 2839138175 2839141210 264
959 iso_pu_bacteria 2939631187 2939631389 264
960 iso_pu_bacteria 2939664404 2939664826 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

74

329

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.987 3 262
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9854 3 264
1f4g-assembly1.cif.gz_B crystal structure of e. coli thymidylate synthase complexed with sp-876 0.9849 3 261
1zpr-assembly1.cif.gz_B e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump) 0.9846 3 264
1f4d-assembly1.cif.gz_B crystal structure of e. coli thymidylate synthase c146s, l143c covalently modified at c143 with n-[tosyl-d-prolinyl]amino-ethanethiol 0.9843 3 264
ID Description Score Start End Superfamily
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9697 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9671 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9625 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9602 2 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.952 2 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9932 99 229 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3Q3X194-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.99 107 243 GO:0004799
GO:0005739
GO:0005829
GO:0006231
GO:0006235
GO:0032259
AF-A0A059WNC8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9877 116 238 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2J0MA32-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9867 1 228 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A355C418-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9866 1 222 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map